GenomeNet

Database: RefSeq
Entry: NC_012917
LinkDB: NC_012917
Original site: NC_012917 
LOCUS       NC_012917            4862913 bp    DNA     circular CON 10-JUN-2013
DEFINITION  Pectobacterium carotovorum subsp. carotovorum PC1, complete genome.
ACCESSION   NC_012917
VERSION     NC_012917.1  GI:253686409
DBLINK      Project: 59295
            BioProject: PRJNA59295
KEYWORDS    RefSeq.
SOURCE      Pectobacterium carotovorum subsp. carotovorum PC1
  ORGANISM  Pectobacterium carotovorum subsp. carotovorum PC1
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Pectobacterium.
REFERENCE   1  (bases 1 to 4862913)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H.,
            Bruce,D., Goodwin,L., Pitluck,S., Munk,A.C., Brettin,T.,
            Detter,J.C., Han,C., Tapia,R., Larimer,F., Land,M., Hauser,L.,
            Kyrpides,N., Mikhailova,N., Balakrishnan,V., Glasner,J. and
            Perna,N.T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Pectobacterium carotovorum subsp. carotovorum
            PC1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4862913)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUL-2009) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4862913)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H.,
            Bruce,D., Goodwin,L., Pitluck,S., Munk,A.C., Brettin,T.,
            Detter,J.C., Han,C., Tapia,R., Larimer,F., Land,M., Hauser,L.,
            Kyrpides,N., Mikhailova,N., Balakrishnan,V., Glasner,J. and
            Perna,N.T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUL-2009) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP001657.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4085667
            Source DNA and bacteria available from Nicole T. Perna
            (ntperna@wisc.edu)
            Contacts: Nicole T. Perna (ntperna@wisc.edu)
                      David Bruce (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Pectobacterium carotovorum carotovorum PC1
            GOLD Stamp ID         :: Gi04239
            Oxygen Requirement    :: Facultative
            Cell Shape            :: Rod-shaped
            Motility              :: Motile
            Sporulation           :: Nonsporulating
            Temperature Range     :: Mesophile
            Gram Staining         :: gram-
            Biotic Relationship   :: Free living
            Diseases              :: Soft rot
            Habitat               :: Host
            Phenotypes            :: Pathogen
            ##Metadata-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4862913
                     /organism="Pectobacterium carotovorum subsp. carotovorum
                     PC1"
                     /mol_type="genomic DNA"
                     /strain="PC1"
                     /sub_species="carotovorum"
                     /db_xref="taxon:561230"
     gene            72..1469
                     /locus_tag="PC1_0001"
                     /db_xref="GeneID:8135299"
     CDS             72..1469
                     /locus_tag="PC1_0001"
                     /inference="protein motif:TFAM:TIGR00362"
                     /note="KEGG: eca:ECA4441 chromosomal replication
                     initiation protein;
                     TIGRFAM: chromosomal replication initiator protein DnaA;
                     PFAM: Chromosomal replication initiator DnaA; Chromosomal
                     replication initiator DnaA domain;
                     SMART: Chromosomal replication initiator DnaA domain; AAA
                     ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="YP_003015600.1"
                     /db_xref="GI:253686410"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="GeneID:8135299"
                     /translation="MSLSLWQQCLARLHDELPATEFSMWIRPLQAELSDNTLALYAPN
                     RFVLDWVRDKYLNNINVLLNDFCGMDAPLLRFEVGSKPLVQAISQPAQPHHKQVSAAP
                     QQQVRSAPVRPSWDNSPAQAEHTYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPG
                     GAYNPLFLYGGTGLGKTHLLHAVGNGIIARKPNAKVVYMHSERFVQDMVKALQNNAIE
                     EFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGV
                     EDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVREL
                     EGALNRVIANANFTGRSITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADL
                     LSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESH
                     DIKEDFSNLIRTLSS"
     misc_feature    72..1466
                     /locus_tag="PC1_0001"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    81..266
                     /locus_tag="PC1_0001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    504..935
                     /locus_tag="PC1_0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    579..602
                     /locus_tag="PC1_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(582..605,768..770,870..872)
                     /locus_tag="PC1_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    756..773
                     /locus_tag="PC1_0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    906..908
                     /locus_tag="PC1_0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1191..1460
                     /locus_tag="PC1_0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1260..1262,1284..1289,1308..1310,1326..1334,
                     1359..1373,1380..1382,1389..1394)
                     /locus_tag="PC1_0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1474..2574
                     /locus_tag="PC1_0002"
                     /db_xref="GeneID:8130902"
     CDS             1474..2574
                     /locus_tag="PC1_0002"
                     /EC_number="2.7.7.7"
                     /inference="protein motif:TFAM:TIGR00663"
                     /note="KEGG: eca:ECA4440 DNA polymerase III subunit beta;
                     TIGRFAM: DNA polymerase III, beta subunit;
                     PFAM: DNA polymerase III beta chain;
                     SMART: DNA polymerase III beta chain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_003015601.1"
                     /db_xref="GI:253686411"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="GeneID:8130902"
                     /translation="MKFIVERERLLKPLQQVSSPLGGRPTLPILGNLLIQVTEDALSL
                     TGTDLEMEMVAKVALTQPHEPGATTVPARKLFDICRGLPEGAEITIMLDGDRMLVRSG
                     RSRFSLSTLPAADFPNLDDWQSDVEFSLPQATMKRLIEATQFSMAHQDVRYYLNGMLF
                     ETEGEELRTVATDGHRLAVCSMPVGQSLPSHSVIVPRKGVMELVRLLDGGDTPLQLQI
                     GSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEASCDLLKQAFSRAAILSNE
                     KFRGVRLHLIQNQLKITANNPEQEEAEEILDVQYDGTEMEIGFNVSYVLDVLNALKCE
                     GVRLLLTDSVSSVQIEDSASRAAAYVVMPMRL"
     misc_feature    1474..2571
                     /locus_tag="PC1_0002"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    1474..2568
                     /locus_tag="PC1_0002"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1543..1545,1690..1692,1711..1713,2065..2067)
                     /locus_tag="PC1_0002"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1693..1695,1702..1704,1780..1782,1786..1788,
                     2287..2289,2380..2385)
                     /locus_tag="PC1_0002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1987..1989,1993..2004,2431..2433,2557..2568)
                     /locus_tag="PC1_0002"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(1987..1989,1993..1998,2212..2214,2317..2319,
                     2356..2361,2440..2442,2557..2568)
                     /locus_tag="PC1_0002"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2624..3709
                     /locus_tag="PC1_0003"
                     /db_xref="GeneID:8130903"
     CDS             2624..3709
                     /locus_tag="PC1_0003"
                     /inference="protein motif:TFAM:TIGR00611"
                     /note="TIGRFAM: DNA replication and repair protein RecF;
                     PFAM: SMC domain protein;
                     KEGG: eca:ECA4439 recombination protein F"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="YP_003015602.1"
                     /db_xref="GI:253686412"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="GeneID:8130903"
                     /translation="MALTRLLIKDFRNIEAADLALVPGFNFLVGANGSGKTSVLEAIY
                     TLGHGRAFRSIQAGRVIRHDQPEFVLHGRIDGTETERSVGLSKNRQGDSKVRIDGSDG
                     HKVAELAQLLPIQLITPEGFTLLNGGPKFRRAFLDWGCFHNEPGFFAAWSNMKRLLRQ
                     RNAALRQVSHYGQLRAWDQELVPLAERISEWRAQYSAAIANDIATTCTQFLPEFSLSF
                     SFQRGWDKESEYAELLERQFERDRMLGYTALGPHKADFRIRASGVAVEDMLSRGQLKL
                     LMCALRLAQGEFLTRQNGLRCLYLIDDFASELDSTRRRLLAERLKATHAQVFVSAVSA
                     EQIEDMVGEKGKMFRVEQGKITVQSQD"
     misc_feature    2624..3688
                     /locus_tag="PC1_0003"
                     /note="recF protein; Region: recf; TIGR00611"
                     /db_xref="CDD:233051"
     misc_feature    2630..3691
                     /locus_tag="PC1_0003"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    2711..2734
                     /locus_tag="PC1_0003"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(2720..2725,2729..2737,2978..2980,3527..3532,
                     3620..3622)
                     /locus_tag="PC1_0003"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    2969..2980
                     /locus_tag="PC1_0003"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    3428..3457
                     /locus_tag="PC1_0003"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    3515..3532
                     /locus_tag="PC1_0003"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    3539..3550
                     /locus_tag="PC1_0003"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    3608..3628
                     /locus_tag="PC1_0003"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            3728..6145
                     /locus_tag="PC1_0004"
                     /db_xref="GeneID:8130904"
     CDS             3728..6145
                     /locus_tag="PC1_0004"
                     /EC_number="5.99.1.3"
                     /inference="protein motif:TFAM:TIGR01059"
                     /note="KEGG: eca:ECA4438 DNA gyrase subunit B;
                     TIGRFAM: DNA gyrase, B subunit;
                     PFAM: DNA topoisomerase type IIA subunit B region 2 domain
                     protein; DNA gyrase subunit B domain protein; TOPRIM
                     domain protein; ATP-binding region ATPase domain protein;
                     SMART: DNA topoisomerase II; ATP-binding region ATPase
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_003015603.1"
                     /db_xref="GI:253686413"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="GeneID:8130904"
                     /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
                     DNAIDEALAGYCKDIIITIHADNSVSVQDDGRGIPTGIHEEEGISAAEVIMTVLHAGG
                     KFDDNSYKVSGGLHGVGVSVVNALSEKLKLVIHRDGKLHEQTYKHGVPQAPLAVTGET
                     NRTGTTVRFWPSHETFTNVVEFEYEILAKRLRELSFLNSGVSIRLIDEREKDKADHYH
                     YDGGIKAFVDYLNRNKTPIHPNVFYFSTVKDDIGVEVALQWNDGFQENIYCFTNNIPQ
                     RDGGTHLAGFRAAMTRTLNTYMDKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFS
                     SQTKDKLVSSEVKTAVESLMNEKLVDYLMENPSDAKIVVGKIIDAARAREAARKARDM
                     TRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGK
                     ILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGSHIR
                     TLLLTFFYRQLPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQIMLALDGAT
                     LHTNAQAPALAGEPLEKLVSEHYAVQKLIGRMERRFPRALLNRLIYQPTLSEADLNER
                     ENVQAWAESLVNSLNESELHGSTYSFVIHHDEERGVFEPALRVRTHGVDTDYPLGAGF
                     VAGSEYRKLNQLGEKLRGLIEEDAYIERGERRQPVASFEQALEWLVKESRRGLTVQRY
                     KGLGEMNPDQLWETTMDPNSRRMLRVTVKDAIAADELFTTLMGDAVEPRRAFIEENAL
                     KAMNIDI"
     misc_feature    3728..6142
                     /locus_tag="PC1_0004"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     misc_feature    3833..4240
                     /locus_tag="PC1_0004"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(3851..3853,3863..3865,3872..3874,3938..3940,
                     3944..3946,3950..3952,3956..3961,4076..4087,4193..4195,
                     4199..4201,4217..4222,4226..4228)
                     /locus_tag="PC1_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    3863..3865
                     /locus_tag="PC1_0004"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(3950..3952,3956..3958,4076..4078,4082..4084)
                     /locus_tag="PC1_0004"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    4388..4861
                     /locus_tag="PC1_0004"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    4541..4543
                     /locus_tag="PC1_0004"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(4715..4717,4724..4729,4733..4735)
                     /locus_tag="PC1_0004"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(4733..4735,4739..4741)
                     /locus_tag="PC1_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    4982..5326
                     /locus_tag="PC1_0004"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(5000..5005,5012..5014,5222..5224,5228..5230,
                     5234..5236)
                     /locus_tag="PC1_0004"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(5000..5002,5222..5224)
                     /locus_tag="PC1_0004"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    5915..6109
                     /locus_tag="PC1_0004"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            complement(6488..7678)
                     /locus_tag="PC1_0005"
                     /db_xref="GeneID:8130905"
     CDS             complement(6488..7678)
                     /locus_tag="PC1_0005"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: eca:ECA4437 MFS efflux transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_003015604.1"
                     /db_xref="GI:253686414"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:8130905"
                     /translation="MKFIKLPLLAQISSAHLVSHFHMMVLPALIPLLSAQRDISFVEL
                     GFALSVFNIVSACVQTPIGFMVDRIGARRTLTAGLALGSLCFLSLGFSDSYVWLVAAM
                     GLAGVANAVYHPADYALLSRGIDEKRMGRAFSVHTFSGFLGTAIAPGILLSIAAFSGI
                     NSAFIVSGVIGLLTIPLLLTDRDEPSRVKPAAATGTQPGKSRAPVFTLPILALLILFL
                     LLNLSTGSIQNFSVTALVTGYDLSLSQANVALTAFLFASAFGVLAGGSLADKTKRHGL
                     VATAALAVTAVLVSIVAMYSLPTIVLVPLLAAAGFLSGMIAPSRDMLVRAASPPGAEG
                     RVFGIVSTGFNIGGAAGPVLFGWLLDHGHPHAIFWSAVIFMLITAFITLLQEMRSAKR
                     RALA"
     misc_feature    complement(6527..7645)
                     /locus_tag="PC1_0005"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(6623..7612)
                     /locus_tag="PC1_0005"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(6635..6637,6644..6649,6656..6661,
                     6668..6673,6704..6706,6713..6718,6728..6730,6737..6742,
                     6749..6751,6896..6898,6908..6910,6917..6919,6929..6931,
                     6941..6943,6983..6985,6992..6997,7004..7009,7016..7018,
                     7247..7249,7265..7270,7277..7282,7316..7318,7325..7330,
                     7337..7342,7349..7354,7490..7495,7499..7504,7514..7516,
                     7523..7528,7535..7537,7586..7591,7595..7603,7610..7612))
                     /locus_tag="PC1_0005"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            7843..8211
                     /locus_tag="PC1_0006"
                     /db_xref="GeneID:8130906"
     CDS             7843..8211
                     /locus_tag="PC1_0006"
                     /inference="protein motif:PFAM:PF04828"
                     /note="PFAM: glutathione-dependent formaldehyde-activating
                     GFA;
                     KEGG: pfl:PFL_2470 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-dependent formaldehyde-activating
                     protein"
                     /protein_id="YP_003015605.1"
                     /db_xref="GI:253686415"
                     /db_xref="InterPro:IPR006913"
                     /db_xref="GeneID:8130906"
                     /translation="MTIKSYLGGCLCGQIRFRASGEPGNPHACSCTFCQQHSGAPTLL
                     WVEFPRSAVEWIGEGGEPARYRSSDYSSRAFCPHCGSTLGAIDDEPTIALTIGNFDEK
                     NSPELKPTSHSFEDCCPRWE"
     misc_feature    7858..8184
                     /locus_tag="PC1_0006"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3791"
                     /db_xref="CDD:226314"
     gene            complement(8261..10171)
                     /locus_tag="PC1_0007"
                     /db_xref="GeneID:8130907"
     CDS             complement(8261..10171)
                     /locus_tag="PC1_0007"
                     /inference="protein motif:PFAM:PF00015"
                     /note="PFAM: chemotaxis sensory transducer; Cache domain
                     protein; histidine kinase HAMP region domain protein;
                     SMART: chemotaxis sensory transducer;
                     KEGG: esa:ESA_02212 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer
                     with Cache sensor"
                     /protein_id="YP_003015606.1"
                     /db_xref="GI:253686416"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004010"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:8130907"
                     /translation="MLLAGVSTIALGFILTIGLLIWQSGQQQKTIAQHYLEQTAYTNS
                     YLIQQKLDVALHAARNLVQSVVSLQEAGNADRKTAETLLKNALKSHPDFLSMSLAWEP
                     DAFDGKDREYAGQPDQDPQGRFVRYVDRDTAGNVALHNLVDYETPGSGDYYLLPKKLQ
                     KEVILEPYSYPYNGVDVLLTSIAVPIIINNKFYGSVTADFSLDTLQQLTNNIKPYEGT
                     GYAQLLSHSGAYISHPEKARVTKKIENDPTLLEHVTTGQPYQIERDNAVLNTPAFNVY
                     VPVTIGNTGTPWMLGLSAPVNVVMAETVRQRNIGLLLMVLSIVVVSGVLGIIFNRKVA
                     RPIGGEPAQAAQIALSVAQGDLTQTIPVQPKDDSSIFYAMNAMQSQLRDIAEQLISTS
                     ESVSHGATEIAAGNTDLASRTEQQAAALEETAASMEQITATVKQNADNAHNATTLAQN
                     AAHIAQKGDKIVGQVVHIMSEIDDSSKKIADITSIINGIAFQTNILALNAAVEAARAG
                     EQGRGFAVVANEVRNLAQRSASAVKDITALITESANRVDSGVTLVQSAGETMQDMLRA
                     VTSVKDIMDEIVSASDEQSRGISQVTQAVHEMDGVTQQNAALVQEATAAAASLEEQAR
                     QLAQTVLVFKLS"
     misc_feature    complement(9443..9682)
                     /locus_tag="PC1_0007"
                     /note="Cache domain; Region: Cache_1; pfam02743"
                     /db_xref="CDD:251508"
     misc_feature    complement(9023..9241)
                     /locus_tag="PC1_0007"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    complement(8879..>9055)
                     /locus_tag="PC1_0007"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(8270..9013)
                     /locus_tag="PC1_0007"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(8333..8932)
                     /locus_tag="PC1_0007"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(8336..8341,8348..8350,8357..8362,
                     8369..8371,8378..8383,8387..8392,8399..8404,8408..8413,
                     8420..8422,8429..8434,8441..8443,8450..8455,8462..8467,
                     8471..8476,8483..8485,8492..8497,8504..8506,8513..8518,
                     8555..8560,8567..8572,8576..8581,8588..8593,8600..8602,
                     8609..8614,8621..8623,8630..8632,8642..8644,8663..8665,
                     8672..8674,8684..8686,8693..8698,8705..8707,8714..8716,
                     8723..8728,8735..8740,8747..8749,8756..8761,8765..8767,
                     8777..8782,8786..8791,8798..8800,8807..8812,8819..8824,
                     8831..8833,8840..8845,8852..8854,8861..8866,8870..8875,
                     8882..8884,8891..8896,8903..8908))
                     /locus_tag="PC1_0007"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(8597..8698)
                     /locus_tag="PC1_0007"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(10548..11561)
                     /locus_tag="PC1_0008"
                     /db_xref="GeneID:8130908"
     CDS             complement(10548..11561)
                     /locus_tag="PC1_0008"
                     /inference="protein motif:PFAM:PF00356"
                     /note="PFAM: regulatory protein LacI; periplasmic binding
                     protein/LacI transcriptional regulator;
                     SMART: regulatory protein LacI;
                     KEGG: eca:ECA4436 LacI family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_003015607.1"
                     /db_xref="GI:253686417"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:8130908"
                     /translation="MVTMLDVAKKAGVSKATVSRVLTGNNYVSKTTRDRVFRAIEDIG
                     YRPNLLARQLATSKSQIIGLVVTNTLYSGPYFSELLFQTATMTEKYGRQLIMADGKHS
                     AEEEREAIQFLLDLRCDAVIIYPRFLSIDALESIIEQHEQPIMVVNRTLHRHGDNGIC
                     ADHQQHCHDAVNYLITQGHRDIAFICGSPNSPTGTSRLAGYRQALEENGIPYSDSLVA
                     PGDWTHDSGYSAAKTLLQRSTTFSALVASNDDMAIGAAKALREHGLAIPQDVSLLGFD
                     DLPMASWFYPPLTTVHVPVAEMINYTLEKLLCRLEGETVEPAPDFKGELIIRDSVSKG
                     PAT"
     misc_feature    complement(10557..11558)
                     /locus_tag="PC1_0008"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(11394..11546)
                     /locus_tag="PC1_0008"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(11397..11402,11406..11411,11418..11420,
                     11427..11429,11466..11468,11475..11480,11493..11495,
                     11502..11507,11511..11525))
                     /locus_tag="PC1_0008"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(11400..11429)
                     /locus_tag="PC1_0008"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(10572..11381)
                     /locus_tag="PC1_0008"
                     /note="Ligand binding domain of DNA transcription
                     iso-repressor GalS, which is one of two regulatory
                     proteins involved in galactose transport and metabolism;
                     Region: PBP1_GalS_like; cd06270"
                     /db_xref="CDD:107265"
     misc_feature    complement(order(10710..10715,10791..10793,10887..10892,
                     11214..11216,11226..11228,11268..11270,11274..11285,
                     11310..11312,11319..11321,11334..11336,11358..11360,
                     11379..11381))
                     /locus_tag="PC1_0008"
                     /note="dimerization interface (closed form) [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107265"
     misc_feature    complement(order(10734..10736,10818..10820,10896..10898,
                     10971..10973,11190..11192,11337..11339))
                     /locus_tag="PC1_0008"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107265"
     gene            11776..12081
                     /locus_tag="PC1_0009"
                     /db_xref="GeneID:8130909"
     CDS             11776..12081
                     /locus_tag="PC1_0009"
                     /inference="protein motif:PFAM:PF02302"
                     /note="PFAM: phosphotransferase system
                     lactose/cellobiose-specific IIB subunit;
                     KEGG: eca:ECA4435 pts system, IIB component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS lactose/cellobiose-specific transporter
                     subunit IIB"
                     /protein_id="YP_003015608.1"
                     /db_xref="GI:253686418"
                     /db_xref="InterPro:IPR003501"
                     /db_xref="InterPro:IPR013012"
                     /db_xref="GeneID:8130909"
                     /translation="MNKILLCCAAGMSTSMLVQRMEKVAEQKAIAVEIKAVGFEEFSE
                     LIDEYDCCLLGPQIKYKLPEFKVIADEKEKPIAVINMVDYGMMNGEKVLNDALAMIA"
     misc_feature    11782..12069
                     /locus_tag="PC1_0009"
                     /note="PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme
                     II (EII) of the N,N-diacetylchitobiose-specific and
                     lichenan-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In these systems, EII is
                     either a lichenan- or an N; Region:
                     PTS_IIB_chitobiose_lichenan; cd05564"
                     /db_xref="CDD:99906"
     misc_feature    order(11797..11799,11803..11808,11812..11817,11944..11946,
                     12025..12027)
                     /locus_tag="PC1_0009"
                     /note="active site"
                     /db_xref="CDD:99906"
     misc_feature    11797..11817
                     /locus_tag="PC1_0009"
                     /note="P-loop; other site"
                     /db_xref="CDD:99906"
     misc_feature    11797..11799
                     /locus_tag="PC1_0009"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99906"
     gene            12098..13411
                     /locus_tag="PC1_0010"
                     /db_xref="GeneID:8130910"
     CDS             12098..13411
                     /locus_tag="PC1_0010"
                     /EC_number="2.7.1.69"
                     /inference="protein motif:TFAM:TIGR00410"
                     /note="KEGG: eca:ECA4434 PTS system, IIBC component;
                     TIGRFAM: PTS system, lactose/cellobiose family IIC
                     subunit;
                     PFAM: phosphotransferase system EIIC"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system lactose/cellobiose family transporter
                     subunit IIC"
                     /protein_id="YP_003015609.1"
                     /db_xref="GI:253686419"
                     /db_xref="InterPro:IPR003352"
                     /db_xref="InterPro:IPR004501"
                     /db_xref="GeneID:8130910"
                     /translation="MSKLTESLFSVIENRISPIAAKLSSQRHVVAIKDGFIASMPFLI
                     VGSFMMLFAHPPFSPNSEWAFAQWWLGMVERHGEQIMMPYNMTMGIMAVYITSAIAYN
                     LAQSYKMNGFMAASLALMSFMVVAAPQIDKSLPVGSLGGEGIFTAIIVAIYSTELMHF
                     LQKHNIGIRLPEQVPPKIRQSFDLLIPILAIFLTLFPLSLFMQSQFGMLLPQAIMAVF
                     APIISASDSLPAILIAVLLCHLLWFAGIHGAVIVGGILQAFWLTNLGINQEAFNAGAP
                     ITKIFIEPFWQFFITVGGSGATMGLVFLYLRSRSAHLRSIGKLAVVPSMFNINEPVIF
                     GSPVVMNPLLFIPFITAPLVNAILAYIALKTDLVHRVISLAPWTTPGPIGAAWSTGWD
                     WRAVVLVGVLIVVSSLIYYPFFKMYERQLIEQEVGTAEEAVSDAR"
     misc_feature    12098..13387
                     /locus_tag="PC1_0010"
                     /note="Phosphotransferase system cellobiose-specific
                     component IIC [Carbohydrate transport and metabolism];
                     Region: CelB; COG1455"
                     /db_xref="CDD:224372"
     gene            13401..13727
                     /locus_tag="PC1_0011"
                     /db_xref="GeneID:8130911"
     CDS             13401..13727
                     /locus_tag="PC1_0011"
                     /inference="protein motif:PFAM:PF02255"
                     /note="PFAM: phosphotransferase system PTS
                     lactose/cellobiose-specific IIA subunit;
                     KEGG: eca:ECA4433 pts system, cellobiose-specific IIA
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS lactose/cellobiose-specific transporter
                     subunit IIA"
                     /protein_id="YP_003015610.1"
                     /db_xref="GI:253686420"
                     /db_xref="InterPro:IPR003188"
                     /db_xref="GeneID:8130911"
                     /translation="MLDETTIMELIIYAGEARSSSMEALSAARKYDWDKAEELLNAAS
                     VAARKAHQIQTALIGADEGSGKIPVNLILVHAQDHLMNAMLCRELVEELIQLHREISS
                     LKQLIN"
     misc_feature    13410..13697
                     /locus_tag="PC1_0011"
                     /note="PTS_IIA, PTS system, lactose/cellobiose specific
                     IIA subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_lac;
                     cd00215"
                     /db_xref="CDD:238133"
     misc_feature    order(13452..13454,13623..13625,13629..13637)
                     /locus_tag="PC1_0011"
                     /note="active site"
                     /db_xref="CDD:238133"
     misc_feature    order(13569..13571,13617..13622,13641..13643)
                     /locus_tag="PC1_0011"
                     /note="methionine cluster; other site"
                     /db_xref="CDD:238133"
     misc_feature    13623..13625
                     /locus_tag="PC1_0011"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238133"
     misc_feature    13632..13634
                     /locus_tag="PC1_0011"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238133"
     gene            13760..15202
                     /locus_tag="PC1_0012"
                     /db_xref="GeneID:8130912"
     CDS             13760..15202
                     /locus_tag="PC1_0012"
                     /inference="protein motif:PFAM:PF00232"
                     /note="PFAM: glycoside hydrolase family 1;
                     KEGG: eca:ECA4432 6-phospho-beta-glucosidase"
                     /codon_start=1
                     /transl_table=11
                     /product="family 1 glycoside hydrolase"
                     /protein_id="YP_003015611.1"
                     /db_xref="GI:253686421"
                     /db_xref="InterPro:IPR001360"
                     /db_xref="GeneID:8130912"
                     /translation="MSVQQLPKDFLWGGAVAAHQVEGGWDQGGKGVSICDVLSGGAHG
                     VDRVITDGVQPGVSYPNHQAVEFYSHYKQDVALFAEMGFKCFRTSIAWTRIFPNGDEL
                     EPNEAGLQFYDDLFDELLKYNIEPVITLSHFEMPHHLVKQYGGWLNRKVVDFFVRYSE
                     VVMKRYQSKVKYWMTFNEINNQRNWQYPLFGYCCSGVIFTDHDKPEQAMYQTLHHQFV
                     ASAKVVKLGHEINPNFKIGCMLALVPIYPWSCHPDDVMFAQEAMRERHLFGDVQLRGY
                     YPSYILKEWARKGYQIDMQPEDEQTLRDGCTDYLGFSYYMSSAVQLAAKGQKKEDSIT
                     GFDGGVKNPHVKASEWGWQIDPVGLRYTLNSFYERYQKPMFIVENGFGAVDKVEADGS
                     INDDYRIEYLKAHIDQMKKAVVEDGVELMGYTPWGCIDCVSFTTGQYSKRYGFIYVDK
                     HDDGTGTFKRSKKKSFDWYKKVISSNGAEL"
     misc_feature    13760..15199
                     /locus_tag="PC1_0012"
                     /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta-
                     galactosidase [Carbohydrate transport and metabolism];
                     Region: BglB; cl01046"
                     /db_xref="CDD:260762"
     misc_feature    13772..15190
                     /locus_tag="PC1_0012"
                     /note="Glycosyl hydrolase family 1; Region: Glyco_hydro_1;
                     pfam00232"
                     /db_xref="CDD:249702"
     gene            15358..16173
                     /locus_tag="PC1_0013"
                     /db_xref="GeneID:8130913"
     CDS             15358..16173
                     /locus_tag="PC1_0013"
                     /inference="protein motif:TFAM:TIGR00099"
                     /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
                     hydrolase, subfamily IIB;
                     PFAM: Haloacid dehalogenase domain protein hydrolase type
                     3; Haloacid dehalogenase domain protein hydrolase;
                     sucrose-6F-phosphate phosphohydrolase;
                     KEGG: eca:ECA4428 sugar phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="Cof-like hydrolase"
                     /protein_id="YP_003015612.1"
                     /db_xref="GI:253686422"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR006380"
                     /db_xref="InterPro:IPR013200"
                     /db_xref="GeneID:8130913"
                     /translation="MSVKLIAIDMDGTLLTPQNQISPAVKAAIAAAREKGVQVVLATG
                     RPYIGVERYLMELDLQQEGCYCITNNGALVQRTVNGDCVAQTALSFDDYLYFEALACK
                     LGVHFHALDFNFVYTANKDISPYTIHESHLTGMPLKYRAVEEMDRSLTFPKVMMIDEP
                     EILDRAISQIPPEAFERYTIMKSAEYYLEILDKRVNKGEGVKMLAEHLGIPRESVMTL
                     GDQQNDLAMIRYAGIGVAMGNAIDEVKEASQFVTKSNTEDGVAYAIEKFVLNA"
     misc_feature    15358..16167
                     /locus_tag="PC1_0013"
                     /note="sugar phosphate phosphatase; Provisional; Region:
                     PRK10513"
                     /db_xref="CDD:182509"
     misc_feature    15367..16041
                     /locus_tag="PC1_0013"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     misc_feature    15370..>15582
                     /locus_tag="PC1_0013"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(15382..15390,15484..15489)
                     /locus_tag="PC1_0013"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    15382..15399
                     /locus_tag="PC1_0013"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    15484..15486
                     /locus_tag="PC1_0013"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <15946..16170
                     /locus_tag="PC1_0013"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            complement(16319..17215)
                     /locus_tag="PC1_0014"
                     /db_xref="GeneID:8130914"
     CDS             complement(16319..17215)
                     /locus_tag="PC1_0014"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: eca:ECA4427 LysR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003015613.1"
                     /db_xref="GI:253686423"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:8130914"
                     /translation="MRINPRQVEAFHKVILTGGITAAANMMYITQPAVSRLIKDFEDA
                     LNLKLFDRDGRGLIPRAEAMKLYREVERLYLGLDQIGLIADEIRHAKGSVLRIAAVQA
                     LSFLCSDQVLPTLLKKYPDLSLFLDIESSSRITDAIAENHYDVGFIFGQPGIKGLEAE
                     PLADASAVAVLAMGHPLATADEITLADLAGTRAILPGRTTPLRAQIDISARKEQIYLH
                     NPIETSMANCCVLASRNVGIGVVDFITALNSPSPVIVKPFNPDIKMAYCAVYPPQIPR
                     SQVVNHITQVMKEKIADSLELK"
     misc_feature    complement(16340..17215)
                     /locus_tag="PC1_0014"
                     /note="DNA-binding transcriptional regulator LysR;
                     Provisional; Region: PRK11013"
                     /db_xref="CDD:236819"
     misc_feature    complement(17039..17200)
                     /locus_tag="PC1_0014"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(16376..16933)
                     /locus_tag="PC1_0014"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(16514..16519,16523..16528,16544..16546,
                     16547..16558,16832..16852,16856..16858,16868..16870,
                     16877..16882,16886..16891))
                     /locus_tag="PC1_0014"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            17358..18908
                     /locus_tag="PC1_0015"
                     /db_xref="GeneID:8130915"
     CDS             17358..18908
                     /locus_tag="PC1_0015"
                     /inference="protein motif:PFAM:PF00496"
                     /note="PFAM: extracellular solute-binding protein family
                     5;
                     KEGG: eca:ECA4426 putative extracellular solute-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 5 extracellular solute-binding protein"
                     /protein_id="YP_003015614.1"
                     /db_xref="GI:253686424"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="GeneID:8130915"
                     /translation="MKKSTLALLFTVLFSSSPLVYSADLNIGLASSTTSMDPQFYVSG
                     ANSAMARNIFDGLVVQDEKQQIAPALATSWKVIDDKTWEFVLRPGVKFHDGSDFTAKD
                     VIASIKRVALASKNSPSSYAPYVSDIAEVIEVNPLTVRIKTKEASPLLLNNLSRISIL
                     PARLENVPTETLNSGKDVIGTGPFKFVSWVPDDRVVLSRNDDYWGGKAEWDNVTVRVF
                     KNSSARVAAVLSGDVDMIENVPTADSSNIEKNQQLKTISTPGNRVIYLHMDQQREESP
                     FAKGPDGKNPLLKKEVRQAMSLAINRQAIVDRVMEGQAVVASQLVPKGYPGYSASIPA
                     PVYNPEKAKQELAAAGYPDGFTLTFHASNDRYPNDSKIAQAIGQMFTRAGIKTEVVTM
                     PGSVYFSRASRLEFSLIMGGAAIETGEASGVLGPLLETFGPNAGQGNRGRYSNPAFDK
                     ALSEARVTLDETKRDALLAEAMNIGMNDLGVIPVMFLSNTWAMKKQYTYVGRSDAYTL
                     PYFVRSAK"
     misc_feature    17370..18893
                     /locus_tag="PC1_0015"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    17427..18869
                     /locus_tag="PC1_0015"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_2; cd08498"
                     /db_xref="CDD:173863"
     gene            18978..19862
                     /locus_tag="PC1_0016"
                     /db_xref="GeneID:8130916"
     CDS             18978..19862
                     /locus_tag="PC1_0016"
                     /inference="protein motif:PFAM:PF00701"
                     /note="PFAM: dihydrodipicolinate synthetase;
                     KEGG: eca:ECA4425 putative dihydrodipicolinate synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="YP_003015615.1"
                     /db_xref="GI:253686425"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="GeneID:8130916"
                     /translation="MNTFSGVFPYLVSPVRPDGQVDKPVLAQLTEHLIQCGVHGVVPL
                     GSTGEFAYLSAAQRLDVVKTVIETTAGRVPVIAGVASTTIQDAVEQTKRYVELGADGI
                     LAVLEAYFPLKDEGVEQYFRAIAEAAQGKPVVLYTNPQFQRSDLSLPVIERLSHVSNI
                     RYIKDASTNTGRLLSIIERTRGRMDVFSASAHIPACVMLIGGVGWMAGPACIVPKQSI
                     ALYEAARAGDWNKAMELQRPLWRINEIFARYSIAGCIKAALQLQGFAVGDPLPPQLPL
                     DEKARKEIADVLASVDSL"
     misc_feature    18996..19841
                     /locus_tag="PC1_0016"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    order(19005..19007,19101..19103,19110..19118,19383..19385,
                     19467..19469)
                     /locus_tag="PC1_0016"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    order(19101..19103,19110..19118,19383..19385,19467..19469,
                     19593..19595)
                     /locus_tag="PC1_0016"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    order(19113..19115,19128..19133,19224..19229,19299..19304,
                     19323..19325,19335..19337,19788..19793)
                     /locus_tag="PC1_0016"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    19467..19469
                     /locus_tag="PC1_0016"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            19965..20918
                     /locus_tag="PC1_0017"
                     /db_xref="GeneID:8130917"
     CDS             19965..20918
                     /locus_tag="PC1_0017"
                     /inference="protein motif:PFAM:PF01156"
                     /note="PFAM: Inosine/uridine-preferring nucleoside
                     hydrolase;
                     KEGG: eca:ECA4424 putative nucleoside hydrolase protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Inosine/uridine-preferring nucleoside hydrolase"
                     /protein_id="YP_003015616.1"
                     /db_xref="GI:253686426"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR015910"
                     /db_xref="GeneID:8130917"
                     /translation="MSALPIIIDCDPGIDDAIALLSAFVAPELDIRGICTVCGNQPLD
                     KTLRNALQIVELGQRTDIPVFAGCHRPLLRDPIHGQFHGESGLGQTVLPAPQKQAEAQ
                     HAVSFIIAQCKQAIADGTPITLCTLGPLTNVAMALRMAPEIADGIARIVMMGGAYREA
                     GNRSLTSEFNMIADPQAAKVVFDSSIALVALPLDVTHQVILTPELVARFIALSGRISA
                     PLGEMMAFWDRNDIRRYGSRGGPLHDPLVIAWVLAPHCFTTEKASVYIEQESELCMGQ
                     TVADWYGKTDRQPNVDVVTGVDAKQVVELFADLLSRYGEGV"
     misc_feature    19977..20894
                     /locus_tag="PC1_0017"
                     /note="nuc_hydro_IU_UC_XIUA: inosine-uridine preferring,
                     xanthosine-inosine-uridine-adenosine-preferring and,
                     uridine-cytidine preferring nucleoside hydrolases.
                     Nucleoside hydrolases cleave the N-glycosidic bond in
                     nucleosides generating ribose and the...; Region:
                     nuc_hydro_IU_UC_XIUA; cd02651"
                     /db_xref="CDD:239117"
     misc_feature    order(19995..19997,20007..20012,20082..20084,20205..20207,
                     20343..20345,20448..20450,20466..20468,20472..20474,
                     20694..20696)
                     /locus_tag="PC1_0017"
                     /note="active site"
                     /db_xref="CDD:239117"
     misc_feature    order(20178..20180,20376..20378,20502..20504,20763..20765,
                     20769..20774,20781..20783)
                     /locus_tag="PC1_0017"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239117"
     gene            20920..21927
                     /locus_tag="PC1_0018"
                     /db_xref="GeneID:8130918"
     CDS             20920..21927
                     /locus_tag="PC1_0018"
                     /inference="protein motif:PFAM:PF01156"
                     /note="PFAM: Inosine/uridine-preferring nucleoside
                     hydrolase;
                     KEGG: eca:ECA4423 putative nucleoside hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="Inosine/uridine-preferring nucleoside hydrolase"
                     /protein_id="YP_003015617.1"
                     /db_xref="GI:253686427"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR015910"
                     /db_xref="GeneID:8130918"
                     /translation="MVQERIIIDTDPGVDDAIAIWLALASPELDVLGITVVAGNVPLA
                     ATLSNACNVVGVTGRTDVPIFAGASRPLIRDQVFGKYAHIGKFSADWVPESTLSPEQE
                     HAVDFLVRMTRQAAADNNPITICALGPLTNLALALCFHPDVARGIKQIVSMSCAFTAM
                     GNRVPWADFNVYADPHAAEIVFSSGVPIVIMPLDMTFQALIQTEQVDDIERSGGAPGK
                     AMAALLRMFDRSEVDRFGREGGPIHDATVIAWLLKPELFKSKRARIGVEVAGRTAGYA
                     FADFYHKLGEPENALVMREIDEQGFLGLIAERLRRYGSEEIEGSEKKDSSEALNGSGG
                     R"
     misc_feature    20932..21846
                     /locus_tag="PC1_0018"
                     /note="nuc_hydro_IU_UC_XIUA: inosine-uridine preferring,
                     xanthosine-inosine-uridine-adenosine-preferring and,
                     uridine-cytidine preferring nucleoside hydrolases.
                     Nucleoside hydrolases cleave the N-glycosidic bond in
                     nucleosides generating ribose and the...; Region:
                     nuc_hydro_IU_UC_XIUA; cd02651"
                     /db_xref="CDD:239117"
     misc_feature    order(20950..20952,20962..20967,21037..21039,21163..21165,
                     21298..21300,21403..21405,21421..21423,21427..21429,
                     21649..21651)
                     /locus_tag="PC1_0018"
                     /note="active site"
                     /db_xref="CDD:239117"
     misc_feature    order(21133..21135,21331..21333,21457..21459,21718..21720,
                     21724..21729,21733..21735)
                     /locus_tag="PC1_0018"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239117"
     gene            21927..22904
                     /locus_tag="PC1_0019"
                     /db_xref="GeneID:8130919"
     CDS             21927..22904
                     /locus_tag="PC1_0019"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: eca:ECA4422 ABC transporter permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_003015618.1"
                     /db_xref="GI:253686428"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8130919"
                     /translation="MIAYLLSRIGQTLLTLAVMSVLVFVGVYLVGNPVDMLLGATATP
                     AERLAVIQSFGLDKPVWEQYGLFVWNAFQGDMGNSFIFNQPALTLIFQRMPATLELAM
                     VAFVMALIVGIPLGIYAGLKPDSAVSKSIMTFSILGFSLPTFWIGLVMIMLFSVKLGW
                     LPSSGRGDVHELFGIPFSFLTRDGLEHLLLPAFNLALFKISLVIRLMRAGVMECLQQD
                     YVQFARAKGLSETRIVLVHVLRNTLIPLITVLGLELGSLIAFAVVTETIYAWPGMGKL
                     IIDSIAVLDRPVILAYLMITVVMFSVINLLVDLLYVLVDPRVRLGGDKG"
     misc_feature    21927..22892
                     /locus_tag="PC1_0019"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    22206..22832
                     /locus_tag="PC1_0019"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(22254..22259,22266..22271,22284..22286,22317..22328,
                     22332..22361,22368..22373,22377..22379,22518..22523,
                     22527..22529,22533..22535,22542..22547,22551..22553,
                     22563..22568,22575..22577,22626..22628,22668..22673,
                     22680..22682,22701..22712,22719..22724,22749..22754,
                     22782..22787,22794..22799,22803..22808,22815..22820,
                     22827..22832)
                     /locus_tag="PC1_0019"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(22335..22379,22701..22718)
                     /locus_tag="PC1_0019"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(22377..22379,22503..22505,22719..22721,22743..22745,
                     22752..22754,22782..22784)
                     /locus_tag="PC1_0019"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(22578..22616,22632..22637,22647..22649)
                     /locus_tag="PC1_0019"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            22901..23809
                     /locus_tag="PC1_0020"
                     /db_xref="GeneID:8130920"
     CDS             22901..23809
                     /locus_tag="PC1_0020"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: eca:ECA4421 ABC transporter permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_003015619.1"
                     /db_xref="GI:253686429"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8130920"
                     /translation="MTGNTIHQPAAVQKAVHPVMRVVMALINDRLALFGLIMLAIFVL
                     LALLAPLLSPQNPYDLMQLDIMDGRLVPGSSSMSGMTYWLGTDDQGRDLFSAILYGTR
                     ISLMVGFTSAVFALLIGASLGLISAYVGGKTDATIMRIVDIQLSFPPILIALILLAVL
                     GQGVDKIIMALVVTQWAYYARTIRGSALVERRRSYVDAARSMALSNRRILFRHILPNC
                     LAPLIVVATMRIAYAIMLEATLSFLGIGLPVTEPSLGLLISNGFEYLMSGDYWISFFP
                     GLTLLLLIVAINLVGDALRDILNPRN"
     misc_feature    22952..23803
                     /locus_tag="PC1_0020"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    23204..23755
                     /locus_tag="PC1_0020"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(23249..23254,23261..23266,23279..23281,23309..23320,
                     23324..23347,23420..23425,23429..23431,23435..23437,
                     23444..23449,23453..23455,23465..23470,23477..23479,
                     23528..23530,23570..23575,23582..23584,23603..23614,
                     23621..23626,23672..23677,23705..23710,23717..23722,
                     23726..23731,23738..23743,23750..23755)
                     /locus_tag="PC1_0020"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(23327..23347,23603..23620)
                     /locus_tag="PC1_0020"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(23405..23407,23621..23623,23666..23668,23675..23677,
                     23705..23707)
                     /locus_tag="PC1_0020"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(23480..23518,23534..23539,23549..23551)
                     /locus_tag="PC1_0020"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            23825..25657
                     /locus_tag="PC1_0021"
                     /db_xref="GeneID:8130921"
     CDS             23825..25657
                     /locus_tag="PC1_0021"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     Oligopeptide/dipeptide ABC transporter domain protein;
                     SMART: AAA ATPase;
                     KEGG: eca:ECA4420 ABC transporter ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_003015620.1"
                     /db_xref="GI:253686430"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8130921"
                     /translation="MGIRGNEHMTAPIMSVSHLTTAFQVNGEWMNVVRDLSFTIGEKE
                     TVAVVGESGSGKSVMAKSIMRLLPPGQSRIEGQIHFGDTELLSLPSKAMQDVRGNRIG
                     MIFQEPMTSLNPVLPIGYQITEVLRRHRGMGKAEARAEAVRLLEKVRIPAAKSRLNEY
                     PQSFSGGMRQRVVIAIALACHPKLLIADEPTTALDVTIQAQILTLIKTLQEEEGMSVL
                     FITHDMGVVAEVSDRTLVMYQGEMVENAVTREIFHHPQQPYTRMLLSAVPKLGSMSGS
                     AWPQRFPLIDLKTGERQSVPDAVNTVSGEEPVLTVKNLVTRFDIRSGFFRRLSGRVHA
                     VENVSFDLWPGETLALVGESGCGKSTTGRSIIRLNDAVSGDIQLLGKNILTADKRELT
                     ESRRQIQMVFQDPYESLNPRMRIGEAIAEPMLLHGLATRQNVSARVSELLEQVGLSGD
                     MASRFPHQFSGGQRQRVCIARALALEPKVIIADESVSALDVSVKAQVINLMLDLQQKL
                     GLSFLFISHDMAVVERISHRVAVMYLGEIVEIGPRSAIFDNPQHDYTRRLISAVPVPD
                     PDTRPVRNITNDELRSPVRAPDFHPPVRRYKQVGEGHFVLETVA"
     misc_feature    23849..25528
                     /locus_tag="PC1_0021"
                     /note="ATPase components of various ABC-type transport
                     systems, contain duplicated ATPase [General function
                     prediction only]; Region: COG1123"
                     /db_xref="CDD:224048"
     misc_feature    23861..24556
                     /locus_tag="PC1_0021"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    23972..23995
                     /locus_tag="PC1_0021"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(23981..23986,23990..23998,24140..24142,24386..24391,
                     24488..24490)
                     /locus_tag="PC1_0021"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    24131..24142
                     /locus_tag="PC1_0021"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    24314..24343
                     /locus_tag="PC1_0021"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    24374..24391
                     /locus_tag="PC1_0021"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    24398..24409
                     /locus_tag="PC1_0021"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    24476..24496
                     /locus_tag="PC1_0021"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    24551..>24637
                     /locus_tag="PC1_0021"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     misc_feature    24746..25447
                     /locus_tag="PC1_0021"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    24878..24901
                     /locus_tag="PC1_0021"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(24887..24892,24896..24904,25031..25033,25271..25276,
                     25373..25375)
                     /locus_tag="PC1_0021"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    25022..25033
                     /locus_tag="PC1_0021"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    25199..25228
                     /locus_tag="PC1_0021"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    25259..25276
                     /locus_tag="PC1_0021"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    25283..25294
                     /locus_tag="PC1_0021"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    25361..25381
                     /locus_tag="PC1_0021"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    25436..>25534
                     /locus_tag="PC1_0021"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; pfam08352"
                     /db_xref="CDD:254752"
     gene            complement(25733..25990)
                     /locus_tag="PC1_0022"
                     /db_xref="GeneID:8130922"
     CDS             complement(25733..25990)
                     /locus_tag="PC1_0022"
                     /inference="protein motif:PFAM:PF07338"
                     /note="PFAM: protein of unknown function DUF1471;
                     KEGG: eca:ECA4414 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015621.1"
                     /db_xref="GI:253686431"
                     /db_xref="InterPro:IPR010854"
                     /db_xref="GeneID:8130922"
                     /translation="MKNVKFFAAAVVLSTLSFGAFAAEQVSSQQAQGLEKVGVVSATA
                     RSLDSLQAQLAQKAEKAGASAFTITSATGDNQLRGVAVIYK"
     misc_feature    complement(25736..25990)
                     /locus_tag="PC1_0022"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; cl11507"
                     /db_xref="CDD:264403"
     gene            complement(26163..26963)
                     /locus_tag="PC1_0023"
                     /db_xref="GeneID:8130923"
     CDS             complement(26163..26963)
                     /locus_tag="PC1_0023"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: eca:ECA4413 aliphatic sulfonates transport
                     ATP-binding subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_003015622.1"
                     /db_xref="GI:253686432"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8130923"
                     /translation="MTAFTDSATRAHSPSPLTKGTPLALDAITKHYGHRTVLNDVQLR
                     IPSGQFVAIVGRSGCGKSTLLRLLAGLEAASSGELLTGTAPLSSAKDDTRLMFQEARL
                     LPWKKVIDNVGLGLRGNWREKAQEALASVGLADRASDWPAALSGGQKQRVALARALIH
                     HPRLLLLDEPLGALDALTRIEMQSLIENLWLQHGFTVLLVTHDVSEAIALADRVILIE
                     EGRVGLDITVDLPRPRRRGSAKLAELEARVLERVLAPASSPLPQQAVI"
     misc_feature    complement(26175..26933)
                     /locus_tag="PC1_0023"
                     /note="aliphatic sulfonates transport ATP-binding subunit;
                     Provisional; Region: ssuB; PRK11247"
                     /db_xref="CDD:183055"
     misc_feature    complement(26274..26897)
                     /locus_tag="PC1_0023"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    complement(26778..26801)
                     /locus_tag="PC1_0023"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(order(26358..26360,26457..26462,26670..26672,
                     26775..26783,26787..26792))
                     /locus_tag="PC1_0023"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(26670..26681)
                     /locus_tag="PC1_0023"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(26505..26534)
                     /locus_tag="PC1_0023"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(26457..26474)
                     /locus_tag="PC1_0023"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(26439..26450)
                     /locus_tag="PC1_0023"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(26352..26372)
                     /locus_tag="PC1_0023"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            complement(26960..27754)
                     /locus_tag="PC1_0024"
                     /db_xref="GeneID:8130924"
     CDS             complement(26960..27754)
                     /locus_tag="PC1_0024"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: eca:ECA4412 putative aliphatic sulfonates transport
                     permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_003015623.1"
                     /db_xref="GI:253686433"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8130924"
                     /translation="MARTPSSLAQRLAPFLLPVTLLVAWQVAVEFGWLSNRILPAPSS
                     VITAGWSLIYSGELWQHLAISGWRALIGFAIGGTIGLTLGFITGLSRWGERLLDSSVQ
                     MIRNVPHLALIPLVILWFGIDEAAKIFLVALGTLFPVYLNTYHGIKNIDRGLLEMARS
                     YGLSGLSLFYQVVLPGALPSIMVGIRFALGFMWLTLIVAETISANSGIGYLAMNAREF
                     LQTDVVVVAIILYALLGKLADISAQGLERIWLRWNPAYQTSSGDAS"
     misc_feature    complement(26984..27754)
                     /locus_tag="PC1_0024"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    complement(27044..27571)
                     /locus_tag="PC1_0024"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(27044..27049,27056..27061,27068..27073,
                     27077..27082,27089..27094,27122..27127,27152..27157,
                     27164..27175,27194..27196,27203..27208,27248..27250,
                     27299..27301,27308..27313,27323..27325,27329..27334,
                     27341..27343,27347..27349,27353..27358,27404..27406,
                     27410..27415,27422..27451,27455..27466,27491..27493,
                     27506..27511,27518..27523))
                     /locus_tag="PC1_0024"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(27158..27175,27404..27448))
                     /locus_tag="PC1_0024"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(27092..27094,27122..27124,27131..27133,
                     27155..27157,27404..27406))
                     /locus_tag="PC1_0024"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(27227..27229,27239..27244,27260..27298))
                     /locus_tag="PC1_0024"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(27765..28907)
                     /locus_tag="PC1_0025"
                     /db_xref="GeneID:8130925"
     CDS             complement(27765..28907)
                     /locus_tag="PC1_0025"
                     /EC_number="1.14.14.5"
                     /inference="protein motif:PRIAM:1.14.14.5"
                     /note="PFAM: Luciferase-like monooxygenase;
                     KEGG: eca:ECA4411 alkanesulfonate monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Alkanesulfonate monooxygenase"
                     /protein_id="YP_003015624.1"
                     /db_xref="GI:253686434"
                     /db_xref="InterPro:IPR016048"
                     /db_xref="GeneID:8130925"
                     /translation="MSLNVFWFLPTHGDGRYLGSTEGARHVDYGYLQQVAQAAERQGF
                     GGVLLPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGVISPTIAARQAATLDRLSNGR
                     ALFNLVTGGDPEELAAEGLFLSHEERYEASAEFTHIWRRLLEGETVDFAGKHIQVKDA
                     KLLYPPVQQPRPPLYFGGSSEAAQNLAAEQVDLYLTWGEPPEQVKEKLAEVRDKAAAQ
                     GREVRFGIRLHVIVRETTEEAWQAADRLISHLDEKTIADAQAALARFDSVGQQRMAAL
                     HGGKKDKLEISPNLWAGIGLVRGGAGTALVGDGPTVAERIQEYADLGIDTFILSGYPH
                     LEEAYRVGELLFPHLDLAQQPTPLHAVNNAGEVVANRYVPRKVSQS"
     misc_feature    complement(28173..28901)
                     /locus_tag="PC1_0025"
                     /note="Alkanesulfonate monoxygenase is the monoxygenase of
                     a two-component system that catalyzes the conversion of
                     alkanesulfonates to the corresponding aldehyde and
                     sulfite. Alkanesulfonate monoxygenase (SsuD) has an
                     absolute requirement for reduced flavin...; Region:
                     Alkanesulfonate_monoxygenase; cd01094"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(28221..28223,28227..28229,28323..28325,
                     28365..28370,28524..28526,28584..28586,28743..28745,
                     28872..28874,28884..28886))
                     /locus_tag="PC1_0025"
                     /note="active site"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(28416..28421,28425..28436,28440..28442,
                     28554..28559,28566..28568,28617..28619,28626..28628,
                     28635..28640,28647..28652,28656..28658,28707..28709,
                     28716..28721,28728..28730,28737..28754))
                     /locus_tag="PC1_0025"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(28674..28679)
                     /locus_tag="PC1_0025"
                     /note="non-prolyl cis peptide bond; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(28173..28190,28209..28220,28401..28442,
                     28527..28535,28554..28580))
                     /locus_tag="PC1_0025"
                     /note="insertion regions; other site"
                     /db_xref="CDD:238527"
     gene            complement(28966..29988)
                     /locus_tag="PC1_0026"
                     /db_xref="GeneID:8130926"
     CDS             complement(28966..29988)
                     /locus_tag="PC1_0026"
                     /inference="protein motif:TFAM:TIGR01728"
                     /note="TIGRFAM: aliphatic sulfonates family ABC
                     transporter, periplsmic ligand-binding protein;
                     SMART: extracellular solute-binding protein family 3;
                     KEGG: eca:ECA4410 alkanesulfonate transporter
                     substrate-binding subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="aliphatic sulfonates family ABC transporter,
                     periplsmic ligand-binding protein"
                     /protein_id="YP_003015625.1"
                     /db_xref="GI:253686435"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR010067"
                     /db_xref="GeneID:8130926"
                     /translation="MSLMMKKSVTEIREKRTPLWKNVATQLRRIPTLLVASAVLFMST
                     AYAQDSVPTQLRIGYQKGSISLVLAKSHLLLEKQFPNTKISWIEFPAGPQMLEALNVG
                     SIDLGGTGDIPPIFAQAAGADLLYVGVEPPKPQAEVILVREDSPVKTVADLKGRKVAF
                     QKGSSAHNTLLRALQRDGLKFTDIKPTYLTPADARAAFQQGNVDAWAIWDPYYSAALL
                     EGGVRVLVDSSGLEKTGSFYLAGRPYAEAHGTFIRQVLDELTKADALTISDRAQSVTL
                     LANAVGLPEKVIETALDHRPPTTIEPLDAATIKAQQSTADLFYENRLVPVKVNIAERV
                     WRPKAN"
     misc_feature    complement(28981..29826)
                     /locus_tag="PC1_0026"
                     /note="ABC transporter, substrate-binding protein,
                     aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
                     /db_xref="CDD:130789"
     misc_feature    complement(29206..29748)
                     /locus_tag="PC1_0026"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(29362..29364,29494..29496,29632..29634,
                     29713..29715))
                     /locus_tag="PC1_0026"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(29383..29385,29401..29403,29413..29415))
                     /locus_tag="PC1_0026"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(29278..29295)
                     /locus_tag="PC1_0026"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            30438..31883
                     /locus_tag="PC1_0027"
                     /db_xref="GeneID:8130927"
     CDS             30438..31883
                     /locus_tag="PC1_0027"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: ent:Ent638_2482 major facilitator transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_003015626.1"
                     /db_xref="GI:253686436"
                     /db_xref="InterPro:IPR001411"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:8130927"
                     /translation="MALTDSSQDKAPRQEHSDSGRISGLALLVASAFFMEFLDGTVIA
                     TALPDMAKAFGVTAIDLNIGISAYLLTLAVLIPANGWVAERFGARNVFTLALCIFTLS
                     SLLCGLSHNVTEFVLMRILQGVGGAMMVPVGRLVVLRTTPKDQLIKAIATLTWPALVA
                     PIIGPPLGGFITTYASWHWIFFLNVPLGLIAIVLSLRMMPNQSANESKPFDFPGFIAT
                     GVTMLCLVVGLEMLSQQNVSLIGAAVTIAIGLATLVWSVRHLLTCKTPLIGLSSLSVP
                     SFRISMRGGFILRATISSAPFMLPLMFQVGFGMNAFEAGSMVLAVFAGNLAMKPATTP
                     LIRYFGFRKLLISNGIACVLTLLLCALLTPDSPHLITLTLLFLGGLSRSMQFTSISSL
                     AFAEVPSQEMSSANTLFSTSLQLASGLGVTMGALSIRLGNILSDELGYTAVPGMGFRL
                     GFVVIAIITAFGVYDMTRLAPNAGINVSQKK"
     misc_feature    30516..>31037
                     /locus_tag="PC1_0027"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    30522..31697
                     /locus_tag="PC1_0027"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(30555..30557,30564..30572,30576..30581,30630..30632,
                     30639..30644,30651..30653,30663..30668,30672..30677,
                     30813..30818,30825..30830,30837..30842,30849..30851,
                     30885..30890,30897..30902,30918..30920)
                     /locus_tag="PC1_0027"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            32221..32544
                     /locus_tag="PC1_0028"
                     /db_xref="GeneID:8130928"
     CDS             32221..32544
                     /locus_tag="PC1_0028"
                     /inference="protein motif:PFAM:PF02302"
                     /note="PFAM: phosphotransferase system
                     lactose/cellobiose-specific IIB subunit;
                     KEGG: eca:ECA4409 PTS system, cellobiose-specific IIB
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS lactose/cellobiose-specific transporter
                     subunit IIB"
                     /protein_id="YP_003015627.1"
                     /db_xref="GI:253686437"
                     /db_xref="InterPro:IPR003501"
                     /db_xref="InterPro:IPR013012"
                     /db_xref="GeneID:8130928"
                     /translation="MKRIMLCCSAGMSTSLLVKKMKEAASTRGLDVDIAAYAAHEFDE
                     QVGKYDVVLLGPQVKYMLASFQEKAEGKGVPVAAIDMMDYGMQRGDNVLDFAFSLIEK
                     SGQPL"
     misc_feature    32227..32514
                     /locus_tag="PC1_0028"
                     /note="PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme
                     II (EII) of the N,N-diacetylchitobiose-specific and
                     lichenan-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In these systems, EII is
                     either a lichenan- or an N; Region:
                     PTS_IIB_chitobiose_lichenan; cd05564"
                     /db_xref="CDD:99906"
     misc_feature    order(32242..32244,32248..32253,32257..32262,32389..32391,
                     32470..32472)
                     /locus_tag="PC1_0028"
                     /note="active site"
                     /db_xref="CDD:99906"
     misc_feature    32242..32262
                     /locus_tag="PC1_0028"
                     /note="P-loop; other site"
                     /db_xref="CDD:99906"
     misc_feature    32242..32244
                     /locus_tag="PC1_0028"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99906"
     gene            32541..33863
                     /locus_tag="PC1_0029"
                     /db_xref="GeneID:8130929"
     CDS             32541..33863
                     /locus_tag="PC1_0029"
                     /EC_number="2.7.1.69"
                     /inference="protein motif:TFAM:TIGR00410"
                     /note="KEGG: eca:ECA4408 PTS system EIIC component;
                     TIGRFAM: PTS system, lactose/cellobiose family IIC
                     subunit;
                     PFAM: phosphotransferase system EIIC"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system lactose/cellobiose family transporter
                     subunit IIC"
                     /protein_id="YP_003015628.1"
                     /db_xref="GI:253686438"
                     /db_xref="InterPro:IPR003352"
                     /db_xref="InterPro:IPR004501"
                     /db_xref="GeneID:8130929"
                     /translation="MSGLYQSMVNIIEQKITPLAGVVGQQRHIIAIRDGFIAALPFMI
                     IGSFMLVFIFPPFAPDTTLGFARAWLDFSVAYREQLMLPYYLSMGVMTFFISVGIGAS
                     LGKHYKLDPIMTGLLALMAFLLVAAPYHDKQISTQYFSGEGIFTAILTSIYAGEVYAW
                     LKKRNITIRLPKEVPTGVARSFEILIPVLVIVATLHPFNLFIQSATGMIIPEAIMHLL
                     APLISASDSLPAILISVFICQILWFAGIHGALIVTGIMNPFWMTNLALNQAALSAGAP
                     LPHIYLQGFWDHYLLIGGVGSTLPLAFLLLRSRAVHLRTIGRMGVVPSFFNINEPILF
                     GAPIIMNPLLFLPFIFVPMVNAVIAYTATKLGWIAQVVSLTPWTTPAPIGASWAANWA
                     FSPVIMCLLCMVMSAAMYYPFLKVYERTLLKQEQEKQQQAAGEASASA"
     misc_feature    32562..33797
                     /locus_tag="PC1_0029"
                     /note="Phosphotransferase system cellobiose-specific
                     component IIC [Carbohydrate transport and metabolism];
                     Region: CelB; COG1455"
                     /db_xref="CDD:224372"
     gene            33889..35301
                     /locus_tag="PC1_0030"
                     /db_xref="GeneID:8130930"
     CDS             33889..35301
                     /locus_tag="PC1_0030"
                     /EC_number="3.2.1.21"
                     /inference="protein motif:PRIAM:3.2.1.21"
                     /note="PFAM: glycoside hydrolase family 1;
                     KEGG: eca:ECA4407 putative glycosyl hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-glucosidase"
                     /protein_id="YP_003015629.1"
                     /db_xref="GI:253686439"
                     /db_xref="InterPro:IPR001360"
                     /db_xref="GeneID:8130930"
                     /translation="MHDHLQKDFRFPANFWWGSASSAPQTEGESLNYGKSATVWDEWF
                     ATQPGRFHQQVGPADTSTFYQHWREDIALLKTLNHNTFRTSISWARLIPDGVGEPNPQ
                     AVAFYNQVIDEMLAQGITPFINLFHFDMPMVMQRLGGWENRAVVVAYAGYAATCFRLF
                     GDRVKHWFTFNEPVVPVEGGYLYDFHYPNVVDFKRAATVAYHTMLAHSLAVKAYREQS
                     QGGEIGIILNLTPSYPRSQHPADVKAANIADLMFNRSFLDPALRGEYPQELVDLLQRY
                     GQLPSCQPDDRALLADGVVDLLGINYYQPRRIQCRDSLVNPDSPFMPEWFFSSYEMPG
                     RKMNPYRGWEIYEPGIYDILTNLRVNYGNPRCFISENGMGVENEQRFDANGQIQDDYR
                     IDFVREHLKYVHKGIAEGSNCLGYHMWTFIDNWSWSNAYKNRYGFVQLDLVTQKRTVK
                     KSGEWFATIAAENGFQDVTS"
     misc_feature    33910..35283
                     /locus_tag="PC1_0030"
                     /note="Glycosyl hydrolase family 1; Region: Glyco_hydro_1;
                     pfam00232"
                     /db_xref="CDD:249702"
     misc_feature    33916..35280
                     /locus_tag="PC1_0030"
                     /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta-
                     galactosidase [Carbohydrate transport and metabolism];
                     Region: BglB; COG2723"
                     /db_xref="CDD:225343"
     gene            complement(35464..35721)
                     /locus_tag="PC1_0031"
                     /db_xref="GeneID:8130931"
     CDS             complement(35464..35721)
                     /locus_tag="PC1_0031"
                     /inference="protein motif:PFAM:PF07338"
                     /note="PFAM: protein of unknown function DUF1471;
                     KEGG: eca:ECA4406 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015630.1"
                     /db_xref="GI:253686440"
                     /db_xref="InterPro:IPR010854"
                     /db_xref="GeneID:8130931"
                     /translation="MKNVKTIAAAVVLATMTFGASAAEYVAPSQTQNLEKVGVVTATA
                     QDLSSLQAQLAAKAEKAGAKAYTITSATGNDQLRGSAVIFN"
     misc_feature    complement(35470..35721)
                     /locus_tag="PC1_0031"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; cl11507"
                     /db_xref="CDD:264403"
     gene            35934..37238
                     /locus_tag="PC1_0032"
                     /db_xref="GeneID:8130932"
     CDS             35934..37238
                     /locus_tag="PC1_0032"
                     /inference="similar to AA sequence:KEGG:ECA4405"
                     /note="KEGG: eca:ECA4405 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015631.1"
                     /db_xref="GI:253686441"
                     /db_xref="GeneID:8130932"
                     /translation="MLNKWGDVLSVEVQLTFNAAGHQLTNINCWSCDGDWLVYDIRPY
                     GSSFTGLTIERVHLTSRETEVIYRATAGAHVGVVTCSPQEPLRYVFIHGPENPDGEWQ
                     YDFHHRRGTIVADCQRDEAITLDAFSITSPYQAGALRGGTHVHVFSPDASRLSFTYND
                     HVLHERDPALNLRNVGVAVPLQAVTVEKRHPREYDGSHYCVLVSQTTPQPQPGSDEIN
                     RAYEEGWVGTVGYIRQDGSRQRWALAFIGDTRAADGTTVPEIFIVDLPDALEDYAKEG
                     DAPLAGTATSMPAPPAGVQQRRLTFTHSRRYPGLVNQPRHWLRASPDGSEIAFLMRDE
                     AGVVQLWTISPNGGEPRQVTHTEHGVQSAFNWHPDGRSLAFVCDNSIMLCEAKSGELV
                     RLTARTDSAPSADAVVFSPDGKHIAYMREIDGFNQLFVVTSA"
     misc_feature    36150..36515
                     /locus_tag="PC1_0032"
                     /note="Protein of unknown function (DUF3748); Region:
                     DUF3748; pfam12566"
                     /db_xref="CDD:193082"
     gene            complement(37274..37666)
                     /locus_tag="PC1_0033"
                     /db_xref="GeneID:8130933"
     CDS             complement(37274..37666)
                     /locus_tag="PC1_0033"
                     /inference="protein motif:PFAM:PF07119"
                     /note="PFAM: protein of unknown function DUF1375;
                     KEGG: eca:ECA4404 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015632.1"
                     /db_xref="GI:253686442"
                     /db_xref="InterPro:IPR010780"
                     /db_xref="GeneID:8130933"
                     /translation="MTLLKSALFSFIITGSGAVATSGCSSVMTHTGSDQGYYSGMRAS
                     MDMLRDDDTSWAMMPLVVIDLPFSAVADTVLLPYDYYRSGSDKNKMSTRERISHSEEQ
                     NQTASSQLATMPHNDTMPHNNTMPHNQL"
     misc_feature    complement(37301..37657)
                     /locus_tag="PC1_0033"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11616"
                     /db_xref="CDD:183233"
     gene            38051..38464
                     /locus_tag="PC1_0034"
                     /db_xref="GeneID:8130934"
     CDS             38051..38464
                     /locus_tag="PC1_0034"
                     /inference="protein motif:PFAM:PF00011"
                     /note="PFAM: heat shock protein Hsp20;
                     KEGG: eca:ECA4403 heat shock protein IbpA"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp20"
                     /protein_id="YP_003015633.1"
                     /db_xref="GI:253686443"
                     /db_xref="InterPro:IPR002068"
                     /db_xref="GeneID:8130934"
                     /translation="MRNPDFSPLYRSAIGFDRLFNLLETGQTQSNGGYPPYNVELVDE
                     NQYRIAIAVAGFAEQELDITAHDNLLIVKGAHAGEQVARNYLYQGIAERNFERKFQLA
                     EHIQVKGANLENGLLYIDLERIVPEAMKPRRIEIK"
     misc_feature    38051..38461
                     /locus_tag="PC1_0034"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    38153..38419
                     /locus_tag="PC1_0034"
                     /note="Alpha-crystallin domain (ACD) found in Escherichia
                     coli inclusion body-associated proteins IbpA and IbpB, and
                     similar proteins.  IbpA and IbpB are 16 kDa small heat
                     shock proteins (sHsps). sHsps are molecular chaperones
                     that suppress protein aggregation...; Region:
                     ACD_IbpA-B_like; cd06470"
                     /db_xref="CDD:107227"
     misc_feature    order(38159..38173,38198..38200,38204..38206,38210..38215,
                     38339..38341,38393..38398)
                     /locus_tag="PC1_0034"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     gene            38620..39069
                     /locus_tag="PC1_0035"
                     /db_xref="GeneID:8130935"
     CDS             38620..39069
                     /locus_tag="PC1_0035"
                     /inference="protein motif:PFAM:PF00011"
                     /note="PFAM: heat shock protein Hsp20;
                     KEGG: eca:ECA4402 heat shock chaperone IbpB"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp20"
                     /protein_id="YP_003015634.1"
                     /db_xref="GI:253686444"
                     /db_xref="InterPro:IPR002068"
                     /db_xref="GeneID:8130935"
                     /translation="MRNYDLSPLLRQWIGFDKLASSMQGSQEPIDFPPYNIEKKDDNH
                     YRITLALAGFRQSDLDIEVEGPRLTVKGSPAPTEKAVEYLHQGLVFKPFTLSFTLAEH
                     LHVSDAHFENGLLHIDLVRDVPEALQPQRIAIGGGRPALNQQPAEDA"
     misc_feature    38620..39021
                     /locus_tag="PC1_0035"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    38716..38982
                     /locus_tag="PC1_0035"
                     /note="Alpha-crystallin domain (ACD) found in Escherichia
                     coli inclusion body-associated proteins IbpA and IbpB, and
                     similar proteins.  IbpA and IbpB are 16 kDa small heat
                     shock proteins (sHsps). sHsps are molecular chaperones
                     that suppress protein aggregation...; Region:
                     ACD_IbpA-B_like; cd06470"
                     /db_xref="CDD:107227"
     misc_feature    order(38722..38736,38761..38763,38767..38769,38773..38778,
                     38902..38904,38956..38961)
                     /locus_tag="PC1_0035"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     gene            39247..40905
                     /locus_tag="PC1_0036"
                     /db_xref="GeneID:8130936"
     CDS             39247..40905
                     /locus_tag="PC1_0036"
                     /inference="protein motif:TFAM:TIGR01625"
                     /note="TIGRFAM: YidE/YbjL duplication;
                     PFAM: YidE/YbjL duplication domain protein; TrkA-C domain
                     protein;
                     KEGG: eca:ECA4401 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015635.1"
                     /db_xref="GI:253686445"
                     /db_xref="InterPro:IPR006037"
                     /db_xref="InterPro:IPR006512"
                     /db_xref="GeneID:8130936"
                     /translation="MSDIALTVSMLALVAVLGLWIGNWRIYGVGLGIGGVLFGGIIVG
                     HVAHQYQIQLNDDMLHVIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNAFALLTVF
                     LGCVVTVLLHKLLNIPLPIILGIFSGAVTNTPSLGAGQQILTDLGSSAALVNQMGTGY
                     AMAYPLGICGILLVMWLMRVLFRVAVENEAKQFEVSNGQHHEQLHTMNVSVTNTNLQG
                     LAIQDVPILNRDTIVCSRLKRGDELMVPSPQTLIQLGDYLHLVGAKNDLEQARLVIGH
                     EVETSLSTRGTDLHVERVVVTNEKVLGRKIRELNLKQNYDVVISRLNRAGVELVASNQ
                     ASLQFGDILNLVGRKTAIDAVADIVGNAQQKLQQVQMLPVFIGIGLGVLLGSVPLMIP
                     GFPVALRLGLAGGPLVVALVLGRIGGIGKLHWFMPPSANLALRELGIVLFLSVVGLKS
                     GGDFIDTLLNGDGVWWIGYGALITIVPLLLVGILARTLGKMNYLTLCGMLAGSMTDPP
                     ALAFANGLHPTSGAAALSYATVYPLAMFLRIMSPQLLAVLFLTL"
     misc_feature    39247..40902
                     /locus_tag="PC1_0036"
                     /note="putative transporter; Validated; Region: PRK03818"
                     /db_xref="CDD:179654"
     misc_feature    39274..39786
                     /locus_tag="PC1_0036"
                     /note="Predicted Permease Membrane Region; Region:
                     Asp-Al_Ex; pfam06826"
                     /db_xref="CDD:253932"
     misc_feature    39898..40056
                     /locus_tag="PC1_0036"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     misc_feature    40117..40311
                     /locus_tag="PC1_0036"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     misc_feature    40378..40845
                     /locus_tag="PC1_0036"
                     /note="AspT/YidE/YbjL antiporter duplication domain;
                     Region: YidE_YbjL_dupl; TIGR01625"
                     /db_xref="CDD:130686"
     gene            41490..42902
                     /locus_tag="PC1_0037"
                     /db_xref="GeneID:8130937"
     CDS             41490..42902
                     /locus_tag="PC1_0037"
                     /inference="protein motif:TFAM:TIGR00785"
                     /note="TIGRFAM: anion transporter;
                     PFAM: sodium/sulphate symporter; Citrate transporter;
                     KEGG: eca:ECA4400 putative sodium:sulfate symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="anion transporter"
                     /protein_id="YP_003015636.1"
                     /db_xref="GI:253686446"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004680"
                     /db_xref="GeneID:8130937"
                     /translation="MSANNSRFIKLLIILCIAGGLWLLPVPDGVKPDAWHLMAIFIAT
                     VVGLILSPYPLGAMAMFSLTSVAILGLLSIKDVLAGFSDPTIWMIACAFFISRGFIKT
                     GFGRRIGLLFISKLGNSSLGLAYGLVFTDLLFAPAMPSTSARCGGIITPLFRSIAEAY
                     DSTPEKGTQRRIGAFLVQSIFQCNAVTSAMFMTSMAGNPMVAKLASQFGIHISWTDWA
                     LATLLPGFLSLALIPYLIYRFYPPELKKTSEMRAIAVERLREMGKMTRDEWVVLGVFL
                     GLVTFWVLGSTLNIDATLTALAGLSVLLLSRALSWDDVVGEKEAWHTVVWFAVLMTLA
                     GQLNKMGLIAWLGGLAGSAVSGMHWLPMLGLLLLVYYYSHYLMASAIAHISAMYAIFV
                     SIALAAGAPPMLTVLVFGIFSNLFMSTTHYSSGPAPILFGTGYMPLGTWWKIGFSISL
                     VIIPIWLGVGSMWWKVLGFW"
     misc_feature    41505..42899
                     /locus_tag="PC1_0037"
                     /note="Sodium:sulfate symporter transmembrane region;
                     Region: Na_sulph_symp; pfam00939"
                     /db_xref="CDD:250243"
     misc_feature    41562..42881
                     /locus_tag="PC1_0037"
                     /note="anion transporter; Region: dass; TIGR00785"
                     /db_xref="CDD:233126"
     misc_feature    order(41625..41633,41652..41693,41736..41789,41856..41879,
                     41886..41912,41916..41966,41991..41993,42006..42044,
                     42048..42080,42159..42203,42300..42338,42360..42404,
                     42441..42446,42450..42500,42588..42635,42699..42719,
                     42726..42764,42837..42875)
                     /locus_tag="PC1_0037"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     gene            43093..44721
                     /locus_tag="PC1_0038"
                     /db_xref="GeneID:8130938"
     CDS             43093..44721
                     /locus_tag="PC1_0038"
                     /inference="protein motif:TFAM:TIGR00229"
                     /note="KEGG: eca:ECA4399 sensory histidine kinase DcuS;
                     TIGRFAM: PAS sensor protein;
                     PFAM: ATP-binding region ATPase domain protein; PAS fold
                     domain protein; PAS fold-4 domain protein;
                     SMART: ATP-binding region ATPase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase regulating
                     citrate/malate metabolism"
                     /protein_id="YP_003015637.1"
                     /db_xref="GI:253686447"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:8130938"
                     /translation="MGKKKAPLKLGTSVFLMVSVVLGAVLLVVYSLLFFRINQLSEDH
                     LREKAFAIARTFAASPVVIDELKGIGRPEEVQIAAETIRQRNQLLFVTVTDMDAVRHS
                     HPEPERIGEHFAGRDIYPALLGMENTAINRGTLDPALRVFTPVFDSNHKQVGVVALGI
                     ALTSVQKVISDNRWMIPWTLLAGALVGWLGTLILVKVLKRIMLGFEPFEISNLFEQRN
                     AMLKHIKEGVIAVDQNGRITVINDEARRLFRQNKPQGSETPSSKPAERVSEQWLEHLH
                     LKQVLESGTPRRDEEINFNGHLLLTNTVPVFVKGDIIGAIATFRDKTEISQLLQRLSG
                     MSYYADALRAQSHEFMNKLHVILGMLHLKYYSQLEDYILKTANNYQAEIGSIIRKVKS
                     PVIAGFLLGKINRARDLGITLSISEESLLPDTDDVDATNELITVLGNLIENAMDAIDG
                     QENCEISVSFHHQNGRLHCTVGDDGPGISPESQARIYEQGFSTKGSGRGIGLFLTKQS
                     LEKIGGTIEFESEPEVYTQFFVTIPYQARLFDHD"
     misc_feature    43093..44715
                     /locus_tag="PC1_0038"
                     /note="sensory histidine kinase DcuS; Provisional; Region:
                     PRK11086"
                     /db_xref="CDD:236839"
     misc_feature    43243..43587
                     /locus_tag="PC1_0038"
                     /note="Sensory domain of two-component sensor kinase;
                     Region: Cache_3; pfam14827"
                     /db_xref="CDD:258964"
     misc_feature    43735..>43836
                     /locus_tag="PC1_0038"
                     /note="PAS domain; Region: PAS; smart00091"
                     /db_xref="CDD:214512"
     misc_feature    44080..44238
                     /locus_tag="PC1_0038"
                     /note="Sensor_kinase_SpoOB-type, alpha-helical domain;
                     Region: SPOB_a; pfam14689"
                     /db_xref="CDD:258827"
     misc_feature    44389..44688
                     /locus_tag="PC1_0038"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(44407..44409,44419..44421,44428..44430,44503..44505,
                     44509..44511,44515..44517,44521..44526,44587..44598,
                     44644..44646,44650..44652,44665..44670,44674..44676)
                     /locus_tag="PC1_0038"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    44419..44421
                     /locus_tag="PC1_0038"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(44515..44517,44521..44523,44587..44589,44593..44595)
                     /locus_tag="PC1_0038"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            44714..45436
                     /locus_tag="PC1_0039"
                     /db_xref="GeneID:8130939"
     CDS             44714..45436
                     /locus_tag="PC1_0039"
                     /inference="protein motif:PFAM:PF00072"
                     /note="PFAM: response regulator receiver;
                     SMART: response regulator receiver;
                     KEGG: eca:ECA4398 DNA-binding transcriptional activator
                     DcuR"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver and unknown
                     domain-containing protein"
                     /protein_id="YP_003015638.1"
                     /db_xref="GI:253686448"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:8130939"
                     /translation="MINVLIVDDDAMVAELNKSYLNQVSGFSCYATVPTLQQARNLLM
                     QPDSEIDLVLLDIYMQQDNGLDLLPTIREFSEKTDVIIISSASDVYTIKKALHYGVVD
                     YLIKPFQFSRFEQALTAYREEANLFKHRDFVGQSDIDNLIRRTSSSTVSERKKLPKGL
                     TSLTLRTVCEWIEGNQGIEFSTEMLANAIGISRVSCRKYLIYLSDTGILTTNILYGST
                     GRPVYLYRLLPEKQDSLRQYCE"
     misc_feature    44714..45433
                     /locus_tag="PC1_0039"
                     /note="DNA-binding transcriptional activator DcuR;
                     Provisional; Region: PRK10430"
                     /db_xref="CDD:182454"
     misc_feature    44726..45073
                     /locus_tag="PC1_0039"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(44735..44740,44879..44881,44903..44905,44963..44965,
                     45020..45022,45029..45034)
                     /locus_tag="PC1_0039"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    44879..44881
                     /locus_tag="PC1_0039"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(44888..44893,44897..44905)
                     /locus_tag="PC1_0039"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    45029..45037
                     /locus_tag="PC1_0039"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(45514..45918)
                     /locus_tag="PC1_0040"
                     /db_xref="GeneID:8130940"
     CDS             complement(45514..45918)
                     /locus_tag="PC1_0040"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: bte:BTH_I1429 metallo-beta-lactamase family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015639.1"
                     /db_xref="GI:253686449"
                     /db_xref="GeneID:8130940"
                     /translation="MKKALSVLLLSGLLATSATISAQEIDPHAVPLATASEFIATGKS
                     YNVDFGDQKFRLDFKSPAEMTFTSPDGKNKADVAITTTKVGDGVYMIYWSRRAGQHVV
                     HVDDFKNGVSYTNIVLPDGSISRRQGTLIEIK"
     misc_feature    complement(<45682..45855)
                     /locus_tag="PC1_0040"
                     /note="Planctomycetes uncharacterized domain TIGR03067;
                     Region: Planc_TIGR03067"
                     /db_xref="CDD:234100"
     gene            complement(45955..46509)
                     /locus_tag="PC1_0041"
                     /db_xref="GeneID:8130941"
     CDS             complement(45955..46509)
                     /locus_tag="PC1_0041"
                     /inference="protein motif:PFAM:PF00258"
                     /note="PFAM: flavodoxin/nitric oxide synthase;
                     KEGG: elf:LF82_p421 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin/nitric oxide synthase"
                     /protein_id="YP_003015640.1"
                     /db_xref="GI:253686450"
                     /db_xref="InterPro:IPR001226"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="GeneID:8130941"
                     /translation="MTNVAVVYFSGYGHTRRIAEDVAEGADAVLVAIDDDGHVDEQGW
                     ETLNAADAIIFGAPTYMGSVPWQFKKFADATSKAWFTRAWQDKIFGGFTNSASLNGDK
                     QVTLIYLQTLASQHGGIWVSLGLAPSNALATTRNDVNNLGGSVGLLVQSPSDAGAEAI
                     PSGDLDTARHYGKRVADIARRFKD"
     misc_feature    complement(45961..46509)
                     /locus_tag="PC1_0041"
                     /note="Multimeric flavodoxin WrbA [General function
                     prediction only]; Region: WrbA; COG0655"
                     /db_xref="CDD:223728"
     gene            46614..47012
                     /locus_tag="PC1_0042"
                     /db_xref="GeneID:8130942"
     CDS             46614..47012
                     /locus_tag="PC1_0042"
                     /inference="protein motif:PFAM:PF01638"
                     /note="PFAM: helix-turn-helix HxlR type;
                     KEGG: azo:azo3515 putative transcriptional regulatory
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="YP_003015641.1"
                     /db_xref="GI:253686451"
                     /db_xref="InterPro:IPR002577"
                     /db_xref="GeneID:8130942"
                     /translation="MTKNSATERKETEAGEQRYNVYLQGCPARMVLERLADKWALLIV
                     GLLRTGPLRFNQLRREIEGVSQKALSQTLKKLERDGLLSRKAFPTVPVTVEYALTPLG
                     KTLSEAVEPLARWAEKNIEDVLLAQSHYDQ"
     misc_feature    46707..46913
                     /locus_tag="PC1_0042"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(46707..46712,46716..46718,46725..46727,46734..46739,
                     46746..46751,46758..46760,46851..46853)
                     /locus_tag="PC1_0042"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(46710..46715,46725..46733,46770..46778,46806..46817,
                     46821..46826,46833..46838,46842..46847,46863..46868,
                     46878..46880,46893..46901)
                     /locus_tag="PC1_0042"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(46770..46772,46779..46781)
                     /locus_tag="PC1_0042"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            complement(47050..48393)
                     /locus_tag="PC1_0043"
                     /db_xref="GeneID:8130943"
     CDS             complement(47050..48393)
                     /locus_tag="PC1_0043"
                     /inference="protein motif:PFAM:PF03390"
                     /note="PFAM: Citrate carrier protein;
                     KEGG: eca:ECA4395 Na(+)-malate symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Citrate carrier protein"
                     /protein_id="YP_003015642.1"
                     /db_xref="GI:253686452"
                     /db_xref="InterPro:IPR004679"
                     /db_xref="GeneID:8130943"
                     /translation="MKKIETDILCENNLALETQESFIGSFFKKKVGSVPVALFMAIAA
                     IVAIAAYEGYLPKNMIGGFAVIMTMGFLLAHIGSNIPVFKDIGGPAILCLMVPSVMVY
                     FDLFNDNTMKTVHLLMKEANFLYFVIACLVVGSILGMNRKILIQGMVRMFVPLVIGTA
                     TALATGLLVGKLCGYSFYHTFFFIIVPIIGGGIGEGILPLSLAYSAILGQTPDVYVAQ
                     LAPAAVVGNIFAILCAGVLSRLGMRRKDLNGEGRLVRSDEDNAMFAVNEAPKPVDFHL
                     MGGGLLMICAFFIVGGLFEKLVHIPGPVLMILIAVFCKYGRVIPAIMETGAHSVYKFV
                     SSSLVWPLMIGLGMLYIPLESVVAVFSVGYVIVCGSVVLSMALVSFLIAPYLNMYPIE
                     ASIVTTCHSGLGGTGDVAILSASNRMSLMPFAQIATRIGGASTVIAATLLLGWFA"
     misc_feature    complement(47068..48306)
                     /locus_tag="PC1_0043"
                     /note="2-hydroxycarboxylate transporter family; Region:
                     2HCT; pfam03390"
                     /db_xref="CDD:251919"
     gene            49825..51432
                     /locus_tag="PC1_0044"
                     /db_xref="GeneID:8130944"
     CDS             49825..51432
                     /locus_tag="PC1_0044"
                     /inference="protein motif:PFAM:PF00496"
                     /note="PFAM: extracellular solute-binding protein family
                     5;
                     KEGG: eca:ECA4394 periplasmic dipeptide transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 5 extracellular solute-binding protein"
                     /protein_id="YP_003015643.1"
                     /db_xref="GI:253686453"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="GeneID:8130944"
                     /translation="MEKSLVKSRVLKFGLGLLAMSVAAGVQAKTLVYCSEGSPEGFNP
                     QLFTSGTTFDASSIPIYNRLVEFKDGTTDTSPGLAEKWDISEDGKTYTFHLRKGVKWQ
                     DSKDFKPSREFNADDVIFSFMRQQDANHPYHKVSGGSYEYYQGMGMPELVSKIEKVDD
                     YTVRFVLNRPEAPFLANLAMDFASILSAEYADQMLKAGTPEKIDLNPIGTGPFQLQQY
                     QKDSRILYKAFEGYWGSKPGVDRLVFSITPDASVRYAKLQKDECQIMPYPNPADLAKM
                     KEDKNITLMEQPGLNVGYLAYNVEKKPLDNVKIRQALNYAVNKTAIIEAVYQGAGQAA
                     TNLIPPTMWGYNNDVKDYSYDPEKAKALLKEAGMADGFSIDLWAMPVQRPYNPNARRM
                     AEMIQSDWAKVGVKAKIVTYEWGEYLKRAKDGEHQTVLMGWTGDNGDPDNFFATLFSC
                     DAAKNGSNYSKWCYKPFEDLIQPARAVSDHEKRIELYKQAQVVMHDQAPALIVAHSTV
                     YEPVRKNVKGYVVQPRGVHSFNNVTLD"
     misc_feature    49867..51420
                     /locus_tag="PC1_0044"
                     /note="antimicrobial peptide ABC transporter periplasmic
                     binding protein SapA; Provisional; Region: PRK15109"
                     /db_xref="CDD:185064"
     misc_feature    49912..51381
                     /locus_tag="PC1_0044"
                     /note="The substrate-binding component of an ABC-type
                     dipeptide import system contains the type 2 periplasmic
                     binding fold; Region: PBP2_DppA_like; cd08493"
                     /db_xref="CDD:173858"
     misc_feature    order(51064..51066,51076..51078,51115..51126,51130..51132)
                     /locus_tag="PC1_0044"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173858"
     gene            51666..52685
                     /locus_tag="PC1_0045"
                     /db_xref="GeneID:8130945"
     CDS             51666..52685
                     /locus_tag="PC1_0045"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: eca:ECA4393 dipeptide transporter permease DppB"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_003015644.1"
                     /db_xref="GI:253686454"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8130945"
                     /translation="MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGI
                     SAERHAQLLAEMGLDKPLWQQYIHYIGGVLQGDLGISLKSRIPVWEEFVPRFKATLEL
                     GICAMLFAIAVGIPVGVLAAVKRGSIFDHTSVGLALTGYSMPIFWWGMMLIMLVSVQL
                     NLTPVSGRISDTIFLDDSMPLTGFMLIDTLFWGEKGDFIDAVEHMILPAIVLGTIPLA
                     VIVRMTRSAMLEVLGEDYIRTARAKGLSRLRVIVVHALRNAMLPVVTVIGLQVGTMLA
                     GAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLLVDVLYGVVNPR
                     IRHKK"
     misc_feature    51666..52682
                     /locus_tag="PC1_0045"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    51951..52643
                     /locus_tag="PC1_0045"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(51999..52004,52011..52016,52029..52031,52062..52073,
                     52077..52106,52113..52118,52122..52124,52308..52313,
                     52317..52319,52323..52325,52332..52337,52341..52343,
                     52353..52358,52365..52367,52416..52418,52458..52463,
                     52470..52472,52491..52502,52509..52514,52539..52544,
                     52593..52598,52605..52610,52614..52619,52626..52631,
                     52638..52643)
                     /locus_tag="PC1_0045"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(52080..52124,52491..52508)
                     /locus_tag="PC1_0045"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(52122..52124,52293..52295,52509..52511,52533..52535,
                     52542..52544,52593..52595)
                     /locus_tag="PC1_0045"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(52368..52406,52422..52427,52437..52439)
                     /locus_tag="PC1_0045"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            52699..53601
                     /locus_tag="PC1_0046"
                     /db_xref="GeneID:8130946"
     CDS             52699..53601
                     /locus_tag="PC1_0046"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: eca:ECA4392 dipeptide transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_003015645.1"
                     /db_xref="GI:253686455"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8130946"
                     /translation="MTQVTEPVVNSAPKPMTPLQEFWHYFKRNKGAVVGMVYVVLMLV
                     IAIGANVLAPHAPAEQFRDALLRPPVWQEGGSWQFILGTDDVGRDVLSRLMYGARLSL
                     LVGCLVVALSLVLGVIFGLLAGYFGGVVDALIMRIVDIMLALPSLLLALVLVAVFGPS
                     IVNASLALTFVALPHYVRLTRAAVLVEVNRDYVTASRVAGAGSARQMFVNILPNCLAP
                     LIVQASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAI
                     LLTVLAFNLMGDGLRDALDPKLKQ"
     misc_feature    52699..53598
                     /locus_tag="PC1_0046"
                     /note="dipeptide transporter; Provisional; Region:
                     PRK10913"
                     /db_xref="CDD:182833"
     misc_feature    52741..52905
                     /locus_tag="PC1_0046"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    52990..53538
                     /locus_tag="PC1_0046"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(53038..53043,53050..53055,53068..53070,53098..53109,
                     53113..53127,53128..53130,53134..53136,53209..53214,
                     53218..53220,53224..53226,53233..53238,53242..53244,
                     53254..53259,53266..53268,53317..53319,53359..53364,
                     53371..53373,53392..53403,53410..53415,53455..53460,
                     53494..53499,53506..53511,53515..53520,53527..53532)
                     /locus_tag="PC1_0046"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(53116..53127,53128..53136,53392..53409)
                     /locus_tag="PC1_0046"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(53134..53136,53194..53196,53410..53412,53449..53451,
                     53458..53460,53494..53496)
                     /locus_tag="PC1_0046"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(53269..53307,53323..53328,53338..53340)
                     /locus_tag="PC1_0046"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            53615..54595
                     /locus_tag="PC1_0047"
                     /db_xref="GeneID:8130947"
     CDS             53615..54595
                     /locus_tag="PC1_0047"
                     /inference="protein motif:TFAM:TIGR01727"
                     /note="KEGG: eca:ECA4391 dipeptide transporter ATP-binding
                     subunit;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
                     subunit;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter ATPase"
                     /protein_id="YP_003015646.1"
                     /db_xref="GI:253686456"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010066"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8130947"
                     /translation="MALLNVDKLSVHFGDEDLPFRAVDRISYQVEEGQVVGIVGESGS
                     GKSVSSLAIMGLIDYPGKVMADKLEFNQRDLKKISEKERRNLVGSEVAMIFQDPMTSL
                     NPCYTVGYQIMEAIKVHQGGNRKTRRQRAIDLLTLVGIPDPASRLDVYPHQLSGGMSQ
                     RVMIAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQRENMALILITHDLALVA
                     EAAHHIIVMYAGQVVESGKAADIFSAPRHPYTQALLRALPEFAADKSRLASLPGVVPG
                     KYDRPNGCLLNPRCPYAQDRCRQEEPALRDIPGRQVKCHTPLDDAGRPTL"
     misc_feature    53615..54592
                     /locus_tag="PC1_0047"
                     /note="dipeptide transporter ATP-binding subunit;
                     Provisional; Region: dppD; PRK11022"
                     /db_xref="CDD:182906"
     misc_feature    53621..54322
                     /locus_tag="PC1_0047"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    53732..53755
                     /locus_tag="PC1_0047"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(53741..53746,53750..53758,53900..53902,54146..54151,
                     54248..54250)
                     /locus_tag="PC1_0047"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    53891..53902
                     /locus_tag="PC1_0047"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    54074..54103
                     /locus_tag="PC1_0047"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    54134..54151
                     /locus_tag="PC1_0047"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    54158..54169
                     /locus_tag="PC1_0047"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    54236..54256
                     /locus_tag="PC1_0047"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    54305..54559
                     /locus_tag="PC1_0047"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            54592..55602
                     /locus_tag="PC1_0048"
                     /db_xref="GeneID:8130948"
     CDS             54592..55602
                     /locus_tag="PC1_0048"
                     /inference="protein motif:TFAM:TIGR01727"
                     /note="KEGG: eca:ECA4390 dipeptide transporter ATP-binding
                     subunit;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
                     subunit;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter ATPase"
                     /protein_id="YP_003015647.1"
                     /db_xref="GI:253686457"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010066"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8130948"
                     /translation="MSELNATSQPYLLHAIDLKKHYPVKKGFFAPERMVKALDGVSFT
                     LERGKTLAVVGESGCGKSTLGRLLTMIETPSDGELYYQGQDLLKPDPEAQKLRRQKIQ
                     IVFQNPYGSLNPRKKVGQILEEPLLINTELSKAERREKALAMMAKVGLKTEHYDRYPH
                     MFSGGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQDLGLSYVFI
                     SHDLSVVEHIADEVMVMYLGRCVEKGSKDAIFNNPRHPYTQALLSATPRLNPDLRRER
                     IKLTGELPSPLNPPPGCAFNARCQRCFSTCTQFQPQLKTYGEQQVACFAVDQDEQGIA
                     VA"
     misc_feature    54613..55593
                     /locus_tag="PC1_0048"
                     /note="dipeptide transporter ATP-binding subunit;
                     Provisional; Region: dppF; PRK11308"
                     /db_xref="CDD:236898"
     misc_feature    54625..55323
                     /locus_tag="PC1_0048"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    54754..54777
                     /locus_tag="PC1_0048"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(54763..54768,54772..54780,54907..54909,55147..55152,
                     55249..55251)
                     /locus_tag="PC1_0048"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    54898..54909
                     /locus_tag="PC1_0048"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    55075..55104
                     /locus_tag="PC1_0048"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    55135..55152
                     /locus_tag="PC1_0048"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    55159..55170
                     /locus_tag="PC1_0048"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    55237..55257
                     /locus_tag="PC1_0048"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    55312..55566
                     /locus_tag="PC1_0048"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(55696..55977)
                     /locus_tag="PC1_0049"
                     /pseudo
                     /db_xref="GeneID:8130949"
     gene            complement(56142..56579)
                     /locus_tag="PC1_0050"
                     /db_xref="GeneID:8130950"
     CDS             complement(56142..56579)
                     /locus_tag="PC1_0050"
                     /inference="similar to AA sequence:KEGG:ECIAI1_0545"
                     /note="KEGG: ecr:ECIAI1_0545 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015648.1"
                     /db_xref="GI:253686458"
                     /db_xref="GeneID:8130950"
                     /translation="MNKLIELASKYGEIKRQEIKLSECLSAITNFGYLVSDGLISFLQ
                     EYNGLQGNHSAYKNNDAPSKYFYINPEKAILELYREQVESYEQITQCPLVPIGECDNG
                     YIILMYGDGVIYGVFDECVYKYGQDIESCFDTLINGKEVAEIS"
     misc_feature    complement(56160..56579)
                     /locus_tag="PC1_0050"
                     /note="SUKH-3 immunity protein; Region: SUKH-3; pfam14433"
                     /db_xref="CDD:258587"
     gene            complement(56584..60897)
                     /locus_tag="PC1_0051"
                     /db_xref="GeneID:8130951"
     CDS             complement(56584..60897)
                     /locus_tag="PC1_0051"
                     /inference="protein motif:TFAM:TIGR01643"
                     /note="TIGRFAM: YD repeat protein;
                     PFAM: PAAR repeat-containing protein; YD repeat-containing
                     protein;
                     KEGG: eca:ECA4278 rhs-family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="YD repeat-containing protein"
                     /protein_id="YP_003015649.1"
                     /db_xref="GI:253686459"
                     /db_xref="InterPro:IPR006530"
                     /db_xref="InterPro:IPR008727"
                     /db_xref="GeneID:8130951"
                     /translation="MLSDILNRVARVGAMHAGKGPTPPAERPQPGQGKAPTSPGKTIK
                     HKSFLGALAGAIAGAVVAAVVFAAAAAVAGAIAVAVVGTGGMGAALVVGAVKLAVGFG
                     AVSLLGGLISSVSSKVSAMVDSGSPPFGPVSSGSGTVFAEKQKISRAEVDTVACTKHN
                     SPQLIAQGSETVYVNGSPAARIDDKTVCGATIKEGASTVFFGSGQQTCLKISDEFSWW
                     EKALLIAVEFLVPPSRGMFKGLGKLFTRGPTAVLKGIRMGALRTAVGLRKAVRCASKG
                     FKNNKGLARIKEATRGFLKDPVYIPSGNVIEMRQDIELGQTLPLLFERTYRSSSTHTG
                     LLGRGWYDTWSETAQVSRDGLNTHVVITLAQGYDIDFTFHQDVQSVFCPLYPAFTLYR
                     RAKGFSLWDRDSLTWREFDVPQGDRLLLSSIHDPHDNRITLIRDPKGYLRKIRHSDDI
                     ELLLVWRGESLHQIQRIDTGQKTLLAEYRQDEQGRLIEADAAHAYHLFYDYDSENRLT
                     RWHDNDQTWARYEYDYQGRCVYTTCADGYLTAHFEYLDDRVVMTDGLGQRSEFGFNAL
                     SLMSWEKSPLGRITRYDYDDHGNLLREISPAGRVVEFRYLDDSGLVSAFTDGSGHTWA
                     YDYDEAQRLCGITDPLGRIWQWAFDETGNPEKLTGPDTREVRFTWNRHGLLTQVSDQA
                     GEVQARLRYDHRQRLLSASDALGRTQQLRYDQQDRVVQWQRPDGAQYRLGYRRASWKL
                     PEQLVRPDEKEEKRQYDKHNNLLSYVDGNGALWRQSYGPFDLLTSRTDAQERTWRYEY
                     DKESQQLVAVIAPDGSRWQWWLDADARVIRERDMAGTDTHYTYDEDGHCIAIRNGEGE
                     TRHFLYDGRGLLIKETAPDDTQYYRYDAAGRLTEVTSTTSHVQLEYDLRDRVVREWLN
                     GTLLTRQFDDTARTVTRTLVWENESDNALVSAFSYSAAGELQQVQLPDGAELTLAHDA
                     AGRESSRSGGAFVQHREYDVMGWLAREMSGQQQDGRLHATQTKEYLYDGAGNLAGVRH
                     NRETRGYRLDATGRVLSVLSGGAGRTVDTDEAYRYTRNGLPQETSRLTEWQAGRLTQH
                     DDTHYQYDKAGRLIRKQVVQPGYRPQVWHYRWDSRNQLRVVDTPTGERWFYRYDPFGR
                     RTGKRCEQTQDDIRYLWDGDQIAEVRHYRNGKQIARRHWVHNGWELLVQQRQNTDGRW
                     ETDFVTSSQNGEPQALYKPDGTLRWQAPKSTLWGQRPGSTEDSADPGLAFAGQYRDSE
                     SGLCYNRFRYYDPNGGCYVSPDPIGVLGGESNYAYVPNPNTWVDPFGLAGCSKELAQR
                     KAQELRDSATSNTQRSKLPRATSAVVDKATGKVYYGFSGRPLPSTIHPHLAERMPSPS
                     LERWPVQNCAEFKGVNQALLDGARLENLEVHTVKTISGEAFPMCSNCQTTIFGTIVTS
                     G"
     misc_feature    complement(60322..60510)
                     /locus_tag="PC1_0051"
                     /note="PAAR motif; Region: PAAR_motif; pfam05488"
                     /db_xref="CDD:253216"
     misc_feature    complement(56791..59187)
                     /locus_tag="PC1_0051"
                     /note="Rhs family protein [Cell envelope biogenesis, outer
                     membrane]; Region: RhsA; COG3209"
                     /db_xref="CDD:225750"
     misc_feature    complement(59032..59148)
                     /locus_tag="PC1_0051"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    complement(58957..59079)
                     /locus_tag="PC1_0051"
                     /note="YD repeat (two copies); Region: YD_repeat_2x;
                     TIGR01643"
                     /db_xref="CDD:213642"
     misc_feature    complement(58777..58893)
                     /locus_tag="PC1_0051"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    complement(58714..58827)
                     /locus_tag="PC1_0051"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    complement(58507..58632)
                     /locus_tag="PC1_0051"
                     /note="YD repeat (two copies); Region: YD_repeat_2x;
                     TIGR01643"
                     /db_xref="CDD:213642"
     misc_feature    complement(58441..58569)
                     /locus_tag="PC1_0051"
                     /note="YD repeat (two copies); Region: YD_repeat_2x;
                     TIGR01643"
                     /db_xref="CDD:213642"
     misc_feature    complement(58216..58314)
                     /locus_tag="PC1_0051"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    complement(56968..57189)
                     /locus_tag="PC1_0051"
                     /note="RHS repeat-associated core domain; Region:
                     Rhs_assc_core; TIGR03696"
                     /db_xref="CDD:234316"
     misc_feature    complement(56623..56913)
                     /locus_tag="PC1_0051"
                     /note="YwqJ-like deaminase; Region: YwqJ-deaminase;
                     pfam14431"
                     /db_xref="CDD:258585"
     gene            complement(60909..61316)
                     /locus_tag="PC1_0052"
                     /db_xref="GeneID:8130952"
     CDS             complement(60909..61316)
                     /locus_tag="PC1_0052"
                     /inference="protein motif:PFAM:PF08786"
                     /note="PFAM: Domain of unknown function DUF1795;
                     KEGG: eca:ECA4277 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015650.1"
                     /db_xref="GI:253686460"
                     /db_xref="InterPro:IPR014894"
                     /db_xref="GeneID:8130952"
                     /translation="MYQMNEGTLAIPADWRDESLHVFVLPGDAINLVVNRTPIDFGLT
                     AETVYQQTLAQFAAHLKGYEERGVWTLTLDGQPAHGLEYTWRSPEGPMHQVVVMQVRG
                     ELLLTFTVTVAGELSAEQKTAMLAVVETFKAAT"
     misc_feature    complement(60924..61316)
                     /locus_tag="PC1_0052"
                     /note="Domain of unknown function (DUF1795); Region:
                     DUF1795; cl02256"
                     /db_xref="CDD:261226"
     gene            complement(61325..63178)
                     /locus_tag="PC1_0053"
                     /db_xref="GeneID:8130953"
     CDS             complement(61325..63178)
                     /locus_tag="PC1_0053"
                     /inference="protein motif:TFAM:TIGR03361"
                     /note="TIGRFAM: type VI secretion system Vgr family
                     protein; Rhs element Vgr protein;
                     PFAM: Rhs element Vgr protein;
                     KEGG: eca:ECA2867 putative rhs accessory genetic element"
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system Vgr family protein"
                     /protein_id="YP_003015651.1"
                     /db_xref="GI:253686461"
                     /db_xref="InterPro:IPR006533"
                     /db_xref="InterPro:IPR017847"
                     /db_xref="GeneID:8130953"
                     /translation="MANSTGLQFTVKVGALPASTFAVVDFQLSEALNQPFALSLNLAS
                     PLPGIDFGAVLDQPCELLVWYEGELQRRVSGIVSAFAQGDTGFRRTRYQAEVRPTLWR
                     LGLRTNARIFQAQKPEAIIGALLEEAGITDYAFALRNEHAVREYCVQYRESDLAFIAR
                     LAAEEGLFFFHEFEEGKHRVVFADDAGALAKGPELFFNLATQGLSEGAYVRRFRYAEA
                     VSTAEVALKDYSFKTPAYGLLHQKISGELEHQRESYQHFDYPGRFKQDPSGKAFTGYR
                     LDALRAGAMTGSGESNAAELMPGSSFTLTEHPNLALNIGWQLVAITHSGQQPQALEEE
                     SGGEPTTYSNSFEVVKASTTWRADLPYKPMVDGPQIATVVGPAGEEIYCDQYGRVKLQ
                     FPWDRYGASDDQSSCWVRVSQGWAGGQYGLIAIPRIGHEVIVSFLEGDPDQPIVTGRT
                     FHATNPSPYPLPANKTRTTLRTTTHKGAGFNELRFEDQAGQEEVFIHAQKDMNTVVLN
                     NRSTSVNVDHNENIGRDQTVVVQQNQTVSVIADQVTEIQGEQTVVVKKNRSTVVEDNE
                     TLRVTNNIFIHAEDGSIQIGTGAGYISIKHSGDIEIVGNNLTLNGTRIDLN"
     misc_feature    complement(61619..63154)
                     /locus_tag="PC1_0053"
                     /note="type VI secretion system Vgr family protein;
                     Region: VI_Rhs_Vgr; TIGR03361"
                     /db_xref="CDD:234183"
     misc_feature    complement(62192..63094)
                     /locus_tag="PC1_0053"
                     /note="Phage late control gene D protein (GPD); Region:
                     Phage_GPD; pfam05954"
                     /db_xref="CDD:253474"
     misc_feature    complement(61802..62080)
                     /locus_tag="PC1_0053"
                     /note="Phage-related baseplate assembly protein; Region:
                     Phage_base_V; pfam04717"
                     /db_xref="CDD:252757"
     gene            complement(63269..63787)
                     /locus_tag="PC1_0054"
                     /db_xref="GeneID:8130954"
     CDS             complement(63269..63787)
                     /locus_tag="PC1_0054"
                     /inference="protein motif:TFAM:TIGR03344"
                     /note="TIGRFAM: type VI secretion system effector, Hcp1
                     family;
                     PFAM: protein of unknown function DUF796;
                     KEGG: eca:ECA2866 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Hcp1 family type VI secretion system effector"
                     /protein_id="YP_003015652.1"
                     /db_xref="GI:253686462"
                     /db_xref="InterPro:IPR008514"
                     /db_xref="InterPro:IPR017728"
                     /db_xref="GeneID:8130954"
                     /translation="MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEF
                     KHIVTVPTDPQSGQPSGQRVHKPFKFTVALNKAVPLMYNALASGEMLPTVTLKWYRTS
                     VEGKQEHFFSTVLTDSTIVDINCQMPHCQDPSKLDYTQLIEVSLAYRKIDWEHTVAGT
                     SGSDDWRAPIEA"
     misc_feature    complement(63281..63784)
                     /locus_tag="PC1_0054"
                     /note="type VI secretion system effector, Hcp1 family;
                     Region: VI_effect_Hcp1; TIGR03344"
                     /db_xref="CDD:213799"
     gene            complement(64344..65594)
                     /locus_tag="PC1_0055"
                     /db_xref="GeneID:8130955"
     CDS             complement(64344..65594)
                     /locus_tag="PC1_0055"
                     /inference="protein motif:PFAM:PF00155"
                     /note="PFAM: aminotransferase class I and II;
                     KEGG: eca:ECA4386 valine--pyruvate transaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="class I and II aminotransferase"
                     /protein_id="YP_003015653.1"
                     /db_xref="GI:253686463"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="GeneID:8130955"
                     /translation="MNFSLFGKKFTRHAGITQLMDDLNEGLRTPGAIMLGGGNPAHIP
                     EMDSYFQQLCQDMLEQGKLTEALCNYDGPQGKDTLLKALAELLSNELGWQIGPQNIAL
                     TNGSQSAFFYLFNLFAGRHSDGSLKKVLFPLAPEYIGYSDSGLDDNMFVSVRPQIELL
                     PEGQFKYHVDFDNLSITDDIGLVCVSRPTNPTGNVLTDDELMRLDILAQQHKVPLLID
                     NAYGVPFPGIIFTDATPLWNPNIILCMSLSKLGLPGSRCGIVIADEKVISAIGNMNGI
                     ISLSPGAVGPALAHEMIQRGDLLRLSNDVIRPFYQQRVMETIAIIRRYLSPEQCLIHK
                     PEGAIFLWLWFKDLPITTEILYQRLKKRGVLMVPGHYFFPGLDQGWPHAHQCMRMNYV
                     PEPEKIEQGIAILAEEVEKAMQEG"
     misc_feature    complement(64347..65594)
                     /locus_tag="PC1_0055"
                     /note="valine--pyruvate transaminase; Provisional; Region:
                     avtA; PRK09440"
                     /db_xref="CDD:236517"
     misc_feature    complement(64374..65498)
                     /locus_tag="PC1_0055"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(64827..64829,64848..64853,64857..64859,
                     64932..64934,65025..65027,65184..65186,65274..65282))
                     /locus_tag="PC1_0055"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(64731..64733,64740..64742,64827..64835,
                     64953..64955,65271..65273))
                     /locus_tag="PC1_0055"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(64848..64850)
                     /locus_tag="PC1_0055"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            65988..67196
                     /locus_tag="PC1_0056"
                     /db_xref="GeneID:8130956"
     CDS             65988..67196
                     /locus_tag="PC1_0056"
                     /inference="similar to AA sequence:KEGG:ECA4385"
                     /note="KEGG: eca:ECA4385 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015654.1"
                     /db_xref="GI:253686464"
                     /db_xref="GeneID:8130956"
                     /translation="MKKLLAIGITLALTSWQLSAQTFVLTDAESSVEKGNWQIGSDAL
                     KIKNQHFSIEQKVLHGGRQEGSKVITITSQDGLKIALSPTRGMNLLHVTGKNIRLGWD
                     SPVDEVVNPNTINLESRNGLGWLEGFNEMMVRCGFEWTGHPVVSEGMIYTLHGRAGNT
                     PASKVVVEVSDSAPHTITVRGLLKENSFKKSNLETWTELRYVPGSESFTVHDVLTNKA
                     DYARDYQIIYHSNFGTPILEDGARFIAPVKEISPFNDHAKAGLATWQTYKGPTKDFDE
                     MVFNITPYTDGQGKTLAALVNKAGDKGVSIAFDTHQLPLLTLWKNTDTEKQGYVTGIE
                     PGTNYAYPVTIEREQGRVKKLQPGQSTTFELTYSLLSSAEAVQKTEQKVKAIQGDNKT
                     TLTEKPIAIE"
     misc_feature    66228..67085
                     /locus_tag="PC1_0056"
                     /note="Aldose 1-epimerase, similar to Escherichia coli
                     c4013; Region: Aldose_epim_Ec_c4013; cd09023"
                     /db_xref="CDD:185700"
     misc_feature    order(66447..66449,66672..66674,66678..66680,66807..66809,
                     66951..66953,66987..66989)
                     /locus_tag="PC1_0056"
                     /note="active site"
                     /db_xref="CDD:185700"
     misc_feature    order(66672..66674,66987..66989)
                     /locus_tag="PC1_0056"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:185700"
     gene            67360..68271
                     /locus_tag="PC1_0057"
                     /db_xref="GeneID:8130957"
     CDS             67360..68271
                     /locus_tag="PC1_0057"
                     /inference="protein motif:PFAM:PF00892"
                     /note="PFAM: protein of unknown function DUF6
                     transmembrane;
                     KEGG: eca:ECA4384 amino acid metabolite efflux pump"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015655.1"
                     /db_xref="GI:253686465"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="GeneID:8130957"
                     /translation="MSVKDALLALCVVVLWGVNFVVIKVGLNDMPPFLLAGLRFSLVA
                     LPAIFFVPFPRIPLKWLIAYGMTISFGQFGFLFLAIKLGMPAGIASLVLQAQAFFTLL
                     VGAVLLSEKLRWNHVVGILVAAIGMVVLAEGRTALQMSSGMTTTTLLLTLAAALSWAV
                     GNIVNKVIMSKNSDVRIMSLVVWGALVPVVPFFISSWLFEGRDAIVHSLTTIQLPTIL
                     SLAYLAFAATIIGYGIWGSLLARYETWRVAPLSLLVPVVGLVSAAVFLGESLSLLQIM
                     GAVLIMAGLLVNVFGARLRSWLPVRQL"
     misc_feature    67360..68262
                     /locus_tag="PC1_0057"
                     /note="O-acetylserine/cysteine export protein;
                     Provisional; Region: PRK11453"
                     /db_xref="CDD:183142"
     misc_feature    67399..67749
                     /locus_tag="PC1_0057"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    <67993..68229
                     /locus_tag="PC1_0057"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(68345..69790)
                     /locus_tag="PC1_0058"
                     /db_xref="GeneID:8130958"
     CDS             complement(68345..69790)
                     /locus_tag="PC1_0058"
                     /inference="protein motif:PFAM:PF08125"
                     /note="PFAM: Mannitol dehydrogenase domain; Mannitol
                     dehydrogenase rossman domain;
                     KEGG: eca:ECA4383 altronate oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol dehydrogenase domain-containing
                     protein"
                     /protein_id="YP_003015656.1"
                     /db_xref="GI:253686466"
                     /db_xref="InterPro:IPR013118"
                     /db_xref="InterPro:IPR013131"
                     /db_xref="GeneID:8130958"
                     /translation="MKTLNRKDFPGACYPTKVIQFGEGNFLRAFVDWQLDVLNEKTDL
                     QAGVTIVRPINTDFPPSLNTQDGLYTTVIRGLNEQGEAVSDARLIRSVNNEINPYQHF
                     ADYLALAHNAAIRFVFSNTTEAGISYHAGDSVNDTPPVSFPAKLTRLLLERFTHFNGE
                     NDKGWVIIPCELIDYNGEALKALVLRYAQEWQLSPAFLDWIETANTFCSTLVDRIVTG
                     YPREESSAQEEELGYHDAFLDTAEHFYLFVIQGPGWLADELKLAECPLNIRIVDDIRP
                     YKERKVAILNGAHTALVPVAWLCGLDTVGEAMQDADVRRFVENTLHQEIIPVLDLPAN
                     ELREFADAVTGRFQNPYIRHQLLSIALNGMTKFRTRILPQLLAGQRDARFPARLTFAL
                     AALIVFYRGERAGETYPLQDDEQWLTRYRQLWPRVGTDLTVHELVNEVLADTAHWGED
                     LTQRSGLVEQVAADLGNILTQGMRQALKAQG"
     misc_feature    complement(68381..69790)
                     /locus_tag="PC1_0058"
                     /note="altronate oxidoreductase; Provisional; Region:
                     PRK03643"
                     /db_xref="CDD:235147"
     misc_feature    complement(69272..69742)
                     /locus_tag="PC1_0058"
                     /note="Mannitol dehydrogenase Rossmann domain; Region:
                     Mannitol_dh; pfam01232"
                     /db_xref="CDD:144722"
     misc_feature    complement(68420..69184)
                     /locus_tag="PC1_0058"
                     /note="Mannitol dehydrogenase C-terminal domain; Region:
                     Mannitol_dh_C; pfam08125"
                     /db_xref="CDD:149275"
     gene            complement(69804..70826)
                     /locus_tag="PC1_0059"
                     /db_xref="GeneID:8130959"
     CDS             complement(69804..70826)
                     /locus_tag="PC1_0059"
                     /inference="protein motif:PFAM:PF08240"
                     /note="PFAM: Alcohol dehydrogenase GroES domain protein;
                     Alcohol dehydrogenase zinc-binding domain protein;
                     KEGG: eca:ECA4382 putative zinc-binding dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase GroES domain-containing
                     protein"
                     /protein_id="YP_003015657.1"
                     /db_xref="GI:253686467"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="GeneID:8130959"
                     /translation="MSTMNTLICQEPKKLIWKKREIPIPGEGETLIKIKSVGICGTDI
                     HAWGGNQPFFSYPRVLGHEICGEVVDTGKNVHQFKKGQQVAVIPYVACQQCPACKSGR
                     TNCCEKISVIGVHQDGGFSEYLAVPATNVLLAEGIDPQAAALIEPYAISAHAVRRAKV
                     LQGEQVLVVGAGPIGLGAAAIAKADGAHVVVADTSAARREHVIAHLNLSVVDPSAEDF
                     EAQLRAEFGGSLAEKVIDATGNQHAMNNTINLIRHGGSIVFVGLFKGDLQFSDPDFHK
                     KETTMMGSRNATPEDFSKVGRLMSEGKLTAEMMLTHRYSFSTLADIYEKDVINNRELI
                     KGVITF"
     misc_feature    complement(69807..70817)
                     /locus_tag="PC1_0059"
                     /note="Threonine dehydrogenase and related Zn-dependent
                     dehydrogenases [Amino acid transport and metabolism /
                     General function prediction only]; Region: Tdh; COG1063"
                     /db_xref="CDD:223991"
     misc_feature    complement(69807..70817)
                     /locus_tag="PC1_0059"
                     /note="Alcohol dehydrogenases of the MDR family; Region:
                     Zn_ADH7; cd08261"
                     /db_xref="CDD:176222"
     misc_feature    complement(order(69969..69977,70044..70049,70107..70109,
                     70113..70118,70188..70190,70233..70235,70245..70250,
                     70302..70319,70377..70379,70389..70391,70692..70694,
                     70701..70709))
                     /locus_tag="PC1_0059"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176222"
     misc_feature    complement(order(70389..70391,70638..70643,70707..70709))
                     /locus_tag="PC1_0059"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176222"
     misc_feature    complement(order(70509..70511,70533..70535,70542..70544,
                     70551..70553))
                     /locus_tag="PC1_0059"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176222"
     gene            70969..71883
                     /locus_tag="PC1_0060"
                     /db_xref="GeneID:8130960"
     CDS             70969..71883
                     /locus_tag="PC1_0060"
                     /inference="protein motif:PFAM:PF07729"
                     /note="PFAM: GntR domain protein;
                     KEGG: eca:ECA4381 putative DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_003015658.1"
                     /db_xref="GI:253686468"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="GeneID:8130960"
                     /translation="MSRSQNLRHNVINQIIDDMARGHIPSPLPSQNALAEMYNISRTT
                     VRHILVHLCDCGVLIQVGSDYVIARKPDHDDGFTCITAPMAEQNRIFEQAFFTMINQR
                     LLRVGETFSELQLARDAGVSPVVVREYLLKFGRYNLIQNEKRGQWSMKEFDQAYAEQL
                     FELREMLETHALQHFLNLPDDDPRWLEAKTLLERHRMLRDSIGNSFRMFSQLDRSFHA
                     LLLSAAENVFFDQSLEIISVIFHFHYQWDESDLKQRNIIAIDEHMTILSALICRSDLD
                     ATLALRNHLNSAKQSMIRSINQTVRADY"
     misc_feature    70987..>71124
                     /locus_tag="PC1_0060"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    order(70990..70992,71053..71055,71059..71064,71086..71100,
                     71104..71109,71116..71118)
                     /locus_tag="PC1_0060"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    71209..71877
                     /locus_tag="PC1_0060"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    71443..71829
                     /locus_tag="PC1_0060"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            72097..73446
                     /locus_tag="PC1_0061"
                     /db_xref="GeneID:8130961"
     CDS             72097..73446
                     /locus_tag="PC1_0061"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: eca:ECA4380 sugar transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_003015659.1"
                     /db_xref="GI:253686469"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:8130961"
                     /translation="MEKNNITLDPRSSFDTRSSAPPEGIIQRSSRIKRIQTTAMILLF
                     FAAVINYLDRSSLSVANLTIRQELGLSATEIGALLSVFSLAYGIAQLPCGPLLDRKGP
                     RIMLGLGMFFWSLFQALSGMVHSFTQFVLVRIGMGIGEAPMNPCGVKVINDWFNIKER
                     GRPMGFFNAASTIGVAISPPILAAMMLVMGWRGMFITIGLFGILLAIGWYMLYRNREQ
                     IELTADEQAYLNAGSVNARRDPLSFIEWRSLFRNRTMWGMMLGFSGINYTAWLYLAWL
                     PGYLQTAYNLDLKSTGLMAAIPFLFGAAGMLVNGYVTDWLVKRGMEPIKSRKICIIAG
                     MLCSAAFTFVVPQATTSIEAVLLISMALFCIHFAGTSCWGLIHVAVASRMTASVGSIQ
                     NFASFICASFAPIVTGFIVDTTHSFRLALIICGCVTVLGALAYVFLVRQPISDPRKD"
     misc_feature    72214..73413
                     /locus_tag="PC1_0061"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    72232..73413
                     /locus_tag="PC1_0061"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    order(72256..72258,72265..72273,72277..72282,72331..72333,
                     72340..72345,72352..72354,72364..72369,72373..72378,
                     72514..72519,72526..72531,72538..72543,72550..72552,
                     72586..72591,72598..72603,72619..72621,72892..72894,
                     72901..72906,72913..72918,72925..72927,72967..72969,
                     72979..72981,72991..72993,73000..73002,73012..73014,
                     73180..73182,73189..73194,73201..73203,73213..73218,
                     73225..73227,73258..73263,73270..73275,73282..73287,
                     73294..73296)
                     /locus_tag="PC1_0061"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            73711..75489
                     /locus_tag="PC1_0062"
                     /db_xref="GeneID:8130962"
     CDS             73711..75489
                     /locus_tag="PC1_0062"
                     /EC_number="2.3.2.2"
                     /inference="protein motif:TFAM:TIGR00066"
                     /note="KEGG: eca:ECA4379 gamma-glutamyltranspeptidase;
                     TIGRFAM: gamma-glutamyltransferase;
                     PFAM: gamma-glutamyltranspeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase"
                     /protein_id="YP_003015660.1"
                     /db_xref="GI:253686470"
                     /db_xref="InterPro:IPR000101"
                     /db_xref="GeneID:8130962"
                     /translation="MKTKNTTSGKWLLSLSVAALLVSGAVQAASAPAVEAKNGMVVSS
                     QYLASQIGVDIMKMGGNAIDAAVAVGYAQAVVNPCCGNIGGGGFMTLHLADGKDTFIN
                     FRETAPAAASANMYLNADGSVKKDASLYGYLAAGVPGTVLGLDTALQKYGKLTREQVM
                     APAIKLAREGFELTRADTDILDTTVKRFKADPEAARIFLRPDGSPLQPGDKLVQTDLA
                     NTLAAIAAKGPDAFYKGEIPQAVEKAAKQGGGILTAADFADYRITETAPVTCNYRGYQ
                     FVSSPPPSSGGVTMCEILNIVEGYDMKSTGFNSAATVHVLTEAMRHAYMDRNTYLGDP
                     AFVSNPVERLLSKDYAAEIRKQIEPENATPSKNVQPGVGPHERPETTHYSIVDNQGNA
                     VSTTYTVNGRFGSVVIAPGTGFFLNNEMDDFTVKVGEKNLYGLVQGERNSIAPGKRPL
                     SSMSPSLVTKDGKVFMVLGSPGGSRIITITLQTALNIIDHGMAPQEAVDAPRIHHQWL
                     PDEVYYEQRGLSADTLNLLKQRGYKMVEQTPWGAAELILVGLPGAAGVTPADSGNDSA
                     VSGKVREGYLYGANDIRRPAGAAIGY"
     misc_feature    73792..75486
                     /locus_tag="PC1_0062"
                     /note="Gamma-glutamyltransferase [Amino acid transport and
                     metabolism]; Region: Ggt; COG0405"
                     /db_xref="CDD:223482"
     gene            complement(75526..75849)
                     /locus_tag="PC1_0063"
                     /db_xref="GeneID:8130963"
     CDS             complement(75526..75849)
                     /locus_tag="PC1_0063"
                     /inference="similar to AA sequence:KEGG:PMI1126"
                     /note="KEGG: pmr:PMI1126 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015661.1"
                     /db_xref="GI:253686471"
                     /db_xref="GeneID:8130963"
                     /translation="MNKNEIYVKMLILAIPYIRNVQSHKGRTDRSCYHEAELVHNLAY
                     TILTPGFEDHDIYFLNNQARYYIENCSDEIALNYNEHKRLITELIKAVPCDLKDKLTW
                     AGPTQ"
     gene            complement(75934..76398)
                     /locus_tag="PC1_0064"
                     /db_xref="GeneID:8130964"
     CDS             complement(75934..76398)
                     /locus_tag="PC1_0064"
                     /inference="similar to AA sequence:KEGG:plu3572"
                     /note="KEGG: plu:plu3572 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015662.1"
                     /db_xref="GI:253686472"
                     /db_xref="GeneID:8130964"
                     /translation="MNTVNSRITPPNPNYETCLECRAKLLIYPGEMHPDEVSAILNIE
                     PTQKNIIGDRKTNSLGRTREVKISGWFLSSEDFISSKDLRDHIDWIIAKLDPCQEGLK
                     KLQNIPGVKMTLSCVWWSAVGHCGPVLWPEQMKALADLDLECAFDIYFFPEE"
     misc_feature    complement(75961..76320)
                     /locus_tag="PC1_0064"
                     /note="Domain of unknown function (DUF4279); Region:
                     DUF4279; pfam14106"
                     /db_xref="CDD:258325"
     gene            complement(76395..81566)
                     /locus_tag="PC1_0065"
                     /db_xref="GeneID:8130965"
     CDS             complement(76395..81566)
                     /locus_tag="PC1_0065"
                     /inference="protein motif:TFAM:TIGR01901"
                     /note="TIGRFAM: filamentous haemagglutinin family outer
                     membrane protein; adhesin HecA family;
                     PFAM: protein of unknown function DUF637 hemagglutinin
                     putative; filamentous haemagglutinin domain protein;
                     Haemagluttinin repeat-containing protein;
                     KEGG: plu:plu3064 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="filamentous hemagglutinin family outer membrane
                     protein"
                     /protein_id="YP_003015663.1"
                     /db_xref="GI:253686473"
                     /db_xref="InterPro:IPR006915"
                     /db_xref="InterPro:IPR008619"
                     /db_xref="InterPro:IPR008638"
                     /db_xref="InterPro:IPR010069"
                     /db_xref="GeneID:8130965"
                     /translation="MEKFNNRATRGLSYLLIYLTAIQPLHPAFAALTPDGPRTQVNNA
                     GAVPVINIATPNAAGVSHNTYKDFSVGTPGAVLNNSIAAGQSQLAGQLNANANLNGKA
                     AELIINEVTGSTRSDLQGKIEVFGHKANVLIANPNGITCDGCGFINTPSATLTTGKPV
                     LDQQGALEALEVKKGSITIGGKGLDGSATDYVDILSRATELNGKINAKNLTLTQGSNR
                     VDVKTGTVAPIAGEGAKPLLAVDTKALGGMYAERIRLVATEDGVGANVANLTSSQQGI
                     TLDSKGKIQLGNVHAKTDLNLTAQQVDIAAGNTVKSDRDITLASTVLNNRGNIIAGED
                     MRLFNDSLTNTQATIQANNNLWIQKDATGNKGVKVENRSGTIKTNTGDLVIRTEQLDN
                     VVEQFSVNKISTPANSTSIDGQFGIMIDGTGPDSFVTIYTGVVDDRNLRWIGSFKFTE
                     SPYANTEKNKYTFISSREGNISSGKNIYINSSELNNKYSTISALGDIISTGKNANILN
                     HSIGDSNSYVKLALKFDERDIGIDISPIPAGFNVDEYPLWGDAPVPLVRDGNKKTWFE
                     KEYVSSKIHAGGSLVLDFTDTIKIEDNAPENLTELSEKIYSTPHSYSITGKEIIFKSK
                     DIKNQSSVKSTGNLSLLSEGNIKLTGGELNSAGDLSILASNGIDANQNKFLGRNITII
                     SREGDTSLYTDSAAKHFSVDGVRQFSTLNATENLSIQSGKDILLNGIEIGKAKNISLI
                     SGNNITVKNDEAILDPQKIGSTFTDPEKQKKFDYAFNHLGNITSTDSITLNARNVLDI
                     AGISLEATKDINLTAGDNINLNPREVNTIPEALFANSRQTELSSTINAGNQLLISSGK
                     DLLAQSASLSANGNVALLAGNSLKLLATAYSAIDSQNDNNKDDRNVTAKVHAGKNLTV
                     ASNGELIATGTDFSSGGDMTLSSGGKMEFNAVANHIYREGSNEYSESVTQKNVVLNSS
                     GILTLLSNGSILFQATQLLAKGTLDAAAKGGFLYAQAVEESNHYEKTTTKRKWYGKKT
                     TIRQTSHNVTNKVTEFTAGGDINLLSRDDSTYEASKINAGKNAKLTSTQGSINFKAVK
                     DTAFEQTITTSKGFFIKSNDKGYTKDTWLLPSIYSGGQLTIDAATGITADAKTQNAQS
                     LQNALLTLGNNPGTAWLKDLNARPDVQWNAVQDAYSTWNHTTQSLNPVVGAVIAIAVA
                     AVTAGTGLAAAAGQLAAGAVGTGASATTIAVVNGAAYSGMTALTSQAAVALVDNKGNL
                     SKTFQAMSSSDSVKSLVTSMVIGGALAGFDEVMQFSQAANGTTVIDPAKAKLPMLSNG
                     DWSKVAQRVAGQSVISSSIGTAINGGSFKDNFTTALLSNIGSQINAEGAKFIGDKGEV
                     LGITGKTISHAVVAGVAAEISGGNVKGAAAGALAAELAAISLGNTFVDPALREIQITS
                     TGRIIGALAGAAITGKATGVNSGASAAESVLLYNFLMHDEPKTLAEKYAACKGSSDCE
                     SNVRKEMNQTSVKNQEIFEGCRAAGNATCVNDMLYGISEASGYDELGRLIGFDLSNSY
                     KEMGQNAYDRANICGGDMSYGCGLKLWADQLPEELLGGILSWGIGKAVSPLIGKYFTE
                     TGILSAKETANRLVNGKWVDANGLPLPVPPSVGAAGRVPVVLQTGGHTITARTANGLN
                     KEFNKNLTSREWGRALESLKDDYSLRHDFHGRILDNGNYIDKAGKIIGNIEDYLP"
     misc_feature    complement(81075..81452)
                     /locus_tag="PC1_0065"
                     /note="haemagglutination activity domain; Region:
                     Haemagg_act; pfam05860"
                     /db_xref="CDD:253427"
     misc_feature    complement(78582..79067)
                     /locus_tag="PC1_0065"
                     /note="Haemagluttinin repeat; Region: Fil_haemagg_2;
                     pfam13332"
                     /db_xref="CDD:257662"
     misc_feature    complement(77355..77852)
                     /locus_tag="PC1_0065"
                     /note="Possible hemagglutinin (DUF637); Region: DUF637;
                     pfam04830"
                     /db_xref="CDD:252824"
     gene            complement(81606..83288)
                     /locus_tag="PC1_0066"
                     /db_xref="GeneID:8130966"
     CDS             complement(81606..83288)
                     /locus_tag="PC1_0066"
                     /inference="protein motif:PFAM:PF08479"
                     /note="PFAM: Polypeptide-transport-associated domain
                     protein ShlB-type; Hemolysin activator HlyB domain
                     protein;
                     KEGG: plu:plu3569 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polypeptide-transport-associated
                     domain-containing protein ShlB-type"
                     /protein_id="YP_003015664.1"
                     /db_xref="GI:253686474"
                     /db_xref="InterPro:IPR005565"
                     /db_xref="InterPro:IPR013686"
                     /db_xref="GeneID:8130966"
                     /translation="MCKTLSFISLIFLILCSSTFAATPISPTDRDALELQQKSLLEQA
                     KQQRLSLENSTTLTIPTVTASTAKDAVCFPIQRITFHDADALSIKDRTAIQQRYQNRC
                     LDLATVHNAVRETTNAYLNRGFVTSQAYLQEQDLSSGTLIISISEGKIEAIRMEGETP
                     LAIKMAFPGLEGRILNLRDIEQGMEQLNRLPSRQVAIDIQPGKQAGSSIVYLKRITKA
                     HPATLSLSADNSGQKNTGREQLSTHLTLDNPLRLADRWWLTASRDSAFSHSYGSKALS
                     GGMSLPYGYWTLGYQYAWNDFFQPIPIGSSAYRYEGQSNTHRLSLNRTLYRDGKQKLA
                     LDSALSRRRTENRMAGERLEISSPTVSSASIGLSYSTTLAGGYFTLNPMLSHGLRSWG
                     ATDDTKENRDLPRSEFRKFSASSSYFYPLTPSLYFLTSLYGQTTPDNLYTSERVSLGG
                     EYSVRGFKEQTLTGNRGFYWRNELNWQFTTLPFLGDIALTTAVDSGWIAGKTGKVDGG
                     NMTGTSVGLSASSRWVSQSVSLGVPLHFPDDLHPDNAVVYWQVTLPVTALFD"
     misc_feature    complement(81630..83288)
                     /locus_tag="PC1_0066"
                     /note="Hemolysin activation/secretion protein
                     [Intracellular trafficking and secretion]; Region: FhaC;
                     COG2831"
                     /db_xref="CDD:225387"
     misc_feature    complement(82845..83072)
                     /locus_tag="PC1_0066"
                     /note="POTRA domain, ShlB-type; Region: POTRA_2;
                     pfam08479"
                     /db_xref="CDD:117056"
     misc_feature    complement(81672..82484)
                     /locus_tag="PC1_0066"
                     /note="Surface antigen; Region: Bac_surface_Ag; pfam01103"
                     /db_xref="CDD:250364"
     gene            complement(83546..84889)
                     /locus_tag="PC1_0067"
                     /db_xref="GeneID:8130967"
     CDS             complement(83546..84889)
                     /locus_tag="PC1_0067"
                     /inference="protein motif:PFAM:PF00202"
                     /note="PFAM: aminotransferase class-III;
                     KEGG: eca:ECA4378 putative aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="class III aminotransferase"
                     /protein_id="YP_003015665.1"
                     /db_xref="GI:253686475"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="GeneID:8130967"
                     /translation="MATRSTIMDTNSFRAEHADALSADIRTLTDKRSRVLGESYRLFY
                     RKPVHLVRGEGQYLWDADGKKYLDVYNNVASIGHCHPAVIEAVHQQMTMLNTHTRYLH
                     ERILDYSEQLLATAPAAINRAMYMCTGSEANDLAIRVARAWSGGTGVIVTREAYHGTS
                     DLTSGASPALGSGQPLAATTRLVPPPDAYRVNTPDLGVWFANEIQKQIDDMAAHGIKF
                     AAFLADSIFSSDGVHPNPRGFLRPVVDVVHRNGGIFIADEVQPGFARTGDAFWGFARH
                     DVVPDIITTGKPMGNGIPVSGLLAKSDVLAAFSDQIPYFNTFGGNPVAMAAAQAVLKV
                     IHDEQLQEHSRVVGAQLLAELTTLQDKYASVGNVRGAGLFIGFELVSDRDSKTPDKTL
                     ALNLTEALRDRGVLTSVAGPYGNVLKLRPPLAFQTQDIDWLVGALDDCLGALTHA"
     misc_feature    complement(83555..84775)
                     /locus_tag="PC1_0067"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    complement(83567..84757)
                     /locus_tag="PC1_0067"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(84029..84031,84110..84115,84119..84121,
                     84218..84220,84413..84415,84419..84424,84500..84508))
                     /locus_tag="PC1_0067"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(84029..84031,84110..84112,84119..84121,
                     84218..84220,84419..84424,84500..84505))
                     /locus_tag="PC1_0067"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    complement(84029..84031)
                     /locus_tag="PC1_0067"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            complement(84922..86283)
                     /locus_tag="PC1_0068"
                     /db_xref="GeneID:8130968"
     CDS             complement(84922..86283)
                     /locus_tag="PC1_0068"
                     /inference="protein motif:TFAM:TIGR00908"
                     /note="TIGRFAM: ethanolamine transproter;
                     PFAM: amino acid permease-associated region;
                     KEGG: eca:ECA4377 putative ethanolamin permease"
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine transporter"
                     /protein_id="YP_003015666.1"
                     /db_xref="GI:253686476"
                     /db_xref="InterPro:IPR004757"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="GeneID:8130968"
                     /translation="MTSKLKPTLGTLHLWGIAVGLVISGEYFGWSYGWGVAGTLGFLV
                     TTLFIAAMYTCFIFSFTELTTAIPHAGGPFAYSRLAFGDLGGLIAGMATLIEFVFAPP
                     AISMAIGAYLNVQYPELNPKFAAVGAYLIFMSLNILGVKLAAMFELVVTLLAVMELLV
                     FMGVVAPGFSLSNFVAHGWAGQHEFSPAAISGMFAAIPFAIWFFLAIEGAAMAAEEAK
                     DPKRTIPRAYVSGILTLVVLAIGVMLMAGGVGDWRQLSDLNDPLPQAMKLIVGENSNW
                     MHMLVWIGLFGLIASFHGIILGYSRQFFALARAGYLPPGLAKLSRFHTPHRAILAGGA
                     IGIAAIFCDGINLQGMNLTAAMITMAVFGAIVMYIMSMLSLFRLRRSAPNMARSYRAP
                     GYPIVPAFALVCAIICLIAMLWFNPVIGGLFCTFMLLGYLYFLTTKARREHLLEPLVA
                     DAN"
     misc_feature    complement(84958..86283)
                     /locus_tag="PC1_0068"
                     /note="ethanolamine permease; Region: 2A0305; TIGR00908"
                     /db_xref="CDD:129986"
     gene            86542..87549
                     /locus_tag="PC1_0069"
                     /db_xref="GeneID:8130969"
     CDS             86542..87549
                     /locus_tag="PC1_0069"
                     /inference="protein motif:PFAM:PF01636"
                     /note="PFAM: aminoglycoside phosphotransferase;
                     KEGG: eca:ECA4376 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="YP_003015667.1"
                     /db_xref="GI:253686477"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="GeneID:8130969"
                     /translation="MSAKQYDTLSNAEITALAHRALACYPAAVQGEVRLLCRSENATF
                     LVSSAGKRYALRLHRSHYHQKAEIESELLWLDALRETGIAVPEAVRNVDGERVQSLGL
                     SDGSCRYAVLFHWIDGEMPTTSIDPRAFQQLGEITARLHQHSRQWQKPDGFQRIVWDH
                     HTMVSAQSHWGNWRDAPNLSRGEHGIVEEAIGRMAAEMAEFGKAPHRYGLIHADLRLT
                     NLLLHRGETRVIDFDDCGMGWYLHDLAAAISFVEHHPRASEWVENWLCGYERVAHVSD
                     EELALLPTLLIQRRIQLTAWVGSHAETEMAQSLGPDWAKHSVRLCRRYLETSDLPIGV
                     A"
     misc_feature    86542..87471
                     /locus_tag="PC1_0069"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cl17270"
                     /db_xref="CDD:266599"
     misc_feature    order(86656..86658,86668..86670,86701..86703,86707..86709,
                     86797..86799,86878..86889,87181..87183,87193..87198,
                     87202..87204,87229..87234)
                     /locus_tag="PC1_0069"
                     /note="active site"
                     /db_xref="CDD:240159"
     misc_feature    order(86656..86658,87181..87183)
                     /locus_tag="PC1_0069"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240159"
     misc_feature    86659..87375
                     /locus_tag="PC1_0069"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    order(86668..86670,86701..86703,86707..86709,86797..86799,
                     86878..86889,87181..87183,87193..87198,87202..87204,
                     87229..87234)
                     /locus_tag="PC1_0069"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240159"
     gene            87722..88780
                     /locus_tag="PC1_0070"
                     /db_xref="GeneID:8130970"
     CDS             87722..88780
                     /locus_tag="PC1_0070"
                     /inference="protein motif:PFAM:PF00165"
                     /note="PFAM: helix-turn-helix- domain containing protein
                     AraC type;
                     SMART: helix-turn-helix- domain containing protein AraC
                     type;
                     KEGG: eca:ECA4375 AraC family transcription regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_003015668.1"
                     /db_xref="GI:253686478"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="GeneID:8130970"
                     /translation="MENMTYSSALNAAFSRNCGVLAAAATGLGDFIHDSGGDADRIFG
                     ISGVDPEQLASPTLSLGLVNYCRVMEEAARNSGVDNFGLRYGKQFKPQSLGLIGYIGL
                     CSDTLEQALHNVVKAFPCHQHDTLTRMVDKGDCWRLDYQVRHGAILHRRQDAELTLGM
                     FLNLIRHVLGKHWAPREVHFEHPRPEMWHEHCKVFDAPVYFDQPYNSLLIPKHQLVRT
                     MPDRDMTLLLVMQDAIRRLNETSPQQSIVEQVRTQVHLLLMQKEPTLEEVAEKVGLSS
                     WSLQRRLREEGLSFSLLVDKLRCEMATHYLQQKQLPISEMALLLGYSEVSAFSRAFRR
                     WFGISPRQWRKGEALNLS"
     misc_feature    87827..88378
                     /locus_tag="PC1_0070"
                     /note="Arabinose-binding domain of AraC transcription
                     regulator, N-term; Region: Arabinose_bd; pfam12625"
                     /db_xref="CDD:257172"
     misc_feature    88397..88756
                     /locus_tag="PC1_0070"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    88643..88756
                     /locus_tag="PC1_0070"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            89012..90043
                     /locus_tag="PC1_0071"
                     /db_xref="GeneID:8130971"
     CDS             89012..90043
                     /locus_tag="PC1_0071"
                     /inference="similar to AA sequence:KEGG:KPK_2618"
                     /note="KEGG: kpe:KPK_2618 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015669.1"
                     /db_xref="GI:253686479"
                     /db_xref="GeneID:8130971"
                     /translation="MFNINEVKSSFTDDKYGFTASLLSYINDLNKIPSKKLAASIDDL
                     LFEAYEKSSVEAQRVVQNALFMIYQTNLSNPLSNPAKVQHDETLCLLRKKIEEKWLGD
                     EFKNIKPQKEPPDEENFAKFLITVWQEHRASHHELFDFLENEATSEQLYLFFKSDSAL
                     NLIFFDLVAYTLIGSQPETRGTISENLWDEIGHGDNYFTHVNLYKNVLERRDISLPDN
                     HYIDLYGVDALAGHNAFMLGAINRSHYYKLLGVMAMTEVLDPPQYTKLVKGCMRLGLL
                     DKDVHYYSEHITIDIKHGDDWLYNVINVITDAHPESKNEFYLGSLLRLQTAERYYDNL
                     MKEMKKIAK"
     misc_feature    89558..89875
                     /locus_tag="PC1_0071"
                     /note="Iron-containing redox enzyme; Region:
                     Haem_oxygenas_2; pfam14518"
                     /db_xref="CDD:258658"
     gene            90232..91119
                     /locus_tag="PC1_0072"
                     /db_xref="GeneID:8130972"
     CDS             90232..91119
                     /locus_tag="PC1_0072"
                     /inference="protein motif:PFAM:PF00892"
                     /note="PFAM: protein of unknown function DUF6
                     transmembrane;
                     KEGG: kpn:KPN_01754 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015670.1"
                     /db_xref="GI:253686480"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="GeneID:8130972"
                     /translation="MAYLFLTLAAVFWGGNYVAGHILVQYINPYALSIIRWGLTTLLM
                     FSFYWKVIKKEWSILYGNIRINTVYAFLGQVCFPLTLYIGLQYTSSLNAAIYISSTPC
                     LVLIINAVFFKEKISLRNILGVAVSTVGVIYLAFSNAERGNQLSAFGIGDVLTIASAL
                     SWAFYCALLRLKDKRVTNTAFVGFSSLIGTVIMVPIYLCYTFSSGDHFFFTTTPSVYP
                     LLGVAYLVVFPSWLAYVFWNKGVSLIGTTRSEIYTHIIPLSGGLLSIALLGEKLHMYH
                     IISLLLIVVGIICCSGKKK"
     misc_feature    90232..91116
                     /locus_tag="PC1_0072"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    90262..90639
                     /locus_tag="PC1_0072"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    90709..91095
                     /locus_tag="PC1_0072"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(91166..94660)
                     /locus_tag="PC1_0073"
                     /db_xref="GeneID:8130973"
     CDS             complement(91166..94660)
                     /locus_tag="PC1_0073"
                     /inference="protein motif:PFAM:PF05420"
                     /note="PFAM: cellulose synthase operon C domain protein;
                     TPR repeat-containing protein; Tetratricopeptide TPR_2
                     repeat protein;
                     SMART: Tetratricopeptide domain protein;
                     KEGG: eca:ECA4374 cellulose synthase subunit BcsC"
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase operon C domain-containing
                     protein"
                     /protein_id="YP_003015671.1"
                     /db_xref="GI:253686481"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR008410"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:8130973"
                     /translation="MHNNTVNWLRFLPLLLVAAPQAYSAEIASPEQFLMEQVRLGEAS
                     NKDDLVRQSLYRLELIDPNNPEVIAARLRLALRQGDQAQARQQLDKLKAVAPDSATYR
                     QSATTLALTQDAARQQLQQARLLSTAGRYAEAKVQYDALFHGDPPTLELAVEYWRLVS
                     RLPDQQPLAIKQLEALDQVYPNNVPLRMVLARLLFSQNRNEQAYPLLKQLSNDPVGRS
                     QAASLWLEIIGRMLVTPQSVAELNRFLTVFDEGEQADTARKELSRQQGILADPVYQGR
                     LRALAQIEDGGGNSATLSELNKALAATPNDPELIGAIGLVYLRAGDRAKALTQFQKAL
                     QADVNRLNSGKWEGLIQSTQYWTTIAEGDNALKANNLSLARQKYQQARQMDNTNAYAL
                     IGLGDVAVASKNDAAAQPLYQQALHLEPGNDNALRGLVGIYQRQSPEKALAYLNSLPR
                     SQQNTMRETLAALQLNILKQQADQLSEQQQWTQAEEKYRQASQQDPNDIWLAYHYAQT
                     LRQLGQTQQADSVVQRATAVPPTSAEKNYVYSLYLSSTNRDEQALAHLNTLPTAQWSD
                     DMRELSQRLTIQTTLAKAEAMRDAGDEPAAIAFLRQQPADTRIDLLLADWALARGEYA
                     TALAEYQRIRTREPQNPDAQLGEIDAFIAQGRQDDARQRLNQLPTQAVDTLNSQRRVA
                     NAWQAVGNPQKSAALFRQLKIDAQKEPVGQTPIDQTTALIYRDAARVEQQQSQPEQAQ
                     QDYKQAMVASGIAPTLPQSDDDYTRLTRNKSSDDWLQRSIRADAADLYRKQDITVTLD
                     HDYSSSSGTGGISDLSAHNTLLQVDMPLYDGRAFLRTDTVQMNAGSFSTGSNGAYRET
                     FGTCATRDCFDGKSQKTTGTSVAAGWKNDRWSADLGTTPLGFDVVDVVGGASYSGDWR
                     QIGWTATASRRPISSSLLAFGGTKDPGTGITWGGVRATGVSLGLSYDRGEAHGVWSDF
                     SLHQITGKNVADNDRARAMAGYYYKLINEDNRRVTVGLNSMWWRYQKDLSGYSLGQGG
                     YYSPQQYFSLGVPVNYRQRTENWSWELGGSLSWSRSSTKDQRRYPLTGLLGNAALTDR
                     DTIEQGSSSSGFGYTARALVERRLSSHWTLGVGIDIQQAKDYTPSHGLIYLRYSASGW
                     QGDLDSPPQPLTPYADFK"
     misc_feature    complement(91172..94660)
                     /locus_tag="PC1_0073"
                     /note="cellulose synthase subunit BcsC; Provisional;
                     Region: PRK11447"
                     /db_xref="CDD:183140"
     misc_feature    complement(93401..93724)
                     /locus_tag="PC1_0073"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(93416..93418,93425..93427,93437..93439,
                     93473..93475,93518..93520,93527..93529,93539..93541,
                     93581..93583,93662..93664,93671..93673,93683..93685,
                     93719..93721))
                     /locus_tag="PC1_0073"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(93455..93460,93467..93472,93479..93484,
                     93560..93565,93578..93583,93587..93592,93713..93718))
                     /locus_tag="PC1_0073"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(92768..93388)
                     /locus_tag="PC1_0073"
                     /note="type VI secretion-associated protein, VC_A0119
                     family; Region: VI_chp_7; TIGR03362"
                     /db_xref="CDD:234184"
     misc_feature    complement(92987..93265)
                     /locus_tag="PC1_0073"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(93023..93028,93035..93040,93047..93052,
                     93128..93133,93140..93145,93149..93154,93239..93244,
                     93251..93256,93260..93265))
                     /locus_tag="PC1_0073"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(92993..92995,93005..93007,93041..93043,
                     93086..93088,93095..93097,93107..93109,93143..93145,
                     93188..93190,93197..93199,93209..93211,93245..93247))
                     /locus_tag="PC1_0073"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(91223..92227)
                     /locus_tag="PC1_0073"
                     /note="Cellulose synthase operon protein C C-terminus
                     (BCSC_C); Region: BCSC_C; pfam05420"
                     /db_xref="CDD:253187"
     gene            complement(94642..95757)
                     /locus_tag="PC1_0074"
                     /db_xref="GeneID:8130974"
     CDS             complement(94642..95757)
                     /locus_tag="PC1_0074"
                     /EC_number="3.2.1.4"
                     /inference="protein motif:PRIAM:3.2.1.4"
                     /note="PFAM: glycoside hydrolase family 8;
                     KEGG: eca:ECA4373 endo-1,4-D-glucanase"
                     /codon_start=1
                     /transl_table=11
                     /product="Cellulase"
                     /protein_id="YP_003015672.1"
                     /db_xref="GI:253686482"
                     /db_xref="InterPro:IPR002037"
                     /db_xref="GeneID:8130974"
                     /translation="MPRVLRYLIPTLLWLWASQATAAVCDWPAWEQYKQHYISAEGRV
                     IDTSTPNKITTSEGQSYAMFFALVANDRVMFDRLLQWTENNLSAGDLRAHLPAWLWGE
                     NKDKQWTVLDPNSASDADLWIAYSLLEAGRLWKEARYQTVGTALLARIAKEEVVNIPG
                     LGVMLLPGKVGFAEKESWRLNPSYLPPQLLARFAPLSETWKAMQRTTQRLLLETAPKG
                     FSPDWVIWQKDKGWQPDTTKPNIGSYDAIRVYLWAGMMADSSKGKTDLIKQFQPMVQQ
                     TIEQGLPPEKTDTATGTVTGQGSVGFSASLLPMLSRQSDALATQRQRLADNPPGDDAY
                     FSASLTLFGQGWDQKRYRFTSQGQLLPSRGSQCTTTP"
     misc_feature    complement(94645..95754)
                     /locus_tag="PC1_0074"
                     /note="endo-1,4-D-glucanase; Provisional; Region:
                     PRK11097"
                     /db_xref="CDD:236844"
     gene            complement(95764..98082)
                     /locus_tag="PC1_0075"
                     /db_xref="GeneID:8130975"
     CDS             complement(95764..98082)
                     /locus_tag="PC1_0075"
                     /inference="protein motif:PFAM:PF03170"
                     /note="PFAM: cellulose synthase subunit B;
                     KEGG: eca:ECA4372 cellulose synthase regulator protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase subunit B"
                     /protein_id="YP_003015673.1"
                     /db_xref="GI:253686483"
                     /db_xref="InterPro:IPR003920"
                     /db_xref="GeneID:8130975"
                     /translation="MTKKIIWFTALALGVSSLSQAVTAPHAQTPATGDAAQPSATATS
                     ATAMPAVPLAQPSTNAAVRNVMLPFAQIAPAPGTFALRGINPDGQIEFGVRSDEVVTQ
                     ASLDLEFTPSPALIPTESHIKVYLNNELMGVTPLGKEQMGKSNRVRIPIDPRYITDFN
                     RLQLVFVGHYQNICENPASTSLWLDVSKASTLNLQFQKLTLKDDLSPFPAPFFDSRDT
                     RPLTLPIVFAGQPDLVQQRAAAMLASWFGSKAQWRGQSFPALFNQLPESHGIVFATND
                     KRPDFLRDTPAVNGPTVSIVSHPSDPHIKLLLVQGRDDNELLTAVQGIAQGNTLFRGQ
                     SVTIDKVEQLAPRQPYDAPNWVRTDRPMTFAELQQYNEQLQTDGIVPRPISLTMNLPP
                     DLFLIRSQGIDMRLKYRYTAPQIQDGSRLSINLNNQFVQAFSLAPEHDQNSLLMRLPL
                     TQGLWDSNKSLSIPALKLGTTNQLRFDFNYTTLLSSGTADRCETYTPVVNHAVIDSNS
                     TINFSGYRHFMAMPDLRAFANAGYPFSRLADLSQTLVLVNKQPQPAQVSAMLNAIGNI
                     GAQTGYPALAVQLSDDWTQIDKQDSDILMIGAIPPALHDDSKINLLVEQTQSWIKQPT
                     RQTAVLDIDPPDADAKPDSKTTVSGDGPMSAIIGFQSPYHDQRSVVALLADSPQGYTL
                     LNNALIDSEKRASLFGSVSVIRESGINNLRVGDIYYVGHLPWWERIWHALAQHPVWLA
                     IISTLTVVIVAWLLWRGLKFFSRRRLSPDERD"
     misc_feature    complement(95779..98082)
                     /locus_tag="PC1_0075"
                     /note="cellulose synthase regulator protein; Provisional;
                     Region: PRK11114"
                     /db_xref="CDD:236851"
     gene            complement(98157..100856)
                     /locus_tag="PC1_0076"
                     /db_xref="GeneID:8130976"
     CDS             complement(98157..100856)
                     /locus_tag="PC1_0076"
                     /inference="protein motif:TFAM:TIGR03030"
                     /note="TIGRFAM: cellulose synthase catalytic subunit
                     (UDP-forming);
                     PFAM: glycosyl transferase family 2; type IV pilus
                     assembly PilZ;
                     KEGG: spe:Spro_0148 cellulose synthase catalytic subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase catalytic subunit"
                     /protein_id="YP_003015674.1"
                     /db_xref="GI:253686484"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR003919"
                     /db_xref="InterPro:IPR009875"
                     /db_xref="InterPro:IPR017480"
                     /db_xref="GeneID:8130976"
                     /translation="MSGILRLFLVPPARQAIQQRYRGYRQQGASAFAAFFATLFAILG
                     WIFLRLESEGWQQIRAQRTYWFPHILPQRPRPADILRYLTQGLWLLTIKNGQLPTSRR
                     NYFSALPRWRQRYMNAQQALFVRFSHANADDREDSESDSAKTNSLQRLVTVILSLLCA
                     ALALLCITQPFDLLSQFIFMLLLWGIAMLVRNMPGRMPTLMMIALSFTVSCRYLWWRY
                     TETLNWDDPLSLVCGMLLLAAETYAWVVLVLGYFQTIWPLNRHPVSLPEDSKTWPTVD
                     LMIPTYNEPLSVVKPTVYAALGIDWPKDKLNIYILDDGGRAEFKAFAEEVGVHYIARV
                     THEHAKAGNINNALKQAEGEFVAIFDCDHVPTRSFLQLTMGWFFKDKKLAMLQTPHHF
                     FSPDPFERNLGRFRRTPNEGTLFYGLVQDGNDMWDATFFCGSCAILRRKPLDEIGGIA
                     VETVTEDAHTSLRLHRRGYSSAYIRIPQAAGLATESLSAHIGQRIRWARGMVQIFRLD
                     NPLLGKGLKLGQRLCYANAMMHFLSGIPRLIFLTAPLAFLLLHAYIIFAPALAIALYV
                     LPHMVHASLTNSRIQGRYRHSFWSEIYETVLAWYIARPTTVALFNPHKGKFNVTAKGG
                     LVEEQHVDWVITRPYLVLVLLNIAGVVYGVWRLIYGPSEELMTVIISLIWVAYNMTIL
                     GGAVAVAVEAKQVRQAHRVEMSMSAAILRPDGHLFPCVLRDYSDGGVGIETRESGILQ
                     VGDSVSLLLKRGQQEYAFPFSVTRAFDNKIGLRMTNLTIRQHIDFIQCTFARADTWAL
                     WQDSFAQDKPVESLVDVLALGFRGYLRLADYAPPIIRSIILVFLNIVVWVVSFIPRYV
                     GKRTVTDQSGTALPEKAAHQGKTPFAHETRFAQENLFAEKTVA"
     misc_feature    complement(98262..100817)
                     /locus_tag="PC1_0076"
                     /note="cellulose synthase catalytic subunit; Provisional;
                     Region: bcsA; PRK11498"
                     /db_xref="CDD:236918"
     misc_feature    complement(99342..100040)
                     /locus_tag="PC1_0076"
                     /note="CESA_CelA_like are involved in the elongation of
                     the glucan chain of cellulose; Region: CESA_CelA_like;
                     cd06421"
                     /db_xref="CDD:133043"
     misc_feature    complement(99771..99779)
                     /locus_tag="PC1_0076"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133043"
     misc_feature    complement(98484..98777)
                     /locus_tag="PC1_0076"
                     /note="PilZ domain; Region: PilZ; pfam07238"
                     /db_xref="CDD:254119"
     gene            complement(100853..101590)
                     /locus_tag="PC1_0077"
                     /db_xref="GeneID:8130977"
     CDS             complement(100853..101590)
                     /locus_tag="PC1_0077"
                     /inference="protein motif:TFAM:TIGR03371"
                     /note="TIGRFAM: cellulose synthase operon protein YhjQ;
                     PFAM: YhjQ family protein;
                     KEGG: eca:ECA4369 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase operon protein YhjQ"
                     /protein_id="YP_003015675.1"
                     /db_xref="GI:253686485"
                     /db_xref="InterPro:IPR009504"
                     /db_xref="InterPro:IPR017746"
                     /db_xref="GeneID:8130977"
                     /translation="MPVIALQGIRGGVGTTSIAAALGWAFQRLGEPALVIDFSPDNLL
                     RINFNMPFEQRRGWARAEADDAPWQTGAMQYLPGLDFLPFGRLNAQEVATLQQHYHQH
                     PALWQNKLAQLSAAGRHRWILIDVPADNSPLTRQALATANTVFQVVVADANCHSRLHQ
                     QALPRQCHFLVNQFSTLSTLQQDLHQLWLHTLSHLLPLVVHRDEALAESLMLKQPLGE
                     CRPDSVAAEEIMTLANWCLIHVKESGV"
     misc_feature    complement(100856..101590)
                     /locus_tag="PC1_0077"
                     /note="YhjQ protein; Region: YhjQ; pfam06564"
                     /db_xref="CDD:148269"
     misc_feature    complement(100874..101590)
                     /locus_tag="PC1_0077"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            complement(101593..101802)
                     /locus_tag="PC1_0078"
                     /db_xref="GeneID:8130978"
     CDS             complement(101593..101802)
                     /locus_tag="PC1_0078"
                     /inference="similar to AA sequence:KEGG:ECA4368"
                     /note="KEGG: eca:ECA4368 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015676.1"
                     /db_xref="GI:253686486"
                     /db_xref="GeneID:8130978"
                     /translation="MNNEPTRRDTSARADLTENARTEDDLRVLSQAFSLPEINYIDIA
                     RQARLSQMMARWPLLDELKEPAGSD"
     misc_feature    complement(101611..101742)
                     /locus_tag="PC1_0078"
                     /note="Protein of unknown function (DUF2629); Region:
                     DUF2629; pfam10945"
                     /db_xref="CDD:151392"
     gene            102133..103737
                     /locus_tag="PC1_0079"
                     /db_xref="GeneID:8130979"
     CDS             102133..103737
                     /locus_tag="PC1_0079"
                     /inference="protein motif:TFAM:TIGR03369"
                     /note="TIGRFAM: cellulose biosynthesis protein BcsE;
                     KEGG: eca:ECA4366 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose biosynthesis protein BcsE"
                     /protein_id="YP_003015677.1"
                     /db_xref="GI:253686487"
                     /db_xref="InterPro:IPR017745"
                     /db_xref="GeneID:8130979"
                     /translation="MKQNFSLGIRDLWDELVTLQQAGFYWVNIDRQVDAALFCQQIIH
                     VQNNDARMALIGCGERSDSLLTTLFSNEINGAEKKQLSCYILPENKAALLNLTDDLMR
                     ALRPKNRLLVLYAPASLWRDISPERLQRWVDDTAAWLHQRQCTLVVIGHSTGVTRLRN
                     MLISQHRGLYGLASLQWQQDRAQYLVSWWATERGVRANQVQMLQSDNDGWHMLTEEQP
                     ILTPSLDDDGLFLIEKSVLEGAPALSENWQLMDDNAILVQTGMLTHAATLVFALNQTS
                     QVDTLVKQVHSLRRQRGELLKIVVREMKPCLRASDERLLLACGANIIVSHSEPLSRFL
                     ARIESVQGQRFTKHVPVDVEVLLTTMRPLQIKGYQPPETFRQSVQMLIDSTLMPEGSK
                     GVLVALRPVPGVRAAQALTLCTLRRFGDVVTIVQDRLFLFLSNCRLNELDIALKSIFR
                     LPVNEVFSNRIVWSQDLQILAEVKSLAQDGTPGQEQQLNDYVQLQKAESAPRGQTPRR
                     EPIAIDLLNPDLLQPDLLARAPGEPS"
     misc_feature    102619..103560
                     /locus_tag="PC1_0079"
                     /note="Protein of unknown function (DUF2819); Region:
                     DUF2819; pfam10995"
                     /db_xref="CDD:256234"
     gene            103734..103952
                     /locus_tag="PC1_0080"
                     /db_xref="GeneID:8130980"
     CDS             103734..103952
                     /locus_tag="PC1_0080"
                     /inference="similar to AA sequence:KEGG:ECA4365"
                     /note="KEGG: eca:ECA4365 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015678.1"
                     /db_xref="GI:253686488"
                     /db_xref="GeneID:8130980"
                     /translation="MNLLDIVQLVLLSAVVFFTLGYLAHRVIPHWLQYWKNRLLSPRY
                     LQPASVWMRSPSSTKTVSTKPTSAETKK"
     misc_feature    103734..103913
                     /locus_tag="PC1_0080"
                     /note="celllulose biosynthesis operon protein BcsF/YhjT;
                     Region: cellullose_BcsF; TIGR03493"
                     /db_xref="CDD:200277"
     gene            103954..105615
                     /locus_tag="PC1_0081"
                     /db_xref="GeneID:8130981"
     CDS             103954..105615
                     /locus_tag="PC1_0081"
                     /inference="protein motif:TFAM:TIGR03368"
                     /note="TIGRFAM: cellulose synthase operon protein YhjU;
                     KEGG: eca:ECA4364 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase operon protein YhjU"
                     /protein_id="YP_003015679.1"
                     /db_xref="GI:253686489"
                     /db_xref="InterPro:IPR017744"
                     /db_xref="GeneID:8130981"
                     /translation="MDEKTRLQQPHMQKQQNLWRYWRGLGAWNLYFLLKFALLWFGYL
                     NFHPLLNLVFLAFLLFPIPNVTLHRWRHIIAIPLGIGLFYHDTWLPGINSIVSQGTQV
                     AGFSASYLLELLTRFINWQMVGAAVVITVAYLFFAQWIRITVFTVAALAWLNIVNLAG
                     PAVSLMPAASTTTAPSAATSPTGGDAALPEATLPPTNANLTAYLNQFYTREKARTTAF
                     PAALPQDAQPFDLLIINICSLSWSDLDVAQLDNHPLWKKFDILFRQFNSATAYSGPAS
                     IRLLRASCGQQSHTDLYQPVNQQCYLFSNLVKLGFEEQLMLDHSGVFGNYLREVREEG
                     DIQIPMLSQEGISHQITSFDGEPIYNDLELLNRWLGERDKATTTRNATFFNLIPLHDG
                     NRFVGTNQSADYAPRAKILFDQLDAFFDVLQKSGRKVMVVVVPEHGAALAGDKMQMSG
                     LRDIPSPSITHIPVGVKLFGLQAPHQGNALEVTSPSSYLAISELVARMVDGKVFTAPS
                     VDWQTLTSALPQTEAISENENAIVMQYQGKPYIRLNGGDWVPYPQ"
     misc_feature    104032..105597
                     /locus_tag="PC1_0081"
                     /note="Protein of unknown function (DUF3260); Region:
                     DUF3260; pfam11658"
                     /db_xref="CDD:256542"
     gene            105968..107152
                     /locus_tag="PC1_0082"
                     /db_xref="GeneID:8130982"
     CDS             105968..107152
                     /locus_tag="PC1_0082"
                     /inference="protein motif:PFAM:PF00672"
                     /note="PFAM: histidine kinase HAMP region domain protein;
                     GGDEF domain containing protein;
                     SMART: GGDEF domain containing protein;
                     KEGG: eca:ECA4363 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="YP_003015680.1"
                     /db_xref="GI:253686490"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="GeneID:8130982"
                     /translation="MRLRRSLTIKQMTAVSAVALVTISLFIVIQLFHFVHQRREDYSR
                     QLESIAYSVRQPLTDAVLQGEVQRAGNILDSLLPVAFLSRADVLLPDDFQTLHANFPK
                     ERPVPDWIARVFRLPIRISIPLYSPPQTQYSAPLAHLVLQADSYRMYQFIVSTFSTML
                     ATYLLLALIMSIAITWCMNRLLIHPLRGIIIELQNLPPDAMLHRPLTLPPWHHDDELG
                     ALVRSYNRNQQLLEQSLSAGTEGVGLPDKAHFMRRLEQRLADATPFSLLVFGLDSSAS
                     KQGDMATLATQLRVVIEEQNEAGLTCLARLDCDEFALIGKTLGSAGQAQDWAQNVMLA
                     INLPFLPADAQPARAVSVGILTITDPRPEAAALLLSQARFAMQLARHDKKCGIHCLTV
                     PS"
     misc_feature    106001..>107119
                     /locus_tag="PC1_0082"
                     /note="putative diguanylate cyclase; Provisional; Region:
                     PRK13561"
                     /db_xref="CDD:184143"
     misc_feature    106694..107131
                     /locus_tag="PC1_0082"
                     /note="Class III nucleotidyl cyclases; Region:
                     Nucleotidyl_cyc_III; cl11967"
                     /db_xref="CDD:264492"
     misc_feature    order(106775..106786,106793..106798,106892..106894,
                     107084..107086)
                     /locus_tag="PC1_0082"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143637"
     misc_feature    order(106775..106777,106892..106894)
                     /locus_tag="PC1_0082"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143637"
     gene            107472..108764
                     /locus_tag="PC1_0083"
                     /db_xref="GeneID:8130983"
     CDS             107472..108764
                     /locus_tag="PC1_0083"
                     /inference="protein motif:PFAM:PF00375"
                     /note="PFAM: sodium:dicarboxylate symporter;
                     KEGG: eca:ECA4362 C4-dicarboxylate transporter DctA"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:dicarboxylate symporter"
                     /protein_id="YP_003015681.1"
                     /db_xref="GI:253686491"
                     /db_xref="InterPro:IPR001991"
                     /db_xref="GeneID:8130983"
                     /translation="MKTSIFKSLYFQVLAAITIGILLGHFYPQLGEQMKPLGDGFVKL
                     IKMIIAPVIFCTVVTGIAGMESMKSVGRTGAVALLYFEIVSTIALIIGLVVVNIVQPG
                     AGMNIDPSTLDASAVAVYTQQASQQGLIPFLMDVIPASVVGAFASGNILQVLLFAVMF
                     GFALHRLGAKGKVIFDVIDSFSKVIFGVINMIMKLAPLGAFGAMAFTIGKYGVGTLVQ
                     LGQLIACFYITCVLFIFLVLGSIAKATGFSIFKFIRYIREELLIVLGTSSSESVLPRM
                     LEKMEKVGCKKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLV
                     VLLLSSKGAAGVTGSGFIVLAATLSAVGHLPVAGLALILGIDRFMSEARALTNLIGNG
                     VATIVVAKYCRELDEKKLDAELSGTNKSDNAATPTAQS"
     misc_feature    107472..108755
                     /locus_tag="PC1_0083"
                     /note="C4-dicarboxylate transporter DctA; Reviewed;
                     Region: PRK01663"
                     /db_xref="CDD:234968"
     gene            109118..110635
                     /locus_tag="PC1_0084"
                     /db_xref="GeneID:8130984"
     CDS             109118..110635
                     /locus_tag="PC1_0084"
                     /inference="protein motif:PFAM:PF00675"
                     /note="PFAM: peptidase M16 domain protein;
                     KEGG: eca:ECA4361 putative peptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16 domain-containing protein"
                     /protein_id="YP_003015682.1"
                     /db_xref="GI:253686492"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="GeneID:8130984"
                     /translation="MQGTKKALFVGGLLLAVVSSSVQAEALQPDPAWQQGKLDNGFTW
                     QLLTTPQRPGDRVELRLVVNAGSLLENAQQVGFAHFLPRLALAPGDKLSAAQRPSTWM
                     SDANGSRVLPPAIISYDFTSYNLSLPNNRPELLKEALTWLAESAGQMTFDEKSLQAAL
                     KVPDQVATFPVNPQDPSWRYRLKGSPLLAHDPAQDVKPPLNGEQLQQFYKTWYTPDAM
                     TLYIVGHVDNRSVIEQIGKVFSPLEGKREAPAPLPTLSPLPTQAISLMNNNVQKDTLS
                     LMWDAPWHPIRESQALVRYWLGDMTREAMFWHLQQVLEKSPQKGNNLRFDCNVFYTRS
                     QCAIHMDVPNSEGVEPGVTFMARELATLREKGLTQQEFDALIARKTDELNKLFATYAR
                     TSTDILMDQRLRSQQNGVVDIAPEQYQKLRQSYLSALTLDMLNQELHQQLVQDTTLML
                     IQQPGEPEANMKALQEAYDRIMTPATEPAASAATAAPEGAVPEGKKPQETAPAAQ"
     misc_feature    109178..110452
                     /locus_tag="PC1_0084"
                     /note="Predicted Zn-dependent peptidases [General function
                     prediction only]; Region: PqqL; COG0612"
                     /db_xref="CDD:223685"
     misc_feature    109274..>109606
                     /locus_tag="PC1_0084"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    109715..110251
                     /locus_tag="PC1_0084"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            110988..111155
                     /locus_tag="PC1_0085"
                     /db_xref="GeneID:8130985"
     CDS             110988..111155
                     /locus_tag="PC1_0085"
                     /inference="similar to AA sequence:KEGG:PputGB1_2013"
                     /note="KEGG: ppg:PputGB1_2013 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015683.1"
                     /db_xref="GI:253686493"
                     /db_xref="GeneID:8130985"
                     /translation="MSRTLKAAGVIALIAMLSGCLFPPPGGGGGGGGGRGGGGPFGGF
                     QEQPVNQPGPR"
     gene            complement(111251..112183)
                     /locus_tag="PC1_0086"
                     /db_xref="GeneID:8130986"
     CDS             complement(111251..112183)
                     /locus_tag="PC1_0086"
                     /inference="protein motif:PFAM:PF00294"
                     /note="PFAM: PfkB domain protein;
                     KEGG: eca:ECA4360 2-dehydro-3-deoxygluconokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="PfkB domain-containing protein"
                     /protein_id="YP_003015684.1"
                     /db_xref="GI:253686494"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="GeneID:8130986"
                     /translation="MTTTNIAVIGECMIELSQKGTDLNRGFGGDTLNTAVYIARQVNA
                     DKLGVHYVTALGTDSFSTEMVAAWQKEGVKTDLIQRLDNKLPGLYFIETDASGERTFY
                     YWRNDAAARYWLDSPEAEKIGQSLAHFDYLYLSGISLAILNAESRQRLLALLRACRAN
                     GGKVTFDNNYRPRLWQSKEETQQAYTDILSCTDIAFLTLDDEDMLWGTKPLEAVLERT
                     HGLGVSEVVIKRGADSCIVSERGQALVDVPAIKLPKEKVVDTTAAGDSFSAGYLSVRL
                     NGGSTQEAAQRGHLTASTVIQYRGAIIPLEAMPA"
     misc_feature    complement(111278..112168)
                     /locus_tag="PC1_0086"
                     /note="2-keto-3-deoxygluconate kinase (KdgK)
                     phosphorylates 2-keto-3-deoxygluconate (KDG) to form
                     2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the
                     common intermediate product, that allows organisms to
                     channel D-glucuronate and/or D-galacturinate into the...;
                     Region: KdgK; cd01166"
                     /db_xref="CDD:238571"
     misc_feature    complement(order(111281..111283,111389..111391,
                     111398..111400,111671..111673,111773..111775,
                     111869..111871,111875..111877,111917..111919,
                     112085..112087,112094..112099))
                     /locus_tag="PC1_0086"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238571"
     misc_feature    complement(order(111305..111307,111317..111319,
                     111383..111385,111392..111400,111425..111427,
                     111482..111484,111497..111499))
                     /locus_tag="PC1_0086"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238571"
     gene            complement(112331..113347)
                     /locus_tag="PC1_0087"
                     /db_xref="GeneID:8130987"
     CDS             complement(112331..113347)
                     /locus_tag="PC1_0087"
                     /inference="protein motif:TFAM:TIGR00766"
                     /note="TIGRFAM: ribonuclease;
                     PFAM: ribonuclease BN;
                     KEGG: eca:ECA4359 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease"
                     /protein_id="YP_003015685.1"
                     /db_xref="GI:253686495"
                     /db_xref="InterPro:IPR004664"
                     /db_xref="InterPro:IPR005274"
                     /db_xref="GeneID:8130987"
                     /translation="MPVPADPDRQSTSSTPEGDTSPQKPLSFLDKSKRLAARIQAIPS
                     VAHLIRAGERFNDRMGNQFGAAITYFSFLSLIPILMVSFAAVGFVLASNPDLLTGLIN
                     RIVNSISDPNLANTLKNTVNTAVQQRTTVGITGLLIALYSGISWMGNLREAIRAQSRD
                     VWERSPKDEEKIYFQYTRDFLSLTGLVIALIITLFLTSVAGTAQNMIVTALGLDGIEW
                     LRPALTLIALSISIFANYLLFLWIFFVLPRHKPKRKALFRGTLIAAVGFEVIKFAMTV
                     ALPKLASSPSGAAFGSVIGLMAFFYFFARLTLFCAAWIATANYKGDTSTDRNEQEKEP
                     PSDR"
     misc_feature    complement(112388..113212)
                     /locus_tag="PC1_0087"
                     /note="inner membrane protein YhjD; Region: TIGR00766"
                     /db_xref="CDD:188082"
     gene            113478..114677
                     /locus_tag="PC1_0088"
                     /db_xref="GeneID:8130988"
     CDS             113478..114677
                     /locus_tag="PC1_0088"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: eca:ECA4358 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_003015686.1"
                     /db_xref="GI:253686496"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:8130988"
                     /translation="MPTPSPSEPALSGLRLNLRIVSIVAFNFASYLNIGLPLAVLPGY
                     VHDHLGYSAFWAGLVISLQYFSTLLTRPHAGRSADEKGPKKIVVWGLAGVMLSGVFYL
                     LAAFSDASPAITLLLLCLGRVVLGAGQSFAGTGATLWGVGVVGSRHIGRVISWNGIAT
                     YGAMAIGAPLGVWLNHIGGLKLLSVCIILIAAVAIVLALPRPTVQVAPGKKIPFREVL
                     GKVWVYGIILAIASAGFGVIATFITLFYADRNWEGAALTLTIFSCAFVGARLVFPNSI
                     QRFGGLRVAMACFVVEIVGLLLVWGAALPLMAEVGAFLAGAGFSLVFPALGVVAVQAV
                     SPQNQGSALATYTIFLDLSLGIVGPVAGVLMAYTGIASIYLAAALLGLCGLALTWRLT
                     QRTAVKE"
     misc_feature    113490..114665
                     /locus_tag="PC1_0088"
                     /note="major facilitator superfamily transporter;
                     Provisional; Region: PRK05122"
                     /db_xref="CDD:235348"
     misc_feature    113535..114650
                     /locus_tag="PC1_0088"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(113577..113579,113586..113594,113598..113603,
                     113655..113657,113664..113669,113676..113678,
                     113688..113693,113697..113702,113862..113867,
                     113874..113879,113886..113891,113898..113900,
                     113934..113939,113946..113951,113967..113969,
                     114171..114173,114180..114185,114192..114197,
                     114204..114206,114237..114239,114249..114251,
                     114261..114263,114270..114272,114282..114284,
                     114423..114425,114432..114437,114444..114446,
                     114456..114461,114468..114470,114501..114506,
                     114513..114518,114525..114530,114537..114539)
                     /locus_tag="PC1_0088"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(114723..115289)
                     /locus_tag="PC1_0089"
                     /db_xref="GeneID:8130989"
     CDS             complement(114723..115289)
                     /locus_tag="PC1_0089"
                     /inference="similar to AA sequence:KEGG:ECA4355"
                     /note="KEGG: eca:ECA4355 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015687.1"
                     /db_xref="GI:253686497"
                     /db_xref="GeneID:8130989"
                     /translation="MSNVIKYLGVGLLVGLLAACDGKTDDAAKAGAQDKPAAEASAGQ
                     NIELMEGKIAFTLPADMRDQSGKVGTQANNMHVYANDNGQKAVIVILGDNTTEELTVL
                     AQRLEDQQRTRDANLQVVTNKTIDVDGKKLQQLDSIITSSGQQAYSSVVLGKVENQLL
                     TLQITLPASNQQQAQSEAEGIIHTLKLK"
     misc_feature    complement(114726..115289)
                     /locus_tag="PC1_0089"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11615"
                     /db_xref="CDD:183232"
     gene            115346..115492
                     /locus_tag="PC1_0090"
                     /db_xref="GeneID:8130990"
     CDS             115346..115492
                     /locus_tag="PC1_0090"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015688.1"
                     /db_xref="GI:253686498"
                     /db_xref="GeneID:8130990"
                     /translation="MAPYSDSKNKHFVVANRCGNLRYFYKTMSDLRGKGGVNSRPIGI
                     NGGC"
     gene            complement(115476..116153)
                     /locus_tag="PC1_0091"
                     /db_xref="GeneID:8130991"
     CDS             complement(115476..116153)
                     /locus_tag="PC1_0091"
                     /inference="protein motif:TFAM:TIGR00697"
                     /note="TIGRFAM: conserved hypothetical protein;
                     PFAM: protein of unknown function DUF165;
                     KEGG: eca:ECA4354 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015689.1"
                     /db_xref="GI:253686499"
                     /db_xref="InterPro:IPR003744"
                     /db_xref="GeneID:8130991"
                     /translation="MYRFTPQQRLTALIWLSLFHVLIITSSNYLVQLPVLIFGFHTTW
                     GAFTFPFIFLATDLTVRIFGAPMARRIILTVMVPALVISYLVSSLFYQGSWQSFEALS
                     QVNIVVARIACASFMAYVLGQILDVHVFNRLRQNRAWWVAPAVSTVFGNFSDTLAFFF
                     IAFYHSTDAFMAANWVEIAMVDYAFKLLISLAFFLPMYGVMLNMVLKRLSEQKGSADY
                     HSVSSHH"
     misc_feature    complement(115527..116153)
                     /locus_tag="PC1_0091"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11212"
                     /db_xref="CDD:183041"
     gene            116370..116612
                     /locus_tag="PC1_0092"
                     /db_xref="GeneID:8130992"
     CDS             116370..116612
                     /locus_tag="PC1_0092"
                     /inference="protein motif:PFAM:PF01206"
                     /note="PFAM: SirA family protein;
                     KEGG: eca:ECA4353 cell developmental protein SirA"
                     /codon_start=1
                     /transl_table=11
                     /product="SirA family protein"
                     /protein_id="YP_003015690.1"
                     /db_xref="GI:253686500"
                     /db_xref="InterPro:IPR001455"
                     /db_xref="GeneID:8130992"
                     /translation="MTDPFTNPDKTLDAQGLRCPEPVMMVRKTVRQMETGQTLLIIAD
                     DPATTRDIPGFCVFMEHELLAQETEQLPYRYLLRKG"
     misc_feature    116400..116606
                     /locus_tag="PC1_0092"
                     /note="SirA (also known as UvrY,  and YhhP) belongs to a
                     family of two-component response regulators that controls
                     secondary metabolism and virulence. The other member of
                     this two-component system is a sensor kinase called BarA
                     which phosphorylates SirA.  A...; Region: SirA; cd03423"
                     /db_xref="CDD:239515"
     misc_feature    order(116403..116408,116415..116417,116424..116435,
                     116439..116441)
                     /locus_tag="PC1_0092"
                     /note="CPxP  motif; other site"
                     /db_xref="CDD:239515"
     gene            complement(116672..119035)
                     /locus_tag="PC1_0093"
                     /db_xref="GeneID:8130993"
     CDS             complement(116672..119035)
                     /locus_tag="PC1_0093"
                     /inference="protein motif:TFAM:TIGR01525"
                     /note="TIGRFAM: heavy metal translocating P-type ATPase;
                     ATPase, P-type (transporting), HAD superfamily, subfamily
                     IC; cadmium-translocating P-type ATPase;
                     PFAM: E1-E2 ATPase-associated domain protein; Heavy metal
                     transport/detoxification protein; Haloacid dehalogenase
                     domain protein hydrolase;
                     KEGG: eca:ECA4352 zinc/cadmium/mercury/lead-transporting
                     ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="YP_003015691.1"
                     /db_xref="GI:253686501"
                     /db_xref="InterPro:IPR000150"
                     /db_xref="InterPro:IPR001366"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR006404"
                     /db_xref="InterPro:IPR006416"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="GeneID:8130993"
                     /translation="MHSHQHHSAEKSACCNNGVHHAPRSTAHSTKSCCNEHAQHSNHA
                     DHSCCSTKHTSDAAVQSACGTEQHSSDSGGSADSDDPDGGDSDRPRSNQRFSWKISGM
                     DCPSCARKIENAVKNLTGIEQAKVLFATEKLVVDAYIDIRPQVQHAVQQAGFTLQDTA
                     LPVVPPNTSTVRRFVHEYGFLLLFTLLAAASWGLSLLSERGGQIAFIATTIVGLIPIL
                     KKAIQLIRTGTPFAIETLMSVASIGALLIGATTEATVILLLFMLGEYLESYAANRARR
                     GVTALMALLPEDATAIVNGQRRLVPVASLVPGDVIEVAPGGRLPADAELLNSDASFDE
                     SALTGESVPVERTPGEKIAAGSLCVDRVVQLRVVSQPGNSAIDRILQLIEEAEERRAP
                     IERFLDKFSRYYTPAIMLLSLLVILVPPLLLAQPWQEWIYRGLTLLLIGCPCALVIST
                     PAAITSGLAAATRRGALIKGGAALESLGSIKTIAFDKTGTLTEGKPQVTDVLPAAGIS
                     ETALLTRTAAVESGSHHPLAKAIVQHALSSSTFLPLAENRKALAGVGVEGTIGGKRIQ
                     VSAPTRVASDLLDADWLQQIDALENEGKTVVVVQEDDRLLGLLALSDTLRHDAREALD
                     ALQQLGIRGVMLTGDNPRAAAAIAARLGIDYRASLLPADKVTAVSDLSKQHPVAMVGD
                     GINDAPAMKAATIGIAMGSGTDVALETADAALTHSRLTGLAAMISLSRATQRNIRQNI
                     TIALGLKAVFLVTSILGITGLWLAVLADSGATALVTANALRLLRKQD"
     misc_feature    complement(116675..119002)
                     /locus_tag="PC1_0093"
                     /note="zinc/cadmium/mercury/lead-transporting ATPase;
                     Provisional; Region: zntA; PRK11033"
                     /db_xref="CDD:236827"
     misc_feature    complement(118574..118744)
                     /locus_tag="PC1_0093"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    complement(order(118715..118717,118724..118732))
                     /locus_tag="PC1_0093"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    complement(117608..118273)
                     /locus_tag="PC1_0093"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    complement(116939..117232)
                     /locus_tag="PC1_0093"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(117125..117127)
                     /locus_tag="PC1_0093"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(116858..>117001)
                     /locus_tag="PC1_0093"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            complement(119130..119759)
                     /locus_tag="PC1_0094"
                     /db_xref="GeneID:8130994"
     CDS             complement(119130..119759)
                     /locus_tag="PC1_0094"
                     /inference="protein motif:PFAM:PF07947"
                     /note="PFAM: YhhN family protein;
                     KEGG: eca:ECA4351 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="YhhN family protein"
                     /protein_id="YP_003015692.1"
                     /db_xref="GI:253686502"
                     /db_xref="InterPro:IPR012506"
                     /db_xref="GeneID:8130994"
                     /translation="MLWSFIAVLFSGWLYVDASYRGPTWQRWLFKPVTMLLLLALAWQ
                     TPLLGVPGYLIVLGLLATLVADTLLLLPTQRLLYAFGAYFLSHLLYTVSFFTGQIALT
                     FFWPLALTLVILAAILIAIIWGRLDTQRWPACAFIIMTTLMVWIAGERYFALGTNANF
                     SLLTGTVLLFIAHAAWLIHHYRFPFRAHQAIVAAGYFGGHFLIVRSLYF"
     misc_feature    complement(119133..119759)
                     /locus_tag="PC1_0094"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3714"
                     /db_xref="CDD:226237"
     gene            119951..120271
                     /locus_tag="PC1_0095"
                     /db_xref="GeneID:8130995"
     CDS             119951..120271
                     /locus_tag="PC1_0095"
                     /inference="protein motif:PFAM:PF08850"
                     /note="PFAM: Domain of unknown function DUF1820;
                     KEGG: eca:ECA4350 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015693.1"
                     /db_xref="GI:253686503"
                     /db_xref="InterPro:IPR014949"
                     /db_xref="GeneID:8130995"
                     /translation="MSSESALYRIQFINNGKNYQLYVRELVQSSLFGFIEIADFVFDS
                     QSAVLVDPSTEKLKTEFSGVSRSFIPLQAIIRIDAVTEKGSARISDLGDNVTAFPYLP
                     GKKP"
     misc_feature    119966..120250
                     /locus_tag="PC1_0095"
                     /note="Domain of unknown function (DUF1820); Region:
                     DUF1820; pfam08850"
                     /db_xref="CDD:149796"
     gene            120271..120630
                     /locus_tag="PC1_0096"
                     /db_xref="GeneID:8130996"
     CDS             120271..120630
                     /locus_tag="PC1_0096"
                     /inference="similar to AA sequence:KEGG:ECA4349"
                     /note="KEGG: eca:ECA4349 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015694.1"
                     /db_xref="GI:253686504"
                     /db_xref="GeneID:8130996"
                     /translation="MNDFPWLLALAVGAILVLAARQYRRQRQRDAQNDAAPLRIVAAE
                     VKHKREFPLTRRRARAHQMMAVEDMRYEVTFRPITGGATITLRLENADYHQLDTGMQG
                     SLQLKGTRFIRFVPQQR"
     misc_feature    120283..120618
                     /locus_tag="PC1_0096"
                     /note="Protein of unknown function (DUF2500); Region:
                     DUF2500; pfam10694"
                     /db_xref="CDD:151190"
     gene            complement(120634..120912)
                     /locus_tag="PC1_0097"
                     /db_xref="GeneID:8130997"
     CDS             complement(120634..120912)
                     /locus_tag="PC1_0097"
                     /inference="protein motif:PFAM:PF06611"
                     /note="PFAM: protein of unknown function DUF1145;
                     KEGG: eca:ECA4348 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015695.1"
                     /db_xref="GI:253686505"
                     /db_xref="InterPro:IPR009525"
                     /db_xref="GeneID:8130997"
                     /translation="MILINLGRLLMLGVWGFLLLNLIQPFPKPLNIFMTVAMVFMILM
                     HGFQLLLLKSSQPKDSPALNRALQARIFLFGVFELLAWQKKQPKPPKP"
     misc_feature    complement(120667..120909)
                     /locus_tag="PC1_0097"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10910"
                     /db_xref="CDD:182831"
     gene            complement(120939..121514)
                     /locus_tag="PC1_0098"
                     /db_xref="GeneID:8130998"
     CDS             complement(120939..121514)
                     /locus_tag="PC1_0098"
                     /EC_number="2.1.1.52"
                     /inference="protein motif:TFAM:TIGR00095"
                     /note="KEGG: eca:ECA4347 16S rRNA
                     m(2)G966-methyltransferase;
                     TIGRFAM: methyltransferase;
                     PFAM: Protein of unknown function methylase putative"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="YP_003015696.1"
                     /db_xref="GI:253686506"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004398"
                     /db_xref="InterPro:IPR016065"
                     /db_xref="GeneID:8130998"
                     /translation="MAKKNASSAAGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETL
                     FNWLAPIIQQARCLDCFAGSGALGLEALSRYAAHATLLEMERAVAQQLTQNLALLRAE
                     NAEVVNTDALSWLAQPGTPFDVVFLDPPFRKELLNNTLVLLEQQGWLAPDAWIYVETE
                     AENAQLTIPENWQLHREKIAGQVAYRLYIRQ"
     misc_feature    complement(<121122..121349)
                     /locus_tag="PC1_0098"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(121131..121133,121182..121190,
                     121263..121268,121317..121337))
                     /locus_tag="PC1_0098"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            121864..123351
                     /locus_tag="PC1_0099"
                     /db_xref="GeneID:8130999"
     CDS             121864..123351
                     /locus_tag="PC1_0099"
                     /inference="protein motif:TFAM:TIGR00064"
                     /note="KEGG: eca:ECA4346 cell division protein FtsY;
                     TIGRFAM: signal recognition particle-docking protein FtsY;
                     PFAM: GTP-binding signal recognition particle SRP54 G-
                     domain; GTP-binding signal recognition particle SRP54
                     helical bundle;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle-docking protein
                     FtsY"
                     /protein_id="YP_003015697.1"
                     /db_xref="GI:253686507"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004390"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="GeneID:8130999"
                     /translation="MSKEKKRGFFSWLGLGKQEEKQQEQPQEKPVVQEKIVVEEQSPA
                     AESDAAASAHQTVEHAPEQVEKPLPEEPVVEAEELTQSVAERDVTAAADESAVVAPEA
                     NVSESIASEPAVSTPAISETDDRDLIDRDVIDRDAADPIVQTEIAESATVVEAEPDVA
                     QQEEHEYEEQELAQPDDVPVVAQEQERPTKEGFFARLKRSLVKTRQNLGSGFIGLFRG
                     KKIDDDLFDELEEQLLVADVGVETTRKIITSLTEHASRRQLKDADTLFVKLKDEMAEI
                     LAKVDAPLNIEGKTPYVILMVGVNGVGKTTTIGKMARQFQAQGKSVMLAAGDTFRAAA
                     VEQLQVWGQRNNVAVVAQHTGADSASVIFDAIQAAKARGVDVLIADTAGRLQNKAHLM
                     EELKKIVRVMKKLDEDAPHEVMLTLDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTA
                     KGGVIFAIADQFAIPIRYIGVGEGIEDLRPFKADDFIEALFARED"
     misc_feature    122413..123348
                     /locus_tag="PC1_0099"
                     /note="signal recognition particle-docking protein FtsY;
                     Provisional; Region: PRK10416"
                     /db_xref="CDD:236686"
     misc_feature    122452..122682
                     /locus_tag="PC1_0099"
                     /note="SRP54-type protein, helical bundle domain; Region:
                     SRP54_N; pfam02881"
                     /db_xref="CDD:251589"
     misc_feature    122737..123273
                     /locus_tag="PC1_0099"
                     /note="The signal recognition particle (SRP) mediates the
                     transport to or across the plasma membrane in bacteria and
                     the endoplasmic reticulum in eukaryotes. SRP recognizes
                     N-terminal sighnal sequences of newly synthesized
                     polypeptides at the ribosome. The...; Region: SRP;
                     cd03115"
                     /db_xref="CDD:239389"
     misc_feature    122755..122778
                     /locus_tag="PC1_0099"
                     /note="P loop; other site"
                     /db_xref="CDD:239389"
     misc_feature    order(122845..122847,123010..123012,123193..123195,
                     123202..123207)
                     /locus_tag="PC1_0099"
                     /note="GTP binding site [chemical binding]; other site"
                     /db_xref="CDD:239389"
     gene            123357..124028
                     /locus_tag="PC1_0100"
                     /db_xref="GeneID:8131000"
     CDS             123357..124028
                     /locus_tag="PC1_0100"
                     /inference="protein motif:TFAM:TIGR00960"
                     /note="KEGG: eca:ECA4345 cell division protein FtsE;
                     TIGRFAM: Type II (General) Secretory Pathway (IISP) Family
                     protein; cell division ATP-binding protein FtsE;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II (General) Secretory Pathway (IISP)
                     Family protein"
                     /protein_id="YP_003015698.1"
                     /db_xref="GI:253686508"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005286"
                     /db_xref="InterPro:IPR013505"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8131000"
                     /translation="MIRFEQVSKAYLGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTL
                     LKLICGIERPSAGQILFGGHNISRLKKREVPFLRRQIGMIFQDHHLLMERTVYDNVAM
                     PLIIAGASSEDIRRRVSAALDKVGLLDKAKNYPIQLSGGEQQRVGIARAVVNKPAVLL
                     ADEPTGNLDEALSEGILRLFEEFNRVGVTVLMATHDTGLIARRNYRVLTLSDGRMVGG
                     NHDGE"
     misc_feature    123357..124025
                     /locus_tag="PC1_0100"
                     /note="cell division protein FtsE; Provisional; Region:
                     PRK10908"
                     /db_xref="CDD:182829"
     misc_feature    123360..124001
                     /locus_tag="PC1_0100"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    123459..123482
                     /locus_tag="PC1_0100"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(123468..123473,123477..123485,123612..123614,
                     123840..123845,123939..123941)
                     /locus_tag="PC1_0100"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    123603..123614
                     /locus_tag="PC1_0100"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    123768..123797
                     /locus_tag="PC1_0100"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    123828..123845
                     /locus_tag="PC1_0100"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    123852..123863
                     /locus_tag="PC1_0100"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    123927..123947
                     /locus_tag="PC1_0100"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            124018..124986
                     /locus_tag="PC1_0101"
                     /db_xref="GeneID:8131001"
     CDS             124018..124986
                     /locus_tag="PC1_0101"
                     /inference="protein motif:TFAM:TIGR00439"
                     /note="TIGRFAM: protein insertion ABC transporter, inner
                     membrane subunit FtsX;
                     PFAM: protein of unknown function DUF214;
                     KEGG: eca:ECA4344 cell division protein FtsX"
                     /codon_start=1
                     /transl_table=11
                     /product="protein insertion ABC transporter inner membrane
                     subunit FtsX"
                     /protein_id="YP_003015699.1"
                     /db_xref="GI:253686509"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="InterPro:IPR004513"
                     /db_xref="GeneID:8131001"
                     /translation="MANNVRNAKKPVAKSKALRGGWQEQWRYAWTNTLADMLRQPLAT
                     FLTVMVIAISLALPSICYLVWKNVSQAATQWYPSPQLTVYLDKSLDDNAAQAVVTQLQ
                     SEDGVDKVNYLSRNEAMGEFRNWSGFGGALDMLEENPLPAVAIITPKMSFQDSTTLTT
                     LRDRVAATQGVDEVRMDDSWFARLVALTNLVGQISATIGILMIVAVFLVIGNSVRLSI
                     FSRRETINVMKLIGATDGFILRPFLNGGAAMGVGGAVLSLILSQALVWKLDAVVAQVA
                     SVFGTTFAVKGLSWDESLLLLLIAGMIGWLAAWLATVQHLRRFTPQ"
     misc_feature    124063..124983
                     /locus_tag="PC1_0101"
                     /note="cell division ABC transporter subunit FtsX;
                     Provisional; Region: ftsX; PRK11026"
                     /db_xref="CDD:182910"
     misc_feature    124081..124983
                     /locus_tag="PC1_0101"
                     /note="putative protein insertion permease FtsX; Region:
                     ftsX; TIGR00439"
                     /db_xref="CDD:129531"
     gene            125319..126176
                     /locus_tag="PC1_0102"
                     /db_xref="GeneID:8131002"
     CDS             125319..126176
                     /locus_tag="PC1_0102"
                     /inference="protein motif:TFAM:TIGR02392"
                     /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
                     polymerase sigma factor, sigma-70 family;
                     PFAM: sigma-70 region 2 domain protein; sigma-70 region 4
                     domain protein;
                     KEGG: eca:ECA4343 RNA polymerase factor sigma-32"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-32 subunit RpoH"
                     /protein_id="YP_003015700.1"
                     /db_xref="GI:253686510"
                     /db_xref="InterPro:IPR000943"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR007630"
                     /db_xref="InterPro:IPR012759"
                     /db_xref="InterPro:IPR014284"
                     /db_xref="GeneID:8131002"
                     /translation="MTKDMQTFTLVPQGSLEGYIRAANAYPMLTAEEERALAERLHYQ
                     GDLDAAKHLILSHLRFVIHVARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLV
                     SFAVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKTRLGWFNQDEVELVARE
                     LGVTSKDVREMESRMAAQDMTFDPTPEEDSHDGKAMSPMLYLQDKSSDFADGIEEDNW
                     DTHAADKLTYALEGLDERSQHIIRARWLDDDNKSTLQELADQYGVSAERVRQLEKNAM
                     KKLRAAIEA"
     misc_feature    125319..126173
                     /locus_tag="PC1_0102"
                     /note="RNA polymerase factor sigma-32; Reviewed; Region:
                     PRK06596"
                     /db_xref="CDD:235838"
     misc_feature    125475..125687
                     /locus_tag="PC1_0102"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    125988..126158
                     /locus_tag="PC1_0102"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(126018..126020,126048..126050,126075..126080,
                     126108..126110,126114..126119,126123..126131,
                     126135..126140,126144..126146)
                     /locus_tag="PC1_0102"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(126260..126706)
                     /locus_tag="PC1_0103"
                     /db_xref="GeneID:8131003"
     CDS             complement(126260..126706)
                     /locus_tag="PC1_0103"
                     /inference="protein motif:PFAM:PF00583"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: eca:ECA4342 putative acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-like N-acetyltransferase"
                     /protein_id="YP_003015701.1"
                     /db_xref="GI:253686511"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:8131003"
                     /translation="MKLTVECLTQFSPQDKIDLAKIWPHQNIDLLEAGLKPTRRLFAA
                     RFNDRLLGGMLVEIAGDYAELSDMMVREVTRRRGVGQLLVDEARRQLPEVNEWWLATA
                     NHAAIKEEVLARFMVSCGFSPVSGGWRYIRRKETPLILDDINSEKP"
     misc_feature    complement(126320..126703)
                     /locus_tag="PC1_0103"
                     /note="Acetyltransferase (GNAT) domain; Region: DUF3749;
                     pfam12568"
                     /db_xref="CDD:204966"
     misc_feature    complement(126428..126586)
                     /locus_tag="PC1_0103"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(126464..126469,126497..126505))
                     /locus_tag="PC1_0103"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            127111..128223
                     /locus_tag="PC1_0104"
                     /db_xref="GeneID:8131004"
     CDS             127111..128223
                     /locus_tag="PC1_0104"
                     /inference="protein motif:PFAM:PF01094"
                     /note="PFAM: Extracellular ligand-binding receptor;
                     KEGG: eca:ECA4341 leucine-specific binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Extracellular ligand-binding receptor"
                     /protein_id="YP_003015702.1"
                     /db_xref="GI:253686512"
                     /db_xref="InterPro:IPR000709"
                     /db_xref="InterPro:IPR001828"
                     /db_xref="GeneID:8131004"
                     /translation="MKFSKGKVLLMGCMAAAFSHAVSAADIKVAVVGAMSGPVAQYGD
                     MEFIGARQAIADINAKGGVNGNKLVGVEYDDACDPKQAVAVANKVINDGIRYVIGHLC
                     SSSTQPASDIYEEEGVIMITPAATNADLTTRGYKMVLRTTGLDSDQGPTAAKYIVETI
                     KPQRIAVVHDKQQYGEGLARSVQDSLKKAGANVVLFEGVTAGDKDFSTLVARLKKENV
                     DFVYFGGYYPEMGQILRQSRQAGMTTKFMGPEGVGNSSLSNIAGDASEGMLVTLPKRY
                     DQVPANQPIVDALKAKKLDPTGPFVWTTYAALQSLTTAMTRTGSDEPEKLVADLKAKS
                     VDTVMGPLSWDAKGDLKGFEFGVFEWHKDGTSSAVK"
     misc_feature    127192..128190
                     /locus_tag="PC1_0104"
                     /note="Type I periplasmic ligand-binding domain of ABC
                     (Atpase Binding Cassette)-type active transport systems
                     that are involved in the transport of all three branched
                     chain aliphatic amino acids (leucine, isoleucine and
                     valine); Region: PBP1_ABC_LIVBP_like; cd06342"
                     /db_xref="CDD:107337"
     misc_feature    order(127213..127215,127240..127242,127252..127254,
                     127261..127263,127813..127815,127876..127878,
                     127885..127887,127894..127899,127987..127989)
                     /locus_tag="PC1_0104"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107337"
     misc_feature    127243..128196
                     /locus_tag="PC1_0104"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     misc_feature    order(127411..127419,127480..127485,127630..127632,
                     127786..127788,127858..127860)
                     /locus_tag="PC1_0104"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107337"
     gene            128379..129305
                     /locus_tag="PC1_0105"
                     /db_xref="GeneID:8131005"
     CDS             128379..129305
                     /locus_tag="PC1_0105"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: eca:ECA4340 branched-chain amino acid transporter
                     permease subunit LivH"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_003015703.1"
                     /db_xref="GI:253686513"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="GeneID:8131005"
                     /translation="MSEQFLYFFQQMFNGLTLGSTYALIAIGYTMVYGIIGMINFAHG
                     EVYMIGSYVSFIVIAALMMMGIDAGWLLIGAAFIAAVVISSAYGWSIERVAYRPVRTS
                     KRLIALISAIGMSIFLQNYVSLNQGSRDVALPSLVTGQWVLGESNGFAATISSMQLII
                     WIVTFLAMLALTLFIRYSRMGRACRACAEDLKMASLLGISTDRVISLTFVIGALMAAV
                     AGVLLGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLILGVAEALTSAYLS
                     TEYKDAVSFALLIVVLLVMPTGILGRPEVEKV"
     misc_feature    128421..129278
                     /locus_tag="PC1_0105"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    128952..129008
                     /locus_tag="PC1_0105"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            129302..130576
                     /locus_tag="PC1_0106"
                     /db_xref="GeneID:8131006"
     CDS             129302..130576
                     /locus_tag="PC1_0106"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: eca:ECA4339 leucine/isoleucine/valine transporter
                     permease subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_003015704.1"
                     /db_xref="GI:253686514"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="GeneID:8131006"
                     /translation="MKQLNLFNALVSAFMLLVLASFLMGMQLALDGTKLVVRGADEVR
                     WYWIGAGCVVVFFFQLIRPFFQQSIKKFSAPPLVLPSFDGSTPRQKVLAAALIIAAIA
                     WPFLVSRGTVDIATLTLIYVMLGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLNHYY
                     GLGFWESLPLAGMAAALSGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGG
                     PNGISQIPKPTFFGLEFSRSARDGGWDTFHNFFGLQYDPSDRIIFLYLVALLLVVLTL
                     FVINRLLRMPLGRAWEALRDDEIACRSLGLSPTRIKLTAFTISAAFAGFAGTLFAARQ
                     GFVSPESFTFAESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDLNEYSMLLLGA
                     LMVLMMIWRPQGLLPMKRPEMKLKVAKKEEQA"
     misc_feature    129302..130558
                     /locus_tag="PC1_0106"
                     /note="leucine/isoleucine/valine transporter permease
                     subunit; Provisional; Region: livM; PRK11301"
                     /db_xref="CDD:236896"
     misc_feature    129305..129571
                     /locus_tag="PC1_0106"
                     /note="Domain of unknown function (DUF3382); Region:
                     DUF3382; pfam11862"
                     /db_xref="CDD:256682"
     misc_feature    129656..130522
                     /locus_tag="PC1_0106"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    130196..130252
                     /locus_tag="PC1_0106"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            130573..131343
                     /locus_tag="PC1_0107"
                     /db_xref="GeneID:8131007"
     CDS             130573..131343
                     /locus_tag="PC1_0107"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: eca:ECA4338 leucine/isoleucine/valine transporter
                     ATP-binding subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_003015705.1"
                     /db_xref="GI:253686515"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8131007"
                     /translation="MSAQPLLSVRGLMMRFGGLLAVNNVEMDIHAGEIVSLIGPNGAG
                     KTTVFNCLTGFYRPSGGTIMLRDRHLEGLPGQAIARMGVVRTFQHVRLFREMTVIENL
                     LVAQHQHLKSGVFAGLLKTPGFRRAEADAQERAAVWLERIGLLDLANRQAGNLAYGQQ
                     RRLEIARCMVTRPELLMLDEPAAGLNPKETDELNQLIAELRDSHQVSVLLIEHDMKLV
                     MGISDRIYVVNQGTPLAQGTPAEIRNNPDVIRAYLGEG"
     misc_feature    130576..131337
                     /locus_tag="PC1_0107"
                     /note="leucine/isoleucine/valine transporter ATP-binding
                     subunit; Provisional; Region: livG; PRK11300"
                     /db_xref="CDD:183080"
     misc_feature    130591..131316
                     /locus_tag="PC1_0107"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    130687..130710
                     /locus_tag="PC1_0107"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    order(130696..130701,130705..130713,130834..130836,
                     131107..131112,131209..131211)
                     /locus_tag="PC1_0107"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    130825..130836
                     /locus_tag="PC1_0107"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    131035..131064
                     /locus_tag="PC1_0107"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    131095..131112
                     /locus_tag="PC1_0107"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    131119..131130
                     /locus_tag="PC1_0107"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    131197..131217
                     /locus_tag="PC1_0107"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            131349..132050
                     /locus_tag="PC1_0108"
                     /db_xref="GeneID:8131008"
     CDS             131349..132050
                     /locus_tag="PC1_0108"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: eca:ECA4337 leucine/isoleucine/valine transporter
                     ATP-binding subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_003015706.1"
                     /db_xref="GI:253686516"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8131008"
                     /translation="MLSLHQVSAHYGKIQALHQVSLHINQGEIVTLIGANGAGKTTLL
                     GTLCGDPRATEGTITFDGKDITNWQTAQIMREAIAIVPEGRRVFSRMTVEENLAMGGF
                     FADREQYQERIARVYDLFPRLYERRAQRSGTMSGGEQQMLAIGRALMSQPRLLLLDEP
                     SLGLAPIIILQIFDTIQQLREEGMTIFLVEQNANQALKLADRGYVLENGHVVLEDTGA
                     ALLANEAVRSAYLGG"
     misc_feature    131349..132047
                     /locus_tag="PC1_0108"
                     /note="leucine/isoleucine/valine transporter ATP-binding
                     subunit; Provisional; Region: livF; PRK11614"
                     /db_xref="CDD:183231"
     misc_feature    131352..132017
                     /locus_tag="PC1_0108"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    131448..131471
                     /locus_tag="PC1_0108"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    order(131457..131462,131466..131474,131595..131597,
                     131820..131825,131919..131921)
                     /locus_tag="PC1_0108"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    131586..131597
                     /locus_tag="PC1_0108"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    131748..131777
                     /locus_tag="PC1_0108"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    131808..131825
                     /locus_tag="PC1_0108"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    131832..131843
                     /locus_tag="PC1_0108"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    131907..131927
                     /locus_tag="PC1_0108"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            132080..133270
                     /locus_tag="PC1_0109"
                     /db_xref="GeneID:8131009"
     CDS             132080..133270
                     /locus_tag="PC1_0109"
                     /inference="protein motif:PFAM:PF00155"
                     /note="PFAM: aminotransferase class I and II;
                     KEGG: eca:ECA4336 putative aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative GntR family transcriptional regulator"
                     /protein_id="YP_003015707.1"
                     /db_xref="GI:253686517"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="GeneID:8131009"
                     /translation="MAIEGLLAHRIAQLKSSAIRELLKHSKMENIISLAGGIPSDALF
                     DFEGLSQATHLAITEQPKTAFQYGLTEGSGVLRDRIAELCAVRGVKTRGDDIVVTAGS
                     QQALDLIMRSMVDPGDVFVVERPTYLAALQTLELAQAQVMSVSSDANGMVVDELEELL
                     KKQRIKGVYIVPNFGNPSGVTLSYERRLQLIQLAERYGFVIIEDDPYGELRFTEERNP
                     TLFQLAQEKLGSTEYVLYTSTFSKVLAPGLRLGWAILPDWLLHKVAIIKQAADLHASA
                     LSQTVAECYLGLGRLDSQIEKIRHAYKHKGELLAQLVEKELGDVITFNQPKGGMFLWA
                     KFRQNDFNTTEWLKKTLDQGVVFVPGEFFFPDNVDYSTLRLSFATATDEQMHEAVARL
                     RRAL"
     misc_feature    132104..133267
                     /locus_tag="PC1_0109"
                     /note="Aspartate/tyrosine/aromatic aminotransferase [Amino
                     acid transport and metabolism]; Region: COG0436"
                     /db_xref="CDD:223513"
     misc_feature    132173..133261
                     /locus_tag="PC1_0109"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(132380..132388,132458..132460,132605..132607,
                     132698..132700,132794..132796,132800..132805,
                     132824..132826)
                     /locus_tag="PC1_0109"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(132389..132391,132488..132490,132677..132679,
                     132818..132826,132911..132913,132920..132922)
                     /locus_tag="PC1_0109"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    132803..132805
                     /locus_tag="PC1_0109"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(133360..135006)
                     /locus_tag="PC1_0110"
                     /db_xref="GeneID:8131010"
     CDS             complement(133360..135006)
                     /locus_tag="PC1_0110"
                     /inference="protein motif:PFAM:PF00015"
                     /note="PFAM: chemotaxis sensory transducer; histidine
                     kinase HAMP region domain protein;
                     SMART: chemotaxis sensory transducer;
                     KEGG: eca:ECA4335 methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_003015708.1"
                     /db_xref="GI:253686518"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:8131010"
                     /translation="MKNMSLGKMLGTGFTLIIVIGFLVAILGRVQLEKLGGNIQLLSQ
                     MRITNLLLMQEVKDNVNIAARSIRNIALLSDQQQMKVEKDRIEQTIARNSELLAKIRK
                     NLVDDDAKTLLSTLDQVRPAYTSSMKKATELAMSNEHDAFRNFLLTEVRTTQASVFDI
                     LDKMVEMQKQLTVELANDSENNALHAGTLMLIIALCSALLGGVVAWWITRKIKRQLGG
                     EPAYTLEVTRQVAQGNLAIAIDRRDGDTTSVLAAMEEMRQSLSNIVGQVHQSSESIAT
                     GASQIAIGNTDLSQRTEEQAANLQETAASMEEMNTTVKQNADTVRSAAQLANAASAAA
                     RKGGDVVNNVVRTMEEITASSRKIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRG
                     FAVVAGEVRSLAQRSASAAREIKDLISISVGKVEAGELLVNEAGVTIEEVVEQSQRVA
                     NLINEIGLTTHEQEQGVSQVNDAVNQLDQVTQQNAALVEESASAADSLNQQARHLVEL
                     MSVFKIDGIQPQRAAPQAATLPRPKLALAANSSHTNWETF"
     misc_feature    complement(134458..135000)
                     /locus_tag="PC1_0110"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(134221..134439)
                     /locus_tag="PC1_0110"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    complement(134077..>134277)
                     /locus_tag="PC1_0110"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(133468..134211)
                     /locus_tag="PC1_0110"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(133531..134130)
                     /locus_tag="PC1_0110"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(133534..133539,133546..133548,
                     133555..133560,133567..133569,133576..133581,
                     133585..133590,133597..133602,133606..133611,
                     133618..133620,133627..133632,133639..133641,
                     133648..133653,133660..133665,133669..133674,
                     133681..133683,133690..133695,133702..133704,
                     133711..133716,133753..133758,133765..133770,
                     133774..133779,133786..133791,133798..133800,
                     133807..133812,133819..133821,133828..133830,
                     133840..133842,133861..133863,133870..133872,
                     133882..133884,133891..133896,133903..133905,
                     133912..133914,133921..133926,133933..133938,
                     133945..133947,133954..133959,133963..133965,
                     133975..133980,133984..133989,133996..133998,
                     134005..134010,134017..134022,134029..134031,
                     134038..134043,134050..134052,134059..134064,
                     134068..134073,134080..134082,134089..134094,
                     134101..134106))
                     /locus_tag="PC1_0110"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(133795..133896)
                     /locus_tag="PC1_0110"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(135598..137268)
                     /locus_tag="PC1_0111"
                     /db_xref="GeneID:8131011"
     CDS             complement(135598..137268)
                     /locus_tag="PC1_0111"
                     /inference="protein motif:PFAM:PF00015"
                     /note="PFAM: chemotaxis sensory transducer; histidine
                     kinase HAMP region domain protein;
                     SMART: chemotaxis sensory transducer;
                     KEGG: eca:ECA4334 methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_003015709.1"
                     /db_xref="GI:253686519"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:8131011"
                     /translation="MNLIKNSSLGKMLGTGFTLVIAIGFLVAVFGRIQLDKLGENIQL
                     LSQVRITNLIMMQEFKDNINTNAIAIRNLTMQEDSRQMQQEKVRIEEMVSRNNALLTK
                     IHDSATEKHAQELVAELERVRPAYSSSYTNAITLAMTNKNSEAQHLLLTDVRAKQEAV
                     FKALNDMVNWQEKLTVDIADQSLKNATHAGTLMVIIALLSVVLGAMISWWITRTIKRQ
                     LGGEPAYTLEVTRQVAQGNLAVAIELRDGDTTSVLAAMEDMRQNLSNLVGQVHQSSES
                     IATGATQIAMGNTDLSQRTEEQAANLQETAASMEQMNTTVKQNAATVRTATELAHSAS
                     TTAQKGGDAVNNVVRTMEDITASSRKIGDIIGVIDSIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRSLAQRSASAAREIKDLINASVANVEMGEKMVNDAGITIKDIVEKSQ
                     HVANLLSEIGLTTHEQEQGVAQVNDAVNQLDQVTQQNAALVEESASAADSLSQQARTL
                     LELMGVFKISGVQAQAPRLSAQVKQPTAPRLALASQSGSTSSDNWETF"
     misc_feature    complement(136711..137253)
                     /locus_tag="PC1_0111"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(136474..136692)
                     /locus_tag="PC1_0111"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    complement(135721..136464)
                     /locus_tag="PC1_0111"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(135784..136383)
                     /locus_tag="PC1_0111"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(135787..135792,135799..135801,
                     135808..135813,135820..135822,135829..135834,
                     135838..135843,135850..135855,135859..135864,
                     135871..135873,135880..135885,135892..135894,
                     135901..135906,135913..135918,135922..135927,
                     135934..135936,135943..135948,135955..135957,
                     135964..135969,136006..136011,136018..136023,
                     136027..136032,136039..136044,136051..136053,
                     136060..136065,136072..136074,136081..136083,
                     136093..136095,136114..136116,136123..136125,
                     136135..136137,136144..136149,136156..136158,
                     136165..136167,136174..136179,136186..136191,
                     136198..136200,136207..136212,136216..136218,
                     136228..136233,136237..136242,136249..136251,
                     136258..136263,136270..136275,136282..136284,
                     136291..136296,136303..136305,136312..136317,
                     136321..136326,136333..136335,136342..136347,
                     136354..136359))
                     /locus_tag="PC1_0111"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(136048..136149)
                     /locus_tag="PC1_0111"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(138182..139852)
                     /locus_tag="PC1_0112"
                     /db_xref="GeneID:8131012"
     CDS             complement(138182..139852)
                     /locus_tag="PC1_0112"
                     /inference="protein motif:PFAM:PF00015"
                     /note="PFAM: chemotaxis sensory transducer; histidine
                     kinase HAMP region domain protein;
                     SMART: chemotaxis sensory transducer;
                     KEGG: eca:ECA4333 methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_003015710.1"
                     /db_xref="GI:253686520"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:8131012"
                     /translation="MQHTKKMKLGTQVGSGFAIVIIIGLLVAIFGRMHLVGLGNTTDR
                     LAKHHLANLIVLQELKDNLNVTIKATLRMLIATEQKVLEDNQKLIETTSAKNTQLVTQ
                     LETNLRATEVRNILGELQQNRTEFARVGRQAVALSLSNRQAESIELVKTQLEPIQTKL
                     FNNLNTMIQLQRDYTTQTATNAIEESYYDGNSLLILAVIASLFGAGIAWLITRHIKKQ
                     LGGEPAYATQVTQEIAQGNLAIPVDLASGDNTSLLFAMNNMRKSLSSIVEQVRESSES
                     IATGARQIAAGSADLSQRTEEQAANLQQTAASTEEMSQTVRQNTDTVRNAAQLAQAAS
                     NTAAKGGEAVGNIVVTMKEITDSSHKINDIISVIDGIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRSLAQRSATAAKEIKELIGHSVEKVETGSALVSDAGTTIEELVRQAR
                     HVADLINEIGITTQEQESGVSQIHEAVNQLDQVTQQNAALVEQSASAADSLSEQAAHL
                     VELMKVFIVEGGAPQRLAPQLKRPDSAKLSLANPKSTTGSDKQNWETF"
     misc_feature    complement(139337..139837)
                     /locus_tag="PC1_0112"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(139058..139276)
                     /locus_tag="PC1_0112"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    complement(138308..139048)
                     /locus_tag="PC1_0112"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(138368..138967)
                     /locus_tag="PC1_0112"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(138371..138376,138383..138385,
                     138392..138397,138404..138406,138413..138418,
                     138422..138427,138434..138439,138443..138448,
                     138455..138457,138464..138469,138476..138478,
                     138485..138490,138497..138502,138506..138511,
                     138518..138520,138527..138532,138539..138541,
                     138548..138553,138590..138595,138602..138607,
                     138611..138616,138623..138628,138635..138637,
                     138644..138649,138656..138658,138665..138667,
                     138677..138679,138698..138700,138707..138709,
                     138719..138721,138728..138733,138740..138742,
                     138749..138751,138758..138763,138770..138775,
                     138782..138784,138791..138796,138800..138802,
                     138812..138817,138821..138826,138833..138835,
                     138842..138847,138854..138859,138866..138868,
                     138875..138880,138887..138889,138896..138901,
                     138905..138910,138917..138919,138926..138931,
                     138938..138943))
                     /locus_tag="PC1_0112"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(138632..138733)
                     /locus_tag="PC1_0112"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(140132..141811)
                     /locus_tag="PC1_0113"
                     /db_xref="GeneID:8131013"
     CDS             complement(140132..141811)
                     /locus_tag="PC1_0113"
                     /inference="protein motif:PFAM:PF00015"
                     /note="PFAM: chemotaxis sensory transducer;
                     SMART: chemotaxis sensory transducer;
                     KEGG: eca:ECA4332 methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_003015711.1"
                     /db_xref="GI:253686521"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:8131013"
                     /translation="MNFLAKMKLGTMLGAGFASVIIIGLMVAVLGRAHLVDLGEDIES
                     LSEKNLTSLILIQDAKNGFDAVARSVRNIGLTDDRSRIQEEKRLIDQQIARNTEILTK
                     LYEHMSEPETRDTLESLTQARPAYRDTVNKAVELGLSENAEERARAVQIMVNEMQVTQ
                     APVFAALDSMREFQKTRTLDMTTSAMQEARSDGNMLIVFAAIAVLVGILVSVLITRTI
                     KGLLGGEVAYAAQIAQAVAQGNLAVAVNLRPGDDRSVLAAMNGMRKSLSSIVEQVRES
                     SESIATGASQIAAGSTDLSQRTEEQAANLQQTAASMEEMSQTVRQNSDTVRNAAQLAQ
                     AASNTAAKGGEAVGNIVVTMKEITDSSHKIGDIISVIDGIAFQTNILALNAAVEAARA
                     GEQGRGFAVVAGEVRSLAQRSATAAKEIKELIGHSVEKVETGSALVSDAGTTIEELVR
                     QARHVADLINEIGVTTQEQESGVSQIHDAVNQLDQVTQQNAALVEQSASAADSLSDQA
                     AHLVELMKVFVVEGGSSQRLAPQLKRPDSAKLSLANSRSRAGSDTQNWEQF"
     misc_feature    complement(141287..141796)
                     /locus_tag="PC1_0113"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(140258..140998)
                     /locus_tag="PC1_0113"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(140318..140917)
                     /locus_tag="PC1_0113"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(140321..140326,140333..140335,
                     140342..140347,140354..140356,140363..140368,
                     140372..140377,140384..140389,140393..140398,
                     140405..140407,140414..140419,140426..140428,
                     140435..140440,140447..140452,140456..140461,
                     140468..140470,140477..140482,140489..140491,
                     140498..140503,140540..140545,140552..140557,
                     140561..140566,140573..140578,140585..140587,
                     140594..140599,140606..140608,140615..140617,
                     140627..140629,140648..140650,140657..140659,
                     140669..140671,140678..140683,140690..140692,
                     140699..140701,140708..140713,140720..140725,
                     140732..140734,140741..140746,140750..140752,
                     140762..140767,140771..140776,140783..140785,
                     140792..140797,140804..140809,140816..140818,
                     140825..140830,140837..140839,140846..140851,
                     140855..140860,140867..140869,140876..140881,
                     140888..140893))
                     /locus_tag="PC1_0113"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(140582..140683)
                     /locus_tag="PC1_0113"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(142116..143474)
                     /locus_tag="PC1_0114"
                     /db_xref="GeneID:8131014"
     CDS             complement(142116..143474)
                     /locus_tag="PC1_0114"
                     /inference="protein motif:TFAM:TIGR00791"
                     /note="TIGRFAM: gluconate transporter;
                     PFAM: Gluconate transporter; Citrate transporter;
                     KEGG: eca:ECA4331 inner membrane permease YgbN"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate transporter"
                     /protein_id="YP_003015712.1"
                     /db_xref="GI:253686522"
                     /db_xref="InterPro:IPR003474"
                     /db_xref="InterPro:IPR004680"
                     /db_xref="GeneID:8131014"
                     /translation="MATSLLLCIAIAGVLLLLLMVIKFKIQPFVALLVVSLLVALATG
                     IPTEEIMKVMSSGMGGVLGSITMIIGLGAMLGRMIEISGGAESLARKFTQTLGEKRVI
                     AALTMAAFILGIPVFFDVGFIILAPIIYGFAKVAKVSPLKFGLPVAGVMLTVHVALPP
                     HPGPVAAASLLKADVGWLTILGLAISIPVGIIGFWVAKYINRRQYALSVDVLEQLQLT
                     KTEDKSEAVQHKNAPSASLVTALIVIPIAIIMLGTVAATLFPVGHPLRNITTLVGSPA
                     VALLIALALAFYFIAMRRGWSLEKTGNVMGDAMPAAAVVIMVTGAGGVFGKVLVESGV
                     GKALADTLTSIHLPLVPAAFLLSLALRASQGSATVAILTTCGLLSEAVSGLNQMQLVL
                     VTLSACFGGLGLSHVNDSGFWIVTKYLGLSVADGLRTWTVLTTILGLAGFLFTWALWL
                     VM"
     misc_feature    complement(142119..143474)
                     /locus_tag="PC1_0114"
                     /note="putative transporter; Provisional; Region:
                     PRK09821"
                     /db_xref="CDD:182094"
     misc_feature    complement(142122..143462)
                     /locus_tag="PC1_0114"
                     /note="GntP family permease; Region: GntP_permease;
                     pfam02447"
                     /db_xref="CDD:251299"
     gene            complement(143665..144447)
                     /locus_tag="PC1_0115"
                     /db_xref="GeneID:8131015"
     CDS             complement(143665..144447)
                     /locus_tag="PC1_0115"
                     /EC_number="5.3.1.22"
                     /inference="protein motif:PRIAM:5.3.1.22"
                     /note="PFAM: Xylose isomerase domain protein TIM barrel;
                     KEGG: eca:ECA4330 putative isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="Hydroxypyruvate isomerase"
                     /protein_id="YP_003015713.1"
                     /db_xref="GI:253686523"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="GeneID:8131015"
                     /translation="MPKFAANLSMLFTDVPFLDRFKAAADAGFTSVEYLFPYEYPAPL
                     LAEKLRENGLKQVLFNTAPGNIAAGEWGVSALPDRIEDARRDIDNALEYALALNCPSV
                     LVMGGVVPPGEDRAAYQQTFIDNLRYAADKFAPHGINIMIEALSAKVKPNYLFASQYQ
                     ALELSNLIDRPNVYIQLDFFHAQIVDGNLTQIIHDLDGRIGHIQIASVPARHEPDEGE
                     INYPFIFAELDRVNYGGWVGCEYNPRGKTEDGLGWIKPWLKK"
     misc_feature    complement(143677..144447)
                     /locus_tag="PC1_0115"
                     /note="Fructose/tagarose-bisphosphate aldolase class II.
                     This family includes fructose-1,6-bisphosphate (FBP) and
                     tagarose 1,6-bisphosphate (TBP) aldolases. FBP-aldolase is
                     homodimeric and used in gluconeogenesis and glycolysis;
                     the enzyme controls the...; Region: FTBP_aldolase_II;
                     cl17181"
                     /db_xref="CDD:266533"
     misc_feature    complement(143677..144447)
                     /locus_tag="PC1_0115"
                     /note="Hydroxypyruvate isomerase [Carbohydrate transport
                     and metabolism]; Region: Hfi; COG3622"
                     /db_xref="CDD:226149"
     gene            complement(144481..145137)
                     /locus_tag="PC1_0116"
                     /db_xref="GeneID:8131016"
     CDS             complement(144481..145137)
                     /locus_tag="PC1_0116"
                     /EC_number="4.1.2.17"
                     /inference="protein motif:PRIAM:4.1.2.17"
                     /note="PFAM: class II aldolase/adducin family protein;
                     KEGG: eca:ECA4329 putative aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-fuculose-phosphate aldolase"
                     /protein_id="YP_003015714.1"
                     /db_xref="GI:253686524"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="GeneID:8131016"
                     /translation="MSEKHHNTEAALNSEQRARAEMVKLGASFFQRGYATGSAGNLSL
                     LLDDGTLLATPTGSCLGDLDAERLSKVSLSGEWISGDKPSKEVSFHLSIYRNDPECKA
                     IVHLHSTYLTALSCLEGLDTQDAIKPFTPYVVMRVGKVPVVPYYRPGDARLGEDLAKL
                     ASRYKAFLLANHGPVVTGKDLRAAADNMEELEETAKLIFILDDRKIRYLTADDIAELS
                     "
     misc_feature    complement(144487..145098)
                     /locus_tag="PC1_0116"
                     /note="putative aldolase; Validated; Region: PRK08130"
                     /db_xref="CDD:181241"
     misc_feature    complement(order(144559..144561,144571..144573,
                     144592..144594,144625..144627,144703..144705,
                     144742..144744,144748..144750,144787..144795,
                     144808..144813,144817..144819,144952..144957,
                     144961..144963,145030..145032))
                     /locus_tag="PC1_0116"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(144622..144624,144817..144819,
                     144823..144825,144880..144888,144967..144972,
                     145015..145017))
                     /locus_tag="PC1_0116"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(144622..144624,144817..144819,
                     144823..144825))
                     /locus_tag="PC1_0116"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     gene            complement(145134..146408)
                     /locus_tag="PC1_0117"
                     /db_xref="GeneID:8131017"
     CDS             complement(145134..146408)
                     /locus_tag="PC1_0117"
                     /inference="protein motif:PFAM:PF07005"
                     /note="PFAM: type III effector Hrp-dependent outers;
                     KEGG: eca:ECA4328 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Hrp dependent type III effector protein"
                     /protein_id="YP_003015715.1"
                     /db_xref="GI:253686525"
                     /db_xref="InterPro:IPR010737"
                     /db_xref="GeneID:8131017"
                     /translation="MIKLGVIADDFTGATDIASFLVNNGLPTVQLNGVPPSDFKVDTQ
                     AVVISLKSRSCPAEQAVADSLKALAWLQQQGCQQFYFKYCSTFDSTAKGNIGPVTDAL
                     LEQLGETQTIISPALPVNGRTVYQGHLFVMDQLLSESGMRHHPVTPMTDSNLMRVMEQ
                     QAAGQCGLVPYAVMDQGAEAVKQRLAQLKEQGIRYVVLDTLNEQHLLTQGEALRDMKL
                     VTGGSGLAIGLARQLADSTKQTGSATEAGKPQSGAGVVLSGSCSVMTNKQVAHYLKQA
                     AGRAIDVARCLESDDAQQAYVQELADWVKAHRDDALAPLLYATSSPDELAQIQQRWGA
                     EASSQAVEKLFAAVARQLQQDGFQRFIIAGGETSSIVVQTLGIHAFHIGPSISPGVPW
                     VRSTNHPLSLALKSGNFGDEDFFARAQKEFAA"
     misc_feature    complement(145140..146405)
                     /locus_tag="PC1_0117"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3395"
                     /db_xref="CDD:225930"
     gene            complement(146405..147319)
                     /locus_tag="PC1_0118"
                     /db_xref="GeneID:8131018"
     CDS             complement(146405..147319)
                     /locus_tag="PC1_0118"
                     /EC_number="1.1.1.60"
                     /inference="protein motif:PRIAM:1.1.1.60"
                     /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
                     KEGG: eca:ECA4327 putative oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxy-3-oxopropionate reductase"
                     /protein_id="YP_003015716.1"
                     /db_xref="GI:253686526"
                     /db_xref="InterPro:IPR002204"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="GeneID:8131018"
                     /translation="MKKTSDYAVAVIGLGSMGFGAAASCINAGLTTYGVDINPQALER
                     LRQAGAAQADTRIDAFADKLDAVVLLVVNAAQVNGILFGEPQVAAKLKPGTVVMVSST
                     ISAQDAKNIEQRLAEHQLIMLDAPVSGGAAKAAAGDMTVMASGSDLAFEKLKPVLDAV
                     AGKVYRIGEEIGLGATVKIIHQLLAGVHIAAGAEAMALAARADIPLDIMYDVVTNAAG
                     NSWMFENRMRHVVDGDYTPKSAVDIFVKDLGLVTDTAKSLHFPLPLASTAFNMFTAAS
                     NAGFGKEDDSAVIKIFNGITLPEKKEAP"
     misc_feature    complement(146444..147295)
                     /locus_tag="PC1_0118"
                     /note="3-hydroxyisobutyrate dehydrogenase and related
                     beta-hydroxyacid dehydrogenases [Lipid metabolism];
                     Region: MmsB; COG2084"
                     /db_xref="CDD:224995"
     misc_feature    complement(146813..147295)
                     /locus_tag="PC1_0118"
                     /note="NAD binding domain of 6-phosphogluconate
                     dehydrogenase; Region: NAD_binding_2; pfam03446"
                     /db_xref="CDD:251959"
     misc_feature    complement(146450..146806)
                     /locus_tag="PC1_0118"
                     /note="NAD-binding of NADP-dependent 3-hydroxyisobutyrate
                     dehydrogenase; Region: NAD_binding_11; pfam14833"
                     /db_xref="CDD:258970"
     gene            147656..148414
                     /locus_tag="PC1_0119"
                     /db_xref="GeneID:8131019"
     CDS             147656..148414
                     /locus_tag="PC1_0119"
                     /inference="protein motif:PFAM:PF08220"
                     /note="PFAM: regulatory protein DeoR; Helix-turn-helix
                     type 11 domain protein;
                     SMART: regulatory protein DeoR;
                     KEGG: eca:ECA4325 DeoR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="YP_003015717.1"
                     /db_xref="GI:253686527"
                     /db_xref="InterPro:IPR001034"
                     /db_xref="InterPro:IPR013196"
                     /db_xref="InterPro:IPR014036"
                     /db_xref="GeneID:8131019"
                     /translation="MIPVERHQQILALIAERGVVSINELTERLGVSHMTVRRDVQKLE
                     QDGLLLSVSGGVRSPERLAIEPSHQDKSVMFSQQKAAMGKLAAQHIPLNSCIYLDAGT
                     TTLSLARELAERDDLLIVTNDFAIAAFLIESSQCRMIHTGGTLCRENRSCIGEAVAQA
                     LRNLFIDIAFISASSWSLRGLSTPNEDKVVVKRAAVEASSKCVLLCDTSKYGRIATHL
                     ATPLSVFDSIITDDGLPAAAKEALSKMGVEVLVA"
     misc_feature    147656..148411
                     /locus_tag="PC1_0119"
                     /note="Transcriptional regulators of sugar metabolism
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: GlpR; COG1349"
                     /db_xref="CDD:224268"
     misc_feature    147671..147829
                     /locus_tag="PC1_0119"
                     /note="helix_turn_helix, Deoxyribose operon repressor;
                     Region: HTH_DEOR; smart00420"
                     /db_xref="CDD:197714"
     misc_feature    147872..148354
                     /locus_tag="PC1_0119"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            148530..149225
                     /locus_tag="PC1_0120"
                     /db_xref="GeneID:8131020"
     CDS             148530..149225
                     /locus_tag="PC1_0120"
                     /inference="similar to AA sequence:KEGG:ECA4324"
                     /note="KEGG: eca:ECA4324 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015718.1"
                     /db_xref="GI:253686528"
                     /db_xref="GeneID:8131020"
                     /translation="MSVRSEIIDGRQASGVTYGLIYTEVLGWIDLGHAKGDDIKDIIQ
                     QMYVGENTEDGMPYYDVTYKQGMIGLRRSVTINRFIKWRIKKGRSLQERHSIALAMML
                     TVAKRFESMQASFPFNLVTDSGFSGEDLVSDLLGFYRVVSTPNPFYLLRPVSKEEALK
                     RWDFYGPIGNFKNIGFRPILFPDPELMSYAQPRLGFLPSFMQTIQPYNDFESGNVGIA
                     SYDGTELTTNFFK"
     gene            149227..149643
                     /locus_tag="PC1_0121"
                     /db_xref="GeneID:8131021"
     CDS             149227..149643
                     /locus_tag="PC1_0121"
                     /inference="similar to AA sequence:KEGG:ECA4323"
                     /note="KEGG: eca:ECA4323 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015719.1"
                     /db_xref="GI:253686529"
                     /db_xref="GeneID:8131021"
                     /translation="MKKKIIIPLVISLLIALPLIYYWPAMVILTEGSSRYTEQDTRRY
                     EMLTDEIIKNCPRISSIYDFGYATVDGPALEVSNITFQNTNDATSIRGYLASLGFTLS
                     YTDTAGEYWKSTDSDKTIHIGIINDPKTVIVDVIRK"
     gene            149754..150032
                     /locus_tag="PC1_0122"
                     /db_xref="GeneID:8131022"
     CDS             149754..150032
                     /locus_tag="PC1_0122"
                     /inference="protein motif:PFAM:PF08681"
                     /note="PFAM: Protein of unknown function DUF1778;
                     KEGG: ecf:ECH74115_4726 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015720.1"
                     /db_xref="GI:253686530"
                     /db_xref="InterPro:IPR014795"
                     /db_xref="GeneID:8131022"
                     /translation="MKPETKEAPINIRAKASQWDLIDRAANLVSKSRTDFMLEAACRE
                     AQDILLDQRLFILDNEQFDGLLAELDAPITAERHARINDLMCRQSPWE"
     misc_feature    149754..150029
                     /locus_tag="PC1_0122"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4453"
                     /db_xref="CDD:226860"
     gene            complement(150108..150401)
                     /locus_tag="PC1_0123"
                     /db_xref="GeneID:8131023"
     CDS             complement(150108..150401)
                     /locus_tag="PC1_0123"
                     /inference="protein motif:PFAM:PF05016"
                     /note="PFAM: plasmid stabilization system;
                     KEGG: son:SO_A0079 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization system"
                     /protein_id="YP_003015721.1"
                     /db_xref="GI:253686531"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="GeneID:8131023"
                     /translation="MYKLSNLAAEDFAGIFEYTLINYGISQADNYTESLENTLILLAE
                     SPYIGQEYPEISQGVRRFDHRQHAIFYRIREEDLLIIRILHQQMEPMCHFFDI"
     misc_feature    complement(150114..150401)
                     /locus_tag="PC1_0123"
                     /note="Plasmid stabilization system protein [General
                     function prediction only]; Region: ParE; COG3668"
                     /db_xref="CDD:226194"
     gene            complement(150394..150636)
                     /locus_tag="PC1_0124"
                     /db_xref="GeneID:8131024"
     CDS             complement(150394..150636)
                     /locus_tag="PC1_0124"
                     /inference="protein motif:TFAM:TIGR02606"
                     /note="TIGRFAM: addiction module antidote protein, CC2985
                     family;
                     PFAM: protein of unknown function UPF0156;
                     KEGG: son:SO_A0078 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative CopG/Arc/MetJ family addiction module
                     antidote protein"
                     /protein_id="YP_003015722.1"
                     /db_xref="GI:253686532"
                     /db_xref="InterPro:IPR005360"
                     /db_xref="GeneID:8131024"
                     /translation="MPRTTSITIGEQLDDFVSKLIDSGRYSSTSEVIRSALRLLEQQE
                     SKTEALKKAIYAGEQSGESSLTLREIAAKKKRERNV"
     misc_feature    complement(150406..150636)
                     /locus_tag="PC1_0124"
                     /note="Uncharacterized protein family (UPF0156); Region:
                     RHH_2; cl17383"
                     /db_xref="CDD:247937"
     gene            150833..152167
                     /locus_tag="PC1_0125"
                     /db_xref="GeneID:8131025"
     CDS             150833..152167
                     /locus_tag="PC1_0125"
                     /inference="protein motif:PFAM:PF01547"
                     /note="PFAM: extracellular solute-binding protein family
                     1;
                     KEGG: eca:ECA4322 glycerol-3-phosphate transporter
                     periplasmic binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 1 extracellular solute-binding protein"
                     /protein_id="YP_003015723.1"
                     /db_xref="GI:253686533"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="InterPro:IPR006061"
                     /db_xref="GeneID:8131025"
                     /translation="MFNNTTRKTHAIRTAAACVALALMSASAQAATEIPFWHSMEGEL
                     GKEVNSLADRFNKAHSDVKIVPVYKGNYEQNLAAGIAAYRAGNAPAILQVYEVGTATM
                     MASKAIKPVYEVFKESGINFDESVFVPTVSGYYTDAKSGHLLSQPFNSSTPVLYYNKD
                     AFKKAGLDPEQPPKTWQQMAEYTAKLRAAGMKCGYASGWQGWIQIENFSAWHGLPVAS
                     KNNGFDGTDAVLEFNKPTQVKHIQLLQDMNKKGDFTYFGRKDEPTEKFYNGDCAITTA
                     SSGSLANIREHAKFNYGVGMMPYDADAKGAPQNAIIGGASLWVMGGKDAATYKGVAEF
                     MKFLAEPENAAEWHQKTGYLPITTAAYELTQKQGFYEKNPGADIATRQMLNKPPLPFT
                     KGLRLGNMPQIRTVVDEELESVWTGKKTPQQALDSAVERGNALLRRFEQSTK"
     misc_feature    150857..152164
                     /locus_tag="PC1_0125"
                     /note="glycerol-3-phosphate transporter periplasmic
                     binding protein; Provisional; Region: PRK10974"
                     /db_xref="CDD:182876"
     misc_feature    150863..152149
                     /locus_tag="PC1_0125"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     gene            152240..153127
                     /locus_tag="PC1_0126"
                     /db_xref="GeneID:8131026"
     CDS             152240..153127
                     /locus_tag="PC1_0126"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: eca:ECA4321 glycerol-3-phosphate transporter
                     permease"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_003015724.1"
                     /db_xref="GI:253686534"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8131026"
                     /translation="MTSSRPVFRSSWLPYVLVLPQLLITVIFFIWPAGQALWYSVQNL
                     DPFGLSSEFVGMENFKQLFNNPYYLDSFYTTLIFSFLVAGFGMLISLFLAALVDYVIR
                     ASRLYQTLIILPYAVAPAVAAVLWMFLFNPGLGLITHFLGLMGYTWNHAQHSGQAMFL
                     VVLASVWKQISYNFLFFLAALQSIPRSLVEAGAIDGAGPVRRFFNLVLPMISPVSFFL
                     LVVNLVYAFFDTFPIIDAATAGGPVQSTTTLIYKIYREGFAGLDLSSSAAQSVVLMML
                     VIGLTIIQFRFVERKVNYQ"
     misc_feature    152465..153073
                     /locus_tag="PC1_0126"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(152513..152518,152525..152530,152543..152545,
                     152573..152584,152588..152617,152624..152629,
                     152660..152662,152735..152740,152747..152749,
                     152753..152755,152762..152767,152771..152773,
                     152783..152788,152795..152797,152846..152848,
                     152888..152893,152900..152902,152921..152932,
                     152948..152953,152990..152995,153023..153028,
                     153035..153040,153044..153049,153056..153061,
                     153068..153073)
                     /locus_tag="PC1_0126"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(152591..152629,152657..152662,152921..152938)
                     /locus_tag="PC1_0126"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(152660..152662,152720..152722,152948..152950,
                     152984..152986,152993..152995,153023..153025)
                     /locus_tag="PC1_0126"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(152798..152836,152852..152857,152867..152869)
                     /locus_tag="PC1_0126"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            153140..153985
                     /locus_tag="PC1_0127"
                     /db_xref="GeneID:8131027"
     CDS             153140..153985
                     /locus_tag="PC1_0127"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: eca:ECA4320 glycerol-3-phosphate transporter
                     membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_003015725.1"
                     /db_xref="GI:253686535"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8131027"
                     /translation="MIENRRGLDIFSHVMLIVGILAVLFPLYVGFVAATLDNQEVFQA
                     PMTLIPGTHLWENLRYIWLHGAGNNTTPFGLMLLNSFVMALAITVGKITVSILSAYAI
                     VYFRFPLRNLFFWMIFLTLMLPVEVRIFPTVEVIARLDMMDSYTGLTLPLMASATATF
                     LFRQFFMTLPDELMEAARIDGASPMRFFFDMVLPLSKTNLAALFVITFIYGWNQYLWP
                     LLIISDANLGTAVAGIKSMIASGDGATQWNQVMAAMLLTMLPPLLVVLLMQRWFVRGL
                     VDSEK"
     misc_feature    153152..153970
                     /locus_tag="PC1_0127"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    153368..153832
                     /locus_tag="PC1_0127"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(153416..153421,153428..153433,153446..153448,
                     153476..153487,153491..153520,153527..153532,
                     153536..153538,153593..153598,153602..153604,
                     153608..153610,153617..153622,153626..153628,
                     153638..153643,153650..153652,153701..153703,
                     153743..153748,153755..153757,153776..153787,
                     153794..153799)
                     /locus_tag="PC1_0127"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(153494..153538,153776..153793)
                     /locus_tag="PC1_0127"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(153536..153538,153794..153796,153830..153832)
                     /locus_tag="PC1_0127"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(153653..153691,153707..153712,153722..153724)
                     /locus_tag="PC1_0127"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            154011..155084
                     /locus_tag="PC1_0128"
                     /db_xref="GeneID:8131028"
     CDS             154011..155084
                     /locus_tag="PC1_0128"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related; Transport-associated
                     OB domain protein;
                     SMART: AAA ATPase;
                     KEGG: eca:ECA4319 glycerol-3-phosphate transporter
                     ATP-binding subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_003015726.1"
                     /db_xref="GI:253686536"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013611"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8131028"
                     /translation="MACLKLQAVTKSYDGKIQIIQPIDLDVADGEFVVMVGPSGCGKS
                     TLLRMVAGLERTTSGDIYIDNQRVTDLEPKDRGIAMVFQNYALYPHMNVFDNMAYGLK
                     IRGFGKAQIRERVEDAARILELMPLLQRKPRELSGGQRQRVAMGRAIVREPAVFLFDE
                     PLSNLDAKLRVQMRLELQQLHQRLKTTSLYVTHDQVEAMTLAQRVIVMNKGIAEQIGA
                     PADIYRRPASLFVASFIGSPAMNLWSGRISDDGCRFEIGGDIALALPEPKPQWRGKAL
                     TLGVRPEHIQLATRETDGIPLQIDTLELLGADNLAHGKWGGQNVIARLSYEHCPAIGS
                     TLWLHLPTSSWHLFDSQSGLRME"
     misc_feature    154011..155081
                     /locus_tag="PC1_0128"
                     /note="glycerol-3-phosphate transporter ATP-binding
                     subunit; Provisional; Region: ugpC; PRK11650"
                     /db_xref="CDD:236947"
     misc_feature    154020..154661
                     /locus_tag="PC1_0128"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    154119..154142
                     /locus_tag="PC1_0128"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(154128..154133,154137..154145,154257..154259,
                     154485..154490,154587..154589)
                     /locus_tag="PC1_0128"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    154248..154259
                     /locus_tag="PC1_0128"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    154413..154442
                     /locus_tag="PC1_0128"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    154473..154490
                     /locus_tag="PC1_0128"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    154497..154508
                     /locus_tag="PC1_0128"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    154575..154595
                     /locus_tag="PC1_0128"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    154842..155054
                     /locus_tag="PC1_0128"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            155084..155833
                     /locus_tag="PC1_0129"
                     /db_xref="GeneID:8131029"
     CDS             155084..155833
                     /locus_tag="PC1_0129"
                     /inference="protein motif:PFAM:PF03009"
                     /note="PFAM: glycerophosphoryl diester phosphodiesterase;
                     KEGG: eca:ECA4318 cytoplasmic glycerophosphodiester
                     phosphodiesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="YP_003015727.1"
                     /db_xref="GI:253686537"
                     /db_xref="InterPro:IPR004129"
                     /db_xref="GeneID:8131029"
                     /translation="METIWPYPNIVAHRGGGSLAPENTLAAIDVGASLGHKMIEFDAK
                     LSQDGQIFLLHDDTLERTSNGWGIAGELPWDKLVGLDVGGWYGHKFVGERLPLLSEVA
                     KRCVQYGMAANIEIKPTTGYETETGRVIALAARQLWADHPVAPLLSSFSIDALEAAQQ
                     AAPELPRGLLLDEWDEDWLTLTQRLGCVSIHLNHQLLTAERVAELKAAGLRILVYTVN
                     QPDRAQTLLDWGVDCICTDRIDLIGASFATG"
     misc_feature    155084..155830
                     /locus_tag="PC1_0129"
                     /note="cytoplasmic glycerophosphodiester
                     phosphodiesterase; Provisional; Region: ugpQ; PRK09454"
                     /db_xref="CDD:236524"
     misc_feature    155111..155800
                     /locus_tag="PC1_0129"
                     /note="Glycerophosphodiester phosphodiesterase domain in
                     Escherichia coli cytosolic glycerophosphodiester
                     phosphodiesterase UgpQ and similar proteins; Region:
                     GDPD_EcUgpQ_like; cd08562"
                     /db_xref="CDD:176505"
     misc_feature    order(155120..155122,155201..155203,155207..155209,
                     155246..155248,155426..155428,155525..155527,
                     155726..155728)
                     /locus_tag="PC1_0129"
                     /note="putative active site [active]"
                     /db_xref="CDD:176505"
     misc_feature    order(155120..155122,155246..155248)
                     /locus_tag="PC1_0129"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176505"
     misc_feature    order(155201..155203,155207..155209,155426..155428)
                     /locus_tag="PC1_0129"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176505"
     gene            155909..156865
                     /locus_tag="PC1_0130"
                     /db_xref="GeneID:8131030"
     CDS             155909..156865
                     /locus_tag="PC1_0130"
                     /inference="protein motif:PFAM:PF03547"
                     /note="PFAM: Auxin Efflux Carrier;
                     KEGG: eca:ECA4317 putative transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="auxin efflux carrier"
                     /protein_id="YP_003015728.1"
                     /db_xref="GI:253686538"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="GeneID:8131030"
                     /translation="MPAFIVSLWHQIFLSLPLFVLIALGYSLIRYGKWPTTVTDGMTR
                     FVFSVAMPAMLFRLMSDFSQRPVVDARLLIAFFGGCLLVFVLGRIVARKIFHLDGVSG
                     SLFALSGIFSNNVMLGLPIATLMLGEEAIPSVALVVVFNGLILWTLVTVSVEWARNGA
                     LSLQGFTKTALGVLKNPLIIGILSGTAFSLTGLPLPSYIDQPLSMLGQIAAPLSLVAL
                     GMGLAEYRVRDGWQISTAICTIKLLVQPLVIWGIAIALSLPEMETRAVVLLGSMAVGV
                     NVYLMSRQFGVLGGPVASSLLLSTAMAALTTPLILTLMGVRL"
     misc_feature    155927..156853
                     /locus_tag="PC1_0130"
                     /note="Predicted permeases [General function prediction
                     only]; Region: COG0679"
                     /db_xref="CDD:223751"
     gene            complement(156879..157175)
                     /locus_tag="PC1_0131"
                     /db_xref="GeneID:8131031"
     CDS             complement(156879..157175)
                     /locus_tag="PC1_0131"
                     /inference="similar to AA sequence:KEGG:ECA4316"
                     /note="KEGG: eca:ECA4316 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015729.1"
                     /db_xref="GI:253686539"
                     /db_xref="GeneID:8131031"
                     /translation="MKHPTTLLACTVLLGLPLLASANTTQAPTPQQQFESGISSQKQL
                     QQNMQQSQKVQQQQLNQQLQQRNQQLQQQRQQQLQKDLERSQRTTPPPPIKQNP"
     gene            157372..157836
                     /locus_tag="PC1_0132"
                     /db_xref="GeneID:8131032"
     CDS             157372..157836
                     /locus_tag="PC1_0132"
                     /inference="protein motif:PFAM:PF00588"
                     /note="PFAM: tRNA/rRNA methyltransferase (SpoU);
                     KEGG: eca:ECA4315 putative RNA-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA/rRNA methyltransferase SpoU"
                     /protein_id="YP_003015730.1"
                     /db_xref="GI:253686540"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="GeneID:8131032"
                     /translation="MFHIALYEPQIAPNTGNIIRLAANNGCTLHLIEPLGFDFEEKKL
                     RRAGLDYHDLANVSRHKNYQDFLAAVPGKRIFACTTKGSRPYDQPAYQPGDVLLFGSE
                     TSGLPDEIRNGFESDFRIRIPMQSNNRSLNLSNAVAIISYEAWRQNGFGGCL"
     misc_feature    157372..157827
                     /locus_tag="PC1_0132"
                     /note="Predicted rRNA methylase (SpoU class) [Translation,
                     ribosomal structure and biogenesis]; Region: CspR;
                     COG0219"
                     /db_xref="CDD:223297"
     gene            complement(157847..158647)
                     /locus_tag="PC1_0133"
                     /db_xref="GeneID:8131033"
     CDS             complement(157847..158647)
                     /locus_tag="PC1_0133"
                     /inference="similar to AA sequence:KEGG:ECA4314"
                     /note="KEGG: eca:ECA4314 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015731.1"
                     /db_xref="GI:253686541"
                     /db_xref="GeneID:8131033"
                     /translation="MGRQARLLLVTPSIVLACILSFCTQATSVNAAPSTVNAANTTVD
                     ATRYQDFWLWAAVKPQPILHQAQTLYLHQGEVARRQGKVVFLRQGIPPSQLRVNRVWL
                     AFRMTTLELSDRHLNRMLKLREKWQRHGNQIVGIQIDFDAKSYQLAGYVAFLTQLRER
                     LPEDCQLSITGLLDWSKTGDVSALNRLQGKLDEVVVQTYQGRNTITNYAEYLPALMKL
                     TLPFRVGLVQNGKWEPQWQQRLATSPYYRGEVVFLVNPPLKKSATGRL"
     misc_feature    complement(157880..158377)
                     /locus_tag="PC1_0133"
                     /note="Protein of unknown function (DUF3142); Region:
                     DUF3142; pfam11340"
                     /db_xref="CDD:256422"
     gene            complement(158617..160791)
                     /locus_tag="PC1_0134"
                     /db_xref="GeneID:8131034"
     CDS             complement(158617..160791)
                     /locus_tag="PC1_0134"
                     /inference="similar to AA sequence:KEGG:ECA4313"
                     /note="KEGG: eca:ECA4313 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015732.1"
                     /db_xref="GI:253686542"
                     /db_xref="GeneID:8131034"
                     /translation="MKGVTLLAGVLTALMSSQAFSSSDGVCGFSDSECGMSALPYLQP
                     GNDTRTNLMLLQSRLHGISLPLPHPLPDQARSRIDPFTAYRVMGIAATETPQTSESGE
                     DVTADAPYLSTLNKAKQLHLPLSVQSTISTFSPDDNEGRHISNALSTLEAFFDVLLAD
                     KPLTEEQRTLLAHQRVNILNPLYTKDALNEGLASLPDEGHAGALMQYLFAVLAFYQGH
                     FDEAESGFQALVSSPQPWVAETSRYMLIRVAINKAMENALDEYNMFDAGKADKATAQL
                     AVQHIDDYLKQYPEGQYVDSANGLYRRAYWIMNDTNALAKTYQHELDGTTDVEDLLEL
                     NDEIDNKLLENRQFTSAPGSAPLTMVQDLKRLRSDEGWLALPALSTEELAAQKPLFEQ
                     DNMQDAFSYLQAAQLFYGQKDYAAVVNSVPATQENDLTDTVRFSLQVLRGRALVRLER
                     WDEAEVHWRQLLTRKMGYTQNQFLQLALAETLVKAGHPERIFTADSPVKNLRFRSAVL
                     KISANADLLRQQTGAQQSHEERAIALHTLLTKSLTHGDYASYLKDVQLRKDIAPLVSS
                     ENQSWNQEDLTAFDWDGSDTEEDYQCPALNDVVTTLNQRPNDARAINCLGEFFLRTNN
                     SVGFDWGEGSMLSGLTNAPTQFVGTEYNRLDGYMKVIADPKAPPEDKTYALYRAVYCY
                     APSGYNDCGPQEISKATRKAWFTQLKTKYKGSVWADKLDYYW"
     misc_feature    complement(<159232..159501)
                     /locus_tag="PC1_0134"
                     /note="poly-beta-1,6 N-acetyl-D-glucosamine export porin
                     PgaA; Region: PGA_TPR_OMP; TIGR03939"
                     /db_xref="CDD:234406"
     gene            complement(160982..162352)
                     /locus_tag="PC1_0135"
                     /db_xref="GeneID:8131035"
     CDS             complement(160982..162352)
                     /locus_tag="PC1_0135"
                     /inference="protein motif:PFAM:PF02518"
                     /note="PFAM: ATP-binding region ATPase domain protein;
                     histidine kinase HAMP region domain protein; histidine
                     kinase A domain protein;
                     SMART: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein; histidine kinase HAMP region
                     domain protein;
                     KEGG: eca:ECA4312 two-component sensor protein"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="YP_003015733.1"
                     /db_xref="GI:253686543"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:8131035"
                     /translation="MINSLTARIFAIFWLTLALVLMLVLMVPKLDSRQLTALLENEQR
                     QGIMLEQHIEADLANTPANDLRWWLRLFWVLEKWAPPGQRLFLVTSEGRIFGVEKHET
                     PIVRNFIGLSDNADHPQKKNYGRIELLGPFAIRDGDDNYQLYLIRPASSPQSDFISLL
                     FDRPLLLLIFTMLISSPLLLWLAWSLAKPARKLKHAADEVAKGNLRQHPELESGPQEF
                     QATGVSFNQMVSALERMVTAQQRLLSDISHELRTPLTRLQLATALLRRRQGEGNELNR
                     IETETQRLDSMINDLLVLSRNQHKNELTREFLRADELWGNVLDDAAFEAEQMGKTLEV
                     PYPPGPWTLFGNPASLDSALENIVRNALRYSHNHIEVAFSVDNQGITIKVDDDGPGVS
                     PEDREQIFRPFYRTDEARDRESGGSGLGLAIVETAITQHKGWVKAEDSPLGGLRLIIW
                     LPLHQR"
     misc_feature    complement(160985..162352)
                     /locus_tag="PC1_0135"
                     /note="two-component sensor protein; Provisional; Region:
                     cpxA; PRK09470"
                     /db_xref="CDD:236532"
     misc_feature    complement(161651..161791)
                     /locus_tag="PC1_0135"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(161657..161662,161669..161674,
                     161678..161683,161690..161695,161699..161704,
                     161753..161755,161759..161764,161771..161776,
                     161780..161785))
                     /locus_tag="PC1_0135"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(161465..161641)
                     /locus_tag="PC1_0135"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(161480..161482,161492..161494,
                     161501..161503,161513..161515,161522..161524,
                     161573..161575,161582..161584,161594..161596,
                     161603..161605,161615..161617,161627..161629))
                     /locus_tag="PC1_0135"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(161609..161611)
                     /locus_tag="PC1_0135"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(161000..161305)
                     /locus_tag="PC1_0135"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(161012..161014,161018..161023,
                     161036..161038,161042..161044,161090..161101,
                     161180..161185,161189..161191,161195..161197,
                     161201..161203,161264..161266,161273..161275,
                     161285..161287))
                     /locus_tag="PC1_0135"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(161273..161275)
                     /locus_tag="PC1_0135"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(161093..161095,161099..161101,
                     161183..161185,161189..161191))
                     /locus_tag="PC1_0135"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(162349..163047)
                     /locus_tag="PC1_0136"
                     /db_xref="GeneID:8131036"
     CDS             complement(162349..163047)
                     /locus_tag="PC1_0136"
                     /inference="protein motif:PFAM:PF00072"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein;
                     SMART: response regulator receiver;
                     KEGG: eca:ECA4311 DNA-binding transcriptional regulator
                     CpxR"
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix family two component
                     transcriptional regulator"
                     /protein_id="YP_003015734.1"
                     /db_xref="GI:253686544"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:8131036"
                     /translation="MNKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQALQVLDNT
                     IDLLLLDVMMPKKNGIDTLKELRQQHQTPVIMLTARGSELDRVLGLELGADDYLPKPF
                     NDRELVARIRAILRRSNWTDQQQAGDNSAPTLEVDGLRLNPGRQEASFDDIVLDLTGT
                     EFTLLYLLAQRLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERKDGLPWF
                     KTLRGRGYLMVSAA"
     misc_feature    complement(162352..163047)
                     /locus_tag="PC1_0136"
                     /note="DNA-binding transcriptional regulator CpxR;
                     Provisional; Region: PRK10955"
                     /db_xref="CDD:182864"
     misc_feature    complement(162703..163035)
                     /locus_tag="PC1_0136"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(162745..162750,162757..162759,
                     162814..162816,162871..162873,162895..162897,
                     163021..163026))
                     /locus_tag="PC1_0136"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(162895..162897)
                     /locus_tag="PC1_0136"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(162871..162879,162883..162888))
                     /locus_tag="PC1_0136"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(162742..162750)
                     /locus_tag="PC1_0136"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(162364..162648)
                     /locus_tag="PC1_0136"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(162373..162375,162388..162390,
                     162424..162429,162451..162453,162460..162462,
                     162514..162519,162574..162576))
                     /locus_tag="PC1_0136"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            163201..163725
                     /locus_tag="PC1_0137"
                     /db_xref="GeneID:8131037"
     CDS             163201..163725
                     /locus_tag="PC1_0137"
                     /inference="similar to AA sequence:KEGG:ECA4310"
                     /note="KEGG: eca:ECA4310 putative stress resistance
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative stress resistance protein"
                     /protein_id="YP_003015735.1"
                     /db_xref="GI:253686545"
                     /db_xref="GeneID:8131037"
                     /translation="MQQFATLSLASLLMLGTFTAVAAESGDAPASGWHIDDSATKGVS
                     GQQGMFDGVRLTEQQRQQMRDLMHQSRQDKPAFNAEDVKAMHKLVTAETFDEAAVRAQ
                     ITRMMSVQIERQIQMTRVRNQMYNLLTPAQKEILDVKHKQRMKEMQQQISMFNQMAAP
                     APGTTNQTETENPE"
     misc_feature    163363..163632
                     /locus_tag="PC1_0137"
                     /note="CpxP component of the bacterial Cpx-two-component
                     system and related proteins; Region: CpxP_like; cd09916"
                     /db_xref="CDD:197366"
     misc_feature    order(163456..163458,163465..163470,163480..163482,
                     163486..163488,163498..163500,163507..163509,
                     163519..163521,163531..163533,163543..163545,
                     163552..163557,163564..163566,163573..163575,
                     163606..163611,163618..163620)
                     /locus_tag="PC1_0137"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:197366"
     gene            164123..165310
                     /locus_tag="PC1_0138"
                     /db_xref="GeneID:8131038"
     CDS             164123..165310
                     /locus_tag="PC1_0138"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: eca:ECA4309 sugar efflux transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_003015736.1"
                     /db_xref="GI:253686546"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:8131038"
                     /translation="MTRSSRSTAWLRVVSLSLAAFIFNTAEFAPVALLSDIAASFSMS
                     AAQVGLIITIYAWVVGLMSLPCMLLSSDMERRSLLIKIFILFAISNVLSGLAWNYWVL
                     VIARIGVALAHAIFWSITASLVVRLAPADKKAQALSLLATGTALALVLGLPLGRVVGQ
                     YLGWRVTFVLIGLIAAAIMVGLMKLLPVLPSSNSGSLKSLPLLLKRPALLCVYGLIVM
                     IVTAHFTAYSYIEPFIQKVALLSENFTTILLLIFGGAGIIGSMLFSRYSSKYPAGFLI
                     VSFAFLAVCLLLLLPLSFSGWSLSTLCIVWGIAIMALSLGMQVKVLTLASDATDVAMA
                     LYSGIYNIGIGGGALLGNQVIIHLGLPDIGFMGAAMAMLATVCCILTFVRYSRVLKTS
                     LTS"
     misc_feature    164132..165295
                     /locus_tag="PC1_0138"
                     /note="putative arabinose transporter; Provisional;
                     Region: PRK03545"
                     /db_xref="CDD:179591"
     misc_feature    164159..165268
                     /locus_tag="PC1_0138"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(164201..164203,164210..164218,164222..164227,
                     164276..164278,164285..164290,164297..164299,
                     164309..164314,164318..164323,164459..164464,
                     164471..164476,164483..164488,164495..164497,
                     164531..164536,164543..164548,164564..164566,
                     164780..164782,164789..164794,164801..164806,
                     164813..164815,164855..164857,164867..164869,
                     164879..164881,164888..164890,164900..164902,
                     165038..165040,165047..165052,165059..165061,
                     165071..165076,165083..165085,165116..165121,
                     165128..165133,165140..165145,165152..165154)
                     /locus_tag="PC1_0138"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            165354..166256
                     /locus_tag="PC1_0139"
                     /db_xref="GeneID:8131039"
     CDS             165354..166256
                     /locus_tag="PC1_0139"
                     /inference="protein motif:TFAM:TIGR01297"
                     /note="TIGRFAM: cation diffusion facilitator family
                     transporter;
                     PFAM: cation efflux protein;
                     KEGG: eca:ECA4308 ferrous iron efflux protein F"
                     /codon_start=1
                     /transl_table=11
                     /product="cation diffusion facilitator family transporter"
                     /protein_id="YP_003015737.1"
                     /db_xref="GI:253686547"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="GeneID:8131039"
                     /translation="MNPHYARLVTLAAVSATAVALVLFIMKVFAWWHTGSVSLLASLV
                     DSLVDIAASLVNLLVVRYSLQPADTEHAFGHGKAESLAALAQSMFISGSALFLILTGL
                     QHSLEPQTLHAPEVGMWVTLIALVATLLLVSFQRWVVKRTHSQAVRADMLHYQSDLLM
                     NGAILVALALSWKGITRADSLFALGIGGYILYSALRMGYDAVQSLLDRALPDDEHRAI
                     AEVIVNWPGIRGAHALRTRRSGPTRFIQLHLEMDDALPLVQAHQIADDLEQALLKRFP
                     GADIIIHQDPVSAVPENQRGRLTA"
     misc_feature    165354..166244
                     /locus_tag="PC1_0139"
                     /note="ferrous iron efflux protein F; Reviewed; Region:
                     fieF; PRK09509"
                     /db_xref="CDD:181919"
     gene            166464..167426
                     /locus_tag="PC1_0140"
                     /db_xref="GeneID:8131040"
     CDS             166464..167426
                     /locus_tag="PC1_0140"
                     /EC_number="2.7.1.11"
                     /inference="protein motif:TFAM:TIGR02482"
                     /note="KEGG: eca:ECA4307 6-phosphofructokinase;
                     TIGRFAM: 6-phosphofructokinase;
                     PFAM: phosphofructokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="YP_003015738.1"
                     /db_xref="GI:253686548"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR012828"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="GeneID:8131040"
                     /translation="MIRRIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVYGIYDGYQG
                     LYEDRMEQLDRYSVSDVINRGGTFLGSARFPQFRDEAVRQVCVENMKRRGLDALVVIG
                     GDGSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYFTALETVLEAIDRLRDTSSS
                     HQRISIVEVMGRHCGDLTLAAAIAGGCEFIVLPEVPFSPEDLVCEIKAGIEKGKKHAI
                     VAITELVCDVDELAKYIEKETGRETRATVLGHIQRGGSPVAYDRILASRMGAYSIELL
                     QQGYGGRCVGIQNEKMVHHDIVDAIENMKRPFKGDWLDTAKKLF"
     misc_feature    166470..167420
                     /locus_tag="PC1_0140"
                     /note="Phosphofructokinase, a key regulatory enzyme in
                     glycolysis, catalyzes the phosphorylation of
                     fructose-6-phosphate to fructose-1,6-biphosphate. The
                     members belong to a subfamily of the PFKA family (cd00363)
                     and include bacterial ATP-dependent...; Region:
                     Bacterial_PFK; cd00763"
                     /db_xref="CDD:238388"
     misc_feature    order(166497..166499,166587..166589,166680..166682,
                     166773..166781,166785..166790,166839..166841,
                     166845..166847,166851..166853,166971..166979,
                     167130..167132,167211..167213,167220..167222)
                     /locus_tag="PC1_0140"
                     /note="active site"
                     /db_xref="CDD:238388"
     misc_feature    order(166497..166499,166587..166589,166680..166682,
                     166773..166781,166785..166790)
                     /locus_tag="PC1_0140"
                     /note="ADP/pyrophosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238388"
     misc_feature    order(166527..166529,166539..166541,166626..166628,
                     166641..166643,166650..166652,166869..166871,
                     166905..166907,166917..166919,166926..166928,
                     167010..167015,167019..167021,167103..167105,
                     167247..167252,167262..167264,167283..167285,
                     167328..167330,167415..167420)
                     /locus_tag="PC1_0140"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238388"
     misc_feature    order(166527..166529,166539..166541,166626..166631,
                     166638..166643,166926..166928,167019..167021,
                     167025..167027,167097..167099,167103..167111)
                     /locus_tag="PC1_0140"
                     /note="allosteric effector site; other site"
                     /db_xref="CDD:238388"
     misc_feature    order(166839..166841,166845..166847,166851..166853,
                     166950..166952,166971..166979,167130..167132,
                     167193..167195,167211..167213,167220..167222)
                     /locus_tag="PC1_0140"
                     /note="fructose-1,6-bisphosphate binding site; other site"
                     /db_xref="CDD:238388"
     gene            167946..168875
                     /locus_tag="PC1_0141"
                     /db_xref="GeneID:8131041"
     CDS             167946..168875
                     /locus_tag="PC1_0141"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: eca:ECA4305 LysR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003015739.1"
                     /db_xref="GI:253686549"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:8131041"
                     /translation="MNIDLRQLRHFIALIEHRNFTSAAQAMKLSQSAFSRSIQSLEQT
                     IGTRLIDRMNQLEPTPKGLVVLEHARRLINQTHDLFNDIQQFNEKEAGEVNFGCGPAP
                     AAWLMPQVIGDFSRHYPKVRMVFRVDNWQALGHRLMAEELDFIVADMRNFEFDTRYRV
                     QPLSQHRWGFCCRSGHPLAAQEEITVEQFFSYPLAATIRPPNLHRALVQLSGKLDIRT
                     SIECENGYSLLDVVRHSDAIGTTNHFNEPERHGLHMLKIAGLDDNTDEFYTHYGIIYL
                     ADARLSLLARKLIDTFVQVDSDLHGTPAVLTAE"
     misc_feature    167952..168827
                     /locus_tag="PC1_0141"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    167958..168131
                     /locus_tag="PC1_0141"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    168222..168815
                     /locus_tag="PC1_0141"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(168267..168272,168276..168281,168288..168290,
                     168300..168302,168306..168326,168600..168617,
                     168633..168638,168642..168647)
                     /locus_tag="PC1_0141"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(168862..169590)
                     /locus_tag="PC1_0142"
                     /db_xref="GeneID:8131042"
     CDS             complement(168862..169590)
                     /locus_tag="PC1_0142"
                     /inference="similar to AA sequence:KEGG:ECA4304"
                     /note="KEGG: eca:ECA4304 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015740.1"
                     /db_xref="GI:253686550"
                     /db_xref="GeneID:8131042"
                     /translation="MPPPGGTLQDITMTDPGCTENTLLLSLQADDTHDIIDSPHRSTF
                     IWSTDSIGQPLRWQVEQEDPDRTTIQTTPEHLALESAAGLTIWLDAPLSGTYRIAFTR
                     EVLVADRPYDRVSDLNQFWGARDLHHPNLFTRYGKLNEYDSLNLYYVGMGGNWNSTTR
                     FRYYDGHGERLLLGEYTDATHLLRPNHRYRIVIEVDRRETRFWVDDVLYFHASYPNIP
                     APGYFGFRTVFSRQEISDFSITPL"
     gene            complement(169590..172349)
                     /locus_tag="PC1_0143"
                     /db_xref="GeneID:8131043"
     CDS             complement(169590..172349)
                     /locus_tag="PC1_0143"
                     /inference="similar to AA sequence:KEGG:ECA4303"
                     /note="KEGG: eca:ECA4303 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015741.1"
                     /db_xref="GI:253686551"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="GeneID:8131043"
                     /translation="MNKMPYSRRRFLRDSTLLALSAPFWNATAPRASAYAGESAPQVN
                     LRWLDGQRPRAFTGVTWGVPWPQGAVRNDSGFQLHDAQQHAYDLQSWPLARWPDGSIK
                     WSAHALGGDTPPEDGLTLRPIPAKDGSMGSAMVREHEHGWTVETGRIRYEIPRSGTRL
                     ISEIWRNNRLALTNGRLVLRMQRGAETESTLTLDAYQGVIDTVTVEQNGAQRTVIALR
                     GTHHAPQQGVTRIPFIIRLYSYANTDSLRVLHTLIYDNDDDLVSLKGLGLAFDVPLQG
                     ELHDRHIRFVSDQGGLFREAVRGLSGLRRDPGSAVIAAQLAGQATPPIADFSPEVGKR
                     LDYIPAFGSYRLTQHHPDGFQIHKRTVAGQGWLLSATGERAAGVGYLGTPTGGVAFGI
                     RHFWQSYPACLEIDNAHTDVATVTLWLWSPWAEPMDMRFYHDGLGQDTHDKQREGLAI
                     TYEDYEPGFGSAVGVARTSELFIDVLPATPDAEDLVNRARRMQQPPLLVADAQDLQRA
                     QAFGSMWAPSSATTPARIRLEKQLDAYFDVYQQEVEQRKWYGFWDFGDVMHTYDSDRH
                     VWRYDVGGYAWDNSELSTDLWLWYYFLHSGRAEAFRLAEAMTRHTGEVDVHHLGRFSP
                     LGSRHNVRHWGDSAKQLRISTVANRRFLYYLTADERIGELMDEQVEALRTLSAVLPGR
                     KIGQTHPDSPNHISLGFGTDWGAVAAAWLTAWERHSDPSMRERLLNSMQTLASQPHGF
                     FTGSAAIDPDTGRFLPAPADQVEISHLSAVFGLTEICSELVEALPDPAFTRAWLDYCR
                     LYNDPIALSTAVGKTVKKLNLAQGHARLTAFAARRLNDRALAQRAWAEFTAGSGGIAH
                     PTLEQRRVTPPAVLYPINEPVIDSTIDKHSGSTMAVNLATNAVAQWGLTAIALLALLD
                     DIPSS"
     gene            complement(172354..174624)
                     /locus_tag="PC1_0144"
                     /db_xref="GeneID:8131044"
     CDS             complement(172354..174624)
                     /locus_tag="PC1_0144"
                     /inference="protein motif:PFAM:PF00593"
                     /note="PFAM: TonB-dependent receptor; TonB-dependent
                     receptor plug;
                     KEGG: eca:ECA4302 TonB-dependent receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="YP_003015742.1"
                     /db_xref="GI:253686552"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:8131044"
                     /translation="MYLKKHQQYLKEHQRKITSGILMSCVLTLPAMARAADPQITTDN
                     VPRTEATTAAPVQLKRVKVNAQRTPVQPPTTLASVIDGKTLEEERVYRFEELSQLVTG
                     LDVDTVDVMDTTVTIRGIGDGGESGTNIGMPGSVGLFVDGVYLSRPGVISNDLLDIDS
                     TRVLKGPQGAAYGFNTTGGAIDIRTRKPTFTPEYSLEQSFGQRGYLQSKLMASGPLSD
                     HWAGRINLSRTERGGNVTNIENGHKLGGSTNNGVRGQLLYQPNDSFSLRITGDYSDST
                     QRPVSVLVSATDDFRNRAQQTGLKVVGDRQVAMDDENVIRVAQGGGSVEANWRLKNGY
                     SVNSLSSLRYFRVLPSTADNWNIPLYHDSGADVRDRVWSQSFWLDSPKGNTFDYSLGV
                     DYWGENLDTEANSRYYNDNRVRTWVGNGYQGINVQRFGTLDDTVYSVYGRGTWHAADK
                     LDVIVGLRQTYEKKEGTFVRKNRATFDSGPLSQTNRLPSGSISLNWFAAPNVTPYVTL
                     GYGEKSGGLNVSSGAARQLGIDSLYVDPEKTRSAELGVKTHWLQRKVEWNTALFWSVV
                     EDFQNNAYDEETDTSYLINAGKFRSRGGETQLTVRPIDGLSISLAGTVLDARYLNFPN
                     ARCPAEISAVSCDMSGKRVFKSPTLSYNTRVRYQWDTPNNLQASVSGQWSWRSWAYGT
                     LDDSEYNRIPAYGVLNLSSGLSGKQGDNRWNVSLWVKNALDKNYYRSVRGSSATTGVI
                     GEPRMVGISVGYDFKG"
     misc_feature    complement(172363..174396)
                     /locus_tag="PC1_0144"
                     /note="TonB-dependent siderophore receptor; Region:
                     TonB-siderophor; TIGR01783"
                     /db_xref="CDD:233575"
     misc_feature    complement(172363..174393)
                     /locus_tag="PC1_0144"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            complement(174710..175717)
                     /locus_tag="PC1_0145"
                     /db_xref="GeneID:8131045"
     CDS             complement(174710..175717)
                     /locus_tag="PC1_0145"
                     /inference="protein motif:PFAM:PF09084"
                     /note="PFAM: NMT1/THI5 like domain protein;
                     KEGG: eca:ECA4301 putative sulfate ester binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NMT1/THI5 like domain-containing protein"
                     /protein_id="YP_003015743.1"
                     /db_xref="GI:253686553"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="GeneID:8131045"
                     /translation="MKTSGRKWLVTSLLAMGMAWSGIASAITEIRIAAPDIGAGTKPS
                     GGGLLDVIHSQKLLEREFGKDGISVRWTFIKGAGPVINEAFGNHQVDVAYLGDLASII
                     GRARGLDTRVIAVASRGINHYLAVAKGSGIEKIADLKGKRIGIFRGTAGELSFVSALD
                     SQGLKPSDVKLINLDFAAASAALAAGQIDATWGGSNTLSLRDKGLADIPLSSRDLNGA
                     GQLSGFLLVDEKFAKGNEDILRRLVKVQREAANWASDEKNKDEFIRLLATQSGYPENI
                     LRVEWDTLPPLTERLSPELDPAFVEKLKRAVTLAYESRLIRQPFDVDKWLDDSYLKAT
                     Q"
     misc_feature    complement(174716..175717)
                     /locus_tag="PC1_0145"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     misc_feature    complement(174959..175534)
                     /locus_tag="PC1_0145"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            176370..177233
                     /locus_tag="PC1_0146"
                     /db_xref="GeneID:8131046"
     CDS             176370..177233
                     /locus_tag="PC1_0146"
                     /inference="protein motif:TFAM:TIGR01352"
                     /note="TIGRFAM: TonB family protein;
                     PFAM: Gram-negative tonB protein;
                     KEGG: eca:ECA4300 TonB protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB family protein"
                     /protein_id="YP_003015744.1"
                     /db_xref="GI:253686554"
                     /db_xref="InterPro:IPR000480"
                     /db_xref="InterPro:IPR003538"
                     /db_xref="InterPro:IPR006260"
                     /db_xref="GeneID:8131046"
                     /translation="MTELLYAGAVSGSRSYSPEPTPHASRVNGVVQSRVPALNTTVSS
                     RPERWLAAIATLLLHAAVLALFSSASTPPVTVPARPQPISIELVAAVAEPVLQAEPAE
                     PEVVAPPPELTPPVVDKPVDDNALLPPEPEKKEPERKAPEKKPEPAPKKVAVKKNPPA
                     PTPKPQAETVSASAPVTPAPVAQQAVAPPVDAPLTPPLANADYLHNPAPSYPDVAISR
                     GYEGTVLLNVQVRADGKVQTIRIHQSSGYPSLDEAARDTVLRWSFVPARRGNQPVSGW
                     VVVPVDFSLNS"
     misc_feature    176595..177227
                     /locus_tag="PC1_0146"
                     /note="Periplasmic protein TonB, links inner and outer
                     membranes [Cell envelope biogenesis, outer membrane];
                     Region: TonB; COG0810"
                     /db_xref="CDD:223880"
     misc_feature    176988..177224
                     /locus_tag="PC1_0146"
                     /note="Gram-negative bacterial TonB protein C-terminal;
                     Region: TonB_C; pfam03544"
                     /db_xref="CDD:252020"
     gene            177245..177961
                     /locus_tag="PC1_0147"
                     /db_xref="GeneID:8131047"
     CDS             177245..177961
                     /locus_tag="PC1_0147"
                     /inference="protein motif:PFAM:PF01618"
                     /note="PFAM: MotA/TolQ/ExbB proton channel;
                     KEGG: eca:ECA4299 putative biopolymer transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MotA/TolQ/ExbB proton channel"
                     /protein_id="YP_003015745.1"
                     /db_xref="GI:253686555"
                     /db_xref="InterPro:IPR002898"
                     /db_xref="GeneID:8131047"
                     /translation="MTLGHIELFSAEGAVILLLLLFSLVTWGLGLLKFVQYGRAQRRD
                     RRFRAAFWQQDDVSQTPETSAKQPGSLANLALAAVKAPEQMSGQLALNIHLPDRVERA
                     LQQQIQRERRTLESGLAVLASIGSTSPFIGLFGTVWGIMAALQEIGLSGSASLDTVAG
                     PIGNALIATGIGIAVAVPAVLIYNYFLRRLKLAVADMDDFAHDVYSVMQAHDFHVSTV
                     HASVDPSSATFSVKNLREVV"
     misc_feature    177284..177871
                     /locus_tag="PC1_0147"
                     /note="Biopolymer transport proteins [Intracellular
                     trafficking and secretion]; Region: TolQ; COG0811"
                     /db_xref="CDD:223881"
     gene            177963..178364
                     /locus_tag="PC1_0148"
                     /db_xref="GeneID:8131048"
     CDS             177963..178364
                     /locus_tag="PC1_0148"
                     /inference="protein motif:PFAM:PF02472"
                     /note="PFAM: Biopolymer transport protein ExbD/TolR;
                     KEGG: eca:ECA4298 putative biopolymer transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Biopolymer transport protein ExbD/TolR"
                     /protein_id="YP_003015746.1"
                     /db_xref="GI:253686556"
                     /db_xref="InterPro:IPR003400"
                     /db_xref="GeneID:8131048"
                     /translation="MAFTSRNDEDVMSEMNITPLVDVMLVLLVVFIVTAPMLTNAIPI
                     QLPKTSAVAPADRADPVVISIDGEQRVFINKENLAREQLVPRLQQAKASNADLVVQVQ
                     ADKDANYGAVAALLADVEQAGITRLSLLTQK"
     misc_feature    177963..178361
                     /locus_tag="PC1_0148"
                     /note="Biopolymer transport protein [Intracellular
                     trafficking and secretion]; Region: ExbD; COG0848"
                     /db_xref="CDD:223917"
     gene            178386..179984
                     /locus_tag="PC1_0149"
                     /db_xref="GeneID:8131049"
     CDS             178386..179984
                     /locus_tag="PC1_0149"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: eca:ECA4297 sulfate ester ABC transporter permease
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_003015747.1"
                     /db_xref="GI:253686557"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8131049"
                     /translation="MMPKYPLRIRPAPDASLTAAALSAGYSALVVSLVVPLLVLAGWW
                     LASRHGWMSEQILPSPLAVIDSARAFIPEELVHQLPISLLRLAIGFSGGIALGLVLGS
                     LFGLNRRLNALFMPLFTVIAQIPTLAWIPLLMLSLGIGEALKLVVLVKSVTVPVTLYT
                     CAGIQQTPQKLHEMARSLRLPPAAFLRYLILPAMLPYVMTGVRLAFSTGWVALIAVEL
                     LASSEGLGYLLVQSRQLFMLDLVFVCILIIGILGFAGERVLLKLERRWIHWPAPVLGR
                     DSLGYALPSLSLTPWLAPLVLVVLWQVSSTYEWVNVAFLPAPSRVIDALWTGLVQGGL
                     LIDLHASLLRALQGFTLGSAIGVLVGAVLGGWRIADRLFNPALSALRCVALFAWLPLI
                     TAWFGLGESAKIVFIAVAAFFPVMLATRQGIAQLPPALLEVAQVLRLTPVQTLRTLIL
                     PSVLPPLFSGLRLALMHAWTGAIGAEYFMPSGEGLGGMMIRAQQLLESDRIMAGVVLI
                     AAVAALFSRLITLSERRLTRWRFA"
     misc_feature    178506..179192
                     /locus_tag="PC1_0149"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    178620..179138
                     /locus_tag="PC1_0149"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(178668..178673,178680..178685,178698..178700,
                     178725..178736,178740..178769,178776..178781,
                     178785..178787,178833..178838,178842..178844,
                     178848..178850,178857..178862,178866..178868,
                     178878..178883,178890..178892,178941..178943,
                     178983..178988,178995..178997,179016..179027,
                     179034..179039,179064..179069,179097..179102,
                     179109..179114,179118..179123,179130..179135)
                     /locus_tag="PC1_0149"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(178743..178787,179016..179033)
                     /locus_tag="PC1_0149"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(178785..178787,178818..178820,179034..179036,
                     179058..179060,179067..179069,179097..179099)
                     /locus_tag="PC1_0149"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(178893..178931,178947..178952,178962..178964)
                     /locus_tag="PC1_0149"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    179247..179981
                     /locus_tag="PC1_0149"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    179406..179933
                     /locus_tag="PC1_0149"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(179445..179450,179457..179462,179475..179477,
                     179502..179513,179517..179546,179553..179558,
                     179562..179564,179610..179615,179619..179621,
                     179625..179627,179634..179639,179643..179645,
                     179655..179660,179667..179669,179718..179720,
                     179760..179765,179772..179774,179793..179804,
                     179811..179816,179853..179858,179886..179891,
                     179898..179903,179907..179912,179919..179924,
                     179931..179933)
                     /locus_tag="PC1_0149"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(179520..179564,179793..179810)
                     /locus_tag="PC1_0149"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(179562..179564,179595..179597,179811..179813,
                     179847..179849,179856..179858,179886..179888)
                     /locus_tag="PC1_0149"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(179670..179708,179724..179729,179739..179741)
                     /locus_tag="PC1_0149"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            180002..180760
                     /locus_tag="PC1_0150"
                     /db_xref="GeneID:8131050"
     CDS             180002..180760
                     /locus_tag="PC1_0150"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: eca:ECA4296 sulfate ester ABC transporter
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_003015748.1"
                     /db_xref="GI:253686558"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8131050"
                     /translation="MSLHFQHITKHFIVNGTPLTVLQDIDLSLHAGELVAIIGASGCG
                     KSTLLRLAAGIDTTERGRILIGERPVRGIPDDVSLVFQEPRLFPWLTVTDNIRLGMLN
                     LNLSPAEVERRIAHYLQMMGLEGFADAWPHQLSGGMAQRVAIARGLVSTPHILLLDEP
                     FGALDALTKQQLQARLAEIRQQTDLTILLVTHDVEEAVFLADRVVVMSPRPGRISRIL
                     PINLTYPRDRTSTALLEQRQAVSQALHQADAVEA"
     misc_feature    180002..180748
                     /locus_tag="PC1_0150"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, ATPase component [Inorganic ion transport and
                     metabolism]; Region: TauB; COG1116"
                     /db_xref="CDD:224041"
     misc_feature    180008..180667
                     /locus_tag="PC1_0150"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    180116..180139
                     /locus_tag="PC1_0150"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    order(180125..180130,180134..180142,180245..180247,
                     180473..180478,180575..180577)
                     /locus_tag="PC1_0150"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    180236..180247
                     /locus_tag="PC1_0150"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    180401..180430
                     /locus_tag="PC1_0150"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    180461..180478
                     /locus_tag="PC1_0150"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    180485..180496
                     /locus_tag="PC1_0150"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    180563..180583
                     /locus_tag="PC1_0150"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            complement(180801..180938)
                     /locus_tag="PC1_0151"
                     /pseudo
                     /db_xref="GeneID:8131051"
     gene            181270..182154
                     /locus_tag="PC1_0152"
                     /db_xref="GeneID:8131052"
     CDS             181270..182154
                     /locus_tag="PC1_0152"
                     /inference="protein motif:TFAM:TIGR03381"
                     /note="TIGRFAM: N-carbamoylputrescine amidase;
                     PFAM: Nitrilase/cyanide hydratase and apolipoprotein
                     N-acyltransferase;
                     KEGG: eca:ECA4274 putative carbon-nitrogen hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-carbamoylputrescine amidase"
                     /protein_id="YP_003015749.1"
                     /db_xref="GI:253686559"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR017755"
                     /db_xref="GeneID:8131052"
                     /translation="MKKVTVAATQMACSWDLPKNIENAEKLVRQAHAKGAQVILIQEL
                     FAAPYFCIDQSPEHYALAQELETSPLIKHFSALAAELNVVLPLSFFERANNAYYNSLV
                     MIDADGAVLDVYRKTHIPNGPAYQEKQFFIPGDTGFKVWQTRYAKIGVGICWDQWFPE
                     TARSLALQGAELIFYPTAIGSEPAYPDIDSQPHWTRVQQGHAAANLVPVIASNRIGTE
                     ASKYIDGLEMTFYGSSFIADQTGALVAQANKTDEAILVHEFDLEAIAAQRASWGLFRD
                     RRPDMYGTIATSDGKTWR"
     misc_feature    181279..182130
                     /locus_tag="PC1_0152"
                     /note="N-carbamoylputrescine amidohydrolase (CPA) (class
                     11 nitrilases); Region: CPA; cd07573"
                     /db_xref="CDD:143597"
     misc_feature    order(181396..181398,181615..181617,181627..181629,
                     181648..181650,181726..181731,181735..181740,
                     181801..181803)
                     /locus_tag="PC1_0152"
                     /note="putative active site; other site"
                     /db_xref="CDD:143597"
     misc_feature    order(181396..181398,181615..181617,181726..181728)
                     /locus_tag="PC1_0152"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143597"
     misc_feature    order(181618..181629,181645..181647,181666..181674,
                     181729..181731,181735..181749,181756..181761,
                     181855..181860,181864..181872,181876..181881,
                     181963..181968,182092..182106)
                     /locus_tag="PC1_0152"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143597"
     gene            182158..183261
                     /locus_tag="PC1_0153"
                     /db_xref="GeneID:8131053"
     CDS             182158..183261
                     /locus_tag="PC1_0153"
                     /EC_number="3.5.3.12"
                     /inference="protein motif:TFAM:TIGR03380"
                     /note="KEGG: eca:ECA4273 agmatine deiminase;
                     TIGRFAM: agmatine deiminase;
                     PFAM: Porphyromonas-type peptidyl-arginine deiminase"
                     /codon_start=1
                     /transl_table=11
                     /product="agmatine deiminase"
                     /protein_id="YP_003015750.1"
                     /db_xref="GI:253686560"
                     /db_xref="InterPro:IPR007466"
                     /db_xref="InterPro:IPR017754"
                     /db_xref="GeneID:8131053"
                     /translation="MSQPATPSLTTPHQDGFAMPAEWAPHDAVWMIWPYRTDNWREQG
                     IPAQKTFARVAEAIAQNTPVIMGVPARYMANAQQVMPVNVTLVEMESDDAWMRDTGPT
                     IVLNQAGERRGIDWQFNAWGGELGGLYEDWRQDEKVAAQVLDYHQAGRYAAPLILEGG
                     SIHVDGEGTLLTTAECLLNPNRNPHLSKAEIEQLMRDYLSISTIIWLEEGVYNDETDG
                     HIDNMCCFVRPGEVALHWTDDENDPQYARSVAAYEVLSAARDAQGRELKIWKLPAPGP
                     LYATKEEAQGVDSGDAVERLAGSRLAGSYVNFLISNQQIIFPLLDEKTDDVARDLLQQ
                     MFPGYLISGVPAREILLGGGNIHCITQQIPAVK"
     misc_feature    182185..183258
                     /locus_tag="PC1_0153"
                     /note="agmatine deiminase; Provisional; Region: PRK13551"
                     /db_xref="CDD:184135"
     gene            complement(183401..184168)
                     /locus_tag="PC1_0154"
                     /db_xref="GeneID:8131054"
     CDS             complement(183401..184168)
                     /locus_tag="PC1_0154"
                     /inference="protein motif:TFAM:TIGR00419"
                     /note="TIGRFAM: triosephosphate isomerase;
                     PFAM: triosephosphate isomerase;
                     KEGG: eca:ECA4272 triosephosphate isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="YP_003015751.1"
                     /db_xref="GI:253686561"
                     /db_xref="InterPro:IPR000652"
                     /db_xref="GeneID:8131054"
                     /translation="MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPA
                     IYLDQANHQLAGSRIALGAQNVDVNLSGAFTGETSADMLKDIGAKYIIIGHSERRTYH
                     KESDEFIAKKFGVLKDAGLIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAKAFE
                     NTVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANA
                     AELFTQPDIDGALVGGASLKADAFAVIVKAAADAKRG"
     misc_feature    complement(183428..184159)
                     /locus_tag="PC1_0154"
                     /note="Triosephosphate isomerase (TIM) is a glycolytic
                     enzyme that catalyzes the interconversion of
                     dihydroxyacetone phosphate and
                     D-glyceraldehyde-3-phosphate. The reaction is very
                     efficient and requires neither cofactors nor metal ions.
                     TIM, usually...; Region: TIM; cd00311"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(183467..183472,183476..183478,
                     183533..183535,183650..183652,183668..183670,
                     183884..183886,184136..184138,184142..184144))
                     /locus_tag="PC1_0154"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(183875..183880,183911..183916,
                     183923..183925,183977..183979,184016..184018,
                     184025..184027,184031..184039,184133..184135,
                     184142..184144))
                     /locus_tag="PC1_0154"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(183668..183670,183884..183886,
                     184136..184138))
                     /locus_tag="PC1_0154"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238190"
     gene            complement(184334..184933)
                     /locus_tag="PC1_0155"
                     /db_xref="GeneID:8131055"
     CDS             complement(184334..184933)
                     /locus_tag="PC1_0155"
                     /inference="protein motif:PFAM:PF07305"
                     /note="PFAM: protein of unknown function DUF1454;
                     KEGG: eca:ECA4271 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015752.1"
                     /db_xref="GI:253686562"
                     /db_xref="InterPro:IPR009918"
                     /db_xref="GeneID:8131055"
                     /translation="MTRKRIASLLVLSSLVLYQTHAAADPTFPPKPSANAPYLLAGAP
                     TFDQTITQFRSRYNLSNPTLPIGEFRVVDTGNITSMLTRAASRINDHLYASTALEKGT
                     GKIKTLQITWLPQPQSDQETAARRKQAIDYMAALARTFAPSLTEEQSMKKVTELLEKG
                     KGQRFYPQTEGALRYVVADDGEKGLTFAVEPIKLTLSEP"
     misc_feature    complement(184337..184870)
                     /locus_tag="PC1_0155"
                     /note="Protein of unknown function (DUF1454); Region:
                     DUF1454; pfam07305"
                     /db_xref="CDD:148740"
     gene            185131..185553
                     /locus_tag="PC1_0156"
                     /db_xref="GeneID:8131056"
     CDS             185131..185553
                     /locus_tag="PC1_0156"
                     /inference="protein motif:PFAM:PF05656"
                     /note="PFAM: protein of unknown function DUF805;
                     KEGG: eca:ECA4270 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015753.1"
                     /db_xref="GI:253686563"
                     /db_xref="InterPro:IPR008523"
                     /db_xref="GeneID:8131056"
                     /translation="MTLQQWCFSFKGRIGRRDFWLWMAIWVALMAVLFTLSGQSWLDT
                     QSTAFGLVVLLWPTAAIMVKRLHDRNKSGWWALLLVVAWMLASGNWTMFSTIWQWGIG
                     RFLPILIVVMTLLDCGVFLGTKGENRFGAEAEPFRFRR"
     misc_feature    185131..185544
                     /locus_tag="PC1_0156"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3152"
                     /db_xref="CDD:225694"
     gene            complement(185571..186317)
                     /locus_tag="PC1_0157"
                     /db_xref="GeneID:8131057"
     CDS             complement(185571..186317)
                     /locus_tag="PC1_0157"
                     /inference="protein motif:PFAM:PF00175"
                     /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
                     protein; Oxidoreductase FAD-binding domain protein;
                     KEGG: eca:ECA4269 ferredoxin-NADP reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase FAD/NAD(P)-binding
                     domain-containing protein"
                     /protein_id="YP_003015754.1"
                     /db_xref="GI:253686564"
                     /db_xref="InterPro:IPR001221"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="GeneID:8131057"
                     /translation="MAEWVTGKVVQVENWTESLFSIRVHAPTDSFTAGQYGKLALEIE
                     GEKVQRAYSYVNAPSDPTLEFYLVTVPEGKLSPHLHALQPGSEVMVVKEPAGFFVLEE
                     VPDCETLWMLATGTGIGPYLSILQEGKDLERFKNIVLVHAARFSRDLSYLPLMQQLQQ
                     RYHGKLRIQTVVSREEETGSLTGRVPQLISNGTLEAAVGLPMNAETSHVMLCGNPQMV
                     RDTQLLLKEERQMTKHLRRRPGHMTAENYW"
     misc_feature    complement(185574..186317)
                     /locus_tag="PC1_0157"
                     /note="ferredoxin-NADP reductase; Provisional; Region:
                     PRK10926"
                     /db_xref="CDD:182844"
     misc_feature    complement(185577..186296)
                     /locus_tag="PC1_0157"
                     /note="Ferredoxin-NADP+ (oxido)reductase is an
                     FAD-containing enzyme that catalyzes the reversible
                     electron transfer between NADP(H) and electron carrier
                     proteins such as ferredoxin and flavodoxin. Isoforms of
                     these flavoproteins (i.e. having a non-covalently...;
                     Region: FNR1; cd06195"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(185577..185579,185970..185972,
                     186090..186095,186099..186101,186108..186110,
                     186114..186116,186120..186122,186159..186170,
                     186210..186212))
                     /locus_tag="PC1_0157"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(186159..186164,186168..186170))
                     /locus_tag="PC1_0157"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(186030..186032,186036..186038,
                     186063..186065,186081..186083,186090..186092,
                     186099..186101))
                     /locus_tag="PC1_0157"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(185958..185960,185964..185975,
                     185985..185987))
                     /locus_tag="PC1_0157"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(185676..185681,185886..185894,
                     185967..185972))
                     /locus_tag="PC1_0157"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     gene            complement(186435..187445)
                     /locus_tag="PC1_0158"
                     /db_xref="GeneID:8131058"
     CDS             complement(186435..187445)
                     /locus_tag="PC1_0158"
                     /EC_number="3.1.3.11"
                     /inference="protein motif:TFAM:TIGR00330"
                     /note="KEGG: eca:ECA4268 fructose 1,6-bisphosphatase II;
                     TIGRFAM: fructose-1,6-bisphosphatase, class II;
                     PFAM: GlpX family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1,6-bisphosphatase, class II"
                     /protein_id="YP_003015755.1"
                     /db_xref="GI:253686565"
                     /db_xref="InterPro:IPR004464"
                     /db_xref="GeneID:8131058"
                     /translation="MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADNAAVQAMRIML
                     NQVNINGQIVIGEGEIDEAPMLFIGEQVGTGKGDAVDIAVDPIEGTRMTAMGQANALA
                     VLAVGEKGAFLHAPDMYMEKLIVGPEAKGAIDLNLPLADNLRNIALKLGKPLSQLTVT
                     TLAKPRHDACIAEMQQLGVKVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVISA
                     AVIRALDGDMQGRLLARHQVKGDSAENRRIGEDELARCRQMGIEAGSVLKLDDMARND
                     NVIFSATGITKGDLLDGIARKGNMATTETLLIRGKSRTIRRIKSTHYLDRKDRTLHEF
                     LL"
     misc_feature    complement(186480..187442)
                     /locus_tag="PC1_0158"
                     /note="Bacterial fructose-1,6-bisphosphatase,
                     glpX-encoded. A dimeric enzyme dependent on Mg(2+).
                     glpX-encoded FPBase (FBPase class II) differs from other
                     members of the inositol-phosphatase superfamily by
                     permutation of secondary structure elements. The core...;
                     Region: FBPase_glpX; cd01516"
                     /db_xref="CDD:238774"
     misc_feature    complement(order(186807..186809,186882..186884,
                     187179..187193,187275..187280,187347..187349))
                     /locus_tag="PC1_0158"
                     /note="putative active site [active]"
                     /db_xref="CDD:238774"
     gene            complement(187700..189211)
                     /locus_tag="PC1_0159"
                     /db_xref="GeneID:8131059"
     CDS             complement(187700..189211)
                     /locus_tag="PC1_0159"
                     /inference="protein motif:TFAM:TIGR01311"
                     /note="TIGRFAM: glycerol kinase;
                     PFAM: carbohydrate kinase FGGY;
                     KEGG: eca:ECA4267 glycerol kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="YP_003015756.1"
                     /db_xref="GI:253686566"
                     /db_xref="InterPro:IPR000577"
                     /db_xref="InterPro:IPR005999"
                     /db_xref="GeneID:8131059"
                     /translation="MNPEKKYIVALDQGTTSSRAIVLDHDANIVSVSQREFTQIYPKA
                     GWVEHDPMEIWASQSSTLVEVLAKADISSDEVAGIGITNQRETTVVWEKESGKPIYNA
                     IVWQCRRTADICEKLKKDGLEEYVRNTTGLVVDPYFSGTKVKWILDHVEGSRERAKRG
                     ELLFGTIDTWLIWKMTQGRVHVTDYTNASRTMLFNIHTLEWDTRMLEALDIPREMLPE
                     VRASSEVYGQTNIGGKGGTRIPIAGIAGDQQAALYGQLCVNPGQAKNTYGTGCFLLMN
                     TGKEAVLSKHGLLTTIACGPRGEVNYALEGSVFVGGASIQWLRDELKLIGDSMDSEYF
                     ATKVKDTNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHIIRATLESIAFQTRD
                     VLDAMQADADTRLKALRVDGGAVANNFLMQFQSDILGTRVERPEVRESTALGAAFLAG
                     LATGFWNDLDEVKSKATIEREFRPSIETVERNYRYSGWQKAVARARNWEDHDA"
     misc_feature    complement(187715..189202)
                     /locus_tag="PC1_0159"
                     /note="glycerol kinase; Provisional; Region: glpK;
                     PRK00047"
                     /db_xref="CDD:234594"
     misc_feature    complement(187733..189193)
                     /locus_tag="PC1_0159"
                     /note="Escherichia coli glycerol kinase-like proteins;
                     belongs to the FGGY family of carbohydrate kinases;
                     Region: FGGY_EcGK_like; cd07786"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(187844..187849,187853..187870,
                     187874..187879,187883..187891,187895..187897,
                     188123..188125,188129..188134,188138..188140,
                     188159..188161,188264..188266,188282..188287,
                     188291..188293,188297..188299,188306..188308,
                     188312..188314,188327..188347,188363..188365,
                     188369..188371,188396..188398,188405..188407,
                     188462..188467,188483..188488,188540..188551,
                     188615..188617,188621..188626,188642..188647,
                     188654..188659,188798..188803,188807..188809,
                     188813..188824,188831..188833,188867..188869,
                     188879..188881,188888..188890,188894..188899,
                     188957..188983,189077..189079,189125..189127,
                     189131..189133,189140..189145,189149..189151,
                     189155..189157,189164..189169,189176..189178,
                     189182..189184,189188..189193))
                     /locus_tag="PC1_0159"
                     /note="N- and C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(187961..187963,187970..187978,
                     188219..188221,188225..188230,188264..188269,
                     188273..188278,188396..188398,188405..188413,
                     188468..188473,188801..188803,188897..188899,
                     188954..188962,189155..189157,189164..189172,
                     189176..189178))
                     /locus_tag="PC1_0159"
                     /note="active site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(187961..187963,187970..187978,
                     188219..188221,188225..188230,188264..188269,
                     188273..188278,188405..188413,189155..189157,
                     189164..189172,189176..189178))
                     /locus_tag="PC1_0159"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(188471..188473,189167..189169,
                     189176..189178))
                     /locus_tag="PC1_0159"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(188471..188473,189176..189178))
                     /locus_tag="PC1_0159"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(188396..188398,188468..188473,
                     188801..188803,188897..188899,188954..188962,
                     189167..189169))
                     /locus_tag="PC1_0159"
                     /note="glycerol binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(188519..188524,188681..188683,
                     188690..188692,188921..188923,189020..189025,
                     189032..189034,189044..189049,189056..189058,
                     189107..189109))
                     /locus_tag="PC1_0159"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(188078..188080,188087..188089,
                     188099..188125,188162..188164,188177..188179,
                     188183..188185,188252..188254,188261..188266,
                     188273..188275,188282..188284,188894..188896,
                     189071..189073,189080..189082,189089..189091))
                     /locus_tag="PC1_0159"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(188498..188500,188504..188509))
                     /locus_tag="PC1_0159"
                     /note="FBP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(187763..187765,187769..187780,
                     187784..187786,187790..187792,187994..187996,
                     188000..188002))
                     /locus_tag="PC1_0159"
                     /note="protein IIAGlc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198361"
     gene            complement(189265..190104)
                     /locus_tag="PC1_0160"
                     /db_xref="GeneID:8131060"
     CDS             complement(189265..190104)
                     /locus_tag="PC1_0160"
                     /inference="protein motif:TFAM:TIGR00861"
                     /note="TIGRFAM: MIP family channel protein;
                     PFAM: major intrinsic protein;
                     KEGG: eca:ECA4266 glycerol uptake facilitator protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MIP family channel protein"
                     /protein_id="YP_003015757.1"
                     /db_xref="GI:253686567"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR012269"
                     /db_xref="GeneID:8131060"
                     /translation="MSQAERSTLKGQCIAEFLGTGLLIFFGVGCVAALKLAGASFGQW
                     EISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFDGRKVVPYILAQIAGAFCA
                     AALVYGLYHNLFVDFEQTNNMVRGSTESLSLAGIFSTYPNPHISVMQALLVETVITAI
                     LMCLILALTDDGNGIPRGPLAPLLIGILIAVIGASMGPLTGFALNPARDFGPKLFAFL
                     AGWGNVAFTGAREIPYFLVPIFGPIIGACLGAFGYRALIGRNLPCDVCEPEAETTTRR
                     ESR"
     misc_feature    complement(189343..190071)
                     /locus_tag="PC1_0160"
                     /note="Major intrinsic protein (MIP) superfamily. Members
                     of the MIP superfamily function as membrane channels that
                     selectively transport water, small neutral molecules, and
                     ions out of and between cells. The channel proteins share
                     a common fold: the N-terminal...; Region: MIP; cd00333"
                     /db_xref="CDD:238204"
     misc_feature    complement(order(189481..189483,189490..189492,
                     189499..189504,189895..189903,189955..189957))
                     /locus_tag="PC1_0160"
                     /note="amphipathic channel; other site"
                     /db_xref="CDD:238204"
     misc_feature    complement(order(189484..189492,189889..189897))
                     /locus_tag="PC1_0160"
                     /note="Asn-Pro-Ala signature motifs; other site"
                     /db_xref="CDD:238204"
     gene            190258..190470
                     /locus_tag="PC1_0161"
                     /db_xref="GeneID:8131061"
     CDS             190258..190470
                     /locus_tag="PC1_0161"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: ypy:YPK_0408 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015758.1"
                     /db_xref="GI:253686568"
                     /db_xref="GeneID:8131061"
                     /translation="MSVFAYKMTRRGFSHKVDSNAQVKFINTYPSYFKLYVRWLPLLT
                     PVTYWCKLLGIRAIAAFLQFELFWVT"
     gene            190801..191040
                     /locus_tag="PC1_0162"
                     /db_xref="GeneID:8131062"
     CDS             190801..191040
                     /locus_tag="PC1_0162"
                     /inference="protein motif:PFAM:PF06005"
                     /note="PFAM: protein of unknown function DUF904;
                     KEGG: eca:ECA4265 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015759.1"
                     /db_xref="GI:253686569"
                     /db_xref="InterPro:IPR009252"
                     /db_xref="GeneID:8131062"
                     /translation="MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEQNNALSQDVQAA
                     AGSREALVRENEQLKEEQVVWQERLRALLGKMEEV"
     misc_feature    190801..191037
                     /locus_tag="PC1_0162"
                     /note="Protein of unknown function (DUF904); Region:
                     DUF904; cl11531"
                     /db_xref="CDD:245674"
     gene            complement(191160..191645)
                     /locus_tag="PC1_0163"
                     /db_xref="GeneID:8131063"
     CDS             complement(191160..191645)
                     /locus_tag="PC1_0163"
                     /inference="protein motif:TFAM:TIGR01935"
                     /note="TIGRFAM: regulator of ribonuclease activity A;
                     PFAM: Dimethylmenaquinone methyltransferase;
                     KEGG: eca:ECA4264 ribonuclease activity regulator protein
                     RraA"
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of ribonuclease activity A"
                     /protein_id="YP_003015760.1"
                     /db_xref="GI:253686570"
                     /db_xref="InterPro:IPR005493"
                     /db_xref="InterPro:IPR010203"
                     /db_xref="InterPro:IPR014339"
                     /db_xref="GeneID:8131063"
                     /translation="MKYDTSELCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFED
                     NGLLFDLLEENGLGRVLLVDGGGSVRRALINAEIARLATQNEWEGIVVYGAVRQVDDL
                     AELDIGIQAMAAIPVGAGSEGIGESDIRVNFGGVTFFSGDHLYADNTGIILAEDPLDI
                     E"
     misc_feature    complement(191169..191645)
                     /locus_tag="PC1_0163"
                     /note="ribonuclease activity regulator protein RraA;
                     Provisional; Region: PRK09372"
                     /db_xref="CDD:236487"
     gene            complement(191771..192697)
                     /locus_tag="PC1_0164"
                     /db_xref="GeneID:8131064"
     CDS             complement(191771..192697)
                     /locus_tag="PC1_0164"
                     /inference="protein motif:TFAM:TIGR00751"
                     /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase;
                     PFAM: UbiA prenyltransferase;
                     KEGG: eca:ECA4263 1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /protein_id="YP_003015761.1"
                     /db_xref="GI:253686571"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR004657"
                     /db_xref="GeneID:8131064"
                     /translation="MTLSTHSSKTKAWLDSLRPKTLPLAFASIVTGSAIASWHSSFKP
                     GVALLALLTAGLLQILSNLANDYGDAVKGSDTEDRIGPLRGIQTGAITLTQLRNALIV
                     TVVLTIISGVSLVILACEKPADIFGFLILGLLAIFAAITYTVGNKPYGYIGLGDISVL
                     IFFGWLSVAGSYYLQTGHFDSIVMLPATACGLLATAVLNINNLRDIDNDRISGKNTLA
                     VRLGAEKARFYHTMLLLLAPVCLGLFATFYLHSLAGWLFILTLPLLIKQARYVLRETS
                     AFSMRPMLEKTVKGALLTNILFAVGVILSSCG"
     misc_feature    complement(191795..192658)
                     /locus_tag="PC1_0164"
                     /note="1,4-Dihydroxy-2-naphthoate octaprenyltransferase;
                     Region: PT_UbiA_UBIAD1; cd13962"
                     /db_xref="CDD:260125"
     misc_feature    complement(order(192071..192073,192083..192085,
                     192092..192097,192491..192493,192500..192505))
                     /locus_tag="PC1_0164"
                     /note="putative active site [active]"
                     /db_xref="CDD:260125"
     gene            complement(192843..194174)
                     /locus_tag="PC1_0165"
                     /db_xref="GeneID:8131065"
     CDS             complement(192843..194174)
                     /locus_tag="PC1_0165"
                     /inference="protein motif:TFAM:TIGR00390"
                     /note="KEGG: eca:ECA4262 ATP-dependent protease
                     ATP-binding subunit;
                     TIGRFAM: heat shock protein HslVU, ATPase subunit HslU;
                     PFAM: ATPase AAA-2 domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein HslVU, ATPase subunit HslU"
                     /protein_id="YP_003015762.1"
                     /db_xref="GI:253686572"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004491"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="GeneID:8131065"
                     /translation="MSEMTPREIVSELDSYIIGQHKAKRAVSIALRNRWRRMQLDEAL
                     RHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRD
                     LTDSAIKMVRLQSIEKNRFRAEEMAEDRILDVLIPPAKNNWGQAESTPEPSAARQAFR
                     KKLREGQLDDKEIEIDLAAAPVGVEIMAPPGMEEMTNQLQSMFQNLAGQKQKARKIKI
                     KDAFKLLIEEEAAKLVNPEELKQQAIEAVEQHGIVFIDEIDKICKRGESSGPDVSREG
                     VQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVASPSDLIPELQGRLPIRVELQA
                     LTTEDFERILTEPSASLTEQYKALMATEGVDISFTADGIRRIAEAAWQVNESTENIGA
                     RRLHTVMERLIEDVSYDASEMNGQSVTIDADYVRNHLDELVADEDLSRFIL"
     misc_feature    complement(192846..194174)
                     /locus_tag="PC1_0165"
                     /note="ATP-dependent protease ATP-binding subunit HslU;
                     Provisional; Region: hslU; PRK05201"
                     /db_xref="CDD:235364"
     misc_feature    complement(<193845..194123)
                     /locus_tag="PC1_0165"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(193983..194006)
                     /locus_tag="PC1_0165"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(193980..194003)
                     /locus_tag="PC1_0165"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(193176..>193499)
                     /locus_tag="PC1_0165"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(193404..193421)
                     /locus_tag="PC1_0165"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(193200..193202)
                     /locus_tag="PC1_0165"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(192906..193172)
                     /locus_tag="PC1_0165"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; smart01086"
                     /db_xref="CDD:198154"
     gene            complement(194184..194714)
                     /locus_tag="PC1_0166"
                     /db_xref="GeneID:8131066"
     CDS             complement(194184..194714)
                     /locus_tag="PC1_0166"
                     /inference="protein motif:PFAM:PF00227"
                     /note="PFAM: 20S proteasome A and B subunits;
                     KEGG: eca:ECA4261 ATP-dependent protease peptidase
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="20S proteasome A and B subunits"
                     /protein_id="YP_003015763.1"
                     /db_xref="GI:253686573"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="GeneID:8131066"
                     /translation="MTTIVSVRRNGQVVIGGDGQATLGNTVMKGNVRKVRRLYHDRVI
                     AGFAGGTADAFTLFELFERKLELHQGHLVKAAVELAKDWRTDRMLRKLEALLAVADEN
                     ASLIITGNGDVVQPENDLIAIGSGGPYAQAAARALLENTELGARDIVEKSLGIAGDIC
                     IYTNQFHTIEELASKA"
     misc_feature    complement(194199..194711)
                     /locus_tag="PC1_0166"
                     /note="Protease HslV and the ATPase/chaperone HslU are
                     part of an ATP-dependent proteolytic system that is the
                     prokaryotic homolog of the proteasome. HslV is a dimer of
                     hexamers (a dodecamer) that forms a central proteolytic
                     chamber with active sites on the...; Region:
                     protease_HslV; cd01913"
                     /db_xref="CDD:238894"
     misc_feature    complement(order(194340..194342,194613..194615,
                     194655..194657,194661..194663,194709..194711))
                     /locus_tag="PC1_0166"
                     /note="active site"
                     /db_xref="CDD:238894"
     misc_feature    complement(order(194232..194234,194238..194243,
                     194250..194252,194262..194264,194295..194297,
                     194319..194321,194328..194333,194370..194372,
                     194382..194384,194463..194465,194634..194642))
                     /locus_tag="PC1_0166"
                     /note="HslU subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238894"
     gene            complement(194798..195571)
                     /locus_tag="PC1_0167"
                     /db_xref="GeneID:8131067"
     CDS             complement(194798..195571)
                     /locus_tag="PC1_0167"
                     /inference="protein motif:TFAM:TIGR02223"
                     /note="TIGRFAM: cell division protein FtsN;
                     PFAM: Sporulation domain protein;
                     KEGG: eca:ECA4260 cell division protein FtsN"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsN"
                     /protein_id="YP_003015764.1"
                     /db_xref="GI:253686574"
                     /db_xref="InterPro:IPR007730"
                     /db_xref="InterPro:IPR011930"
                     /db_xref="GeneID:8131067"
                     /translation="MIALAVAVLVTFAGGLYFIAHNKPDESPVLPHQNVGKGNGLPPK
                     PEERWRYIKELENRQLGVTTPTEPSAGGEIRSPVQLTDEQRQLLEQMQSDMRRQPTQL
                     SEVPYNDQTQVPRSQVTIKPSTQPMQQPPVVTTQPATRAPAVTQTTPVVPRQETPRQE
                     TPKQEAPKQQPVKQPEAPKAEKTQRWAIQCGSFKTMDPAESVRAQLAFAGIESRITSN
                     GGWNRIMLGPYNNRAAADSMIQRLKSAGASNCIPLASGG"
     misc_feature    complement(194801..195571)
                     /locus_tag="PC1_0167"
                     /note="cell division protein FtsN; Provisional; Region:
                     PRK12757"
                     /db_xref="CDD:237191"
     misc_feature    complement(194966..>195571)
                     /locus_tag="PC1_0167"
                     /note="Mid-1-related chloride channel (MCLC); Region:
                     MCLC; pfam05934"
                     /db_xref="CDD:114645"
     misc_feature    complement(194819..195028)
                     /locus_tag="PC1_0167"
                     /note="Sporulation related domain; Region: SPOR;
                     pfam05036"
                     /db_xref="CDD:252961"
     gene            complement(195887..196930)
                     /locus_tag="PC1_0168"
                     /db_xref="GeneID:8131068"
     CDS             complement(195887..196930)
                     /locus_tag="PC1_0168"
                     /inference="protein motif:PFAM:PF00532"
                     /note="PFAM: periplasmic binding protein/LacI
                     transcriptional regulator; regulatory protein LacI;
                     SMART: regulatory protein LacI;
                     KEGG: eca:ECA4259 DNA-binding transcriptional regulator
                     CytR"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_003015765.1"
                     /db_xref="GI:253686575"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:8131068"
                     /translation="MKQKKGVTTATMKDVADEAGVSTATVSRTLMNPEKVSATTRRKV
                     EQAVIAVGYSPHALNRNLKRNESRTILTIVPDICDPYFSEIFRGIEETAAEHGYLVLI
                     GDCAHQHQKEKTFVDLIITKQIDGMLLLGSNLPFDAGQEEQRNLPPMVMANEFSPDLA
                     LPTVHIDNLTAAFEAVHYLYQAGHQRIACIAGPEHMHLSQYRLQGYIQALRRNGILID
                     NQYIFRGDFTYETGINGLIALMQHPQPPSAVFCHSDLMALGVLAQARKMGLDIPRDLS
                     VIGFDDIEQAQYCWPPLTSVAQPRYQIGREAMLLLLEQLQGNTVQSGSRLLSSELVIR
                     DSVAAPNFARNRL"
     misc_feature    complement(196739..196894)
                     /locus_tag="PC1_0168"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(196742..196747,196751..196756,
                     196763..196765,196772..196774,196811..196813,
                     196820..196825,196838..196840,196847..196852,
                     196856..196870,196892..196894))
                     /locus_tag="PC1_0168"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(195911..196834)
                     /locus_tag="PC1_0168"
                     /note="DNA-binding transcriptional regulator CytR;
                     Provisional; Region: PRK11041"
                     /db_xref="CDD:182923"
     misc_feature    complement(196745..196774)
                     /locus_tag="PC1_0168"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(195923..196726)
                     /locus_tag="PC1_0168"
                     /note="Ligand-binding domain of an uncharacterized
                     transcription regulator from Actinobacillus succinogenes
                     and its close homologs from other bacteria; Region:
                     PBP1_LacI_like_6; cd06284"
                     /db_xref="CDD:107279"
     misc_feature    complement(order(196145..196147,196244..196246,
                     196562..196564,196619..196621,196625..196627,
                     196634..196636,196661..196663,196724..196726))
                     /locus_tag="PC1_0168"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107279"
     misc_feature    complement(order(196037..196039,196088..196090,
                     196325..196327,196694..196696))
                     /locus_tag="PC1_0168"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107279"
     gene            complement(197207..199405)
                     /locus_tag="PC1_0169"
                     /db_xref="GeneID:8131069"
     CDS             complement(197207..199405)
                     /locus_tag="PC1_0169"
                     /inference="protein motif:TFAM:TIGR00595"
                     /note="KEGG: eca:ECA4258 primosome assembly protein PriA;
                     TIGRFAM: primosomal protein N';
                     PFAM: DEAD/DEAH box helicase domain protein; helicase
                     domain protein; type III restriction protein res subunit;
                     SMART: DEAD-like helicase ; helicase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal protein N'"
                     /protein_id="YP_003015766.1"
                     /db_xref="GI:253686576"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR005259"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8131069"
                     /translation="MSVAQVALPVPLARTFDYLLPAGGIAPQVGARVSVSFGNRKAIG
                     IITALSDTSELPLEQLKPVHDVLDEQPLFPPSLWRILLWAVEYYHYPIGEVLFHALPI
                     LLRQGKPAHRAPLWQWFATEQGRATPLSTLKRAVKQQQALAALLQSPIYRHQVSEIGL
                     TETALQALRSKGLCELQAAEQTLHDWRQNFSLSTDRLRLNTEQATAVGAIRSEDNHFA
                     AWLLAGITGSGKTEVYLSVLENVLAQGKQALVLVPEIGLTPQTIARFRERFNAPVDVL
                     HSALNDSERLAVWLRARSGEAAIVIGTRSALFTPFARLGLIVIDEEHDSSYKQQEGWR
                     YHARDLAVFRAREEDIPIVMGTATPALETLYNVQIGKYRRLNLTKRAGNAALAKQHVI
                     DLKGLPLTAGLSQPLITRIRHHLTNDNQVILFLNRRGFSPVVMCHECGWIAECQRCDH
                     YYTYHQHQKMLRCHHCDSQRPVPQQCPSCGSTNMVPVGLGTEQLEQSLAPIFPNVPIT
                     RIDRDTTSRKGALEQQLSQVRQGGARLLIGTQMLAKGHHFPDVTLVALLDVDGSLFSA
                     DFRAAERFAQLYTQVAGRAGRAGKAGEVALQTHHPEHPLLQTLLQQGYDAFASQALTE
                     RKSVFLPPFTSHILFRADDHDNQQAALFLQQLRNLLEASPLRDESLWLLGPVPALQPK
                     RAGRFRWQLLLQHPSRALLQKLVRTSMALIGTLPQARKVKWMLDVDPTDS"
     misc_feature    complement(197213..199405)
                     /locus_tag="PC1_0169"
                     /note="primosome assembly protein PriA; Validated; Region:
                     PRK05580"
                     /db_xref="CDD:235514"
     misc_feature    complement(198329..198745)
                     /locus_tag="PC1_0169"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(198713..198727)
                     /locus_tag="PC1_0169"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(198437..198448)
                     /locus_tag="PC1_0169"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(197954..198076)
                     /locus_tag="PC1_0169"
                     /note="Zinc ribbon domain; Region: Zn-ribbon_8; pfam09723"
                     /db_xref="CDD:255509"
     misc_feature    complement(197639..197899)
                     /locus_tag="PC1_0169"
                     /note="Helicase conserved C-terminal domain; Region:
                     Helicase_C; pfam00271"
                     /db_xref="CDD:249733"
     gene            199720..199935
                     /locus_tag="PC1_0170"
                     /db_xref="GeneID:8131070"
     CDS             199720..199935
                     /locus_tag="PC1_0170"
                     /inference="protein motif:TFAM:TIGR00105"
                     /note="TIGRFAM: ribosomal protein L31;
                     PFAM: ribosomal protein L31;
                     KEGG: eca:ECA4257 50S ribosomal protein L31"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="YP_003015767.1"
                     /db_xref="GI:253686577"
                     /db_xref="InterPro:IPR002150"
                     /db_xref="GeneID:8131070"
                     /translation="MKKGIHPNYSAVTVTCSCGNVIKTHSTVGRDLNLDVCGECHPFY
                     TGKQRDVATGGRVDRFNKRFSVPGTKK"
     misc_feature    199720..199932
                     /locus_tag="PC1_0170"
                     /note="50S ribosomal protein L31; Reviewed; Region: rpmE;
                     PRK00019"
                     /db_xref="CDD:234576"
     gene            complement(200062..200472)
                     /locus_tag="PC1_0171"
                     /db_xref="GeneID:8131071"
     CDS             complement(200062..200472)
                     /locus_tag="PC1_0171"
                     /inference="protein motif:PFAM:PF03681"
                     /note="PFAM: protein of unknown function UPF0150;
                     KEGG: pen:PSEEN5229 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015768.1"
                     /db_xref="GI:253686578"
                     /db_xref="InterPro:IPR005357"
                     /db_xref="GeneID:8131071"
                     /translation="MFYPIAIEAGDDTHAYGVTVPDLPGCFSAGDTLDDAITNAKEAI
                     TGHIELLVEMGQDIPTVSTVGQLAKRSEYAGYTWAVVDIDVTRLMGGSEKINVTLPKS
                     LIDRIDRCVASNPEFKSRSGFLAQAALERISSSR"
     misc_feature    complement(200326..200466)
                     /locus_tag="PC1_0171"
                     /note="Uncharacterized protein family (UPF0150); Region:
                     UPF0150; pfam03681"
                     /db_xref="CDD:252098"
     misc_feature    complement(<200065..200199)
                     /locus_tag="PC1_0171"
                     /note="Uncharacterized protein family (UPF0156); Region:
                     RHH_2; cl17383"
                     /db_xref="CDD:247937"
     gene            complement(200500..200679)
                     /locus_tag="PC1_0172"
                     /db_xref="GeneID:8131072"
     CDS             complement(200500..200679)
                     /locus_tag="PC1_0172"
                     /inference="protein motif:PFAM:PF07927"
                     /note="PFAM: YcfA family protein;
                     KEGG: bte:BTH_II1999 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="YcfA family protein"
                     /protein_id="YP_003015769.1"
                     /db_xref="GI:253686579"
                     /db_xref="InterPro:IPR012933"
                     /db_xref="GeneID:8131072"
                     /translation="MDSRTLIAEIKADGWELIRVNGSHHHFMHPSKPGLVTIPHPKKD
                     LPIGTVKSIRKQAGI"
     misc_feature    complement(200503..200679)
                     /locus_tag="PC1_0172"
                     /note="YcfA-like protein; Region: YcfA; cl00752"
                     /db_xref="CDD:260605"
     gene            complement(200777..201787)
                     /locus_tag="PC1_0173"
                     /db_xref="GeneID:8131073"
     CDS             complement(200777..201787)
                     /locus_tag="PC1_0173"
                     /inference="protein motif:PFAM:PF01032"
                     /note="PFAM: transport system permease protein;
                     KEGG: eca:ECA4256 putative iron(III) ABC transporter
                     permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transport system permease protein"
                     /protein_id="YP_003015770.1"
                     /db_xref="GI:253686580"
                     /db_xref="InterPro:IPR000522"
                     /db_xref="GeneID:8131073"
                     /translation="MSPTSSRYAATFVVALLILAGLMLVNIATGSTTIPLTQVASVLG
                     LSSADVSPMASRIILELRIPRSLLAALCGAGLAMVGAFLQTATRNDLADPFLFGLSAG
                     ASAGAVAVITRFGEQLGDWALPMAAFCGGILSAVAVTVLFLLQQARGAERLIICGLAI
                     SFLFGALTNYLVFSGDQRAASSILFWSLGGLGLARWDTLPFAVFSVLLLFGLTALRWR
                     ALDALLAGGQTAASMGVNLSRVRVEIFICCAFATSLLVALTGVIGFIGLMIPHLARPL
                     SGVLHKRLLPMTAVLGAILLCGGDWLSRQLLAPQELPIGIITAGLGGVFVLGMLVKRQ
                     QG"
     misc_feature    complement(200807..201589)
                     /locus_tag="PC1_0173"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(200945..200947,200966..200968,
                     201089..201097,201101..201118,201122..201127,
                     201131..201139,201143..201148,201518..201526,
                     201536..201538))
                     /locus_tag="PC1_0173"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(200807..200812,200819..200821,
                     200828..200833,200840..200842,200996..200998,
                     201224..201226,201233..201238,201272..201274,
                     201278..201283,201290..201292,201299..201304,
                     201311..201316,201323..201328,201332..201334,
                     201500..201502,201515..201517,201521..201523))
                     /locus_tag="PC1_0173"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(200849..200851,200876..200878,
                     201008..201010,201020..201022,201194..201196,
                     201272..201274))
                     /locus_tag="PC1_0173"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            complement(201784..202746)
                     /locus_tag="PC1_0174"
                     /db_xref="GeneID:8131074"
     CDS             complement(201784..202746)
                     /locus_tag="PC1_0174"
                     /inference="protein motif:PFAM:PF01497"
                     /note="PFAM: periplasmic binding protein;
                     KEGG: eca:ECA4255 putative iron(III) ABC transporter,
                     periplasmic-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein"
                     /protein_id="YP_003015771.1"
                     /db_xref="GI:253686581"
                     /db_xref="InterPro:IPR002491"
                     /db_xref="GeneID:8131074"
                     /translation="MKITLLSGLLALTSCWAHASDFPVTVDSCGQPLTFTQPPQRAVI
                     HDLNMTEMAFALGLQKSIVGLTGITGWYKAPPDFIKQQGTIPELAAKYPTLENLLAVH
                     PDFFFAGWNYGMKVGGEVTPQALKKYGIQTLVLSESCVFTEPQQQRPRASMDLLYGDM
                     LKLGKIFGKQELAQKQIDDWKQHIATLQTRIGDRPKQTVFLYDSGDDKPFTSGKFAMP
                     TAIIEAAGGKNVMDDMATSWASTSWENVAAREPDFIILLDYQTGNGADALRRFLESHP
                     LMKFTPAVQQHRYLKLQYAELTPGPANIAAVDKLAHALYPDAFK"
     misc_feature    complement(201787..202746)
                     /locus_tag="PC1_0174"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    complement(201814..202683)
                     /locus_tag="PC1_0174"
                     /note="Metal binding protein TroA_a.  These proteins are
                     predicted to function as initial receptors in ABC
                     transport of metal ions in eubacteria. They belong to the
                     TroA superfamily of helical backbone metal receptor
                     proteins that share a distinct fold and...; Region:
                     TroA_a; cd01148"
                     /db_xref="CDD:238568"
     misc_feature    complement(202513..202515)
                     /locus_tag="PC1_0174"
                     /note="putative ligand binding residues [chemical
                     binding]; other site"
                     /db_xref="CDD:238568"
     gene            complement(202756..203553)
                     /locus_tag="PC1_0175"
                     /db_xref="GeneID:8131075"
     CDS             complement(202756..203553)
                     /locus_tag="PC1_0175"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: eca:ECA4254 putative iron(III) ABC transporter
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_003015772.1"
                     /db_xref="GI:253686582"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8131075"
                     /translation="MTEPLSTRPVLLQLHHVSVADANRAPRLSDISLSMQAGERLALI
                     GPNGSGKSTLLRVLTSELGTTTGYIHLNGQPLNSLSRHERAKRIAILAQNDTPDLRLR
                     VAEYVALGRIPHHGFSTPAYDRQLIEEALDDTGLLPLRHRLLGTLSGGERQRAALARA
                     FAQTPQLLLLDEPTNHLDPLARAQLLSLVRKRGISTLAVLHDLPLITPFADRVAVLQQ
                     GILLRWGTPAHALSADCVKSVFGMESFTVSHPINGSPIRIFEAPELH"
     misc_feature    complement(202780..203523)
                     /locus_tag="PC1_0175"
                     /note="ABC-type cobalamin/Fe3+-siderophores transport
                     systems, ATPase components [Inorganic ion transport and
                     metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
                     /db_xref="CDD:224045"
     misc_feature    complement(202897..203517)
                     /locus_tag="PC1_0175"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    complement(203398..203421)
                     /locus_tag="PC1_0175"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(order(202951..202953,203038..203043,
                     203275..203277,203395..203403,203407..203412))
                     /locus_tag="PC1_0175"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(203275..203286)
                     /locus_tag="PC1_0175"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(203086..203115)
                     /locus_tag="PC1_0175"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(203038..203055)
                     /locus_tag="PC1_0175"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(203020..203031)
                     /locus_tag="PC1_0175"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    complement(202945..202965)
                     /locus_tag="PC1_0175"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            complement(203769..204086)
                     /locus_tag="PC1_0176"
                     /db_xref="GeneID:8131076"
     CDS             complement(203769..204086)
                     /locus_tag="PC1_0176"
                     /inference="protein motif:PFAM:PF01340"
                     /note="PFAM: Methionine repressor MetJ;
                     KEGG: eca:ECA4253 transcriptional repressor protein MetJ"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine repressor, MetJ"
                     /protein_id="YP_003015773.1"
                     /db_xref="GI:253686583"
                     /db_xref="InterPro:IPR002084"
                     /db_xref="GeneID:8131076"
                     /translation="MAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRR
                     QVNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKIIMREMGIDPDT
                     WEY"
     misc_feature    complement(203775..204083)
                     /locus_tag="PC1_0176"
                     /note="Met Repressor, MetJ.  MetJ is a bacterial
                     regulatory protein that uses S-adenosylmethionine (SAM) as
                     a corepressor to regulate the production of Methionine.
                     MetJ binds arrays of two to five adjacent copies of an
                     eight base-pair 'metbox'...; Region: Met_repressor_MetJ;
                     cd00490"
                     /db_xref="CDD:119402"
     misc_feature    complement(order(203874..203876,203889..203897,
                     203901..203906,203910..203915,203922..203924,
                     203967..203969,203976..203981,203985..203990,
                     203994..204029,204048..204050,204054..204059))
                     /locus_tag="PC1_0176"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119402"
     misc_feature    complement(order(203922..203930,203964..203966,
                     204003..204005,204009..204023,204033..204035))
                     /locus_tag="PC1_0176"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119402"
     misc_feature    complement(order(203871..203876,203883..203885,
                     203889..203897,203901..203909,203916..203918,
                     203955..203960,203967..203969))
                     /locus_tag="PC1_0176"
                     /note="corepressor binding sites; other site"
                     /db_xref="CDD:119402"
     gene            204274..205434
                     /locus_tag="PC1_0177"
                     /db_xref="GeneID:8131077"
     CDS             204274..205434
                     /locus_tag="PC1_0177"
                     /EC_number="2.5.1.48"
                     /inference="protein motif:TFAM:TIGR02080"
                     /note="KEGG: eca:ECA4252 cystathionine gamma-synthase;
                     TIGRFAM: O-succinylhomoserine (thiol)-lyase;
                     PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylhomoserine (thiol)-lyase"
                     /protein_id="YP_003015774.1"
                     /db_xref="GI:253686584"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR011821"
                     /db_xref="GeneID:8131077"
                     /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNQPRAH
                     DYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAIMLVCTVFLRPGDLLVAPHDCYG
                     GSYRLFDSLNKRGAFRVKFVDQSDTAALNAALAEKPKLVLVESPSNPLLRVVDIAAIC
                     QAAREAGAVSVVDNTFLSPALQKPLELGADLVVHSCTKYLNGHSDVVAGAVIAKDADT
                     ITELAWWANNIGVTGAAFDSYLLLRGLRTLAPRMAAAQRNAQQIVEFLQTQPLVKALY
                     HPSLPNNPGHDIARRQQSGFGAMLSFELDGDEDTLRRFLASLELFTLAESLGGVESLI
                     SHAATMTHAGMAPEARAAAGISETLLRISTGIEDGDDLVADLDRAFQAAAKR"
     misc_feature    204334..205413
                     /locus_tag="PC1_0177"
                     /note="CGS_like: Cystathionine gamma-synthase is a PLP
                     dependent enzyme and catalyzes the committed step of
                     methionine biosynthesis. This pathway is unique to
                     microorganisms and plants, rendering the enzyme an
                     attractive target for the development of...; Region:
                     CGS_like; cd00614"
                     /db_xref="CDD:99738"
     misc_feature    order(204358..204369,204373..204378,204409..204411,
                     204415..204417,204493..204498,204502..204507,
                     204574..204576,204589..204591,204598..204600,
                     204862..204864,204886..204888,204892..204894,
                     204943..204945,204973..204975,204979..204984,
                     205219..205221)
                     /locus_tag="PC1_0177"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99738"
     misc_feature    order(204496..204504,204574..204576,204703..204705,
                     204790..204792,204856..204858,204862..204867,
                     204892..204894)
                     /locus_tag="PC1_0177"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99738"
     misc_feature    order(204496..204504,204574..204576,204790..204792,
                     204799..204801,204856..204858,204862..204867)
                     /locus_tag="PC1_0177"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99738"
     misc_feature    204865..204867
                     /locus_tag="PC1_0177"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99738"
     gene            205437..207872
                     /locus_tag="PC1_0178"
                     /db_xref="GeneID:8131078"
     CDS             205437..207872
                     /locus_tag="PC1_0178"
                     /EC_number="2.7.2.4"
                     /EC_number="1.1.1.3"
                     /inference="protein motif:TFAM:TIGR00657"
                     /note="KEGG: eca:ECA4251 bifunctional aspartate kinase
                     II/homoserine dehydrogenase II;
                     TIGRFAM: aspartate kinase;
                     PFAM: homoserine dehydrogenase; homoserine dehydrogenase
                     NAD-binding; aspartate/glutamate/uridylate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase"
                     /protein_id="YP_003015775.1"
                     /db_xref="GI:253686585"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001341"
                     /db_xref="InterPro:IPR001342"
                     /db_xref="InterPro:IPR005106"
                     /db_xref="GeneID:8131078"
                     /translation="MSALGVAPSVTGRQLHKFGGSSLADVKCYLRVAGIMAEYSHPGD
                     LMVVSAAGSTTNQLISWLKLSQSDRLSAHQVQQALRRYHSELIAGLLPAQTAETLTAQ
                     FIRDLERLATLLDGKITDAVYAEVVGHGEIWSARLMSAVLNQLDMNAAWLDARDFLCA
                     ERAAQPQVDEGRSWPLLQQYLTQHAGQRLVVTGFICRNNAGETVLLGRNGSDYSATQI
                     GALAGVERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQP
                     VSGSDIDLQLRCSYQPEQGSTRIERVLASGTGAKIVTSHDDVCLIEVQVPSEHDFVLL
                     QKEVEQLLNRAQLKPLAIGVHQDRNLLQLCYTSEVVESALQLLSQAALPVELNQRDGL
                     AMVAMVGAGVGKNPLHSHRFYQQLKDQPIEFVRQADDGISLVAVLRVGPTEHLIRGLH
                     HSLFRAEKRIGLVLFGKGNIGSRWLELFAREQSNLSARTGFEFVLAGVVDSTRSLLNY
                     DGLDASRALAFFESEAQERDGEDLFLWMRAHPFDDLVVLDVTASDSVADLYLDFASYG
                     FHVISANKLAGASGGNNYRQIRDAFAKTDRHWLYNATVGAGLPVNFAVRDLRESGDSI
                     LAISGIFSGTLSWLFLQFDGTVPFTELVDQACQQGLTEPDPRVDLSGQDVMRKLVILA
                     REAGYDIEPSQVRVESLVPSGCEQGSVDYFFENGDSLNDQMLRRLEAAQEMGLVLRHV
                     ARFDSNGKARVGVEAVRPDHPLASLLPGDNVFAIESRWYRDNPLVIRGPGAGRDVTAG
                     ALQSDLNRLAQLL"
     misc_feature    205440..207869
                     /locus_tag="PC1_0178"
                     /note="bifunctional aspartate kinase II/homoserine
                     dehydrogenase II; Provisional; Region: metL; PRK09466"
                     /db_xref="CDD:236530"
     misc_feature    205476..206336
                     /locus_tag="PC1_0178"
                     /note="AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK),
                     AK-HSDH; this CD includes the N-terminal catalytic domain
                     of aspartokinase (AK) of the bifunctional enzyme AK -
                     homoserine dehydrogenase (HSDH). These aspartokinases are
                     found in bacteria (E. coli...; Region: AAK_AK-HSDH;
                     cd04257"
                     /db_xref="CDD:239790"
     misc_feature    order(205485..205487,205599..205601,205827..205829,
                     206070..206072,206205..206207,206244..206246)
                     /locus_tag="PC1_0178"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239790"
     misc_feature    order(205485..205487,205491..205499,206130..206135,
                     206142..206147)
                     /locus_tag="PC1_0178"
                     /note="putative nucleotide binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239790"
     misc_feature    order(205581..205586,205599..205601,205827..205829)
                     /locus_tag="PC1_0178"
                     /note="putative aspartate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239790"
     misc_feature    206832..207239
                     /locus_tag="PC1_0178"
                     /note="Homoserine dehydrogenase, NAD binding domain;
                     Region: NAD_binding_3; pfam03447"
                     /db_xref="CDD:251960"
     misc_feature    207261..207848
                     /locus_tag="PC1_0178"
                     /note="Homoserine dehydrogenase; Region: Homoserine_dh;
                     pfam00742"
                     /db_xref="CDD:250099"
     gene            208361..209527
                     /locus_tag="PC1_0179"
                     /db_xref="GeneID:8131079"
     CDS             208361..209527
                     /locus_tag="PC1_0179"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: eca:ECA4250 ABC transporter ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_003015776.1"
                     /db_xref="GI:253686586"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8131079"
                     /translation="MQKTTSSAAAPHIVIDHLHVGYGTTAVLNDIHLEIAQGEFVALL
                     GSSGCGKTTLLRTVAGFSSPRSGTIRVNGQDMTQAPPEKRGMALVFQSYALWPHMTVA
                     QHIAYGLRLRRVPRAEIASRVAELETMLGLTGLSARKPAELSGGQRQRVALGRALAVR
                     PDILLLDEPLSNLDARIRLQLRDEIRALQQRLGLTAIHVTHDREEAMVMADRIVILNQ
                     GRIMQAGSPQEVYHHPASSFVAAFMGAENRLVLDARYDGDTLMISGDAESHSLVPANT
                     SLPPGPIEARFRAEAACLYDAADAPLIQPGMLMRYGTVQAQSYPGGYWLHTISSGTWR
                     IQVHATHPYAIGQRVAVQIPAEALFLFPLAHETTSLSAVPDTTSRYSPLPGLTA"
     misc_feature    208394..209443
                     /locus_tag="PC1_0179"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    208397..209092
                     /locus_tag="PC1_0179"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    208493..208516
                     /locus_tag="PC1_0179"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(208502..208507,208511..208519,208631..208633,
                     208859..208864,208961..208963)
                     /locus_tag="PC1_0179"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    208622..208633
                     /locus_tag="PC1_0179"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    208787..208816
                     /locus_tag="PC1_0179"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    208847..208864
                     /locus_tag="PC1_0179"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    208871..208882
                     /locus_tag="PC1_0179"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    208949..208969
                     /locus_tag="PC1_0179"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            209550..210683
                     /locus_tag="PC1_0180"
                     /db_xref="GeneID:8131080"
     CDS             209550..210683
                     /locus_tag="PC1_0180"
                     /inference="protein motif:PFAM:PF01547"
                     /note="PFAM: extracellular solute-binding protein family
                     1;
                     KEGG: eca:ECA4249 ABC transporter periplasmic binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 1 extracellular solute-binding protein"
                     /protein_id="YP_003015777.1"
                     /db_xref="GI:253686587"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="GeneID:8131080"
                     /translation="MKRIFAATLMLSTPLAAVQAQELTVLTAGDQNMVDYVNEYLGPL
                     FEKQHPGVKVRAVGTGPGDAGSQKILERFNAQQAAGAKVWDTDVAVVHEKFVGPMVQK
                     GDLLKYRDDIASGKLVSMAAADKAMGTDVKGYVMPMFSSQTALAYNPDMVANPPKSYD
                     EIQQWAAANPKMFGYNGIKGGASGVSFVMGWIYAYGGDAQKLMNGPFDEAEAKKWQPA
                     FERLKAFNKNVTLTPGNAGTLDMLSRGEIAMGPVWVDMFYSWKASGQLPDNFKLLLPA
                     PGMPGQPMHYVIPAQAPNRELAKQFVELATSAKVQAEGIVERFNWYPGIDAKYVQAEL
                     KPAVWQRLFTDVTPDELANKGKTFPIAPYHTAILNAYEQAMAK"
     misc_feature    209550..210680
                     /locus_tag="PC1_0180"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; cl17199"
                     /db_xref="CDD:266549"
     misc_feature    209550..210677
                     /locus_tag="PC1_0180"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     gene            210756..211595
                     /locus_tag="PC1_0181"
                     /db_xref="GeneID:8131081"
     CDS             210756..211595
                     /locus_tag="PC1_0181"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: eca:ECA4248 ABC transporter permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_003015778.1"
                     /db_xref="GI:253686588"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8131081"
                     /translation="MLQVSQFSSRLAGIALVLPALAVVAICFITPLGLSVGGAFVSQN
                     GVGIDNFVTALTLYLPDILFTLLIVSLATLLIGLLSVMIGGYLTLGESPRMVALLRWV
                     YRWPLFIPFIVTGQILRTFLAKNGWLNGALDTLGIVDMASASNWLDWRGIVFAFVWKQ
                     TPFVALLVAGAMASLDRTMIESARNLGASRLRILCEIVVPQIGQTLLTGLILSFVTMM
                     SVLSVPMMINAQSPTMLTANIAFRINAYGDYGVANALGVISLLMTGLFAVIYLRLNMR
                     DKA"
     misc_feature    210777..211562
                     /locus_tag="PC1_0181"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    210939..211544
                     /locus_tag="PC1_0181"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(210987..210992,210999..211004,211017..211019,
                     211050..211061,211065..211094,211101..211106,
                     211110..211112,211224..211229,211236..211238,
                     211242..211244,211251..211256,211260..211262,
                     211272..211277,211284..211286,211335..211337,
                     211377..211382,211389..211391,211410..211421,
                     211428..211433,211464..211469,211497..211502,
                     211509..211514,211518..211523,211530..211535,
                     211542..211544)
                     /locus_tag="PC1_0181"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(211068..211112,211410..211427)
                     /locus_tag="PC1_0181"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(211110..211112,211209..211211,211428..211430,
                     211467..211469,211497..211499)
                     /locus_tag="PC1_0181"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(211287..211325,211341..211346,211356..211358)
                     /locus_tag="PC1_0181"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            211592..212398
                     /locus_tag="PC1_0182"
                     /db_xref="GeneID:8131082"
     CDS             211592..212398
                     /locus_tag="PC1_0182"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: eca:ECA4247 ABC transporter permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_003015779.1"
                     /db_xref="GI:253686589"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8131082"
                     /translation="MKNVLWWIPRMLILGTLIFLIFGPLANLLLWSVAEKWFYPHLLP
                     NDWGFAFWKRVFSPRGVAWEALGNSVLVAVFTVLASLSLAIPAGYALARLPLPARGLI
                     LLIFLIPQAFPNLTVYVNIARLFYQWGLNGTLLGVVLVHTVHGLVFAVWIASAAFSAV
                     GREMEQAARSIGAGPWRAFVDITLPLAMPGLMASAIFVFLESLDEFTGSYFVGAPDVQ
                     MMPLLLYTAGAGGNYQIASITALVLLIPSVLFMLVVERFLKADVMARIGK"
     misc_feature    211592..212368
                     /locus_tag="PC1_0182"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    211787..212326
                     /locus_tag="PC1_0182"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(211835..211840,211847..211852,211865..211867,
                     211895..211906,211910..211939,211943..211945,
                     212018..212023,212027..212029,212033..212035,
                     212042..212047,212051..212053,212063..212068,
                     212075..212077,212126..212128,212168..212173,
                     212180..212182,212201..212212,212219..212224,
                     212261..212266,212294..212299,212306..212311,
                     212315..212320)
                     /locus_tag="PC1_0182"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(211913..211942,211943..211945,212201..212218)
                     /locus_tag="PC1_0182"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(211943..211945,212003..212005,212219..212221,
                     212255..212257,212264..212266,212294..212296)
                     /locus_tag="PC1_0182"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(212078..212116,212132..212137,212147..212149)
                     /locus_tag="PC1_0182"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            212395..213399
                     /locus_tag="PC1_0183"
                     /db_xref="GeneID:8131083"
     CDS             212395..213399
                     /locus_tag="PC1_0183"
                     /inference="protein motif:PFAM:PF00532"
                     /note="PFAM: periplasmic binding protein/LacI
                     transcriptional regulator;
                     SMART: regulatory protein LacI;
                     KEGG: eca:ECA4246 putative sugar binding transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_003015780.1"
                     /db_xref="GI:253686590"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:8131083"
                     /translation="MTVGKQGYVSAQDVARRAGVSRSAVSRSFTPGASVSAATYAKVM
                     TAAQELGYQVNDLARGLLANSSRLVGLVVTQPEVGFRANLVAELSQALIQRGSIPVLI
                     NTGHVREAMAAARSILFGHRAEATIVLSGSPPKEFVELAQLNGQPLIVIGRHEPACDS
                     VHIDNDSAARMAARLFASSGRTRLALAGAASATPNIIEREQAFCDEAQALGLPVAVVR
                     GGDTDYDDGLVVGQTLFSLPEAVRPDAVFCVNDLVAFGVIDRAKQFGLAVPQDLMVIG
                     FDDIPAAGWDAYALTTFRQDPATMAAQALALLDRRQSQVQEPACRAKVAAPLIRRQSA
                     "
     misc_feature    212419..213393
                     /locus_tag="PC1_0183"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    212428..212577
                     /locus_tag="PC1_0183"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(212428..212430,212452..212466,212470..212475,
                     212482..212484,212497..212502,212509..212511,
                     212548..212550,212557..212559,212566..212571,
                     212575..212577)
                     /locus_tag="PC1_0183"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    212548..212577
                     /locus_tag="PC1_0183"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    212596..213393
                     /locus_tag="PC1_0183"
                     /note="Ligand-binding domain of uncharacterized
                     DNA-binding regulatory proteins that are members of the
                     LacI-GalR family of bacterial transcription repressors;
                     Region: PBP1_LacI_like_2; cd06278"
                     /db_xref="CDD:107273"
     misc_feature    order(212596..212598,212635..212643,212650..212655,
                     212659..212664,212683..212697,212701..212703,
                     212734..212736,212743..212745,212752..212760,
                     213067..213069,213157..213159,213169..213171,
                     213178..213183)
                     /locus_tag="PC1_0183"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107273"
     misc_feature    order(212632..212637,212644..212646,212779..212781,
                     212848..212850,212881..212883,212989..212991,
                     213058..213060,213226..213228,213277..213279)
                     /locus_tag="PC1_0183"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107273"
     gene            213447..214208
                     /locus_tag="PC1_0184"
                     /db_xref="GeneID:8131084"
     CDS             213447..214208
                     /locus_tag="PC1_0184"
                     /inference="protein motif:PFAM:PF00149"
                     /note="PFAM: metallophosphoesterase;
                     KEGG: eca:ECA4245 phosphodiesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="YP_003015781.1"
                     /db_xref="GI:253686591"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="GeneID:8131084"
                     /translation="MKLIQLSDLHLTAQGGNLHGRDPEQQLKAAIADINAHHRDTDLV
                     VISGDLSDDGSAASYTFLASVLAELQVPWRVTMGNHDDREMFLAQFPTLVDENGFVQS
                     VTTVGDDCVILLDSLHAGEVAGTLCSERLTWFARQLQAAEGKNVFLFLHHPPMSIGLP
                     ALDSVRLAPEAAEALYQVCHRFGNVRHISAGHVHRPASGGWRGISFSTIRGTNHQSAL
                     RFAPGFEVSLEAPQYAIFLTTEEGHTVHFHDFPGG"
     misc_feature    213447..214190
                     /locus_tag="PC1_0184"
                     /note="Predicted phosphohydrolases [General function
                     prediction only]; Region: Icc; COG1409"
                     /db_xref="CDD:224327"
     misc_feature    213450..214157
                     /locus_tag="PC1_0184"
                     /note="Enterobacter aerogenes GpdQ and related proteins,
                     metallophosphatase domain; Region: MPP_GpdQ; cd07402"
                     /db_xref="CDD:163645"
     misc_feature    order(213468..213470,213474..213476,213591..213593,
                     213600..213602,213681..213686,213897..213899,
                     214020..214022,214026..214028,214086..214088)
                     /locus_tag="PC1_0184"
                     /note="active site"
                     /db_xref="CDD:163645"
     misc_feature    order(213468..213470,213474..213476,213591..213593,
                     213681..213683,213897..213899,214020..214022,
                     214026..214028)
                     /locus_tag="PC1_0184"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163645"
     misc_feature    order(213510..213512,213519..213521,213528..213533,
                     213540..213545,213600..213602,213609..213611,
                     213636..213638,213909..213911,213915..213920,
                     214005..214007,214011..214013,214032..214046,
                     214053..214061,214065..214067,214155..214157)
                     /locus_tag="PC1_0184"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163645"
     gene            214712..215608
                     /locus_tag="PC1_0185"
                     /db_xref="GeneID:8131085"
     CDS             214712..215608
                     /locus_tag="PC1_0185"
                     /EC_number="1.5.1.20"
                     /inference="protein motif:TFAM:TIGR00676"
                     /note="KEGG: eca:ECA4244 5,10-methylenetetrahydrofolate
                     reductase;
                     TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
                     PFAM: methylenetetrahydrofolate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="YP_003015782.1"
                     /db_xref="GI:253686592"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004620"
                     /db_xref="GeneID:8131085"
                     /translation="MSFFHANQREALNQSLAELQGRINVSFEFFPPRTSDMEETLWNS
                     IDRLSNLKPKFVSVTYGANSGERDRTHSIIKTIKERTGLEAAPHLTCIDASREQLREI
                     AQDYWQSGIRHIVALRGDLPPEGGKPDMYAADLVSLLKEVGDFDISVAAYPEVHPEAK
                     SAQADLINLKHKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFK
                     QLQKFATMTNVRVPNWMTAMFDGLDNDPETRKMVGASIAMDMVKILSREGVKDFHFYT
                     LNRAELSYAICHTLGVRPDVAR"
     misc_feature    214784..215581
                     /locus_tag="PC1_0185"
                     /note="Methylenetetrahydrofolate reductase (MTHFR).
                     5,10-Methylenetetrahydrofolate is reduced to
                     5-methyltetrahydrofolate by methylenetetrahydrofolate
                     reductase, a cytoplasmic, NAD(P)-dependent enzyme.
                     5-methyltetrahydrofolate is utilized by methionine
                     synthase...; Region: MTHFR; cd00537"
                     /db_xref="CDD:238299"
     misc_feature    order(214889..214891,214973..214975,215060..215068,
                     215102..215107,215159..215161,215165..215167,
                     215177..215179,215183..215185,215204..215206,
                     215213..215215,215222..215227,215252..215254,
                     215258..215260,215534..215536)
                     /locus_tag="PC1_0185"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:238299"
     gene            complement(215846..215986)
                     /locus_tag="PC1_0186"
                     /pseudo
                     /db_xref="GeneID:8131086"
     gene            216089..216997
                     /locus_tag="PC1_0187"
                     /db_xref="GeneID:8131087"
     CDS             216089..216997
                     /locus_tag="PC1_0187"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: eca:ECA4243 DNA-binding transcriptional regulator
                     OxyR"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003015783.1"
                     /db_xref="GI:253686593"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:8131087"
                     /translation="MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELG
                     VMLLERTSRKVLFTQAGLLLVEQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVG
                     PYLLPQIIPMLHRTFPKLEMYLHEAQTHQLLAQLDSGKLDCAILAMVKESEAFIEVPL
                     FDEPMKLAIYQDHPWANRERVAMSDLAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTH
                     FRATSLETLRNMVAAGSGITLLPSLSVPHERERDGVCYLPCYKPEPKRTIALVYRPGS
                     PLRGRYEQLADTIREHMQGYMENLSK"
     misc_feature    216089..216994
                     /locus_tag="PC1_0187"
                     /note="DNA-binding transcriptional regulator OxyR;
                     Provisional; Region: PRK11151"
                     /db_xref="CDD:182999"
     misc_feature    216095..216271
                     /locus_tag="PC1_0187"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    216359..216955
                     /locus_tag="PC1_0187"
                     /note="The C-terminal substrate-binding domain of the
                     LysR-type transcriptional regulator OxyR, a member of the
                     type 2 periplasmic binding fold protein superfamily;
                     Region: PBP2_OxyR; cd08411"
                     /db_xref="CDD:176103"
     misc_feature    order(216395..216397,216404..216409,216416..216418,
                     216428..216430,216452..216466,216743..216745,
                     216752..216757,216764..216766,216773..216778,
                     216782..216787)
                     /locus_tag="PC1_0187"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176103"
     gene            complement(216989..218395)
                     /locus_tag="PC1_0188"
                     /db_xref="GeneID:8131088"
     CDS             complement(216989..218395)
                     /locus_tag="PC1_0188"
                     /inference="protein motif:PFAM:PF02852"
                     /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
                     dimerisation region; FAD-dependent pyridine
                     nucleotide-disulphide oxidoreductase; HI0933 family
                     protein;
                     KEGG: eca:ECA4242 soluble pyridine nucleotide
                     transhydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase
                     dimerisation region"
                     /protein_id="YP_003015784.1"
                     /db_xref="GI:253686594"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR000815"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR004792"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:8131088"
                     /translation="MTLEHQFDYDAIVIGSGPGGEGAAMGLAKHGAKIAVIERHYNVG
                     GGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNSRIIRSSFSDILRHADSVIGQQTRM
                     RQGFYERNQCELFSGEASFIDAHTIAVHYPDNTHETLTAANIIIATGSRPYHPAEVDF
                     NHPRIYDSDSILQLDHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLD
                     QEMSDALSYHFWNNGVVIRHNEEFESIEGLSDGVIVNLKSGKKMKADCLLYANGRTGN
                     TETLGLENIGLSTDSRGQLKVNSMYQTALAHIYAIGDVIGYPSLASAAYDQGRLAAQA
                     IIKGDASAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVG
                     MNVGSLKILFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYP
                     TMAEAYRVAALNGLNRLF"
     misc_feature    complement(216992..218383)
                     /locus_tag="PC1_0188"
                     /note="soluble pyridine nucleotide transhydrogenase;
                     Provisional; Region: PRK05249"
                     /db_xref="CDD:235373"
     misc_feature    complement(<218243..218368)
                     /locus_tag="PC1_0188"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(217619..217858)
                     /locus_tag="PC1_0188"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    complement(217016..217354)
                     /locus_tag="PC1_0188"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            218595..219236
                     /locus_tag="PC1_0189"
                     /db_xref="GeneID:8131089"
     CDS             218595..219236
                     /locus_tag="PC1_0189"
                     /inference="protein motif:PFAM:PF00440"
                     /note="PFAM: regulatory protein TetR;
                     KEGG: eca:ECA4241 DNA-binding transcriptional repressor
                     FabR"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_003015785.1"
                     /db_xref="GI:253686595"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:8131089"
                     /translation="MGSIMGVRAQQKERTRRSLIEAAFSQLSAERSFASLSLREVARE
                     AGIAPTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKTGSVIRTSVSTFMEF
                     IGNNPNAFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLEVENHIPRSFAEAQSEA
                     MVTIVFSAGAEALDVSLEQRKQLEERLVLQLRMIAKGAYYWYRKEHDSSFTVP"
     misc_feature    218604..219212
                     /locus_tag="PC1_0189"
                     /note="DNA-binding transcriptional repressor FabR;
                     Provisional; Region: PRK11202"
                     /db_xref="CDD:236881"
     misc_feature    218649..218780
                     /locus_tag="PC1_0189"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            219272..219658
                     /locus_tag="PC1_0190"
                     /db_xref="GeneID:8131090"
     CDS             219272..219658
                     /locus_tag="PC1_0190"
                     /inference="protein motif:PFAM:PF07226"
                     /note="PFAM: protein of unknown function DUF1422;
                     KEGG: eca:ECA4240 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015786.1"
                     /db_xref="GI:253686596"
                     /db_xref="InterPro:IPR009867"
                     /db_xref="GeneID:8131090"
                     /translation="MTEKPHQEKGTLVLALIAGLSVNGAFAALFSSIVPFSIFPLIAL
                     VLSVYCLHQRYLHHSMPEGIPMLAAASFLLGLLIYSAIVRVEYPAIGSNFIPSILCVV
                     LVFWIGLKLRRRKGSDSVSAEESETL"
     misc_feature    219272..219628
                     /locus_tag="PC1_0190"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11056"
                     /db_xref="CDD:236832"
     gene            complement(219699..220802)
                     /locus_tag="PC1_0191"
                     /db_xref="GeneID:8131091"
     CDS             complement(219699..220802)
                     /locus_tag="PC1_0191"
                     /EC_number="2.1.1.35"
                     /inference="protein motif:TFAM:TIGR02143"
                     /note="KEGG: eca:ECA4239 tRNA
                     (uracil-5-)-methyltransferase;
                     TIGRFAM: tRNA (uracil-5-)-methyltransferase;
                     PFAM: (Uracil-5)-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (uracil-5-)-methyltransferase"
                     /protein_id="YP_003015787.1"
                     /db_xref="GI:253686597"
                     /db_xref="InterPro:IPR010280"
                     /db_xref="InterPro:IPR011869"
                     /db_xref="GeneID:8131091"
                     /translation="MTPEILPIEQYDDQLAEKTERLRGMMAPFNAPEPVVFRSPVSHY
                     RMRAEFRIWHEGDELYHIMFDQQTKQRIRVDRFPAASELINRLMPELLAAIQPDSVLR
                     RKLFQIDYLSTLSGEVIVSLLYHRALDEEWQEHARALRDSLTAQGFRLQLIGRATKTK
                     ICLDRDYVDECLPVAGRDMIYRQVENSFTQPNAAINIQMLEWALDATAGSTGDLLELY
                     CGNGNFSLALARNFERVLATEIAKPSVAAAQYNIAANQIENVQIIRMAAEEFTQAMQG
                     VRQFNRLQGIDLTSYQCETIFVDPPRSGLDDETVKLVQAYPRILYISCNPETLSHNLQ
                     TLSETHDIRRLALFDQFPYTHHMECGVLLEKRQ"
     misc_feature    complement(219705..220802)
                     /locus_tag="PC1_0191"
                     /note="tRNA (uracil-5-)-methyltransferase; Validated;
                     Region: PRK05031"
                     /db_xref="CDD:235332"
     misc_feature    complement(219843..220166)
                     /locus_tag="PC1_0191"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(219906..219908,220002..220010,
                     220083..220088,220134..220154))
                     /locus_tag="PC1_0191"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     misc_binding    220932..221165
                     /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
                     score 98.89"
                     /bound_moiety="adenosylcobalamin"
     gene            221231..223126
                     /locus_tag="PC1_0192"
                     /db_xref="GeneID:8131092"
     CDS             221231..223126
                     /locus_tag="PC1_0192"
                     /inference="protein motif:TFAM:TIGR01779"
                     /note="TIGRFAM: TonB-dependent vitamin B12 receptor;
                     PFAM: TonB-dependent receptor; TonB-dependent receptor
                     plug;
                     KEGG: yen:YE0139 vitamin B12/cobalamin outer membrane
                     transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent vitamin B12 receptor"
                     /protein_id="YP_003015788.1"
                     /db_xref="GI:253686598"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR010101"
                     /db_xref="InterPro:IPR010917"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:8131092"
                     /translation="MIKKISLLTALSVTAFSGWAQENQNSSSEKNADDMVVTANRFAQ
                     PVSSVLAPIDVVTRDDINRWQAKNVLEVMRRLPGVNIAQTGGVGQSASMYIRGSEARH
                     TLVLIDGVPIAKYGITGNPDFNLIPIALVQRIEFMRGPRSAVYGADAIGGVINIITQT
                     TENKTVLSTGIGSNRYQEYSGSLHQSVGDNTRVSLAGAYQDSRGFNVYPNSSNQALDS
                     DKDGWRNKTFWAGVEHQFNDSISGFFRGYGYGTNSDYDALSDDTYGPINDEQQVYNHT
                     YSGGLRFSHENYASQLIASYQKYTSIQYLSTQGRYGAYNSQDDIDQYDMLWGNTLALS
                     HGMVSAGVDWRRQKLTSEGVSFNTLNRESNRYKQDNSGAYLTAQQQYGAVILEGSVRG
                     DDNEKFGRHGTWQLASGWEFFPDYRVTLSYATGFQAPTLGQLYGQKRFDIESNENLKP
                     EESKQWEAGLEGVTGPLSWRLSGYINKIDNLIAYEYAFATNTGTYYNVDAATMKGLEW
                     TGSFETGVLNHQVTLDYLDARNDENDKVLARRAKQQAKYQVDWNLYDVDFNLSYQYVG
                     KRFDNAANTRRLPSYSTVDLAASYPVTSHLTVRGRIANLFDKDYETAYGYRTAGREYY
                     LTGSYTF"
     misc_feature    221231..223123
                     /locus_tag="PC1_0192"
                     /note="vitamin B12/cobalamin outer membrane transporter;
                     Provisional; Region: btuB; PRK10641"
                     /db_xref="CDD:236730"
     misc_feature    221384..223123
                     /locus_tag="PC1_0192"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(221384..221413,221441..221470,221507..221524,
                     221543..221566,221612..221644,221678..221704)
                     /locus_tag="PC1_0192"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    222182..222184
                     /locus_tag="PC1_0192"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            223071..223928
                     /locus_tag="PC1_0193"
                     /db_xref="GeneID:8131093"
     CDS             223071..223928
                     /locus_tag="PC1_0193"
                     /EC_number="5.1.1.3"
                     /inference="protein motif:TFAM:TIGR00067"
                     /note="KEGG: eca:ECA4237 glutamate racemase;
                     TIGRFAM: glutamate racemase;
                     PFAM: Asp/Glu/hydantoin racemase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="YP_003015789.1"
                     /db_xref="GI:253686599"
                     /db_xref="InterPro:IPR001920"
                     /db_xref="InterPro:IPR004391"
                     /db_xref="InterPro:IPR015942"
                     /db_xref="GeneID:8131093"
                     /translation="MATARQGENTISPEAIPSNLPSRPTVLVFDSGVGGLSVYDEIRQ
                     LLPDLHYIYAFDNEAFPYGEKSQQFIIERVVEIVNAVQLRHQLALVVIACNTASTISL
                     PALRERFTFPVVGVVPAVKPAAKLTRNGVVGLLATRATVQRPYTHELIARFATDCQIL
                     SLGSSELVELAEAKLQGETISISELQKILRPWLRLPEPPDTVVLGCTHFPLLAEELKA
                     ALPDGTRLVDSGAAIARRTAWLIANLDNPPLSTDKNLVYCLAITPKVATLWPILQRYG
                     FDSLEKLPL"
     misc_feature    223125..223919
                     /locus_tag="PC1_0193"
                     /note="glutamate racemase; Provisional; Region: PRK00865"
                     /db_xref="CDD:234851"
     gene            224316..225845
                     /locus_tag="PC1_R0001"
                     /db_xref="GeneID:8131094"
     rRNA            224316..225845
                     /locus_tag="PC1_R0001"
                     /product="16S ribosomal RNA"
                     /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res.
                     Apr2 2, 2007"
                     /db_xref="GeneID:8131094"
     gene            225938..226013
                     /locus_tag="PC1_R0002"
                     /note="tRNA-Glu1"
                     /db_xref="GeneID:8131095"
     tRNA            225938..226013
                     /locus_tag="PC1_R0002"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:8131095"
     gene            226275..229180
                     /locus_tag="PC1_R0003"
                     /db_xref="GeneID:8131096"
     rRNA            226275..229180
                     /locus_tag="PC1_R0003"
                     /product="23S ribosomal RNA"
                     /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res.
                     Apr2 2, 2007"
                     /db_xref="GeneID:8131096"
     gene            229309..229423
                     /locus_tag="PC1_R0004"
                     /db_xref="GeneID:8131097"
     rRNA            229309..229423
                     /locus_tag="PC1_R0004"
                     /product="5S ribosomal RNA"
                     /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res.
                     Apr2 2, 2007"
                     /db_xref="GeneID:8131097"
     gene            229579..230616
                     /locus_tag="PC1_0194"
                     /db_xref="GeneID:8131098"
     CDS             229579..230616
                     /locus_tag="PC1_0194"
                     /EC_number="1.1.1.158"
                     /inference="protein motif:TFAM:TIGR00179"
                     /note="KEGG: eca:ECA0213
                     UDP-N-acetylenolpyruvoylglucosamine reductase;
                     TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine reductase;
                     PFAM: UDP-N-acetylenolpyruvoylglucosamine reductase domain
                     protein; FAD linked oxidase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="YP_003015790.1"
                     /db_xref="GI:253686600"
                     /db_xref="InterPro:IPR003170"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR011601"
                     /db_xref="GeneID:8131098"
                     /translation="MASSIISLKSYNSFSLPVSASCIKVADTQEKLIEGWRVASASQE
                     PILLLGEGSNVLFLEDFLGTILLNRLKGIDIREEGDGWYIHVGAGENWHQLVEYTLKC
                     GIAGLENLALIPGCVGSAPIQNIGAYGIELQHVCDYVDVLDLAEGDVMRFTSEECQFD
                     YRESIFKHQYRSGFAITAVGLFLKKEWSPILNYGDLVKLDPTTVTPQQIFDSVCHMRR
                     SKLPDPAVTGNAGSFFKNPIITQQHAERVLREYPNAPQYLQTDGNVKLAAGWLIDQCE
                     LKGFQLGGAAVHEKQALVLINKNNAKSSDVVELARYVRSQVAEKFSIELEPEVRFIAA
                     HGEVNAIEVLS"
     misc_feature    229594..230574
                     /locus_tag="PC1_0194"
                     /note="UDP-N-acetylenolpyruvoylglucosamine reductase;
                     Provisional; Region: murB; PRK00046"
                     /db_xref="CDD:234593"
     misc_feature    229636..230037
                     /locus_tag="PC1_0194"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    230194..230574
                     /locus_tag="PC1_0194"
                     /note="UDP-N-acetylenolpyruvoylglucosamine reductase,
                     C-terminal domain; Region: MurB_C; pfam02873"
                     /db_xref="CDD:251582"
     gene            230613..231572
                     /locus_tag="PC1_0195"
                     /db_xref="GeneID:8131099"
     CDS             230613..231572
                     /locus_tag="PC1_0195"
                     /EC_number="6.3.4.15"
                     /inference="protein motif:TFAM:TIGR00121"
                     /note="KEGG: eca:ECA0214 biotin--protein ligase;
                     TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; biotin
                     operon repressor;
                     PFAM: biotin/lipoate A/B protein ligase; Helix-turn-helix
                     type 11 domain protein; biotin protein ligase domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional BirA, biotin operon
                     repressor/biotin--acetyl-CoA-carboxylase ligase"
                     /protein_id="YP_003015791.1"
                     /db_xref="GI:253686601"
                     /db_xref="InterPro:IPR003142"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /db_xref="InterPro:IPR004409"
                     /db_xref="InterPro:IPR013196"
                     /db_xref="GeneID:8131099"
                     /translation="MKDTTVPLKLIKILSDGEFYSGELLGEMMGMSRAAINKHIQTIR
                     DWGIDVFTVTGKGYSLPAPMQLLDEEVILKHLPEGGVTVLPVVDSTNQYILDRLDILS
                     SGDACLAEYQQSGRGRRGRQWFSPFGANLYLSLYWRLEQGPAAAVGVSLVIGIVMAEV
                     LHKLGADGVRVKWPNDLYLKDRKLAGILVELTGKTGDAANLVIGAGINLQMREPAPDT
                     ISQGWINLQEAGIDINRNTLASTLISELRGALAIFELQGLEPFIPRWEKLDNYFNRPV
                     RLIIGNREIYGIDRGIDRQGALLLENDGLVTPYIGGEISLRGA"
     misc_feature    230613..230843
                     /locus_tag="PC1_0195"
                     /note="Biotin operon repressor [Transcription]; Region:
                     BirA; COG1654"
                     /db_xref="CDD:224568"
     misc_feature    230616..231569
                     /locus_tag="PC1_0195"
                     /note="bifunctional biotin--[acetyl-CoA-carboxylase]
                     synthetase/biotin operon repressor; Provisional; Region:
                     PRK11886"
                     /db_xref="CDD:237010"
     misc_feature    230859..231236
                     /locus_tag="PC1_0195"
                     /note="Biotin/lipoate A/B protein ligase family; Region:
                     BPL_LplA_LipB; pfam03099"
                     /db_xref="CDD:251729"
     misc_feature    231423..231563
                     /locus_tag="PC1_0195"
                     /note="Biotin protein ligase C terminal domain; Region:
                     BPL_C; pfam02237"
                     /db_xref="CDD:251174"
     gene            complement(231614..232564)
                     /locus_tag="PC1_0196"
                     /db_xref="GeneID:8131100"
     CDS             complement(231614..232564)
                     /locus_tag="PC1_0196"
                     /inference="protein motif:TFAM:TIGR00554"
                     /note="TIGRFAM: pantothenate kinase;
                     KEGG: eca:ECA0215 pantothenate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="YP_003015792.1"
                     /db_xref="GI:253686602"
                     /db_xref="InterPro:IPR004566"
                     /db_xref="GeneID:8131100"
                     /translation="MSNREQSLATPYLQFNRSQWAALRDSVPLTLTEEEIVKLKGINE
                     DLSLDEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQKIPYIIGIAGSVAVGKS
                     TTARVLQALLSRWPEHRSVELITTDGFLHPNKVLKERDLMKKKGFPQSYDMHSLVKFV
                     SDIKSGTHKVTAPTYSHLTYDIVPNNNKVLEQPDILILEGLNVLQSGMDYPHDPHRVF
                     VSDFVDFSIYVDAPETLLQTWYINRFLKFRQGAFSNPNSYFHNYAKLTEEEAVGIASQ
                     LWKEINGLNLKENILPTRERASLIMTKSANHAVECVRLRK"
     misc_feature    complement(231623..232297)
                     /locus_tag="PC1_0196"
                     /note="Pantothenate kinase (PanK) catalyzes the
                     phosphorylation of pantothenic acid to form
                     4'-phosphopantothenic, which is the first of five steps in
                     coenzyme A (CoA) biosynthetic pathway. The reaction
                     carried out by this enzyme is a key regulatory point...;
                     Region: PanK; cd02025"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(231644..231646,231656..231658,
                     231836..231838,231848..231850,232253..232264,
                     232271..232273))
                     /locus_tag="PC1_0196"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(231644..231646,231824..231826,
                     231836..231838,232034..232036,232247..232249,
                     232259..232264))
                     /locus_tag="PC1_0196"
                     /note="CoA-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(231968..231970,232259..232261))
                     /locus_tag="PC1_0196"
                     /note="Mg2+-binding site [ion binding]; other site"
                     /db_xref="CDD:238983"
     gene            complement(232775..233323)
                     /locus_tag="PC1_0197"
                     /db_xref="GeneID:8131101"
     CDS             complement(232775..233323)
                     /locus_tag="PC1_0197"
                     /inference="protein motif:PFAM:PF00583"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: yen:YE0277 putative acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-like N-acetyltransferase"
                     /protein_id="YP_003015793.1"
                     /db_xref="GI:253686603"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:8131101"
                     /translation="MKTVQLNAATLPVYREELANLLIDAVEKGASVGYQSPLHHKEAI
                     EYFHSLQISVANGERILWVARDEEGIIGSVQLELCQKPNGRNRAEIQKLLVHSRARRT
                     GIGRQLIHLLEKHALFQQRGLLYLDTQAGSPAEAFYRALGYRHLGELPDYACTPDGYY
                     HPTAIYYKRLFAVNGLGKAIAS"
     misc_feature    complement(232895..>233161)
                     /locus_tag="PC1_0197"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    complement(232943..233143)
                     /locus_tag="PC1_0197"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(233006..233011,233039..233047))
                     /locus_tag="PC1_0197"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            233656..233731
                     /locus_tag="PC1_R0005"
                     /note="tRNA-Thr1"
                     /db_xref="GeneID:8131102"
     tRNA            233656..233731
                     /locus_tag="PC1_R0005"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:8131102"
     gene            233749..233833
                     /locus_tag="PC1_R0006"
                     /note="tRNA-Tyr1"
                     /db_xref="GeneID:8131103"
     tRNA            233749..233833
                     /locus_tag="PC1_R0006"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:8131103"
     gene            233963..234037
                     /locus_tag="PC1_R0007"
                     /note="tRNA-Gly1"
                     /db_xref="GeneID:8131104"
     tRNA            233963..234037
                     /locus_tag="PC1_R0007"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:8131104"
     gene            234044..234119
                     /locus_tag="PC1_R0008"
                     /note="tRNA-Thr2"
                     /db_xref="GeneID:8131105"
     tRNA            234044..234119
                     /locus_tag="PC1_R0008"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:8131105"
     gene            234227..235411
                     /locus_tag="PC1_0198"
                     /db_xref="GeneID:8131106"
     CDS             234227..235411
                     /locus_tag="PC1_0198"
                     /inference="protein motif:TFAM:TIGR00485"
                     /note="TIGRFAM: translation elongation factor Tu; small
                     GTP-binding protein;
                     PFAM: protein synthesis factor GTP-binding; elongation
                     factor Tu domain protein; elongation factor Tu domain 2
                     protein;
                     KEGG: esa:ESA_04403 elongation factor Tu"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor Tu"
                     /protein_id="YP_003015794.1"
                     /db_xref="GI:253686604"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="GeneID:8131106"
                     /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNA
                     RAFDQIDNAPEEKARGITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQ
                     YDFPGDDTPVVRGSALKALEGEAEWEAKIIELAEHLDSYIPEPERAIDKPFLLPIEDV
                     FSISGRGTVVTGRVERGIVKVGEEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVG
                     VLLRGIKREEIERGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKV
                     IA"
     misc_feature    234227..235408
                     /locus_tag="PC1_0198"
                     /note="elongation factor Tu; Reviewed; Region: PRK00049"
                     /db_xref="CDD:234596"
     misc_feature    234257..234835
                     /locus_tag="PC1_0198"
                     /note="Elongation Factor Tu (EF-Tu) GTP-binding proteins;
                     Region: EF_Tu; cd01884"
                     /db_xref="CDD:206671"
     misc_feature    234281..234304
                     /locus_tag="PC1_0198"
                     /note="G1 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    order(234284..234286,234290..234292,234302..234307,
                     234314..234316,234323..234328,234338..234340,
                     234422..234427,234479..234484,234551..234556,
                     234560..234571,234578..234580,234671..234673,
                     234683..234685,234761..234766)
                     /locus_tag="PC1_0198"
                     /note="GEF interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    order(234290..234307,234365..234367,234632..234637,
                     234641..234643,234746..234754)
                     /locus_tag="PC1_0198"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    234392..234424
                     /locus_tag="PC1_0198"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206671"
     misc_feature    234410..234412
                     /locus_tag="PC1_0198"
                     /note="G2 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    234467..234478
                     /locus_tag="PC1_0198"
                     /note="G3 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    234473..234529
                     /locus_tag="PC1_0198"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206671"
     misc_feature    234632..234643
                     /locus_tag="PC1_0198"
                     /note="G4 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    234746..234754
                     /locus_tag="PC1_0198"
                     /note="G5 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    234857..235117
                     /locus_tag="PC1_0198"
                     /note="EFTU_II: Elongation factor Tu domain II. Elongation
                     factors Tu (EF-Tu) are three-domain GTPases with an
                     essential function in the elongation phase of mRNA
                     translation. The GTPase center of EF-Tu is in the
                     N-terminal domain (domain I), also known as the...;
                     Region: EFTU_II; cd03697"
                     /db_xref="CDD:239668"
     misc_feature    235124..235393
                     /locus_tag="PC1_0198"
                     /note="Domain III of elongation factor (EF) Tu. Ef-Tu
                     consists of three structural domains, designated I, II and
                     III. Domain III adopts a beta barrel structure. Domain III
                     is involved in binding to both charged tRNA and binding to
                     elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707"
                     /db_xref="CDD:239678"
     misc_feature    order(235160..235162,235166..235174,235226..235228,
                     235346..235354,235382..235384)
                     /locus_tag="PC1_0198"
                     /note="Antibiotic Binding Site [chemical binding]; other
                     site"
                     /db_xref="CDD:239678"
     gene            235650..236033
                     /locus_tag="PC1_0199"
                     /db_xref="GeneID:8131107"
     CDS             235650..236033
                     /locus_tag="PC1_0199"
                     /inference="protein motif:TFAM:TIGR00964"
                     /note="TIGRFAM: preprotein translocase, SecE subunit;
                     PFAM: protein secE/sec61-gamma protein;
                     KEGG: eca:ECA0217 preprotein translocase subunit SecE"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="YP_003015795.1"
                     /db_xref="GI:253686605"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR005807"
                     /db_xref="GeneID:8131107"
                     /translation="MSANTEAQDSGRGLEVIKWLVVGALLVVAIVGNYYYREFSLPLR
                     ALAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTA
                     VMSLILWGLDGILVRLVSFITGLRF"
     misc_feature    235746..236021
                     /locus_tag="PC1_0199"
                     /note="preprotein translocase subunit SecE; Reviewed;
                     Region: secE; PRK05740"
                     /db_xref="CDD:235587"
     gene            236035..236580
                     /locus_tag="PC1_0200"
                     /db_xref="GeneID:8131108"
     CDS             236035..236580
                     /locus_tag="PC1_0200"
                     /inference="protein motif:TFAM:TIGR00922"
                     /note="KEGG: eca:ECA0218 transcription antitermination
                     protein NusG;
                     TIGRFAM: transcription termination/antitermination factor
                     NusG;
                     PFAM: NGN domain protein; KOW domain protein;
                     SMART: NGN domain protein; KOW domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NusG antitermination factor"
                     /protein_id="YP_003015796.1"
                     /db_xref="GI:253686606"
                     /db_xref="InterPro:IPR001062"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR006645"
                     /db_xref="InterPro:IPR015869"
                     /db_xref="GeneID:8131108"
                     /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHNMEELFGEVMV
                     PTEEVVEIRGGQRRKSERKFFPGYVLVQMVMEDASWHLVRSVPRVMGFIGGTSDRPAP
                     ISDKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKV
                     SVSIFGRATPVELDFAQVEKG"
     misc_feature    236038..236574
                     /locus_tag="PC1_0200"
                     /note="transcription antitermination protein NusG;
                     Validated; Region: nusG; PRK05609"
                     /db_xref="CDD:180161"
     misc_feature    236056..236379
                     /locus_tag="PC1_0200"
                     /note="Bacterial N-Utilization Substance G (NusG)
                     N-terminal (NGN) domain, subgroup 1; Region: NGN_Bact_1;
                     cd09891"
                     /db_xref="CDD:193580"
     misc_feature    order(236065..236067,236167..236169,236227..236229,
                     236236..236238,236242..236244,236341..236343,
                     236365..236367)
                     /locus_tag="PC1_0200"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193580"
     misc_feature    236407..236574
                     /locus_tag="PC1_0200"
                     /note="NusG contains an NGN domain at its N-terminus and
                     KOW motif at its C-terminus; Region: KOW_NusG; cd06091"
                     /db_xref="CDD:240515"
     misc_feature    order(236443..236457,236464..236466,236500..236502,
                     236527..236535,236539..236550,236560..236565)
                     /locus_tag="PC1_0200"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     misc_feature    236443..236454
                     /locus_tag="PC1_0200"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     gene            236743..237171
                     /locus_tag="PC1_0201"
                     /db_xref="GeneID:8131109"
     CDS             236743..237171
                     /locus_tag="PC1_0201"
                     /inference="protein motif:TFAM:TIGR01632"
                     /note="KEGG: eca:ECA0219 50S ribosomal protein L11;
                     TIGRFAM: ribosomal protein L11;
                     PFAM: ribosomal protein L11;
                     SMART: ribosomal protein L11"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="YP_003015797.1"
                     /db_xref="GI:253686607"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /db_xref="GeneID:8131109"
                     /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNA
                     KTESVEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVT
                     SAQVREIAETKAADMTGSDVDAMARSIAGTARSMGLVVED"
     misc_feature    236743..237168
                     /locus_tag="PC1_0201"
                     /note="50S ribosomal protein L11; Validated; Region: rplK;
                     PRK00140"
                     /db_xref="CDD:234661"
     misc_feature    236767..237162
                     /locus_tag="PC1_0201"
                     /note="Ribosomal protein L11. Ribosomal protein L11,
                     together with proteins L10 and L7/L12, and 23S rRNA, form
                     the L7/L12 stalk on the surface of the large subunit of
                     the ribosome. The homologous eukaryotic cytoplasmic
                     protein is also called 60S ribosomal...; Region:
                     Ribosomal_L11; cd00349"
                     /db_xref="CDD:100101"
     misc_feature    order(236770..236772,236830..236832,236965..236973,
                     236983..236985,237004..237006,237079..237081,
                     237094..237102,237112..237114,237121..237126,
                     237133..237138,237142..237150)
                     /locus_tag="PC1_0201"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100101"
     misc_feature    order(236770..236772,236914..236916,236920..236931,
                     236941..236943,236947..236952,237082..237087,
                     237094..237099)
                     /locus_tag="PC1_0201"
                     /note="L7/L12 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(236818..236820,236830..236832)
                     /locus_tag="PC1_0201"
                     /note="putative thiostrepton binding site; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(237022..237024,237031..237033)
                     /locus_tag="PC1_0201"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     gene            237175..237879
                     /locus_tag="PC1_0202"
                     /db_xref="GeneID:8131110"
     CDS             237175..237879
                     /locus_tag="PC1_0202"
                     /inference="protein motif:TFAM:TIGR01169"
                     /note="TIGRFAM: ribosomal protein L1;
                     PFAM: ribosomal protein L1;
                     KEGG: eca:ECA0220 50S ribosomal protein L1"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="YP_003015798.1"
                     /db_xref="GI:253686608"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR005878"
                     /db_xref="GeneID:8131110"
                     /translation="MAKLTKRMRVIRDKVDVTKQYDINEAVALLKELATAKFVESVDV
                     AVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAEFVGMEDLAE
                     QIKKGEMGFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVNNAKAGQ
                     VRYRNDKNGIIHTTIGKVDFDSNKLKENLEALLVALKKAKPSQAKGVYIKKVSLSTTM
                     GAGVAVDQSGLNAAAN"
     misc_feature    237241..237846
                     /locus_tag="PC1_0202"
                     /note="Ribosomal protein L1.  The L1 protein, located near
                     the E-site of the ribosome, forms part of the L1 stalk
                     along with 23S rRNA.  In bacteria and archaea, L1
                     functions both as a ribosomal protein that binds rRNA, and
                     as a translation repressor that binds...; Region:
                     Ribosomal_L1; cd00403"
                     /db_xref="CDD:238235"
     misc_feature    order(237280..237288,237295..237297,237301..237303,
                     237307..237309,237313..237315,237676..237678,
                     237682..237684,237688..237690,237826..237831,
                     237835..237837)
                     /locus_tag="PC1_0202"
                     /note="mRNA/rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238235"
     gene            238196..238693
                     /locus_tag="PC1_0203"
                     /db_xref="GeneID:8131111"
     CDS             238196..238693
                     /locus_tag="PC1_0203"
                     /inference="protein motif:PFAM:PF00466"
                     /note="PFAM: ribosomal protein L10;
                     KEGG: eca:ECA0221 50S ribosomal protein L10"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="YP_003015799.1"
                     /db_xref="GI:253686609"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR002363"
                     /db_xref="GeneID:8131111"
                     /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKA
                     GREAGVYMRVVRNTLLRRVVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKA
                     NAKFEVKAAAFEGELIPAAQIDRLATLPTYEEALARLMSTMKEAAAGKLVRTLAAVRD
                     AKEAA"
     misc_feature    238205..238675
                     /locus_tag="PC1_0203"
                     /note="Ribosomal protein L10 family, L10 subfamily;
                     composed of bacterial 50S ribosomal protein and eukaryotic
                     mitochondrial 39S ribosomal protein, L10. L10 occupies the
                     L7/L12 stalk of the ribosome. The N-terminal domain (NTD)
                     of L10 interacts with L11 protein...; Region:
                     Ribosomal_L10; cd05797"
                     /db_xref="CDD:240223"
     misc_feature    order(238217..238222,238229..238231,238361..238372,
                     238379..238381)
                     /locus_tag="PC1_0203"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240223"
     misc_feature    order(238463..238465,238532..238534,238541..238543,
                     238589..238591,238598..238603,238610..238615,
                     238619..238627,238631..238639,238643..238651,
                     238658..238663,238667..238672)
                     /locus_tag="PC1_0203"
                     /note="Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240223"
     gene            238760..239125
                     /locus_tag="PC1_0204"
                     /db_xref="GeneID:8131112"
     CDS             238760..239125
                     /locus_tag="PC1_0204"
                     /inference="protein motif:TFAM:TIGR00855"
                     /note="TIGRFAM: ribosomal protein L7/L12;
                     PFAM: Ribosomal protein L7/L12;
                     KEGG: ent:Ent638_0196 50S ribosomal protein L7/L12"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="YP_003015800.1"
                     /db_xref="GI:253686610"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="GeneID:8131112"
                     /translation="MSITKDQILEAVAAMSVMDVVELVSAMEEKFGVSAAAAVAVAAG
                     PAEVAEEKTEFDVVLKGIGANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVSKD
                     DAEALKKSLEEAGAEVEVK"
     misc_feature    238766..239119
                     /locus_tag="PC1_0204"
                     /note="Ribosomal protein L7/L12. Ribosomal protein L7/L12
                     refers to the large ribosomal subunit proteins L7 and L12,
                     which are identical except that L7 is acetylated at the N
                     terminus. It is a component of the L7/L12 stalk, which is
                     located at the surface of...; Region: Ribosomal_L7_L12;
                     cd00387"
                     /db_xref="CDD:100102"
     misc_feature    order(238766..238768,238805..238813,238820..238825,
                     238832..238834,238841..238843,238880..238888,
                     238916..238921,238982..238984,238988..238993,
                     238997..238999,239003..239008,239048..239053,
                     239057..239059,239066..239068)
                     /locus_tag="PC1_0204"
                     /note="core dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100102"
     misc_feature    order(238775..238777,238784..238786,238796..238798,
                     238835..238837,238850..238852)
                     /locus_tag="PC1_0204"
                     /note="peripheral dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100102"
     misc_feature    order(238817..238819,238826..238831,238841..238843,
                     238850..238852)
                     /locus_tag="PC1_0204"
                     /note="L10 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(238955..238960,238967..238972,238979..238981,
                     239000..239005,239012..239014)
                     /locus_tag="PC1_0204"
                     /note="L11 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(238958..238960,238970..238972,238979..238981,
                     239000..239005,239012..239014)
                     /locus_tag="PC1_0204"
                     /note="putative EF-Tu interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(238958..238960,238967..238972,238979..238981)
                     /locus_tag="PC1_0204"
                     /note="putative EF-G interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     gene            239453..243481
                     /locus_tag="PC1_0205"
                     /db_xref="GeneID:8131113"
     CDS             239453..243481
                     /locus_tag="PC1_0205"
                     /EC_number="2.7.7.6"
                     /inference="protein motif:TFAM:TIGR02013"
                     /note="KEGG: eca:ECA0223 DNA-directed RNA polymerase
                     subunit beta;
                     TIGRFAM: DNA-directed RNA polymerase, beta subunit;
                     PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
                     domain 7; RNA polymerase Rpb2 domain 3; RNA polymerase
                     Rpb2 domain 2; RNA polymerase beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="YP_003015801.1"
                     /db_xref="GI:253686611"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR010243"
                     /db_xref="GeneID:8131113"
                     /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPE
                     GQYGLEAAFRSVFPIKSYSGNSELQYVSYRLGEPVFDVKECQIRGVTFSAPLRVKLRL
                     VIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSD
                     KGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALGYSTE
                     QILDLFFDKIVYEINGNKLQMDLVPERLRGETASFDIEANGKVYIEKGRRITARHIRQ
                     LEKDGIERIEVPVEYIAGKVLSKDYIDESTGELIGAANMELSLDLLAKLSQSGHKRIE
                     TLFTNDLDHGAYMSETVRVDPSNDRLSALVEIYRMMRPGEPPTREAAETLFENLFFSE
                     DRYDLSAVGRMKFNRSLLRDEIEGSGILSKDDIIEVMKKLIDIRNGKGEVDDIDHLGN
                     RRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGS
                     SQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEG
                     PNIGLINSLSVYAQTNEYGFLETPYRRVRDNVVTDEIHYLSAIEEGNFVIAQANTNLD
                     EEGRFIDELVTCRNKGESSLFSRDQVEYMDVSTQQVVSVGASLIPFLEHDDANRALMG
                     ANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKRGGTVQYVDASRIVIRVNDDE
                     MYPGEAGIDIYNLTKYTRSNQNTCISQMPCVSLGEPVERGDVLADGPSTDLGELALGQ
                     NMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPN
                     VGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
                     DSSLRVPNGVSGTIIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLF
                     ARIHAVLVSGGVEADKLDKLPRERWLELGLTDEDKQNQLEQLAEQYDELKHEFEKKLE
                     AKRRKITQGDDLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYD
                     ENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGEKINAMLKQHEEVTKLREFIQ
                     RAYDLGDDVRQKVDLSTFSDEEVMRLAENLKKGMPIATPVFDGAKEKEIKELLQMGGI
                     PTSGQITLYDGRTGEKFERQVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGK
                     AQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
                     ESFNVLLKEIRSLGINIELEEE"
     misc_feature    239453..243478
                     /locus_tag="PC1_0205"
                     /note="DNA-directed RNA polymerase subunit beta; Reviewed;
                     Region: rpoB; PRK00405"
                     /db_xref="CDD:234749"
     misc_feature    239531..243472
                     /locus_tag="PC1_0205"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cd00653"
                     /db_xref="CDD:238353"
     misc_feature    order(239714..239716,241937..241939,242048..242050,
                     242054..242056,242066..242074,242078..242080)
                     /locus_tag="PC1_0205"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(241088..241090,241094..241102,241106..241108,
                     241115..241117,241130..241132,241412..241414,
                     241466..241474,241478..241480,241862..241873,
                     241880..241882,241886..241894,242669..242671,
                     242675..242677,242681..242683,242747..242749,
                     242753..242755,242762..242764,242771..242773,
                     242786..242788,242798..242800,243011..243013,
                     243092..243094,243116..243124,243128..243130,
                     243167..243169,243176..243184,243188..243193,
                     243254..243262,243272..243274,243278..243283,
                     243287..243289,243293..243310,243314..243331,
                     243341..243343,243410..243412,243422..243424,
                     243428..243430,243434..243439,243443..243445,
                     243449..243460,243464..243466,243470..243472)
                     /locus_tag="PC1_0205"
                     /note="RPB1 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    241223..241420
                     /locus_tag="PC1_0205"
                     /note="RNA polymerase beta subunit external 1 domain;
                     Region: RNA_pol_Rpb2_45; pfam10385"
                     /db_xref="CDD:255954"
     misc_feature    order(241538..241543,241847..241849,241853..241855,
                     241916..241918,241925..241927,242696..242698,
                     242735..242737,242816..242818,242981..242983,
                     242987..242989,243080..243082,243131..243133)
                     /locus_tag="PC1_0205"
                     /note="RPB10 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(241880..241882,241922..241924,242693..242695,
                     243098..243100)
                     /locus_tag="PC1_0205"
                     /note="RPB11 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(241922..241927,241937..241939,242615..242617,
                     242621..242623,242696..242704,242711..242713,
                     242717..242722,243095..243118,243122..243124)
                     /locus_tag="PC1_0205"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            243588..247811
                     /locus_tag="PC1_0206"
                     /db_xref="GeneID:8131114"
     CDS             243588..247811
                     /locus_tag="PC1_0206"
                     /inference="protein motif:TFAM:TIGR02386"
                     /note="KEGG: eca:ECA0224 DNA-directed RNA polymerase
                     subunit beta';
                     TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
                     PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
                     domain 5; RNA polymerase Rpb1 domain 3; RNA polymerase
                     alpha subunit; RNA polymerase Rpb1 domain 4;
                     SMART: RNA polymerase I subunit A domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="YP_003015802.1"
                     /db_xref="GI:253686612"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR012754"
                     /db_xref="GeneID:8131114"
                     /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERM
                     GHIELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQIL
                     TEEQYLDALEEFGDEFDAKMGAEAIQALLKNMDLEQECEQLREELTETNSETKRKKLT
                     KRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLAT
                     TIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTRDCVNAKGEGMVLTGPKEAERVYRAGLASLHARVKVRITEEIKSIEGDVTHQ
                     TSIIDTTIGRAILWMIVPKGLPYSIVNQPLGKKAISKMLNTCYRILGLKPTVIFADQT
                     MYTGFAYAARSGASVGIDDMVIPEKKAEIIEEAETEVAEIQEQFQSGLVTAGERYNKV
                     IDIWAAANERVAKAMMENLSVEDVVNRDGVVEQQVSFNSIFMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRERVLGRVTAEDVIKPGTADI
                     LVPRNTLLNEQWCDMLEENSVDAVKVRSVVSCETDFGVCANCYGRDLARGHIINKGEA
                     IGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSLKLSNAKFVVNSNGK
                     LVITSRNTELKLIDEFGRTKESYKVPYGAAMAKGDGAEVSGGETVANWDPHTMPVITE
                     VSGNIRFTDMIDGQTITRQTDELTGLSSIVVLDSAERTGSGKDLRPALKIVDDKGEDV
                     LIPGTDMPAQYFLPGKAIVQLEDGVKISSGDTLARIPQESGGTKDITGGLPRVADLFE
                     ARRPKEPAILAEISGIISFGKETKGKRRLVISPLDGSDAYEEMIPKWRQLNVFEGEVV
                     ERGDVVSDGPESPHDILRLRGVHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQMLR
                     KGTIVNAGSTEFLEGEQAEVSRIKIANRQLEADGKITATFSRDLLGITKASLATESFI
                     SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRQAGEA
                     PIVPQVSADEASANLAELLNAGFGSSDDE"
     misc_feature    243630..246026
                     /locus_tag="PC1_0206"
                     /note="Largest subunit (beta') of bacterial DNA-dependent
                     RNA polymerase (RNAP), N-terminal domain; Region:
                     RNAP_beta'_N; cd01609"
                     /db_xref="CDD:259845"
     misc_feature    order(243630..243656,243660..243662,243672..243674,
                     243681..243692,243726..243728,243732..243734,
                     243783..243785,243816..243818,243873..243878,
                     243882..243893,243924..243926,243930..243932,
                     244302..244304,244314..244316,244320..244322,
                     244329..244334,244338..244340,244344..244346,
                     244353..244358,244506..244508,244566..244568,
                     244575..244580,244596..244658,244662..244664,
                     244698..244703,244710..244715,244722..244727,
                     244731..244736,244779..244781,244857..244859,
                     244869..244871,244878..244883,244887..244892,
                     244920..244925,244938..244940,244965..244973,
                     244980..244982,244992..245015,245022..245024,
                     245034..245039,245052..245054,245094..245102,
                     245109..245111,245121..245123,245136..245138,
                     245472..245477,245481..245516,245742..245744,
                     245760..245762,245778..245780,245793..245795,
                     245802..245807,245817..245819,245832..245837,
                     245856..245858,245874..245897,245901..245906,
                     245913..245918,245922..245930,245934..245942,
                     245946..245951,245979..245981,245988..245990)
                     /locus_tag="PC1_0206"
                     /note="beta and beta' interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259845"
     misc_feature    243633..247724
                     /locus_tag="PC1_0206"
                     /note="DNA-directed RNA polymerase subunit beta';
                     Provisional; Region: PRK00566"
                     /db_xref="CDD:234794"
     misc_feature    order(243711..243719,243723..243725,243780..243782,
                     243786..243788,243816..243818,243822..243824,
                     243870..243872,244005..244010,244338..244343,
                     244350..244352,244362..244379,244386..244388,
                     244395..244397,244407..244412,244419..244421,
                     244425..244436,244446..244472,244476..244481,
                     244488..244490,244521..244523,244551..244553,
                     244560..244562,244587..244592,244776..244778,
                     244782..244787)
                     /locus_tag="PC1_0206"
                     /note="beta' and sigma factor interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(243795..243797,243801..243803,243840..243842,
                     243849..243851)
                     /locus_tag="PC1_0206"
                     /note="Zn-binding [ion binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(243948..243950,244518..244520,244587..244589,
                     244602..244604,244623..244625,244641..244643,
                     244860..244868,244965..244967,244971..244973,
                     244977..244979,245955..245960,245967..245972)
                     /locus_tag="PC1_0206"
                     /note="active site region [active]"
                     /db_xref="CDD:259845"
     misc_feature    order(244965..244967,244971..244973,244977..244979)
                     /locus_tag="PC1_0206"
                     /note="catalytic site [active]"
                     /db_xref="CDD:259845"
     misc_feature    246321..>246404
                     /locus_tag="PC1_0206"
                     /note="Largest subunit of RNA polymerase (RNAP),
                     C-terminal domain; Region: RNAP_largest_subunit_C;
                     cl11429"
                     /db_xref="CDD:142634"
     misc_feature    246324..246326
                     /locus_tag="PC1_0206"
                     /note="Rpb1 - Rpb6 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:132719"
     misc_feature    246969..247676
                     /locus_tag="PC1_0206"
                     /note="Largest subunit (beta') of Bacterial DNA-dependent
                     RNA polymerase (RNAP), C-terminal domain; Region:
                     RNAP_beta'_C; cd02655"
                     /db_xref="CDD:132721"
     misc_feature    order(247029..247031,247518..247520,247563..247568)
                     /locus_tag="PC1_0206"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:132721"
     misc_feature    order(247608..247610,247626..247628,247644..247646,
                     247653..247658,247668..247670)
                     /locus_tag="PC1_0206"
                     /note="Rpb1 (beta') - Rpb2 (beta) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     STS             243698..244289
                     /locus_tag="PC1_0206"
                     /standard_name="MARC_46213-46214:1107802028:1"
                     /db_xref="UniSTS:471646"
     gene            248141..249538
                     /locus_tag="PC1_0207"
                     /db_xref="GeneID:8131115"
     CDS             248141..249538
                     /locus_tag="PC1_0207"
                     /inference="protein motif:TFAM:TIGR00883"
                     /note="TIGRFAM: metabolite/H+ symporter, major facilitator
                     superfamily (MFS);
                     PFAM: major facilitator superfamily MFS_1; General
                     substrate transporter;
                     KEGG: eca:ECA0225 shikimate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily metabolite/H+
                     symporter"
                     /protein_id="YP_003015803.1"
                     /db_xref="GI:253686613"
                     /db_xref="InterPro:IPR004736"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:8131115"
                     /translation="MDTSTTPTLSQPGGSVLHQDDSISSDNALQTQSVSHSQNKAKRA
                     AWGSFVGAVVDWYDFLLYGIVAALVFNTEFFPQVSPTMGTLAAFGTFGVGFLFRPLGG
                     MVFGHFGDKLGRKRMLMITVWMMGISTALIGLLPSFDSIGWWAPVLLVMLRAIQGFAV
                     GGEWGGAALLAVESAPKKKKAFYSSGVQVGFGVGLLLATGSVSLVSNLTTNEEFITWG
                     WRLPFLFSLILVAIAWWVRNGMDESQEFEANKTLGERANKLRSFPIMEALRQHPKAFL
                     LIIALRLGELLTMYIVTAFALNYSTTHLGLSRDIFLNIGLLVGAISCVSIPFFAYLAD
                     SFGRRRIYVTGALIGAASAVPFFMALESHNTLLILFFAIMLANIAHDMIVSVQQPMFT
                     ELFGTAYRYSGAGVGYQVASVVGGGFTPFIAVLLVQFMDGSWHAVAAYLAIGCLLSAI
                     VGMQMKAKSADALPR"
     misc_feature    248210..249523
                     /locus_tag="PC1_0207"
                     /note="shikimate transporter; Provisional; Region:
                     PRK09952"
                     /db_xref="CDD:182163"
     misc_feature    248276..249493
                     /locus_tag="PC1_0207"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(248315..248317,248324..248332,248336..248341,
                     248411..248413,248420..248425,248432..248434,
                     248444..248449,248453..248458,248618..248623,
                     248630..248635,248642..248647,248654..248656,
                     248690..248695,248702..248707,248723..248725,
                     248996..248998,249005..249010,249017..249022,
                     249029..249031,249071..249073,249083..249085,
                     249095..249097,249104..249106,249116..249118,
                     249269..249271,249278..249283,249290..249292,
                     249302..249307,249314..249316,249347..249352,
                     249362..249367,249374..249379,249386..249388)
                     /locus_tag="PC1_0207"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(249634..249825)
                     /locus_tag="PC1_0208"
                     /db_xref="GeneID:8131116"
     CDS             complement(249634..249825)
                     /locus_tag="PC1_0208"
                     /inference="protein motif:PFAM:PF06568"
                     /note="PFAM: protein of unknown function DUF1127;
                     KEGG: eca:ECA0226 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015804.1"
                     /db_xref="GI:253686614"
                     /db_xref="InterPro:IPR009506"
                     /db_xref="GeneID:8131116"
                     /translation="MEFHENRSQKPFRESPFWLMLILPYRLWKAWRARAQTLKILRNM
                     SDDGLKDIGLKRSDLDRFR"
     misc_feature    complement(249643..249753)
                     /locus_tag="PC1_0208"
                     /note="Domain of unknown function (DUF1127); Region:
                     DUF1127; pfam06568"
                     /db_xref="CDD:253801"
     gene            249999..251423
                     /locus_tag="PC1_0209"
                     /db_xref="GeneID:8131117"
     CDS             249999..251423
                     /locus_tag="PC1_0209"
                     /inference="protein motif:PFAM:PF00155"
                     /note="PFAM: aminotransferase class I and II; regulatory
                     protein GntR HTH;
                     SMART: regulatory protein GntR HTH;
                     KEGG: eca:ECA0227 GntR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator with
                     aminotransferase domain"
                     /protein_id="YP_003015805.1"
                     /db_xref="GI:253686615"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="GeneID:8131117"
                     /translation="MTRYQHLAGLLEQRIEQGLYQSGERLPSVRALSTEHGVSISTVQ
                     QAYHLLETRQLIMPQPRSGYFVTPRKATPPVPALTRPAQRPVEITQWESVLELVNVRL
                     ETNVLKFGSGMPDVSQPTIKPLWKEMARLCQYQDPRILQYDSVYGVPALREQIARLTV
                     DCGCQLTQDDIVVTTGCQEALFVAVRAVCQPGDIVAVESPAFPGTMQILRGLDIKAIE
                     IPTDSVTGISLEALRLALDQWPIKAVLLVPSCNNPLGFIMPDARKKSLVTLAQHFDIA
                     IIEDDAYGELAYEYPRPRAIKSFDEDGRVLLCSSFSKNLAPGLRVGWIAPGRYLERVI
                     HTKYISTGSTVVQPQLAVAEFIRQGHYQPHLRRMRAQYKANLSTFTCWVREYFPSNIC
                     VSRPQGGFLMWIELPEYFDSLKLTREVRKSGIQIAAGSLFSASGKYRNCIRLNYANRF
                     TEEMREGLRIVGNEVAKMMHTPPD"
     misc_feature    249999..251384
                     /locus_tag="PC1_0209"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    250002..250199
                     /locus_tag="PC1_0209"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(250002..250004,250008..250010,250077..250079,
                     250083..250088,250110..250124,250128..250133,
                     250140..250142,250170..250175,250179..250190)
                     /locus_tag="PC1_0209"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    250317..251378
                     /locus_tag="PC1_0209"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(250524..250532,250602..250604,250752..250754,
                     250845..250847,250926..250928,250932..250937,
                     250956..250958)
                     /locus_tag="PC1_0209"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(250533..250535,250632..250634,250824..250826,
                     250950..250958,251040..251042,251049..251051)
                     /locus_tag="PC1_0209"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    250935..250937
                     /locus_tag="PC1_0209"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(251420..251671)
                     /locus_tag="PC1_0210"
                     /db_xref="GeneID:8131118"
     CDS             complement(251420..251671)
                     /locus_tag="PC1_0210"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015806.1"
                     /db_xref="GI:253686616"
                     /db_xref="GeneID:8131118"
                     /translation="MRLASQSENYTEDNILRIAPRNMTFGLSPRSVTKNTVASLAGLS
                     ITALAGRSRLPLIGSAHQPADTGLILTRIGPSLTLSEAI"
     gene            complement(251815..252936)
                     /locus_tag="PC1_0211"
                     /db_xref="GeneID:8131119"
     CDS             complement(251815..252936)
                     /locus_tag="PC1_0211"
                     /inference="protein motif:TFAM:TIGR02351"
                     /note="TIGRFAM: thiazole biosynthesis protein ThiH;
                     PFAM: biotin and thiamin synthesis associated; Radical SAM
                     domain protein;
                     KEGG: eca:ECA0228 thiamine biosynthesis protein ThiH"
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole biosynthesis protein ThiH"
                     /protein_id="YP_003015807.1"
                     /db_xref="GI:253686617"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010722"
                     /db_xref="InterPro:IPR012726"
                     /db_xref="GeneID:8131119"
                     /translation="MSVDFQTVWEQLDWDDLTLRINGKTAQDVERALTAPHLTHDDFM
                     ALISPAASAYLEPLAQRAQQLTRQRFGNTVSFYVPLYLSNLCSNDCTYCGFSMSNHIK
                     RKTLDEAEILRECAAIKELGFEHLLLVTGEHQRKVGMDYFRRVFPLIRPLFSSLMIEV
                     QPLSQDEYAELKALGLDGVMVYQETYHTATYQLHHLKGQKQDFHWRLATPDRLGRAGI
                     DKIGLGALIGLSNSWRTDCYMVAEHLLHLQQHYWQSRYSISFPRLRPCAGGIEPASLM
                     DEAQLMQVICAFRLLAPDIELSLSTRESPFFRDHAIPIAINNVSAFSKTQPGGYADDH
                     PELEQFSPHDSRRPEDVAQAIVRAGLQPVWKDWDGYLGR"
     misc_feature    complement(251818..252927)
                     /locus_tag="PC1_0211"
                     /note="thiamine biosynthesis protein ThiH; Reviewed;
                     Region: thiH; PRK09240"
                     /db_xref="CDD:236425"
     misc_feature    complement(252076..252699)
                     /locus_tag="PC1_0211"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(252148..252153,252259..252261,
                     252391..252393,252454..252462,252541..252546,
                     252550..252552,252655..252663,252667..252669,
                     252673..252675,252679..252681))
                     /locus_tag="PC1_0211"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(251851..252168)
                     /locus_tag="PC1_0211"
                     /note="Biotin and Thiamin Synthesis associated domain;
                     Region: BATS; pfam06968"
                     /db_xref="CDD:253996"
     gene            complement(252933..253718)
                     /locus_tag="PC1_0212"
                     /db_xref="GeneID:8131120"
     CDS             complement(252933..253718)
                     /locus_tag="PC1_0212"
                     /inference="protein motif:PFAM:PF05690"
                     /note="PFAM: thiazole biosynthesis family protein;
                     KEGG: eca:ECA0229 thiazole synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole biosynthesis family protein"
                     /protein_id="YP_003015808.1"
                     /db_xref="GI:253686618"
                     /db_xref="InterPro:IPR008867"
                     /db_xref="GeneID:8131120"
                     /translation="MLHIADTTLTSRLLTGTGKFATPELMLAALEASGSQLVTMAMKR
                     VDLNGGNDAILAPLRQLGIKLLPNTSGAKTADEAIFAARLAREALGTHWLKLEIHPDV
                     KYLLPDPIETLKAAEQLVKEGFTVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQG
                     LQTRDFLRIIIEQARVPVIVDAGIGAPSQAADALEMGADAVLVNTAIAVARDPVAMAR
                     AFRLAVEAGGLARQAGLGSKQFVASATSPLTGFLHQQAEGAVR"
     misc_feature    complement(252975..253715)
                     /locus_tag="PC1_0212"
                     /note="Thiazole synthase (ThiG) is the tetrameric enzyme
                     that is involved in the formation of the thiazole moiety
                     of thiamin pyrophosphate, an essential ubiquitous cofactor
                     that plays an important role in carbohydrate and amino
                     acid metabolism. ThiG catalyzes...; Region: ThiG; cd04728"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(253551..253553,253560..253562,
                     253596..253598))
                     /locus_tag="PC1_0212"
                     /note="ThiS interaction site; other site"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(253176..253178,253428..253430,
                     253434..253436))
                     /locus_tag="PC1_0212"
                     /note="putative active site [active]"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(252978..252980,252984..252992,
                     252996..252998,253002..253007,253011..253025,
                     253029..253034,253041..253043,253062..253064,
                     253071..253076,253083..253091,253104..253106,
                     253131..253136,253143..253145,253155..253163,
                     253203..253205,253215..253217,253233..253235,
                     253242..253250,253302..253307,253314..253322,
                     253326..253328,253395..253403,253410..253412,
                     253419..253421))
                     /locus_tag="PC1_0212"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240079"
     gene            complement(253720..253920)
                     /locus_tag="PC1_0213"
                     /db_xref="GeneID:8131121"
     CDS             complement(253720..253920)
                     /locus_tag="PC1_0213"
                     /inference="protein motif:TFAM:TIGR01683"
                     /note="TIGRFAM: thiamine biosynthesis protein ThiS;
                     PFAM: thiamineS protein;
                     KEGG: eca:ECA0229A sulfur carrier protein ThiS"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiS"
                     /protein_id="YP_003015809.1"
                     /db_xref="GI:253686619"
                     /db_xref="InterPro:IPR003749"
                     /db_xref="InterPro:IPR010035"
                     /db_xref="GeneID:8131121"
                     /translation="MRITLNDEPFEFPEAITVEALLSQINRLQPGTALAINQTIIPHA
                     TWSQHQVQDGDDILLFQAIAGG"
     misc_feature    complement(253723..253917)
                     /locus_tag="PC1_0213"
                     /note="ThiaminS ubiquitin-like sulfur carrier protein;
                     Region: ThiS; cd00565"
                     /db_xref="CDD:176353"
     misc_feature    complement(order(253741..253749,253801..253803))
                     /locus_tag="PC1_0213"
                     /note="thiS-thiF/thiG interaction site; other site"
                     /db_xref="CDD:176353"
     gene            complement(253917..254696)
                     /locus_tag="PC1_0214"
                     /db_xref="GeneID:8131122"
     CDS             complement(253917..254696)
                     /locus_tag="PC1_0214"
                     /inference="protein motif:PFAM:PF00899"
                     /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
                     MoeZ/MoeB domain protein;
                     KEGG: eca:ECA0230 thiamine biosynthesis protein ThiF"
                     /codon_start=1
                     /transl_table=11
                     /product="UBA/THIF-type NAD/FAD binding protein"
                     /protein_id="YP_003015810.1"
                     /db_xref="GI:253686620"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR007901"
                     /db_xref="GeneID:8131122"
                     /translation="MATHHHSTPAGLSDSEFMRYSRQLMLEDIGPEGQDKLKAASVLL
                     VGLGGLGAPASLYLAAAGIGTLLLADDDALHISNLQRQILYRTSDTDKPKAVLAQRQL
                     QALNPHSEAIALTERLSGETLDNAVSRVDLVLDCSDNMATRHAVNAACFRAGKPLISG
                     SAVGFSGQLAVFTPPYHSGCYACLYPDTTEPQRNCRTAGMLGPVVGVIGTLQALEAIK
                     LLAGMPSALDGKLRMFNGKQQSWNTLQLTRAPHCSVCGGAA"
     misc_feature    complement(253941..254663)
                     /locus_tag="PC1_0214"
                     /note="molybdopterin biosynthesis protein MoeB;
                     Provisional; Region: PRK05690"
                     /db_xref="CDD:180204"
     misc_feature    complement(253959..254642)
                     /locus_tag="PC1_0214"
                     /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved
                     in molybdopterin and thiamine biosynthesis family. The
                     common reaction mechanism catalyzed by MoeB and ThiF, like
                     other E1 enzymes, begins with a nucleophilic attack of the
                     C-terminal carboxylate of MoaD...; Region:
                     ThiF_MoeB_HesA_family; cd00757"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(254271..254273,254289..254291,
                     254415..254417,254454..254456,254481..254483,
                     254487..254489,254547..254549,254553..254555,
                     254559..254561))
                     /locus_tag="PC1_0214"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(253962..253967,253971..253973,
                     253992..253994,254004..254006,254193..254195,
                     254199..254201,254211..254216,254268..254270,
                     254280..254288,254547..254549))
                     /locus_tag="PC1_0214"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238386"
     gene            complement(254698..255339)
                     /locus_tag="PC1_0215"
                     /db_xref="GeneID:8131123"
     CDS             complement(254698..255339)
                     /locus_tag="PC1_0215"
                     /EC_number="2.5.1.3"
                     /inference="protein motif:TFAM:TIGR00693"
                     /note="KEGG: eca:ECA0231 thiamine-phosphate
                     pyrophosphorylase;
                     TIGRFAM: thiamine-phosphate pyrophosphorylase;
                     PFAM: thiamine monophosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="YP_003015811.1"
                     /db_xref="GI:253686621"
                     /db_xref="InterPro:IPR003733"
                     /db_xref="GeneID:8131123"
                     /translation="MTDSTPFAPTAQRLGLYPVVDSVEWIERLLGVGVKTIQLRIKDR
                     SDEQAEADVIQAIALGRRYQAQLFINDYWKLAVKHQAYGVHLGQEDLDTADLTAIKQA
                     GLRLGISTHDDRELARAVAINPSYIALGHIFPTQTKDMPSAPQGLAELTRHITDLQDR
                     FPTVAIGGISIDRVPAVRKTGVGSIAVVSAITQAPDWRQATATLLRMIEGREA"
     misc_feature    complement(254722..255294)
                     /locus_tag="PC1_0215"
                     /note="Thiamine monophosphate synthase (TMP
                     synthase)/TenI. TMP synthase catalyzes an important step
                     in the thiamine biosynthesis pathway, the substitution of
                     the pyrophosphate of 2-methyl-4-amino-5-
                     hydroxymethylpyrimidine pyrophosphate by 4-methyl-5-;
                     Region: TMP_TenI; cd00564"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(254773..254784,254836..254838,
                     254848..254850,254929..254931,254935..254937,
                     254956..254958,254962..254964,255013..255015,
                     255085..255087,255220..255222,255226..255228,
                     255283..255285,255289..255291))
                     /locus_tag="PC1_0215"
                     /note="thiamine phosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(254773..254778,254836..254838,
                     254926..254931,254935..254937,255013..255015,
                     255070..255072,255127..255132,255214..255216,
                     255220..255222,255226..255228))
                     /locus_tag="PC1_0215"
                     /note="active site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(254926..254928,255013..255015,
                     255070..255072,255079..255081,255127..255132,
                     255214..255216,255220..255222))
                     /locus_tag="PC1_0215"
                     /note="pyrophosphate binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238317"
     gene            complement(255336..257291)
                     /locus_tag="PC1_0216"
                     /db_xref="GeneID:8131124"
     CDS             complement(255336..257291)
                     /locus_tag="PC1_0216"
                     /inference="protein motif:TFAM:TIGR00190"
                     /note="TIGRFAM: thiamine biosynthesis protein ThiC;
                     PFAM: thiamine biosynthesis protein ThiC;
                     KEGG: eca:ECA0232 thiamine biosynthesis protein ThiC"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiC"
                     /protein_id="YP_003015812.1"
                     /db_xref="GI:253686622"
                     /db_xref="InterPro:IPR002817"
                     /db_xref="GeneID:8131124"
                     /translation="MSTDPLSINTVSSKSGRREQRAAAQQFIETLQGTAFPNSKRIYL
                     TGSRDDIAVPMREIQLSPTLLGGSKDNPQYEPNEPIPVYDTSGPYGDPAAQPDVRIGL
                     AKLRASWIAERSDTEALSGVSSDFTQQRLADAGLDHLRFEHLPRPLRAKAGKRVTQLH
                     YARQGIITPEMEFIALRENMGRERIRTDVLRQQHPGQSFGALLPENITPEFVRQEVAA
                     GRAIIPSNINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTV
                     MDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGVAENLNWEMFRDTLLEQAEQ
                     GVDYFTIHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHKESFLYEHFREICEIC
                     AAYDVALSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQ
                     MIRRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPK
                     EHLGLPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLAL
                     DPQTARAYHDETLPQESGKVAHFCSMCGPKFCSMKISQEVRDYAAKQEAEAKPIEVGM
                     AQMSQEFRSRGSELYHSATSLQAEENQ"
     misc_feature    complement(255366..257240)
                     /locus_tag="PC1_0216"
                     /note="thiamine biosynthesis protein ThiC; Provisional;
                     Region: PRK09284"
                     /db_xref="CDD:236451"
     misc_feature    complement(256938..257192)
                     /locus_tag="PC1_0216"
                     /note="ThiC-associated domain; Region: ThiC-associated;
                     pfam13667"
                     /db_xref="CDD:257973"
     misc_feature    complement(255459..256832)
                     /locus_tag="PC1_0216"
                     /note="Thiamine biosynthesis protein ThiC [Coenzyme
                     metabolism]; Region: ThiC; COG0422"
                     /db_xref="CDD:223499"
     misc_binding    complement(257414..257567)
                     /note="TPP riboswitch (THI element) as predicted by
                     Rfam(RF 00059), score 66.15"
                     /bound_moiety="thiamin/thiaminpyrophosphate"
     gene            complement(257690..258151)
                     /locus_tag="PC1_0217"
                     /db_xref="GeneID:8131125"
     CDS             complement(257690..258151)
                     /locus_tag="PC1_0217"
                     /inference="protein motif:PFAM:PF04353"
                     /note="PFAM: regulator of RNA polymerase sigma(70) subunit
                     Rsd/AlgQ;
                     KEGG: eca:ECA0233 anti-RNA polymerase sigma 70 factor"
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of RpoD, Rsd/AlgQ"
                     /protein_id="YP_003015813.1"
                     /db_xref="GI:253686623"
                     /db_xref="InterPro:IPR007448"
                     /db_xref="GeneID:8131125"
                     /translation="MLNQLQSLTEYVGGNNALIDQWLQARKQLLVAYYHLVGIKPNKE
                     ALSLLDEEALDNFCQNLVDYLSTGHFHLYEKMLHEAATHSEQLLALSTQLDFALQSNT
                     QQIMTFYDNHLATAIDHDNCLEFQQALSSVGETLEERFTLEDNMIRLVYDN"
     misc_feature    complement(257693..258151)
                     /locus_tag="PC1_0217"
                     /note="anti-RNA polymerase sigma 70 factor; Provisional;
                     Region: PRK11718"
                     /db_xref="CDD:236962"
     gene            258260..259042
                     /locus_tag="PC1_0218"
                     /db_xref="GeneID:8131126"
     CDS             258260..259042
                     /locus_tag="PC1_0218"
                     /EC_number="3.6.1.22"
                     /inference="protein motif:PRIAM:3.6.1.22"
                     /note="PFAM: NUDIX hydrolase; NADH pyrophosphatase-like ;
                     Zinc ribbon NADH pyrophosphatase;
                     KEGG: eca:ECA0234 NADH pyrophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(+) diphosphatase"
                     /protein_id="YP_003015814.1"
                     /db_xref="GI:253686624"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015375"
                     /db_xref="InterPro:IPR015376"
                     /db_xref="GeneID:8131126"
                     /translation="MEQTLKGDETGWWVVSDAVQIWLPQGELPCGTATKWSLQGKTAR
                     QIGEWQEQPVWLVCQGRDTDMASVRQLLDQDVGLFQLAGRGVQLAEFYRSHRFCGYCG
                     HEMVRSKTELACLCHHCKERYYPQIAPCIIVAIRRGEEILLAQHNRHRGNMYTVLAGF
                     VEVGETLEQTVVREVMEESQVQIKNLRYVSSQPWPFPHSLMMAFMAEYAGGEIKHDPK
                     ELRDAGWFRYDQLPQLPPPGTVARRLIEDTVVLCRAYHENEG"
     misc_feature    258260..259015
                     /locus_tag="PC1_0218"
                     /note="NADH pyrophosphatase; Reviewed; Region: nudC;
                     PRK00241"
                     /db_xref="CDD:234699"
     misc_feature    258287..258532
                     /locus_tag="PC1_0218"
                     /note="NADH pyrophosphatase-like rudimentary NUDIX domain;
                     Region: NUDIX-like; pfam09296"
                     /db_xref="CDD:255270"
     misc_feature    258536..258631
                     /locus_tag="PC1_0218"
                     /note="NADH pyrophosphatase zinc ribbon domain; Region:
                     zf-NADH-PPase; pfam09297"
                     /db_xref="CDD:255271"
     misc_feature    258644..259006
                     /locus_tag="PC1_0218"
                     /note="NADH pyrophosphatase, a member of the Nudix
                     hydrolase superfamily, catalyzes the cleavage of NADH into
                     reduced nicotinamide mononucleotide (NMNH) and AMP. Like
                     other members of the Nudix family, it requires a divalent
                     cation, such as Mg2+ or Mn2+, for...; Region:
                     NADH_pyrophosphatase; cd03429"
                     /db_xref="CDD:239521"
     misc_feature    order(258647..258649,258731..258739,258839..258841,
                     258848..258850,258854..258856,258860..258862)
                     /locus_tag="PC1_0218"
                     /note="putative NADH binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239521"
     misc_feature    order(258734..258739,258743..258745,258779..258781,
                     258788..258793,258839..258841,258848..258850,
                     258854..258856,258860..258862)
                     /locus_tag="PC1_0218"
                     /note="putative active site [active]"
                     /db_xref="CDD:239521"
     misc_feature    258734..258802
                     /locus_tag="PC1_0218"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239521"
     misc_feature    order(258779..258781,258788..258793,258914..258916)
                     /locus_tag="PC1_0218"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239521"
     gene            259191..260255
                     /locus_tag="PC1_0219"
                     /db_xref="GeneID:8131127"
     CDS             259191..260255
                     /locus_tag="PC1_0219"
                     /EC_number="4.1.1.37"
                     /inference="protein motif:TFAM:TIGR01464"
                     /note="KEGG: eca:ECA0235 uroporphyrinogen decarboxylase;
                     TIGRFAM: uroporphyrinogen decarboxylase;
                     PFAM: Uroporphyrinogen decarboxylase (URO-D)"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="YP_003015815.1"
                     /db_xref="GI:253686625"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="InterPro:IPR006361"
                     /db_xref="GeneID:8131127"
                     /translation="MTDLKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAG
                     DFMSLCKNAELACEVTLQPLRRYALDAAILFSDILTIPDAMGLGLYFEAGEGPRFHSP
                     ITSHADVVNLPIPDPEQELGYVMNAVRTIRKNLAGEVPLIGFSGSPWTLATYMVEGGS
                     SKAFTVIKKMMFAEPKTLHLLLDKLADSVILYLNAQIRAGAQAVMVFDTWGGALSGRD
                     YKEFSLRYMHKIVDGLQRENEGRRVPVTLFTKGGGQWLEAMAETGCDALGLDWTSDIA
                     DARRRVGDKVALQGNMDPSMLYADPARIEQEVASILAGFGQGNGHVFNLGHGIHQDVP
                     PEHAGVFVEAVHRLSRPYHA"
     misc_feature    259218..260231
                     /locus_tag="PC1_0219"
                     /note="Uroporphyrinogen decarboxylase (URO-D) is a dimeric
                     cytosolic enzyme that decarboxylates the four acetate side
                     chains of uroporphyrinogen III (uro-III) to create
                     coproporphyrinogen III, without requiring any prosthetic
                     groups or cofactors. This reaction...; Region: URO-D;
                     cd00717"
                     /db_xref="CDD:238368"
     misc_feature    order(259266..259283,259296..259298,259308..259310,
                     259326..259328,259407..259427,259461..259463,
                     259476..259478,259620..259622,259650..259652,
                     259668..259670,259809..259811,259815..259820,
                     259932..259934,260169..260171)
                     /locus_tag="PC1_0219"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238368"
     misc_feature    order(259269..259271,259281..259283,259419..259421,
                     259650..259652,259815..259817,260169..260171)
                     /locus_tag="PC1_0219"
                     /note="active site"
                     /db_xref="CDD:238368"
     gene            260271..260960
                     /locus_tag="PC1_0220"
                     /db_xref="GeneID:8131128"
     CDS             260271..260960
                     /locus_tag="PC1_0220"
                     /EC_number="3.1.21.7"
                     /inference="protein motif:PRIAM:3.1.21.7"
                     /note="PFAM: Endonuclease V;
                     KEGG: spe:Spro_0288 endonuclease V"
                     /codon_start=1
                     /transl_table=11
                     /product="Deoxyribonuclease V"
                     /protein_id="YP_003015816.1"
                     /db_xref="GI:253686626"
                     /db_xref="InterPro:IPR007581"
                     /db_xref="GeneID:8131128"
                     /translation="MIDTQQLRAEQLARASDVIRHDDLPFEQPAFIAGADVGFEQEGS
                     VTRAAIAVMRYPSLELVEYKIARISTTMPYIPGFLSFRECPGLLAAWALLEQKPDLLF
                     VDGHGISHPRRLGVASHFGLLVDVPTIGVAKSRLCGRFEPLTESVGSQQPLLDKGEQI
                     GWVWRSKARCNPLFVATGHRVSQDSALHWVQSCMRGYRLPEPTRWADAVASNRPAFVR
                     WQRQQAANVLS"
     misc_feature    260283..260891
                     /locus_tag="PC1_0220"
                     /note="Endonuclease_V, a DNA repair enzyme that initiates
                     repair of nitrosative deaminated purine bases; Region:
                     Endonuclease_V; cd06559"
                     /db_xref="CDD:143472"
     misc_feature    order(260376..260378,260382..260387,260490..260492,
                     260496..260507,260580..260588,260598..260600,
                     260613..260618,260664..260678,260889..260891)
                     /locus_tag="PC1_0220"
                     /note="Active_site [active]"
                     /db_xref="CDD:143472"
     gene            261038..261628
                     /locus_tag="PC1_0221"
                     /db_xref="GeneID:8131129"
     CDS             261038..261628
                     /locus_tag="PC1_0221"
                     /inference="protein motif:PFAM:PF04222"
                     /note="PFAM: protein of unknown function DUF416;
                     KEGG: eca:ECA0237 putative lipoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015817.1"
                     /db_xref="GI:253686627"
                     /db_xref="InterPro:IPR007338"
                     /db_xref="GeneID:8131129"
                     /translation="MLRNPIHLRLEKLASWQHVTFMACLCERMYPNYHEFCRQTEFGD
                     AMVYRRILDLVWETLVVKDAKVNFDSQLEKLEEAIPAAEDYDLYGVYPAIDACIALGE
                     LIHSRLSGETLEHAIAISETSIRTVAMLEMTQAGKEMTDDELKVLPAIEEEWDIQWEI
                     FRLLAACEERDIELIKGLRSDLREAGSSNIGINLHQ"
     misc_feature    261038..261619
                     /locus_tag="PC1_0221"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3068"
                     /db_xref="CDD:225610"
     gene            261833..262105
                     /locus_tag="PC1_0222"
                     /db_xref="GeneID:8131130"
     CDS             261833..262105
                     /locus_tag="PC1_0222"
                     /inference="protein motif:PFAM:PF00216"
                     /note="PFAM: histone family protein DNA-binding protein;
                     SMART: histone family protein DNA-binding protein;
                     KEGG: yen:YE0300 transcriptional regulator HU subunit
                     alpha"
                     /codon_start=1
                     /transl_table=11
                     /product="histone family protein DNA-binding protein"
                     /protein_id="YP_003015818.1"
                     /db_xref="GI:253686628"
                     /db_xref="InterPro:IPR000119"
                     /db_xref="GeneID:8131130"
                     /translation="MNKTQLIDVIADKADLSKAQAKAALESTLAAITESLKEGDAVQL
                     VGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
     misc_feature    261836..262093
                     /locus_tag="PC1_0222"
                     /note="histone-like DNA-binding protein HU; Region: HU;
                     cd13831"
                     /db_xref="CDD:259853"
     misc_feature    order(261848..261850,261857..261862,261869..261871,
                     261896..261907,261911..261919,261923..261931,
                     261935..261940,261950..261964,261971..261973,
                     262055..262063,262067..262069,262073..262075,
                     262085..262090)
                     /locus_tag="PC1_0222"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259853"
     misc_feature    order(261989..261991,261995..262000,262004..262006,
                     262010..262021,262034..262039,262043..262045)
                     /locus_tag="PC1_0222"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259853"
     gene            262110..262796
                     /locus_tag="PC1_0223"
                     /db_xref="GeneID:8131131"
     CDS             262110..262796
                     /locus_tag="PC1_0223"
                     /inference="protein motif:PFAM:PF07356"
                     /note="PFAM: protein of unknown function DUF1481;
                     KEGG: eca:ECA0239 putative lipoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015819.1"
                     /db_xref="GI:253686629"
                     /db_xref="InterPro:IPR010858"
                     /db_xref="GeneID:8131131"
                     /translation="MSVKSLSRGAFSPLLLLRRWCGVGLMLTAVVACSSRTAPPEFFA
                     SGYVADRGIVRLWRKDDAQNTTALTTVFNPLQGNALVVTRYTFQQDKLREIQRNQLGT
                     QKEDMRLRFAEDGTVSFMQRQLAERRESVSDDDVALYQFDAKRMLELSDVLRAGKVIL
                     KQGKWLEGQVQSCDGTAVRPDFDNDSREWIAEQKMHATRPLNVAWLEAPEGTQLLLVV
                     EDDVCQWQPK"
     misc_feature    262239..262793
                     /locus_tag="PC1_0223"
                     /note="Protein of unknown function (DUF1481); Region:
                     DUF1481; pfam07356"
                     /db_xref="CDD:148775"
     gene            complement(262866..264152)
                     /locus_tag="PC1_0224"
                     /db_xref="GeneID:8131132"
     CDS             complement(262866..264152)
                     /locus_tag="PC1_0224"
                     /EC_number="6.3.4.13"
                     /inference="protein motif:TFAM:TIGR00877"
                     /note="KEGG: eca:ECA0240 phosphoribosylamine--glycine
                     ligase;
                     TIGRFAM: phosphoribosylamine/glycine ligase;
                     PFAM: phosphoribosylglycinamide synthetase; protein of
                     unknown function DUF201"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine/glycine ligase"
                     /protein_id="YP_003015820.1"
                     /db_xref="GI:253686630"
                     /db_xref="InterPro:IPR000115"
                     /db_xref="InterPro:IPR003806"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="GeneID:8131132"
                     /translation="MNILVIGNGGREHALAWKAAQSPLAKRVYVAPGNAGTALEAALT
                     NVDIAATDVPALVAFAQENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPSQAAAQLE
                     GSKAFTKDFLARHNIPTAEYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMT
                     LQEAENAIEDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRV
                     GDKDTGPNTGGMGAYSPAPVVTDEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMI
                     SADGQPKVIEFNCRFGDPETQPIMLRLRSDLVELCLAACDGTLDQKDSVWDERPSLGV
                     VLAAGGYPADYNTGDVISGLPQQDAEDGKVFHAGTKLNGINVVTNGGRVLCVTALGNT
                     VAEAQQRAYEIAAGIQWQGVFCRKDIGYRAIEREQA"
     misc_feature    complement(262878..264152)
                     /locus_tag="PC1_0224"
                     /note="phosphoribosylamine--glycine ligase; Provisional;
                     Region: PRK00885"
                     /db_xref="CDD:234856"
     misc_feature    complement(263847..264149)
                     /locus_tag="PC1_0224"
                     /note="Phosphoribosylglycinamide synthetase, N domain;
                     Region: GARS_N; pfam02844"
                     /db_xref="CDD:251569"
     misc_feature    complement(263265..263846)
                     /locus_tag="PC1_0224"
                     /note="Phosphoribosylglycinamide synthetase, ATP-grasp (A)
                     domain; Region: GARS_A; pfam01071"
                     /db_xref="CDD:250341"
     misc_feature    complement(262884..263165)
                     /locus_tag="PC1_0224"
                     /note="Phosphoribosylglycinamide synthetase, C domain;
                     Region: GARS_C; pfam02843"
                     /db_xref="CDD:251568"
     gene            complement(264170..265759)
                     /locus_tag="PC1_0225"
                     /db_xref="GeneID:8131133"
     CDS             complement(264170..265759)
                     /locus_tag="PC1_0225"
                     /EC_number="3.5.4.10"
                     /inference="protein motif:TFAM:TIGR00355"
                     /note="KEGG: eca:ECA0241 bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase;
                     TIGRFAM: phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase;
                     PFAM: AICARFT/IMPCHase bienzyme formylation region; MGS
                     domain protein;
                     SMART: AICARFT/IMPCHase bienzyme formylation region"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /protein_id="YP_003015821.1"
                     /db_xref="GI:253686631"
                     /db_xref="InterPro:IPR002695"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR013982"
                     /db_xref="GeneID:8131133"
                     /translation="MQQRRPIRRALLSVSDKAGIVEFAQALSHRGVELLSTGGTARLL
                     ADAGLAVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRDQDDAIMAQHDIKPIDIVV
                     VNLYPFAQTVARENCTLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYSAIINEI
                     DANEGSLTYETRFDLAIKAFEHTAAYDSMIANYFGALVPPYHGETDKPSGNFPRTLNL
                     NYIKKQDMRYGENSHQQAAFYIEENIHEASVATSTQLQGKALSYNNIADTDAALECVK
                     EFAEPACVIVKHANPSGVAIGGSILDAYERAYKTDPTSAFGGIIAFNRELDEETAQAI
                     ISRQFVEVIIAPSASEAALKVTAAKQNVRVLTSGNWQQRVPGLDFKRVNGGLLIQDRD
                     LGMVDASQLRVVTERQPSEQELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSR
                     VYSAKIAGIKAGDEGLEVKGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEV
                     IAAANEHGIAMIFTDMRHFRH"
     misc_feature    complement(264173..265750)
                     /locus_tag="PC1_0225"
                     /note="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase; Provisional; Region:
                     purH; PRK00881"
                     /db_xref="CDD:234854"
     misc_feature    complement(265178..265738)
                     /locus_tag="PC1_0225"
                     /note="Inosine monophosphate cyclohydrolase domain. This
                     is the N-terminal domain in the purine biosynthesis
                     pathway protein ATIC (purH). The bifunctional ATIC protein
                     contains a C-terminal  ATIC formylase domain that
                     formylates...; Region: IMPCH; cd01421"
                     /db_xref="CDD:238709"
     misc_feature    complement(order(265379..265381,265448..265450,
                     265550..265555,265640..265642,265649..265651,
                     265709..265711,265715..265717))
                     /locus_tag="PC1_0225"
                     /note="purine monophosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    complement(order(265178..265180,265187..265192,
                     265196..265204,265226..265234,265241..265243,
                     265343..265345,265352..265357,265367..265369,
                     265376..265384,265520..265522,265529..265534,
                     265541..265549,265556..265561,265568..265573,
                     265580..265582))
                     /locus_tag="PC1_0225"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    complement(order(265379..265381,265553..265555))
                     /locus_tag="PC1_0225"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:238709"
     misc_feature    complement(264377..265351)
                     /locus_tag="PC1_0225"
                     /note="AICARFT/IMPCHase bienzyme; Region: AICARFT_IMPCHas;
                     smart00798"
                     /db_xref="CDD:214822"
     gene            266371..267898
                     /locus_tag="PC1_R0009"
                     /db_xref="GeneID:8131134"
     rRNA            266371..267898
                     /locus_tag="PC1_R0009"
                     /product="16S ribosomal RNA"
                     /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res.
                     Apr2 2, 2007"
                     /db_xref="GeneID:8131134"
     gene            267977..268053
                     /locus_tag="PC1_R0010"
                     /note="tRNA-Ile1"
                     /db_xref="GeneID:8131135"
     tRNA            267977..268053
                     /locus_tag="PC1_R0010"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:8131135"
     gene            268096..268171
                     /locus_tag="PC1_R0011"
                     /note="tRNA-Ala1"
                     /db_xref="GeneID:8131136"
     tRNA            268096..268171
                     /locus_tag="PC1_R0011"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:8131136"
     gene            268383..271288
                     /locus_tag="PC1_R0012"
                     /db_xref="GeneID:8131137"
     rRNA            268383..271288
                     /locus_tag="PC1_R0012"
                     /product="23S ribosomal RNA"
                     /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res.
                     Apr2 2, 2007"
                     /db_xref="GeneID:8131137"
     gene            271417..271531
                     /locus_tag="PC1_R0013"
                     /db_xref="GeneID:8131138"
     rRNA            271417..271531
                     /locus_tag="PC1_R0013"
                     /product="5S ribosomal RNA"
                     /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res.
                     Apr2 2, 2007"
                     /db_xref="GeneID:8131138"
     gene            complement(271814..272575)
                     /locus_tag="PC1_0226"
                     /db_xref="GeneID:8131139"
     CDS             complement(271814..272575)
                     /locus_tag="PC1_0226"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: eca:ECA0242 L-amino acid ABC transporter ATP-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_003015822.1"
                     /db_xref="GI:253686632"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8131139"
                     /translation="MNQTALTQSTDHMITLENVNKWYGQFHVLKDINLQVRQGERIVL
                     CGPSGSGKSTTIRCINHLEEHQQGRIVVDGIELNNDLRNIEKIRTEVGMVFQHFNLFP
                     HLTVLQNCTLAPCWVRNMPKKEAEELAMHYLERVRIAAHAHKFPGQLSGGQQQRVAIA
                     RSLCMKPKIMLFDEPTSALDPEMVKEVLDTMLGLAQDGMTMLCVTHEMGFARTVADRV
                     IFMDQGEIVEQAPPDIFFSSPRSERTQSFLSQILH"
     misc_feature    complement(271820..272539)
                     /locus_tag="PC1_0226"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    complement(271898..272536)
                     /locus_tag="PC1_0226"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    complement(272417..272440)
                     /locus_tag="PC1_0226"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(order(271958..271960,272054..272059,
                     272288..272290,272414..272422,272426..272431))
                     /locus_tag="PC1_0226"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(272288..272299)
                     /locus_tag="PC1_0226"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(272102..272131)
                     /locus_tag="PC1_0226"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(272054..272071)
                     /locus_tag="PC1_0226"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(272036..272047)
                     /locus_tag="PC1_0226"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(271952..271972)
                     /locus_tag="PC1_0226"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            complement(272584..273672)
                     /locus_tag="PC1_0227"
                     /db_xref="GeneID:8131140"
     CDS             complement(272584..273672)
                     /locus_tag="PC1_0227"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="TIGRFAM: polar amino acid ABC transporter, inner
                     membrane subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     KEGG: eca:ECA0243 L-amino acid ABC transporter permease
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter inner membrane
                     subunit"
                     /protein_id="YP_003015823.1"
                     /db_xref="GI:253686633"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="GeneID:8131140"
                     /translation="MNHYTQGRQSSLFRAMQWARRNLFSSISNSLLTLFCLWLLWVAI
                     PPLLNWAIFQANWIGTTRNDCTRDGACWVFIHARFGHFMYGLYPAAEIWRINFALTIG
                     LLSILPMFLKSIPYRGRYIAVWAVAYPLIAWWLLYGGFGGLSRVETYQWGGLTLTLII
                     AAVGIAGALPLGILLALGRRSTLPIVRMLSVVFIEFWRGVPLITVLFMSSVMLPLFLT
                     EGTTIDKLLRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLGLGYWRMQGLVIL
                     PQALKMVIPGLVNTIISLFKDTSLVIIIGLFDLFSSIQQATVDPTWLGMSTEGYVFAA
                     MVYWIFCFSMSRYSQHLESRFNTGHKSH"
     misc_feature    complement(272596..273276)
                     /locus_tag="PC1_0227"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    complement(272638..273213)
                     /locus_tag="PC1_0227"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(272638..272640,272647..272652,
                     272659..272664,272668..272673,272680..272685,
                     272722..272727,272764..272769,272776..272787,
                     272806..272808,272815..272820,272860..272862,
                     272911..272913,272920..272925,272935..272937,
                     272941..272946,272953..272955,272959..272961,
                     272965..272970,273043..273045,273049..273054,
                     273061..273090,273094..273105,273133..273135,
                     273148..273153,273160..273165))
                     /locus_tag="PC1_0227"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(272770..272787,273043..273087))
                     /locus_tag="PC1_0227"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(272683..272685,272722..272724,
                     272731..272733,272767..272769,272983..272985,
                     273043..273045))
                     /locus_tag="PC1_0227"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(272839..272841,272851..272856,
                     272872..272910))
                     /locus_tag="PC1_0227"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(273687..274865)
                     /locus_tag="PC1_0228"
                     /db_xref="GeneID:8131141"
     CDS             complement(273687..274865)
                     /locus_tag="PC1_0228"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="TIGRFAM: polar amino acid ABC transporter, inner
                     membrane subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     KEGG: eca:ECA0244 L-amino acid ABC transporter permease
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter inner membrane
                     subunit"
                     /protein_id="YP_003015824.1"
                     /db_xref="GI:253686634"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="GeneID:8131141"
                     /translation="MLQRPTVKGDLSLTNPAVRAWLYQIVVVIAVLAVAAYLLHNTVT
                     NLAQRGITSGFDFLNKSAGFGIVQHLIDYQQGDTYARVFLVGLFNTLLVSALCIVFAS
                     ILGFTIGLARLSDNWLLRKISNIYIEIFRNIPPLLQIFFWYFAVLRNLPGPRQSISAF
                     DVAFLSNRGFYLPSPELGPGAAAFFLSLIITLVVTWGVFRRNQRYHALTGQPRRTWPL
                     ALGLLLGLCALSHLIFGAAFHWDMPELKGFNFRGGMVLIPELAALTVALSVYTSSFIA
                     EIIRSGIQSVSHGQHEAARSLGLPNPVTLRKVILPQALRVIIPPLTSQYLNIVKNSSL
                     AAAIGYPDMVSLFAGTVLNQTGQAIETIAITMSVYLIISLLISLLMNLYNRKIALVER
                     "
     misc_feature    complement(273690..274856)
                     /locus_tag="PC1_0228"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     BatB; COG4597"
                     /db_xref="CDD:226960"
     misc_feature    complement(<274431..274619)
                     /locus_tag="PC1_0228"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cl00427"
                     /db_xref="CDD:260417"
     misc_feature    complement(273762..>274073)
                     /locus_tag="PC1_0228"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(273762..273764,273768..273773,
                     273780..273785,273813..273818,273855..273860,
                     273867..273878,273897..273899,273906..273911,
                     273951..273953,274002..274004,274011..274016,
                     274026..274028,274032..274037,274044..274046,
                     274050..274052,274056..274061))
                     /locus_tag="PC1_0228"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(273930..273932,273942..273947,
                     273963..274001))
                     /locus_tag="PC1_0228"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(273783..273785,273813..273815,
                     273822..273824,273858..273860))
                     /locus_tag="PC1_0228"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     gene            complement(274931..275956)
                     /locus_tag="PC1_0229"
                     /db_xref="GeneID:8131142"
     CDS             complement(274931..275956)
                     /locus_tag="PC1_0229"
                     /inference="protein motif:PFAM:PF00497"
                     /note="PFAM: extracellular solute-binding protein family
                     3;
                     SMART: extracellular solute-binding protein family 3;
                     KEGG: eca:ECA0245 general L-amino ABC transporter binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 3 extracellular solute-binding protein"
                     /protein_id="YP_003015825.1"
                     /db_xref="GI:253686635"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="GeneID:8131142"
                     /translation="MKRIVISTLVAGASLFAAINQAHAGATLDAIQKKGFVQCGISDG
                     LPGFSYADASGKYSGIDVDVCRGLAAAVFGDANKVKYTPLTAKERFTALQSGEVDVLS
                     RNTTWTSSRDGGMGMLFTGVTYYDGIGFLTHNKAGLTSAKELDGATVCIQAGTDTELN
                     VADYFKTHKMQYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSKPAEFIVL
                     PEVISKEPLGPVVRRGDEEWFSIVRWTLFAMLNAEEMGVTSKNVDQLAAKPTTPDMSH
                     LLGHEGSYGKDLKLPNDWAFKIIKQVGNYGEIFERNVGMGSELKIKRGLNELWNKGGI
                     QYAPAVR"
     misc_feature    complement(275021..275953)
                     /locus_tag="PC1_0229"
                     /note="lysine-arginine-ornithine-binding periplasmic
                     protein; Region: 3A0103s03R; TIGR01096"
                     /db_xref="CDD:233269"
     misc_feature    complement(275210..275848)
                     /locus_tag="PC1_0229"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(275363..275365,275489..275491,
                     275624..275626,275699..275701,275822..275824))
                     /locus_tag="PC1_0229"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(275384..275386,275402..275404,
                     275414..275416))
                     /locus_tag="PC1_0229"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(275267..275284)
                     /locus_tag="PC1_0229"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(276322..276987)
                     /locus_tag="PC1_0230"
                     /db_xref="GeneID:8131143"
     CDS             complement(276322..276987)
                     /locus_tag="PC1_0230"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="TIGRFAM: polar amino acid ABC transporter, inner
                     membrane subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     KEGG: eca:ECA0246 putative amino-acid transport system
                     permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter inner membrane
                     subunit"
                     /protein_id="YP_003015826.1"
                     /db_xref="GI:253686636"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="GeneID:8131143"
                     /translation="MPPWLQLMADSFWSLLSAGLKFTVPLAILSFIFGLALGIIIALV
                     RLYGPKPLKWLGDFYVWVIRGTPLLVQLFLIFYGLPSAGITLDAFPAALIGFTISVGA
                     YSSEIVRGAILSVPKGQWNAAYSLGMNGRQAIRWVIFPQSVFVSLPPLSNTFISLIKD
                     TSLAAVITVPEMFLSAQRIVSVTYEPLILYVEAALIYLMFSTVLSQLQVKLEKYYQRH
                     ITH"
     misc_feature    complement(276334..276987)
                     /locus_tag="PC1_0230"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    complement(276373..276930)
                     /locus_tag="PC1_0230"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(276373..276375,276382..276387,
                     276394..276399,276403..276408,276415..276420,
                     276448..276453,276490..276495,276502..276513,
                     276532..276534,276541..276546,276586..276588,
                     276637..276639,276646..276651,276661..276663,
                     276667..276672,276679..276681,276685..276687,
                     276691..276696,276760..276762,276766..276771,
                     276778..276807,276811..276822,276850..276852,
                     276865..276870,276877..276882))
                     /locus_tag="PC1_0230"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(276496..276513,276760..276804))
                     /locus_tag="PC1_0230"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(276418..276420,276448..276450,
                     276457..276459,276493..276495,276709..276711,
                     276760..276762))
                     /locus_tag="PC1_0230"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(276565..276567,276577..276582,
                     276598..276636))
                     /locus_tag="PC1_0230"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(277030..277797)
                     /locus_tag="PC1_0231"
                     /db_xref="GeneID:8131144"
     CDS             complement(277030..277797)
                     /locus_tag="PC1_0231"
                     /inference="protein motif:PFAM:PF00497"
                     /note="PFAM: extracellular solute-binding protein family
                     3;
                     SMART: extracellular solute-binding protein family 3;
                     KEGG: eca:ECA0247 putative cystine-binding periplasmic
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 3 extracellular solute-binding protein"
                     /protein_id="YP_003015827.1"
                     /db_xref="GI:253686637"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="GeneID:8131144"
                     /translation="MKKIRFALLTSALLATSVFAHADDLSDIKSAGVLKIGTEGTYAP
                     YTYHDKSGQLVGFDVDIGRAVAEKLGVKAQFIEGRWDGLIAGIDAKRYDAVINQVGVT
                     KERQAKYDFSKPYIDSKAVLVVRGDNTTLKDFSDLKGKKAAQSLTSNYSKQATSYGAD
                     IVPTDGFNQSLDLVLSGRADATLNDNLSFLDFKKHKPDANVKIAATSKDGEPSAILVR
                     KNQATLVEALNKALDEIKADGTYKTISVRYFGEDVSQ"
     misc_feature    complement(277051..277698)
                     /locus_tag="PC1_0231"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(277051..277698)
                     /locus_tag="PC1_0231"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(order(277243..277245,277351..277353,
                     277483..277485,277558..277560,277672..277674))
                     /locus_tag="PC1_0231"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(277264..277266,277282..277284,
                     277294..277296))
                     /locus_tag="PC1_0231"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(277156..277158,277159..277167))
                     /locus_tag="PC1_0231"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            278118..279263
                     /locus_tag="PC1_0232"
                     /db_xref="GeneID:8131145"
     CDS             278118..279263
                     /locus_tag="PC1_0232"
                     /inference="protein motif:PFAM:PF03372"
                     /note="PFAM: Endonuclease/exonuclease/phosphatase;
                     KEGG: eca:ECA0251 endonuclease/exonuclease/phosphatase
                     family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase"
                     /protein_id="YP_003015828.1"
                     /db_xref="GI:253686638"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="GeneID:8131145"
                     /translation="MKIRIASYNVENLFHRTAILNLPDSRQIDALLQQVRQLQHLLEQ
                     PQYDDALKDQVFRLSIALRPYIDIRTDAGTLGRWKKEDAGTGFRINKSCRGRGDWIGE
                     IVFKAQEFSSQQRKNTGKIITLLNADILCAVEVENMDVLRDFNNQVLGDDKFSQFVMI
                     DSPNDPRGIDVACLTRYRIAQLRTHIFDAGKRFDPVFSRDCLEVTLDAGLKQPIYILC
                     NHFKSQSGQTEEERLRGAEKRRDQAERVAEIVQQTYDLKKDYVVILGDLNEDSSNPWH
                     SLAPLFSLSDLHPVIDPERPEKERYTYYFAGGKKGARLNQLDYIFLSAPLHQAVVEWG
                     VERRGIYNIDKIAAKEGAEPVTPLPEVTSWDTAASDHAALWVEVDIT"
     misc_feature    278475..279128
                     /locus_tag="PC1_0232"
                     /note="Endonuclease/Exonuclease/phosphatase family;
                     Region: Exo_endo_phos; pfam03372"
                     /db_xref="CDD:251907"
     misc_feature    order(278517..278519,278775..278777,278913..278915,
                     278919..278921,279069..279071)
                     /locus_tag="PC1_0232"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197306"
     misc_feature    278517..278519
                     /locus_tag="PC1_0232"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197306"
     misc_feature    order(278775..278777,278919..278921)
                     /locus_tag="PC1_0232"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197306"
     gene            279331..279732
                     /locus_tag="PC1_0233"
                     /db_xref="GeneID:8131146"
     CDS             279331..279732
                     /locus_tag="PC1_0233"
                     /inference="protein motif:PFAM:PF04266"
                     /note="PFAM: protein of unknown function DUF437;
                     KEGG: eca:ECA0252 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015829.1"
                     /db_xref="GI:253686639"
                     /db_xref="InterPro:IPR007374"
                     /db_xref="GeneID:8131146"
                     /translation="MSKQGLEQYPDALRWSFGDSPALADELLQLVLEGHKTATCSSYH
                     AFKNEETPQVGDYNIVLDGAGQPSCVIRTRSLTLVRYCDVTAEMAAKEGEGDKSLTFW
                     REGHQTFFEREGTFAPDMLLVFEEFELIEVF"
     misc_feature    279370..279723
                     /locus_tag="PC1_0233"
                     /note="ASC-1 homology domain, subfamily similar to
                     Enterococcus faecalis Ef3133. The ASCH domain, a small
                     beta-barrel domain found in all three kingdoms of life,
                     resembles the RNA-binding PUA domain and may also interact
                     with RNA. ASCH has been proposed to...; Region:
                     ASCH_Ef3133_like; cd06553"
                     /db_xref="CDD:119345"
     gene            complement(279804..280868)
                     /locus_tag="PC1_0234"
                     /db_xref="GeneID:8131147"
     CDS             complement(279804..280868)
                     /locus_tag="PC1_0234"
                     /inference="protein motif:TFAM:TIGR00589"
                     /note="KEGG: ent:Ent638_0045
                     DNA-O6-methylguanine--protein-cysteine S-methyltransferase
                     / transcriptional regulator Ada;
                     TIGRFAM: methylated-DNA/protein-cysteine
                     methyltransferase;
                     PFAM: Methylated-DNA-[protein]-cysteine
                     S-methyltransferase DNA binding; Ada metal-binding domain
                     protein;
                     SMART: helix-turn-helix- domain containing protein AraC
                     type"
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA/protein-cysteine
                     methyltransferase"
                     /protein_id="YP_003015830.1"
                     /db_xref="GI:253686640"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR004026"
                     /db_xref="InterPro:IPR014048"
                     /db_xref="GeneID:8131147"
                     /translation="MKVLDNDQCDVWYQALLERDSGYTGVFFVGVITTGVFCISVCRA
                     RKPKRENVEFYKDVKSALDAGFRPCKVCRPTENAHSAPLLIEQALELVRANPKTRISD
                     TELRKHDISPERVRRWFLQNHGITFQAFQRMQRVNVALQELKGGRNATEVAFDSGYES
                     LSGFGYTYKRLTGVSPTEQSQVIMIHRFTTPLGPMFVCATERGVCLLEFTDRRMLETE
                     FRDLQRLLNARIMSGENIHTRQTEKEISEYFSGTRQQFTLLLDTPGSDFQRTVWQELR
                     AVPYGHTSHYQALSGLIGKPNAVRAVAAANGANRVAIVIPCHRIIGKDGTMTGYGGGI
                     ARKKWLIEHEKTMLNHPTES"
     misc_feature    complement(279837..280868)
                     /locus_tag="PC1_0234"
                     /note="bifunctional DNA-binding transcriptional dual
                     regulator/O6-methylguanine-DNA methyltransferase;
                     Provisional; Region: PRK15435"
                     /db_xref="CDD:185333"
     misc_feature    complement(280644..280850)
                     /locus_tag="PC1_0234"
                     /note="Metal binding domain of Ada; Region:
                     Ada_Zn_binding; pfam02805"
                     /db_xref="CDD:251541"
     misc_feature    complement(279834..280070)
                     /locus_tag="PC1_0234"
                     /note="The DNA repair protein O6-alkylguanine-DNA
                     alkyltransferase (ATase; also known as AGT, AGAT and MGMT)
                     reverses O6-alkylation DNA damage by transferring O6-alkyl
                     adducts to an active site cysteine irreversibly, without
                     inducing DNA strand breaks. ATases...; Region: ATase;
                     cd06445"
                     /db_xref="CDD:119438"
     misc_feature    complement(order(279882..279884,279903..279905,
                     279918..279920,279942..279944,279948..279953,
                     279960..279962,279966..279971,279975..279977,
                     279984..279986,280008..280013,280065..280070))
                     /locus_tag="PC1_0234"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119438"
     misc_feature    complement(order(279837..279839,279909..279911,
                     279915..279920,280011..280013))
                     /locus_tag="PC1_0234"
                     /note="active site"
                     /db_xref="CDD:119438"
     gene            complement(280852..281628)
                     /locus_tag="PC1_0235"
                     /db_xref="GeneID:8131148"
     CDS             complement(280852..281628)
                     /locus_tag="PC1_0235"
                     /inference="similar to AA sequence:KEGG:Ent638_0044"
                     /note="KEGG: ent:Ent638_0044 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015831.1"
                     /db_xref="GI:253686641"
                     /db_xref="GeneID:8131148"
                     /translation="MNFTERHHQSPPLLIANVWDASSAIAAQHAGYQALGTSSAAIAA
                     MLGYEDGEAMSFDELLYIVTRIKSVSHLPLSVDVEAGFGRTASEITVNLKRLASLGVV
                     GVNLEDSRVVNGVRQLDDAVAFSRTLKEIRHALTIENDQLFFNIRTDTFLLGHEQALQ
                     ETLLRGRLYEEAGADGLFVPCLTSENDIAIISREINLPLNVMCMPDLPAFDRLKTLGV
                     NRLSMGNFVHSAIQSTFKNIMLTIQSQQSFAGVFVDESSR"
     misc_feature    complement(280912..281622)
                     /locus_tag="PC1_0235"
                     /note="Members of the ICL/PEPM enzyme family catalyze
                     either P-C or C-C bond formation/cleavage. Known members
                     are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate
                     hydrolase (PPH), carboxyPEP mutase (CPEP mutase),
                     oxaloacetate hydrolase (OAH), isocitrate...; Region:
                     ICL_PEPM; cd00377"
                     /db_xref="CDD:119340"
     misc_feature    complement(order(280912..280917,280921..280929,
                     280933..280941,281230..281232,281239..281244,
                     281251..281253,281260..281265,281335..281337,
                     281344..281346,281356..281361,281380..281382,
                     281422..281427,281434..281439,281443..281448,
                     281455..281460,281464..281475,281482..281487,
                     281494..281499,281509..281511,281530..281538,
                     281542..281544,281551..281556,281560..281574,
                     281578..281589,281593..281595,281614..281616))
                     /locus_tag="PC1_0235"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119340"
     misc_feature    complement(order(280957..280959,281017..281019,
                     281023..281025,281089..281091,281188..281190,
                     281308..281310,281392..281394,281398..281400,
                     281479..281481,281509..281517,281521..281523))
                     /locus_tag="PC1_0235"
                     /note="active site"
                     /db_xref="CDD:119340"
     misc_feature    complement(order(281308..281310,281392..281394,
                     281398..281400,281479..281481))
                     /locus_tag="PC1_0235"
                     /note="Mg2+/Mn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:119340"
     gene            complement(281871..282167)
                     /locus_tag="PC1_0236"
                     /db_xref="GeneID:8131149"
     CDS             complement(281871..282167)
                     /locus_tag="PC1_0236"
                     /inference="protein motif:PFAM:PF02954"
                     /note="PFAM: helix-turn-helix Fis-type;
                     KEGG: eca:ECA0255 DNA-binding protein fis"
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="YP_003015832.1"
                     /db_xref="GI:253686642"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR005412"
                     /db_xref="GeneID:8131149"
                     /translation="MFEQRVNSDVLTVSTVNSQAQVTQKPLRDSVKQALKNYFAQLNG
                     QDVSDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN"
     misc_feature    complement(281874..282158)
                     /locus_tag="PC1_0236"
                     /note="global DNA-binding transcriptional dual regulator
                     Fis; Provisional; Region: fis; PRK00430"
                     /db_xref="CDD:179020"
     gene            complement(282191..283156)
                     /locus_tag="PC1_0237"
                     /db_xref="GeneID:8131150"
     CDS             complement(282191..283156)
                     /locus_tag="PC1_0237"
                     /inference="protein motif:TFAM:TIGR00737"
                     /note="TIGRFAM: TIM-barrel protein, nifR3 family;
                     PFAM: dihydrouridine synthase DuS;
                     KEGG: eca:ECA0256 tRNA-dihydrouridine synthase B"
                     /codon_start=1
                     /transl_table=11
                     /product="TIM-barrel protein, nifR3 family"
                     /protein_id="YP_003015833.1"
                     /db_xref="GI:253686643"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR004652"
                     /db_xref="GeneID:8131150"
                     /translation="MHIGQFQLTNRLIAAPMAGISDRPFRALCHAMGAGMTVSEMLSS
                     NPEVWRSDKSRLRMVHSDEPGIRAVQIAGCDPDEMAAAARINADSGAQIIDINMGCPA
                     KKVNRKMAGSALLQYPDLVKQILSSVVKAVDVPVTLKIRTGWAPEHRNCVEIAKLAED
                     CGIQALTIHGRTRACLFNGSAEYDSIRAVKQAVSIPIIANGDITDPHKARAVLDYTGA
                     DALMIGRAAQGRPWIFREIQHYLDTGELLAPMPLAEVKRLLIEHIRELHDFYGPGKGF
                     RIARKHVSWYLQEHAPNDQFRRTFNAIEDASEQLEALKAYFENLA"
     misc_feature    complement(282194..283156)
                     /locus_tag="PC1_0237"
                     /note="tRNA-dihydrouridine synthase B; Provisional;
                     Region: PRK10415"
                     /db_xref="CDD:182440"
     misc_feature    complement(282431..283126)
                     /locus_tag="PC1_0237"
                     /note="Dihydrouridine synthase-like (DUS-like) FMN-binding
                     domain. Members of this family catalyze the reduction of
                     the 5,6-double bond of a uridine residue on tRNA.
                     Dihydrouridine modification of tRNA is widely observed in
                     prokaryotes and eukaryotes, and also...; Region:
                     DUS_like_FMN; cd02801"
                     /db_xref="CDD:239200"
     misc_feature    complement(order(282482..282487,282551..282553,
                     282557..282559,282650..282652,282740..282742,
                     282866..282868,282947..282949,283034..283036,
                     283106..283114))
                     /locus_tag="PC1_0237"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239200"
     misc_feature    complement(order(282482..282484,282551..282556,
                     282641..282646,282650..282655,282734..282736,
                     282740..282742,282854..282859,282947..282949))
                     /locus_tag="PC1_0237"
                     /note="active site"
                     /db_xref="CDD:239200"
     misc_feature    complement(order(282644..282646,282650..282652,
                     282734..282736,282857..282859))
                     /locus_tag="PC1_0237"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239200"
     misc_feature    complement(order(282551..282556,282641..282643,
                     282653..282655,282740..282742,282854..282856))
                     /locus_tag="PC1_0237"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239200"
     gene            complement(283513..284247)
                     /locus_tag="PC1_0238"
                     /db_xref="GeneID:8131151"
     CDS             complement(283513..284247)
                     /locus_tag="PC1_0238"
                     /EC_number="4.2.1.1"
                     /inference="protein motif:PRIAM:4.2.1.1"
                     /note="PFAM: carbonic anhydrase;
                     KEGG: eca:ECA0257 carbonic anhydrase"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonate dehydratase"
                     /protein_id="YP_003015834.1"
                     /db_xref="GI:253686644"
                     /db_xref="InterPro:IPR001148"
                     /db_xref="GeneID:8131151"
                     /translation="MKGKLSIVLMLSACFPVLAADPVNWGYEGNGDPAHWGKLSPDFS
                     LCETGKNQSPINIRQALNAQHDPLQLAFLPGTQQIINNGHTVQVNVGPGNTLLLDNET
                     FTLQQFHFHAPSENEIDGKQFPLEGHFVYKDASGALTVIALMFQEGEANQPLATAWQQ
                     IPAQVNQAEEVRTPIAIQSLLPTSLNYYRFSGSLTTPPCSEGIRWLVLDHPVTASAEQ
                     INQFRSVMHHANNRPIQPLNGRVIIH"
     misc_feature    complement(283516..284154)
                     /locus_tag="PC1_0238"
                     /note="Carbonic anhydrase alpha, prokaryotic-like
                     subfamily. Carbonic anhydrases (CAs) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism: a nucleophilic attack of
                     a zinc-bound hydroxide ion on carbon...; Region:
                     alpha_CA_prokaryotic_like; cd03124"
                     /db_xref="CDD:239398"
     misc_feature    complement(order(283663..283665,283864..283866,
                     283903..283905,283915..283917,283921..283923,
                     283927..283929,283996..283998))
                     /locus_tag="PC1_0238"
                     /note="active site"
                     /db_xref="CDD:239398"
     misc_feature    complement(order(283864..283866,283915..283917,
                     283921..283923))
                     /locus_tag="PC1_0238"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:239398"
     gene            complement(284423..285310)
                     /locus_tag="PC1_0239"
                     /db_xref="GeneID:8131152"
     CDS             complement(284423..285310)
                     /locus_tag="PC1_0239"
                     /inference="protein motif:TFAM:TIGR00406"
                     /note="TIGRFAM: ribosomal protein L11 methyltransferase;
                     PFAM: ribosomal L11 methyltransferase; Methyltransferase
                     type 12; methyltransferase small; putative RNA methylase;
                     KEGG: eca:ECA0258 ribosomal protein L11 methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11 methyltransferase"
                     /protein_id="YP_003015835.1"
                     /db_xref="GI:253686645"
                     /db_xref="InterPro:IPR000241"
                     /db_xref="InterPro:IPR004498"
                     /db_xref="InterPro:IPR007848"
                     /db_xref="InterPro:IPR010456"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:8131152"
                     /translation="MPWIQLKINTSGNVAEQLGDAMIESGAVSVTFQDTHDTPVFEPL
                     PGETRLWGDTDAIALYDAETDMNDVIAMLEQEPLLGVGFKHKIEQLEDKDWEREWMDN
                     FHPMQFGKRLWICPSWRDIPDPTAVNVMLDPGLAFGTGTHPTTALCLQWLDGLDLEGK
                     TIIDFGCGSGILAIAALKLGAARAIGIDIDPQAIQASRDNAQRNGVSERLELYLPKDQ
                     PADLSADVVVANILAGPLRELAPLISDLPKAGGHLGLSGVLATQADGVAEAYADKFTL
                     DPVAEREEWCRITGQRRAS"
     misc_feature    complement(284432..285307)
                     /locus_tag="PC1_0239"
                     /note="Ribosomal protein L11 methyltransferase (PrmA);
                     Region: PrmA; pfam06325"
                     /db_xref="CDD:253677"
     misc_feature    complement(284531..284830)
                     /locus_tag="PC1_0239"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(284621..284623,284681..284689,
                     284744..284749,284798..284818))
                     /locus_tag="PC1_0239"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(285328..286779)
                     /locus_tag="PC1_0240"
                     /db_xref="GeneID:8131153"
     CDS             complement(285328..286779)
                     /locus_tag="PC1_0240"
                     /inference="protein motif:TFAM:TIGR02119"
                     /note="TIGRFAM: sodium/pantothenate symporter; SSS sodium
                     solute transporter superfamily;
                     PFAM: Na+/solute symporter;
                     KEGG: eca:ECA0259 sodium/panthothenate symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/pantothenate symporter"
                     /protein_id="YP_003015836.1"
                     /db_xref="GI:253686646"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR011849"
                     /db_xref="GeneID:8131153"
                     /translation="MQIEILLPLIGYLLLVFGLSVYAYRRRQAGNFLNEYFLGGRSMG
                     GFVLAMTLIGTYVSASSFIGGPGAAYKYGLGWVLLSMIQLPTMLLSLGILGKKFAILA
                     RRYNAITLNDMLYARYNSPLLVWFASISLLVAFIGAMAVQFIGGARLLETAANIPYDI
                     GLLIFGVTIALYTTFGGFRASVLNDAMQGIVMLIGTVILLVGVIYAAGGLHSAVDKLQ
                     QIDPMLVSPQGSGGILSMPFMASFWVLVCFGVIGLPNTAVRCISYRDSKALHRGIIIG
                     TIVIGILMLGMHLAGALGRAVMPNLTIPDQVLPALMVTVLPPLAAGIFLAAPMAAIMS
                     NINAHLLQASATIIKDLYLSVRPQQIHNERRIKILSSMTTLLLGLLVLLASLRPPDMI
                     IWLNLLAFGGLEAVFLWPLVLGLYWERANAAGALSAMFSGAICYTLLASFNLQLAGYH
                     PIVPSLLLSLMAFIIGNRFGHNPPAPVAASSSL"
     misc_feature    complement(285358..286734)
                     /locus_tag="PC1_0240"
                     /note="Na(+)/pantothenate cotransporters: PanF of
                     Escherichia coli and related proteins; solute binding
                     domain; Region: SLC5sbd_PanF; cd10327"
                     /db_xref="CDD:212037"
     misc_feature    complement(order(285775..285780,285787..285789,
                     286609..286611,286618..286620))
                     /locus_tag="PC1_0240"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212037"
     gene            complement(286769..287011)
                     /locus_tag="PC1_0241"
                     /db_xref="GeneID:8131154"
     CDS             complement(286769..287011)
                     /locus_tag="PC1_0241"
                     /inference="protein motif:PFAM:PF06196"
                     /note="PFAM: protein of unknown function DUF997;
                     KEGG: spe:Spro_4419 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015837.1"
                     /db_xref="GI:253686647"
                     /db_xref="InterPro:IPR010398"
                     /db_xref="GeneID:8131154"
                     /translation="MDTRFPQAHREARWAFGLTLVYLVAWALAAYLPDNTQGITGLPH
                     WFEMACLLLPLVFTLLCWLMVHVIFRDISLESDDAN"
     misc_feature    complement(286772..287011)
                     /locus_tag="PC1_0241"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10633"
                     /db_xref="CDD:182602"
     gene            287557..287985
                     /locus_tag="PC1_0242"
                     /db_xref="GeneID:8131155"
     CDS             287557..287985
                     /locus_tag="PC1_0242"
                     /inference="protein motif:PFAM:PF03459"
                     /note="PFAM: TOBE domain protein;
                     KEGG: eum:ECUMN_3055 putative
                     molybdenum-pterin-binding-protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TOBE domain-containing protein"
                     /protein_id="YP_003015838.1"
                     /db_xref="GI:253686648"
                     /db_xref="InterPro:IPR004606"
                     /db_xref="InterPro:IPR005116"
                     /db_xref="GeneID:8131155"
                     /translation="MSVSARNQLSGVVSSIVEGAVNNEVALTLESGDKLTTVITRASC
                     QSMDLAVGKPAIALVKAPWVILASAECGLNFSARNQFHGKVSSVTKGAVNSTVQLVTA
                     GGLTLTSTVTNESLEEMNIDVGNELIALVKASSIILATRK"
     misc_feature    287557..287757
                     /locus_tag="PC1_0242"
                     /note="TOBE domain; Region: TOBE; cl01440"
                     /db_xref="CDD:260939"
     misc_feature    287782..287976
                     /locus_tag="PC1_0242"
                     /note="TOBE domain; Region: TOBE; cl01440"
                     /db_xref="CDD:260939"
     gene            complement(288258..289601)
                     /locus_tag="PC1_0243"
                     /db_xref="GeneID:8131156"
     CDS             complement(288258..289601)
                     /locus_tag="PC1_0243"
                     /inference="protein motif:TFAM:TIGR00514"
                     /note="TIGRFAM: acetyl-CoA carboxylase, biotin
                     carboxylase;
                     PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
                     biotin carboxylase domain protein;
                     phosphoribosylglycinamide synthetase; Carbamoyl-phosphate
                     synthetase large chain domain protein;
                     KEGG: eca:ECA0260 acetyl-CoA carboxylase biotin
                     carboxylase subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase, biotin carboxylase"
                     /protein_id="YP_003015839.1"
                     /db_xref="GI:253686649"
                     /db_xref="InterPro:IPR000115"
                     /db_xref="InterPro:IPR004549"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="GeneID:8131156"
                     /translation="MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLL
                     ADETVCIGPAPSTKSYLNIPAIISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIF
                     IGPRAETIRLMGDKVSAITAMKKAGVPTVPGSDGPLTDDMDANRVHAKRIGYPVIIKA
                     SGGGGGRGMRVVRSDKELEQSINMTRAEAKAAFNNDMVYMEKYLENPRHVEIQILADG
                     QGHAVYLAERDCSMQRRHQKVVEEAPAPGITDELRRNIGDRCAKACIDINYRGAGTFE
                     FLYENGEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGLPLSIKQKDVKVRGHA
                     VECRINAEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLITYG
                     ETREIAISRMKNALAELIIDGIKTNIELQMKIMSDENFQRGGTNIHYLEKKLGLQ"
     misc_feature    complement(288261..289601)
                     /locus_tag="PC1_0243"
                     /note="acetyl-CoA carboxylase biotin carboxylase subunit;
                     Validated; Region: PRK08591"
                     /db_xref="CDD:236307"
     misc_feature    complement(289275..289598)
                     /locus_tag="PC1_0243"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    complement(288630..289259)
                     /locus_tag="PC1_0243"
                     /note="Carbamoyl-phosphate synthase L chain, ATP binding
                     domain; Region: CPSase_L_D2; pfam02786"
                     /db_xref="CDD:190425"
     misc_feature    complement(288279..288596)
                     /locus_tag="PC1_0243"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; smart00878"
                     /db_xref="CDD:214878"
     gene            complement(289613..290080)
                     /locus_tag="PC1_0244"
                     /db_xref="GeneID:8131157"
     CDS             complement(289613..290080)
                     /locus_tag="PC1_0244"
                     /inference="protein motif:TFAM:TIGR00531"
                     /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
                     carrier protein;
                     PFAM: biotin/lipoyl attachment domain-containing protein;
                     KEGG: eca:ECA0261 acetyl-CoA carboxylase biotin carboxyl
                     carrier protein subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase, biotin carboxyl carrier
                     protein"
                     /protein_id="YP_003015840.1"
                     /db_xref="GI:253686650"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001249"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="GeneID:8131157"
                     /translation="MDIRKIKKLIELVEESGIAELEISEGEESVRISRAPAAVNYPMM
                     QQAYATPMMQPQPALAAAVAPAPVEAAAAPAAISGHIVRSPMVGTFYRTPSPDAKAFV
                     EVGQQVNVGDTLCIVEAMKMMNQIEADKAGVVKAILLESGQPVEFDEPLVVIE"
     misc_feature    complement(289616..290080)
                     /locus_tag="PC1_0244"
                     /note="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein subunit; Validated; Region: PRK06302"
                     /db_xref="CDD:235777"
     misc_feature    complement(289619..289837)
                     /locus_tag="PC1_0244"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    complement(order(289694..289696,289715..289723,
                     289748..289750))
                     /locus_tag="PC1_0244"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    complement(289718..289720)
                     /locus_tag="PC1_0244"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     gene            complement(290105..290557)
                     /locus_tag="PC1_0245"
                     /db_xref="GeneID:8131158"
     CDS             complement(290105..290557)
                     /locus_tag="PC1_0245"
                     /EC_number="4.2.1.10"
                     /inference="protein motif:TFAM:TIGR01088"
                     /note="KEGG: eca:ECA0262 3-dehydroquinate dehydratase;
                     TIGRFAM: 3-dehydroquinate dehydratase, type II;
                     PFAM: dehydroquinase class II"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase, type II"
                     /protein_id="YP_003015841.1"
                     /db_xref="GI:253686651"
                     /db_xref="InterPro:IPR001874"
                     /db_xref="GeneID:8131158"
                     /translation="MAEKFHILLLNGPNLNLLGTREPDKYGKTTLADIVSELETQAQA
                     LNVKFSHLQSNAEHVLIDTIHQARGNTDFILINPAAFTHTSVALRDALLAVSIPFIEI
                     HLSNVHAREPFRHHSYLSDVAVGVICGLGADGYQYALQTAVKRLSTSN"
     misc_feature    complement(290123..290500)
                     /locus_tag="PC1_0245"
                     /note="Dehydroquinase (DHQase), type II. Dehydroquinase
                     (or 3-dehydroquinate dehydratase) catalyzes the reversible
                     dehydration of 3-dehydroquinate to form
                     3-dehydroshikimate. This reaction is part of two metabolic
                     pathways: the biosynthetic shikimate pathway...; Region:
                     DHQase_II; cd00466"
                     /db_xref="CDD:238262"
     misc_feature    complement(order(290216..290218,290243..290251,
                     290288..290290,290309..290311,290318..290323,
                     290327..290329,290480..290482,290495..290497))
                     /locus_tag="PC1_0245"
                     /note="active site"
                     /db_xref="CDD:238262"
     misc_feature    complement(order(290216..290218,290276..290278,
                     290285..290290,290297..290299,290318..290320,
                     290363..290365,290372..290374,290381..290395))
                     /locus_tag="PC1_0245"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     misc_feature    complement(order(290126..290128,290135..290137,
                     290147..290149,290159..290161,290168..290176,
                     290180..290191,290195..290200,290231..290236,
                     290240..290242))
                     /locus_tag="PC1_0245"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     gene            complement(290811..291410)
                     /locus_tag="PC1_0246"
                     /db_xref="GeneID:8131159"
     CDS             complement(290811..291410)
                     /locus_tag="PC1_0246"
                     /inference="protein motif:PFAM:PF01794"
                     /note="PFAM: Ferric reductase domain protein transmembrane
                     component domain;
                     KEGG: eca:ECA0263 putative sulfite oxidase subunit YedZ"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferric reductase transmembrane-domain containing
                     protein"
                     /protein_id="YP_003015842.1"
                     /db_xref="GI:253686652"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="GeneID:8131159"
                     /translation="MRLTLQHITRLKVLLHLAGFLPLLWLILSVDQGWFSADPAKDIQ
                     HFTGRMALKLLLATLLVTPLARYGKQPLLIRCRRLLGLWCFFWATLHLVSYALLELGL
                     DHLALLGKELISRPYLTLGVISWLILLALAVTSPQIMMRKLGSQWQKLHNFVYLVAIL
                     APIHYLWSVKTLSPQPILYALAALILLLFRYKKFRQWWR"
     misc_feature    complement(290814..291410)
                     /locus_tag="PC1_0246"
                     /note="putative sulfite oxidase subunit YedZ; Reviewed;
                     Region: PRK05419"
                     /db_xref="CDD:235452"
     gene            complement(291490..292491)
                     /locus_tag="PC1_0247"
                     /db_xref="GeneID:8131160"
     CDS             complement(291490..292491)
                     /locus_tag="PC1_0247"
                     /inference="protein motif:PFAM:PF00174"
                     /note="PFAM: oxidoreductase molybdopterin binding;
                     KEGG: eca:ECA0264 putative sulfite oxidase subunit YedY"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin binding oxidoreductase"
                     /protein_id="YP_003015843.1"
                     /db_xref="GI:253686653"
                     /db_xref="InterPro:IPR000572"
                     /db_xref="GeneID:8131160"
                     /translation="MHKHRKPTEADVTPESLFYQRRRILKALGISAAALSLPFSAQAD
                     LLAWFKGTDKPKAPPGKPLTFSQPADWKLDLPLTPEDKVTGYNNFYEFGLDKADPAAN
                     AGGLKTEGWTIKIDGDVAKPLTLDIDDLLKRFPLEERIYRFRCVEAWSMVIPWVGFEL
                     AKLIKFAEPTSNARYVAFQTLYDPEQMPGQKDRFMGGGLDYPYVEGLRMDEAMNPLAL
                     LAVGVYGKTLPPQNGAPIRLVTPWKYGFKNIKSIVHIRFTREKPPCTWNLAAPDEYGF
                     YANVNPHVDHPRWSQATERVIGSGGLLNVERQPTLLFNGYAEQVASLYRGLNLRDNF"
     misc_feature    complement(291580..292440)
                     /locus_tag="PC1_0247"
                     /note="Sulfite oxidase and related enzymes [General
                     function prediction only]; Region: COG2041"
                     /db_xref="CDD:224952"
     misc_feature    complement(291589..292242)
                     /locus_tag="PC1_0247"
                     /note="YedY_like molybdopterin cofactor (Moco) binding
                     domain, a subgroup of the sulfite oxidase (SO) family of
                     molybdopterin binding domains. Escherichia coli YedY has
                     been propsed to form a heterodimer, consisting of a
                     soluble catalytic subunit termed YedY; Region:
                     YedY_like_Moco; cd02107"
                     /db_xref="CDD:239025"
     misc_feature    complement(order(291742..291744,291748..291750,
                     291757..291759,291781..291783,291796..291798,
                     291883..291885,291952..291954,292057..292059,
                     292219..292233))
                     /locus_tag="PC1_0247"
                     /note="Moco binding site; other site"
                     /db_xref="CDD:239025"
     misc_feature    complement(292057..292059)
                     /locus_tag="PC1_0247"
                     /note="metal coordination site [ion binding]; other site"
                     /db_xref="CDD:239025"
     gene            complement(292636..292717)
                     /locus_tag="PC1_0248"
                     /pseudo
                     /db_xref="GeneID:8131161"
     gene            complement(292795..293772)
                     /locus_tag="PC1_0249"
                     /db_xref="GeneID:8131162"
     CDS             complement(292795..293772)
                     /locus_tag="PC1_0249"
                     /inference="protein motif:TFAM:TIGR02823"
                     /note="TIGRFAM: quinone oxidoreductase, YhdH/YhfP family;
                     PFAM: Alcohol dehydrogenase zinc-binding domain protein;
                     Alcohol dehydrogenase GroES domain protein;
                     KEGG: eca:ECA0265 putative zinc-binding oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="YhdH/YhfP family quinone oxidoreductase"
                     /protein_id="YP_003015844.1"
                     /db_xref="GI:253686654"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR014188"
                     /db_xref="GeneID:8131162"
                     /translation="MQALVLEQSDGLTHAQIREIDAEQLPTGDVTVDINWSGINYKDA
                     LAITGKGKIIRNFPMVPGIDFAGTVRHSDSDRFTAGQPVILTGWGVGENHWGGLAQQA
                     RVKSDWLVPLPASLDARKAMILGTAGFTAMLCVMALEDGGITPESGDIIVTGASGGVG
                     STAVALLAELGYQVTAVSGRADNTDYLKKLGAKQVLDRSEFSGSPRPLEKQRWAGAVD
                     TVGDNVLATLLAQMDYNATVAACGLAGGIALPTTVMPFILRNVRLQGVDSVMAPLARR
                     QQAWERLATILPESFYQQVTQEIGLEDVPATAAALLENKVTGRTLVKIS"
     misc_feature    complement(292801..293772)
                     /locus_tag="PC1_0249"
                     /note="Yhdh putative quinone oxidoreductases; Region:
                     MDR_yhdh; cd08288"
                     /db_xref="CDD:176248"
     misc_feature    complement(292801..293769)
                     /locus_tag="PC1_0249"
                     /note="putative quinone oxidoreductase, YhdH/YhfP family;
                     Region: oxido_YhdH; TIGR02823"
                     /db_xref="CDD:234026"
     misc_feature    complement(order(292825..292827,292831..292833,
                     292840..292842,292966..292977,293038..293052,
                     293113..293118,293179..293181,293233..293241,
                     293296..293307,293311..293313,293383..293385,
                     293392..293397,293650..293655))
                     /locus_tag="PC1_0249"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:176248"
     misc_feature    complement(order(292960..292965,292972..292995,
                     292999..293007,293011..293022,293026..293028,
                     293044..293055,293071..293073,293152..293154))
                     /locus_tag="PC1_0249"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176248"
     gene            293799..293948
                     /locus_tag="PC1_0250"
                     /db_xref="GeneID:8131163"
     CDS             293799..293948
                     /locus_tag="PC1_0250"
                     /inference="similar to AA sequence:KEGG:ECA3326"
                     /note="KEGG: eca:ECA3326 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015845.1"
                     /db_xref="GI:253686655"
                     /db_xref="GeneID:8131163"
                     /translation="MGKSLTTIYPSHFKLHVHWHRLVTQITYLSKLIGMPSLAAFLQL
                     GLFRV"
     gene            294076..296013
                     /locus_tag="PC1_0251"
                     /db_xref="GeneID:8131164"
     CDS             294076..296013
                     /locus_tag="PC1_0251"
                     /inference="protein motif:TFAM:TIGR00254"
                     /note="KEGG: eca:ECA0266 regulatory protein CsrD;
                     TIGRFAM: diguanylate cyclase;
                     PFAM: EAL domain protein; GGDEF domain containing protein;
                     SMART: EAL domain protein; GGDEF domain containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="YP_003015846.1"
                     /db_xref="GI:253686656"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="GeneID:8131164"
                     /translation="MGFTTRFSILVVLLTVLAIFLMLFSSIFSLCYYSQLRTEQQLRE
                     VTASIDQALLVQSPENIQYWLPSMMKTAGIVVLDIQDNDSTLYSIQLPEAGWERTHLY
                     HEVEFPLMHHLNMTIAIRYVDPLIGLPRFVVSMLSVLLAAGLMLLMLYFSIRWLRRQA
                     AGQEELEERAQRILKGERESVMQGSVREWPVNTSGALDQLLSDLVEAREERGRVDTLI
                     RAFAAQDAETGLSNRLFFDNQLTTQLEDGEEVGTHGVVMMIRVPDFETLQETHGYSSA
                     LQEYRFTLVNLLSTFVMRYPSALLARYFSSDFTVLLPHSTLKEANAIATQLVKSIDIL
                     PACPLIDREEVLHIGICAYRGGQSAEQVMESVEDATRNAVLQGGNSWCVFDRQVPEKG
                     RGSVKWRTLLEQTLARGGPRLYQKPAVTKEGVVHHREMMSRIYDGEQELLAAEYMPLV
                     QQLGLAASYDRQLVARIIDLSANWPGETLALPVSVDSLLQKPFLRWLKEVLLQCPKTQ
                     RQRILFELAEADVCQYIGRLRPVLTVILGLGCRLAVTQAGLTLVSTTYIKSLPVEIIK
                     LHPGLVRSLERRPENQLFVQSLTEACKGTQTRVFAAGVRTKEEWRMLLGKGVYGGQGD
                     FFAASVLVTDELKKYSSQHRV"
     misc_feature    294076..295971
                     /locus_tag="PC1_0251"
                     /note="regulatory protein CsrD; Provisional; Region:
                     PRK11059"
                     /db_xref="CDD:236833"
     misc_feature    294739..295227
                     /locus_tag="PC1_0251"
                     /note="diguanylate cyclase; Region: GGDEF; smart00267"
                     /db_xref="CDD:128563"
     misc_feature    order(294853..294870,294991..294993,295174..295176)
                     /locus_tag="PC1_0251"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143637"
     misc_feature    order(294853..294855,294991..294993)
                     /locus_tag="PC1_0251"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143637"
     misc_feature    295279..295956
                     /locus_tag="PC1_0251"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            296330..297373
                     /locus_tag="PC1_0252"
                     /db_xref="GeneID:8131165"
     CDS             296330..297373
                     /locus_tag="PC1_0252"
                     /inference="protein motif:TFAM:TIGR00904"
                     /note="TIGRFAM: cell shape determining protein, MreB/Mrl
                     family;
                     PFAM: cell shape determining protein MreB/Mrl;
                     KEGG: eca:ECA0267 rod shape-determining protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MreB/Mrl family cell shape determining protein"
                     /protein_id="YP_003015847.1"
                     /db_xref="GI:253686657"
                     /db_xref="InterPro:IPR004753"
                     /db_xref="GeneID:8131165"
                     /translation="MFKKFRGMFSNDLSIDLGTANTLIYVKGQGIILNEPSVVAIRQD
                     RAGSQKSVAAVGHDAKQMLGRTPGNIVAIRPMKDGVIADFQVTEKMLQHFIKQVHSDS
                     FMRPSPRVLVCVPVGATQVERRAIRESALGAGAREVFLIEEPMAAAIGAGMPVSEATG
                     SMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERI
                     KHEIGSAYPGDEVLEIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMAALE
                     QCPPELASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALE
                     MIDMHGGDLFSEE"
     misc_feature    296345..297364
                     /locus_tag="PC1_0252"
                     /note="rod shape-determining protein MreB; Provisional;
                     Region: PRK13927"
                     /db_xref="CDD:237562"
     misc_feature    296366..297340
                     /locus_tag="PC1_0252"
                     /note="MreB and similar proteins; Region: MreB_like;
                     cd10225"
                     /db_xref="CDD:212668"
     misc_feature    order(296375..296377,296381..296392,296564..296566,
                     296756..296758,296822..296824,296828..296839,
                     296900..296905,296975..296977,296984..296989,
                     297212..297220,297224..297229,297293..297295,
                     297302..297304)
                     /locus_tag="PC1_0252"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212668"
     misc_feature    order(296375..296377,296822..296824)
                     /locus_tag="PC1_0252"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212668"
     misc_feature    order(296453..296455,296513..296515,296537..296539,
                     296801..296803,296807..296809,296867..296869,
                     296963..296965,296969..296971,297038..297040,
                     297062..297064,297071..297073,297161..297163,
                     297170..297172,297266..297268,297338..297340)
                     /locus_tag="PC1_0252"
                     /note="putative protofilament interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:212668"
     misc_feature    order(296783..296788,296810..296812,297188..297196,
                     297269..297271,297275..297277,297284..297286)
                     /locus_tag="PC1_0252"
                     /note="RodZ interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212668"
     gene            297549..298532
                     /locus_tag="PC1_0253"
                     /db_xref="GeneID:8131166"
     CDS             297549..298532
                     /locus_tag="PC1_0253"
                     /inference="protein motif:TFAM:TIGR00219"
                     /note="TIGRFAM: rod shape-determining protein MreC;
                     PFAM: Rod shape-determining protein MreC;
                     KEGG: eca:ECA0268 cell wall structural complex MreBCD
                     transmembrane component MreC"
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreC"
                     /protein_id="YP_003015848.1"
                     /db_xref="GI:253686658"
                     /db_xref="InterPro:IPR005223"
                     /db_xref="InterPro:IPR007221"
                     /db_xref="GeneID:8131166"
                     /translation="MKPLFSRGPSLQLRLFLAVVTAIVVIVADSRLGSFVKIRTYMDT
                     AVSPFYFLANGPRQVLDNMSASLATREQLGLENTALRQELLMKNSDLLMLGQLKQENA
                     RLRELLGSPLRQDEQKMVTQVMSAGTDPYSDQVVIDKGQTNGVYEGQPVISDKGVVGQ
                     VVAVGQFTSRVLLICDVSHALPIQVLRNDIRVIAAGNGCADDLQLEHLPNNTDIRVGD
                     VLVTSGLGGRFPEGYPVAVVSSVKADTQRAYTIIQARPTAGLQRLRYLLLLWGVENNS
                     NTSLPPAEVHRVANERLMQMMPQVLPSPDDMGPPLPPDTAAPTVEPQRGRQ"
     misc_feature    297561..298382
                     /locus_tag="PC1_0253"
                     /note="rod shape-determining protein MreC; Region: MreC;
                     cl19252"
                     /db_xref="CDD:267605"
     gene            298529..299017
                     /locus_tag="PC1_0254"
                     /db_xref="GeneID:8131167"
     CDS             298529..299017
                     /locus_tag="PC1_0254"
                     /inference="protein motif:TFAM:TIGR03426"
                     /note="TIGRFAM: rod shape-determining protein MreD;
                     PFAM: Rod shape-determining protein MreD;
                     KEGG: eca:ECA0269 rod shape-determining protein MreD"
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreD"
                     /protein_id="YP_003015849.1"
                     /db_xref="GI:253686659"
                     /db_xref="InterPro:IPR007227"
                     /db_xref="GeneID:8131167"
                     /translation="MNRYRRHGNWIIWLSFLIAMVLQIMPWPDEIYMFRPSWLTLFLI
                     YWVMALPHRVNVGTGFILGLIMDLILGSTLGVRALALSIIAYLVAFKFQLFRNMALWQ
                     QALIVMLLSLLMDLTVFWAEFLVINVSFRPETFWNSVVDGVLWPWLFLLMRKIRRQFT
                     VQ"
     misc_feature    298529..299014
                     /locus_tag="PC1_0254"
                     /note="rod shape-determining protein MreD; Provisional;
                     Region: PRK11060"
                     /db_xref="CDD:182936"
     gene            299026..299619
                     /locus_tag="PC1_0255"
                     /db_xref="GeneID:8131168"
     CDS             299026..299619
                     /locus_tag="PC1_0255"
                     /inference="protein motif:TFAM:TIGR00172"
                     /note="TIGRFAM: maf protein;
                     PFAM: Maf family protein;
                     KEGG: eca:ECA0270 Maf-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="maf protein"
                     /protein_id="YP_003015850.1"
                     /db_xref="GI:253686660"
                     /db_xref="InterPro:IPR003697"
                     /db_xref="GeneID:8131168"
                     /translation="MTQLYLASASPRRRELLTQLDIPFAVLNVAVEEQRLPEEAAEVY
                     VRRLAHEKAAAGVAAAPLDLPVLGADTIVVLNGQVLEKPQDEAHAAEMLSQLSGKPHQ
                     VMTAVALADKDDILSCLVITDVVFRPLSQQDIERYIASGEPMDKAGAYGIQGKGGCFV
                     RSLNGSYYAVVGLPLVETHELFSNFAALRSARGKHDC"
     misc_feature    299035..299559
                     /locus_tag="PC1_0255"
                     /note="Nucleotide binding protein Maf. Maf has been
                     implicated in inhibition of septum formation in
                     eukaryotes, bacteria and archaea, but homologs in
                     B.subtilis and S.cerevisiae are nonessential for cell
                     division. Maf has been predicted to be a nucleotide-
                     or...; Region: Maf; cd00555"
                     /db_xref="CDD:238310"
     misc_feature    order(299047..299049,299062..299064,299122..299124,
                     299179..299181,299233..299235,299269..299271)
                     /locus_tag="PC1_0255"
                     /note="active site"
                     /db_xref="CDD:238310"
     misc_feature    order(299161..299163,299368..299382)
                     /locus_tag="PC1_0255"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238310"
     gene            299609..301078
                     /locus_tag="PC1_0256"
                     /db_xref="GeneID:8131169"
     CDS             299609..301078
                     /locus_tag="PC1_0256"
                     /inference="protein motif:TFAM:TIGR00757"
                     /note="KEGG: eca:ECA0271 ribonuclease G;
                     TIGRFAM: ribonuclease, Rne/Rng family;
                     PFAM: RNA binding S1 domain protein;
                     SMART: RNA binding S1 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Rne/Rng family ribonuclease"
                     /protein_id="YP_003015851.1"
                     /db_xref="GI:253686661"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR004659"
                     /db_xref="GeneID:8131169"
                     /translation="MTAELLVNVTPSETRVAYIDGGILQEIHIERDAKRGIVGNIYKG
                     RVSRVLPGMQAAFVDIGLDKAAFLHASDIMPHTECVAGDEQKNFHVRDIAELVRQGQD
                     LMVQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESEAERERLKKTVAE
                     YCDDDGGFIIRTAAEGIGEEELSQDAAFLKRLWGKVMERKKRNQTKCKLYGEVALAQR
                     ILRDFAGAALDRIRIDSRLTYEALLEFTSEYIPEMTRKLEHYAGKQPIFDLFDVENEI
                     QRSLDRKVELKSGGYLIIDQTEAMTTIDINTGAFVGHRNLDETIFNTNTEATQAIARQ
                     LRLRNLGGIIIIDFIDMNNDDHRRRVLHSLEQALSKDRVKTSINGFSQLGLVEMTRKR
                     TRESIEHVLCHECPTCHGRGTVKTVESVCYEIMREIVRVHHAYDTDRFLVYASPAVGE
                     ALKSEESHALAEVEIFVGKQVKVQIEPLYSQEQFDVVMM"
     misc_feature    299609..301075
                     /locus_tag="PC1_0256"
                     /note="ribonuclease G; Provisional; Region: PRK11712"
                     /db_xref="CDD:183285"
     misc_feature    299702..299992
                     /locus_tag="PC1_0256"
                     /note="S1_RNase_E: RNase E and RNase G, S1-like
                     RNA-binding domain. RNase E is an essential
                     endoribonuclease in the processing and degradation of RNA.
                     In addition to its role in mRNA degradation, RNase E has
                     also been implicated in the processing of rRNA, and...;
                     Region: S1_RNase_E; cd04453"
                     /db_xref="CDD:239900"
     misc_feature    order(299735..299737,299900..299902,299912..299914)
                     /locus_tag="PC1_0256"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239900"
     misc_feature    order(299807..299809,299933..299935,299942..299944,
                     299951..299956,299984..299986)
                     /locus_tag="PC1_0256"
                     /note="oligonucleotide binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239900"
     misc_feature    299978..300790
                     /locus_tag="PC1_0256"
                     /note="Ribonuclease E/G family; Region: RNase_E_G;
                     pfam10150"
                     /db_xref="CDD:255792"
     gene            301120..304950
                     /locus_tag="PC1_0257"
                     /db_xref="GeneID:8131170"
     CDS             301120..304950
                     /locus_tag="PC1_0257"
                     /inference="similar to AA sequence:KEGG:ECA0272"
                     /note="KEGG: eca:ECA0272 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015852.1"
                     /db_xref="GI:253686662"
                     /db_xref="InterPro:IPR011836"
                     /db_xref="GeneID:8131170"
                     /translation="MRRLPGIVVITGATLVVMVALLVSGLRLVLPQLDHFRPQLVAWA
                     QSAAGVPLEIGSMTGRWESFGPTLEIEKLRTSLPESDWQVDRITLALDVWQSLLHGRW
                     QFRDLTFHQLKLDINSPFTGQQQDSKLMESGKVSDLFLRQFDHFDLRDSHITFLTPSG
                     SRAELSIPQLTWLNSDKRHRAEGLISLSSFNGQHGVVQMRMDLHDEQGLLSNGTFYLQ
                     ADNIDMKPWLSRWMKNNTGLESADFSLAAWLNVRDGGIHSGDVFLNQGTANWGDGPDA
                     HRLNVDDMTLHVSRQENGWQVDVPELNLATDGTAWPKGRLSALWLPKNEHMLGPDRQE
                     ELRIRASNLALERVSTLLPLLSSTTPALKERWAELQPTGTLNTVAVDIPLQQPERSRF
                     QANWQDVSWKQWKLLPGVDHFSGSARGSAERGQVSVALKQSTLPYVDMFRAPLEIQQA
                     SGTIDWRNDAQGLALWSHGLDVQAKSLWANGDFRYEQPVKQEPKLDILAGIRLTDAAD
                     AWRYYPEQFMGTELVDYLSGALKGGRVDNATLIFAGNPQHFPYTHNEGQFEVWVPVKG
                     ATFEFQPGWPALTPLDINLDFANNGLWMFAPQTWLGKVEGKNISAVIPDYEKEMLLID
                     GELEGPGPEVGNYFNQTPLKSSLGTALDELKIGGPVKGSLHLDIPLVGDDVHASGDIA
                     LNNNSLYIKPLNTTIKNLTGKFRYENGNLRSDTLQANWMNQPMAVNFTTEEQAKAFLV
                     NVGLQGDWQPALLPGLPASASKALSGTAGWKSTVAVNLPHTGKTTYEVDVQADLNKVS
                     SHLPNPLNKPAGESLPLEVKASGDLNGFAIQGRLGKDNRFNSQWLLKGDTVTLARASW
                     QNAATASPALPDDSSLVLDLPSLDAESWLGLLPSLRASASAEGRKAQSSLRFPEAVTL
                     RTPELQLLGQQWHDLEITRKNTLAGSEVKAKGREIDGTVEIPNRGMWRSDINYLYYNP
                     QWKGNEATNPVALAEKKSPLNDPSISFEDWPSLAVNCRQCWIIGQNMGRIQGTLLPEK
                     EKLTLTDGIIDTGKARLTVNGTWQENAEGVRTALKGRLTGDSLEQNANWFGVDSPLKA
                     GSFDVDYDLYWRGTPWAPDIASLSGILHTRIGKGEIAEVGAGQAGQLLRLLSFDALMR
                     KLRFDFSDTFGRGFYFDSIRSTAWIKDGVLHTDDMLIDGLEADIAMKGDLDLAKRQVN
                     MEAVIAPEISATVGVATAFAVNPVIGAAVFAASKVLAPLWNKISLIRYQISGSLDQPK
                     IQEVLREPNKKKGE"
     misc_feature    301852..304947
                     /locus_tag="PC1_0257"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10899"
                     /db_xref="CDD:236789"
     misc_feature    302626..303471
                     /locus_tag="PC1_0257"
                     /note="Protein of unknown function; Region: DUF3971;
                     pfam13116"
                     /db_xref="CDD:257507"
     misc_feature    304174..304905
                     /locus_tag="PC1_0257"
                     /note="AsmA-like C-terminal region; Region: AsmA_2;
                     pfam13502"
                     /db_xref="CDD:257822"
     gene            305007..306452
                     /locus_tag="PC1_0258"
                     /db_xref="GeneID:8131171"
     CDS             305007..306452
                     /locus_tag="PC1_0258"
                     /inference="protein motif:PFAM:PF01523"
                     /note="PFAM: peptidase U62 modulator of DNA gyrase;
                     KEGG: eca:ECA0273 protease TldD"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase U62 modulator of DNA gyrase"
                     /protein_id="YP_003015853.1"
                     /db_xref="GI:253686663"
                     /db_xref="InterPro:IPR002510"
                     /db_xref="GeneID:8131171"
                     /translation="MSLSFVSEQLLTANKLNLDDLAAVLGSLNERRLDYADLYFQSSY
                     HESWVLEDRIIKDGSYNIDQGVGIRAIDGEKTGFAYADQITLNALHQSAQAARSIVRE
                     QGTGTARTLGEVSHRALYPTLNPLDSLTREDKIALLQRADTVARAADARVQEVSASLT
                     GVYELVLVAATDGTLAADVRPLVRLSISVLVEAEGKRERGSSGGGMRGGYDYFWEVAD
                     GEARVDAWAKEAVRMALVNLSAVAAPAGPMPVVLGAGWPGVLLHEAVGHGLEGDFNRR
                     GTSVFSGQMGKLVASELCTVVDDGTLSGRRGSLSMDDEGVPGQYNVLIENGILKGYMQ
                     DKLNARLMGVAPTGNGRRESYAHLPMPRMTNTYMLAGKSTPEEIISSVEYGLYAPNFG
                     GGQVDITSGKFVFSTSEAYLIEKGRITTPVKGATLIGSGIEAMQQISMVGNDLALDKG
                     VGVCGKEGQSLPVGVGQPTLKLESLTVGGTA"
     misc_feature    305007..306449
                     /locus_tag="PC1_0258"
                     /note="protease TldD; Provisional; Region: tldD; PRK10735"
                     /db_xref="CDD:182685"
     gene            complement(306537..307130)
                     /locus_tag="PC1_0259"
                     /db_xref="GeneID:8131172"
     CDS             complement(306537..307130)
                     /locus_tag="PC1_0259"
                     /inference="similar to AA sequence:KEGG:ECA0274"
                     /note="KEGG: eca:ECA0274 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015854.1"
                     /db_xref="GI:253686664"
                     /db_xref="GeneID:8131172"
                     /translation="MKIFKVGDTQSALCNTCQSLETATFQLRDVPFSDNSGVVRQVLV
                     GVCNRCGNVAIIPHQSTPMIKKARDVQRKALESRVPAHMIDILNLASCELGGEPDFIP
                     TLMKYYLHTLAADRAAAQDIPRFLQSDLAKGKSEKRLSLKGRHVATDIDVLKTTTNIS
                     STTDLLKGIVLKIKEDVLVQRDEIHIRQLKSIIAAVS"
     gene            complement(307140..307478)
                     /locus_tag="PC1_0260"
                     /db_xref="GeneID:8131173"
     CDS             complement(307140..307478)
                     /locus_tag="PC1_0260"
                     /inference="similar to AA sequence:KEGG:ECA0275"
                     /note="KEGG: eca:ECA0275 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015855.1"
                     /db_xref="GI:253686665"
                     /db_xref="GeneID:8131173"
                     /translation="MDKVRINSYNIGEGMGFKDAKKQLIVCLQSGTVLHEARGNISTK
                     NLLATGQASITELIDIIYQSSGTSYSSSPHHFAAHIDVHIIRCRHRGISWYIKWYFAE
                     PNCVFISVHH"
     gene            complement(307589..308524)
                     /locus_tag="PC1_0261"
                     /db_xref="GeneID:8131174"
     CDS             complement(307589..308524)
                     /locus_tag="PC1_0261"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: eca:ECA0276 putative DNA-binding transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003015856.1"
                     /db_xref="GI:253686666"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:8131174"
                     /translation="MERLKSMSVFARVVEFGSFTAAARQLQMSVSAVSQTVTKLEDEL
                     QIKLLNRSTRSIGLTEAGKIYYHGCRRMLHEAHEVHEQLYAFNNTPIGTLRIGSSSTM
                     AQNVLSTMTAAMLKEYPGLSVNLVTGIPAPDLIADGLDIVIRVGALQDSSLFSKRLGS
                     MPMVICAAKSYLAQHGTPDKPADMVNFSWLEYSVRPDSEFELIAPEGISTRVTPQGRF
                     VTNDPQTLVRWLKAGAGIAYVPLMWVVDEINRGEIEILFNRYHSDPRPVYALYTRKDN
                     LPLKVQVCINYMTEYFKNVALTYQGYRQDHGEEKK"
     misc_feature    complement(307601..308524)
                     /locus_tag="PC1_0261"
                     /note="transcriptional regulator; Provisional; Region:
                     PRK10632"
                     /db_xref="CDD:182601"
     misc_feature    complement(308336..308515)
                     /locus_tag="PC1_0261"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(307661..308251)
                     /locus_tag="PC1_0261"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(307724..307726,307805..307807,
                     307856..307858,308042..308044,308048..308050,
                     308090..308092,308207..308209,308219..308221))
                     /locus_tag="PC1_0261"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(307829..307831,307838..307843,
                     307862..307876,307961..307963,308144..308164,
                     308168..308170,308180..308182,308189..308194,
                     308198..308203,308213..308218))
                     /locus_tag="PC1_0261"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            308950..309153
                     /locus_tag="PC1_0262"
                     /db_xref="GeneID:8131175"
     CDS             308950..309153
                     /locus_tag="PC1_0262"
                     /inference="protein motif:PFAM:PF07869"
                     /note="PFAM: protein of unknown function DUF1656;
                     KEGG: eca:ECA0277 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015857.1"
                     /db_xref="GI:253686667"
                     /db_xref="InterPro:IPR012451"
                     /db_xref="GeneID:8131175"
                     /translation="MSSLPVMVLFGLSFPPVFFVLLVSLTLFFVVNCLLQPTGIYDFV
                     WHPALFNSALFCCLFYLLFRYGL"
     misc_feature    308950..309150
                     /locus_tag="PC1_0262"
                     /note="efflux system membrane protein; Provisional;
                     Region: PRK11594"
                     /db_xref="CDD:183220"
     gene            309161..310126
                     /locus_tag="PC1_0263"
                     /db_xref="GeneID:8131176"
     CDS             309161..310126
                     /locus_tag="PC1_0263"
                     /inference="protein motif:PFAM:PF00529"
                     /note="PFAM: secretion protein HlyD family protein;
                     KEGG: eca:ECA0278 p-hydroxybenzoic acid efflux subunit
                     AaeA"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD family protein"
                     /protein_id="YP_003015858.1"
                     /db_xref="GI:253686668"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:8131176"
                     /translation="MKAFFLTLFRQQAVLIKKMSRVAITLVIVLCAIVAIFRVWAFYT
                     ESPWTRDAKFTADVVAIAPDVSGLLSDVRVTDNQLVNKGDVLFVIDQPRYHQAVAQAE
                     ADVAYYQALVTEKRRESGRRARLGISAMSQENIDQSSNALETATHQLAKAQVVLSLAQ
                     LELERTVVRAPADGWVTNLHVQSGEFIERGNTAVALVKKDSFYLLAYMEETKLEGVRR
                     GYRAEITPLGSEKIFYGTVDSVAAGVNNSSSSANNKGLANVDSNLEWVRLAQRVPVKI
                     RLDRQMGDLYPAGTTATVVITGEQVNNDKKPSPLIRLLYRLREFG"
     misc_feature    309194..310123
                     /locus_tag="PC1_0263"
                     /note="p-hydroxybenzoic acid efflux subunit AaeA;
                     Provisional; Region: PRK10559"
                     /db_xref="CDD:182548"
     misc_feature    309329..309478
                     /locus_tag="PC1_0263"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    309659..>309892
                     /locus_tag="PC1_0263"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            310138..312126
                     /locus_tag="PC1_0264"
                     /db_xref="GeneID:8131177"
     CDS             310138..312126
                     /locus_tag="PC1_0264"
                     /inference="protein motif:PFAM:PF04632"
                     /note="PFAM: Fusaric acid resistance protein conserved
                     region;
                     KEGG: eca:ECA0279 p-hydroxybenzoic acid efflux subunit
                     AaeB"
                     /codon_start=1
                     /transl_table=11
                     /product="Fusaric acid resistance protein conserved
                     region"
                     /protein_id="YP_003015859.1"
                     /db_xref="GI:253686669"
                     /db_xref="InterPro:IPR006726"
                     /db_xref="GeneID:8131177"
                     /translation="MKTPSLTGPVFFTTPKFARLRFAFKLSFAIVLSLFLGFHLQLET
                     PRWSVLTAAIVAAGPAFAAGGEPFSGAIRHRGMLRVVGTFIGCIGALIIIIATVRAPV
                     VMLMLCCIWAGLCTWVSSLVKVENAYVFGLAGYTTLIIIVSTQGTPLLTPQFAVERCS
                     EIVLGIVCAILADLLFSPRSIKQDVDRSMGELLVDQYRLLQLSMSGAEKETIDAAWHA
                     LVRKTTALSGMRSSLMLESSRWQNSNRRLTSLHTQSLTMITQACETYLVLQDAPTPVK
                     SSLKLVLDQPVESFRDVHCRVKALRHLIAADSRDVPPTLVSWVGAATRYLLLAKGVQT
                     NGRITTIEADVLNSEVEIKAPSAETHHAMINGLRTGVATALGCLFWLSTGWTSGSVCM
                     VMIAVVTSLAMRLPNPQMMAKDFLFGTIYALPLGALMFMFIMPSTQQSMLLLCLSLGA
                     MAFFLGLEVQKRRLGSLGALASTINILVLDNPMTFHISQFLDSAIGQIIGCFLALMVI
                     LLIRDNTKAHTGRTLLNRFVYGAVSALTTNTTRRKENHLPALYQQLFLLLNRFPDDIA
                     KYRLALWLIIMHQRLRTLDIPQNAALSAFHRQIRATAEQVILARRDTTRSRYFTQLLG
                     ELERYQQMLTEQQLPASVTAPVGRLTGILRDYQHALSN"
     misc_feature    310171..312123
                     /locus_tag="PC1_0264"
                     /note="p-hydroxybenzoic acid efflux subunit AaeB;
                     Provisional; Region: PRK10631"
                     /db_xref="CDD:182600"
     misc_feature    310192..312117
                     /locus_tag="PC1_0264"
                     /note="Fusaric acid resistance protein family; Region:
                     FUSC; pfam04632"
                     /db_xref="CDD:252713"
     gene            312266..313720
                     /locus_tag="PC1_0265"
                     /db_xref="GeneID:8131178"
     CDS             312266..313720
                     /locus_tag="PC1_0265"
                     /inference="protein motif:TFAM:TIGR01780"
                     /note="TIGRFAM: succinic semialdehyde dehydrogenase;
                     PFAM: Aldehyde Dehydrogenase;
                     KEGG: eca:ECA0280 succinate-semialdehyde dehydrogenase
                     [NADP+]"
                     /codon_start=1
                     /transl_table=11
                     /product="succinic semialdehyde dehydrogenase"
                     /protein_id="YP_003015860.1"
                     /db_xref="GI:253686670"
                     /db_xref="InterPro:IPR010102"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="GeneID:8131178"
                     /translation="MSGQNLQDHELFKTGYFAAGKWQQGTATFEVVNPATGETIASVA
                     KAGKKETQAAIDAAYAAFPAWKRKTAKERSEILYRWYELILENKRYLAELMTAEQGKP
                     VQEAEGEVVYAASFIQWFAEQGKRANGEIIPSAKPGSKIYATREPVGVVVAITPWNFP
                     LAMLTRKLGPALAAGCTGVIKPANNTPLSAFALLALAQQAGVPDGVLNGVAGDTQAIS
                     DTVMASDKVRKISFTGSTTVGKTLVRNAADTMKKVSMELGGNAPYIVFDDADIQAAVK
                     GAIANRFRNAGQVCVSANRFYIQDGVYDEFVSLLAEEVKRLKVGNGMDDGVVLGPLID
                     DAAVEKVEKHVNDAVEKGGKALVGGQRHKLGHSFFEPTVIVDANEAMLLAQEETFGPV
                     APCFRFKTEEEVIERANNTPFGLAAYFYSQNLQRVFRVAEALESGMVGINECAVSTEL
                     APFGGVKESGLGREGSVLGLDEFLEVKTWHLGGL"
     misc_feature    312356..313699
                     /locus_tag="PC1_0265"
                     /note="Mitochondrial succinate-semialdehyde dehydrogenase
                     and ALDH family members 5A1 and 5F1-like; Region:
                     ALDH_F5_SSADH_GabD; cd07103"
                     /db_xref="CDD:143421"
     misc_feature    order(312470..312472,312497..312499,312620..312622,
                     312629..312634,312638..312664,312680..312688,
                     312701..312703,312947..312949,312983..312985,
                     312995..312997,313004..313006,313175..313177,
                     313187..313189,313325..313327,313529..313531,
                     313535..313540,313550..313552,313556..313558,
                     313565..313567,313571..313591,313607..313609,
                     313616..313621,313637..313639,313652..313654,
                     313688..313699)
                     /locus_tag="PC1_0265"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143421"
     misc_feature    order(312725..312739,312761..312763,312806..312808,
                     312812..312817,312959..312970,312977..312979,
                     312986..312991,313031..313039,313133..313135,
                     313424..313426,313430..313432,313508..313510,
                     313622..313624)
                     /locus_tag="PC1_0265"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143421"
     misc_feature    order(312737..312739,313031..313033,313124..313126,
                     313133..313135)
                     /locus_tag="PC1_0265"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143421"
     gene            complement(313816..314367)
                     /locus_tag="PC1_0266"
                     /db_xref="GeneID:8131179"
     CDS             complement(313816..314367)
                     /locus_tag="PC1_0266"
                     /inference="protein motif:PFAM:PF04751"
                     /note="PFAM: protein of unknown function DUF615;
                     KEGG: eca:ECA0281 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015861.1"
                     /db_xref="GI:253686671"
                     /db_xref="InterPro:IPR006839"
                     /db_xref="GeneID:8131179"
                     /translation="MKQKYEDWLNDVPDNQEDDEDDEIIWVSKSEIKRDAEALKDLGA
                     ELVDLGKNALEKIPLDDDLRAAVELAQRIKKEGRRRQLQLIGKMLRARDPEPIQTALD
                     KLNNRHNQQVALFHKLEQLRDRLIEEGDDVVPDILALYPHADRQQLRSLVRNAQKEKA
                     ANKPPKSARQIFQYLRELAETTD"
     misc_feature    complement(313828..314337)
                     /locus_tag="PC1_0266"
                     /note="hypothetical protein; Provisional; Region:
                     PRK05255"
                     /db_xref="CDD:235377"
     gene            314665..316005
                     /locus_tag="PC1_0267"
                     /db_xref="GeneID:8131180"
     CDS             314665..316005
                     /locus_tag="PC1_0267"
                     /inference="protein motif:PFAM:PF01523"
                     /note="PFAM: peptidase U62 modulator of DNA gyrase;
                     KEGG: eca:ECA0282 peptidase PmbA"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase U62 modulator of DNA gyrase"
                     /protein_id="YP_003015862.1"
                     /db_xref="GI:253686672"
                     /db_xref="InterPro:IPR002000"
                     /db_xref="InterPro:IPR002510"
                     /db_xref="GeneID:8131180"
                     /translation="MTITTQVAEQRKALELAVAQALELARAGSDAAEVAVTKTTGISV
                     STRYGDVENVEFNSDGALGITVYHQQRKGSASSTDLSPDAIARTVQAALDIARYTSVD
                     PFAGPADRDLLAFDAPDLDLFHPTELDADRGIELAARAEQAALQADKRITNTEGGSFN
                     SHYGVKVFGNSHGLLKSYCSSRHSMSSCVIAEVNGDMERDYAYTVGRALDDLLSPEWV
                     GEECARRTLSRLSPRKLPTMQAPVMFSAEVATGLFGHLVGAISGGSVYRKSTFLLDKL
                     GQQILPEWLTIEEQPHLLKGLASTPFDSEGVRTQAREIVKAGVLQTWLMTSYSARKLG
                     MKSTGHAGGIHNWRIAGQGLDFNGMLKQMGKGLLVTELMGQGVSGVTGDYSRGASGFW
                     VENGEIQYPVSEITIAGNLKDMLRNIVTVGNDIETRSNIQCGSVLLPDMKIAGE"
     misc_feature    314665..316002
                     /locus_tag="PC1_0267"
                     /note="peptidase PmbA; Provisional; Region: PRK11040"
                     /db_xref="CDD:182922"
     gene            316445..319624
                     /locus_tag="PC1_0268"
                     /db_xref="GeneID:8131181"
     CDS             316445..319624
                     /locus_tag="PC1_0268"
                     /inference="protein motif:PFAM:PF00067"
                     /note="PFAM: cytochrome P450; FAD-binding domain protein;
                     flavodoxin/nitric oxide synthase; oxidoreductase
                     FAD/NAD(P)-binding domain protein;
                     KEGG: bur:Bcep18194_C6803 cytochrome P450"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="YP_003015863.1"
                     /db_xref="GI:253686673"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR002401"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="GeneID:8131181"
                     /translation="MSGKTAVPQPPIKPVIGNLADVDPRNSIDSLMKLAKTYGPFFKM
                     RIFSDEFYVASSQELVNELSDESFFEKKLSAELLELRYLGGDGLFTAHTHEPNWGKAH
                     RILMPALGPLGVRSMFDKMLDISEQMFLRWERFGPDVDIDVADNMTRLTLDTIALCGF
                     DYRFNSFYRDDLLPFVKAIVGSLKEAGLRVRRPGIVNKLMIPSTRQYRTDKALMYSVV
                     EQLIAARKMDPKASEKNDLLNRMLNGVDPQTGEKLSDENIAHQMLTFLVAGHETTSGM
                     LSFTVYFLLKNPNVLNKARAIVDEVLGDEIPRIEHLAQLRYLEQILMESLRMWPTAGG
                     HVVSPTQDTILAGKYPLTPKDSIVILQPQLHRDVKAWGDDANLFKPERFGPDNAENLL
                     PNSWQPFGSGKRACIGRMFAMQEAQLVLAMMLQRFDFELSDPSYELKIVEHLTIKPDN
                     LKIRIRVRKPSKTLARGVTPKETSNKMAVMPVAKAQHHQDLIPLLVLHGGNTGSSEAF
                     ANRIAADAQRYGFASTLAALDDYAEKLPQTGALIVITASYEGMPPNNARHFVPWVEGL
                     ADDALSGLKFSVFGCGNLQWVRTYQAIPKRVDLALEHAGGERIHERGVADSGGDFFGN
                     FDDWYTKLWPALTTAFGRQGAVAEDATELELEFVHTDRVSTLQIPDMGRGVVVENREL
                     VDMTSPFARSKRHIEIRLPEGMAYRAGDYLAVLPRNSDDQIDRVLRRFGLSPDMMLVI
                     NQAPDVTGLPIGQPISCAELLGNYVELSQPATRAQVAALAAATRCPPEKMELEKLATE
                     HYENDVLAPRLSVLDLLYRFQSCPTDFRRYLTMLPSIKARQYSISSSPAWKPDHVTLT
                     VAVVDSPALSGIGRYKGVASNYLASLKPDDRIAIVVRPSSPFFHLPDDPSIPIILIGA
                     GSGIAPFRGFLQERALQQAAGVRVGPALLFFGTGHPDVDYLYRDELAAWEKSHIVTVL
                     PAFSHQPDGEVTFVQHRVWADRERIKTLFCNGGSLFVCGDGLRMVPEVRDMLLRIYRE
                     ATGSNETDAMLWADKLEREQGRYVVDMFI"
     misc_feature    316466..317737
                     /locus_tag="PC1_0268"
                     /note="Cytochrome P450; Region: p450; cl12078"
                     /db_xref="CDD:264539"
     misc_feature    317882..319612
                     /locus_tag="PC1_0268"
                     /note="Sulfite reductase, alpha subunit (flavoprotein)
                     [Inorganic ion transport and metabolism]; Region: CysJ;
                     COG0369"
                     /db_xref="CDD:223446"
     misc_feature    317930..318292
                     /locus_tag="PC1_0268"
                     /note="Flavodoxin; Region: Flavodoxin_1; pfam00258"
                     /db_xref="CDD:249722"
     misc_feature    318467..319618
                     /locus_tag="PC1_0268"
                     /note="These bifunctional proteins fuse N-terminal
                     cytochrome p450 with a cytochrome p450 reductase (CYPOR).
                     NADPH cytochrome p450 reductase serves as an electron
                     donor in several oxygenase systems and is a component of
                     nitric oxide synthases and methionine...; Region:
                     bifunctional_CYPOR; cd06206"
                     /db_xref="CDD:99802"
     misc_feature    order(318575..318577,318956..318967,319010..319012,
                     319016..319018,319061..319072)
                     /locus_tag="PC1_0268"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99802"
     misc_feature    order(318956..318958,318962..318967)
                     /locus_tag="PC1_0268"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99802"
     misc_feature    order(318965..318967,319472..319474,319610..319612,
                     319616..319618)
                     /locus_tag="PC1_0268"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:99802"
     misc_feature    order(319016..319027,319184..319186,319190..319192,
                     319283..319288,319370..319375,319397..319399,
                     319403..319405,319490..319492)
                     /locus_tag="PC1_0268"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99802"
     misc_feature    order(319061..319063,319070..319072,319079..319081)
                     /locus_tag="PC1_0268"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99802"
     misc_feature    order(319175..319177,319187..319198,319202..319204)
                     /locus_tag="PC1_0268"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99802"
     gene            complement(319764..320174)
                     /locus_tag="PC1_0269"
                     /db_xref="GeneID:8131182"
     CDS             complement(319764..320174)
                     /locus_tag="PC1_0269"
                     /inference="similar to AA sequence:KEGG:ECA0283"
                     /note="KEGG: eca:ECA0283 nucleoside diphosphate kinase
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="GreA/GreB family elongation factor"
                     /protein_id="YP_003015864.1"
                     /db_xref="GI:253686674"
                     /db_xref="GeneID:8131182"
                     /translation="MTKPNLTISELDAERLDMLLEQPAFADSDIAQALNEELDRAEIL
                     PSASIPSHVVTMNSRVRFRDLNTNEEHIRTLVYPAAVKDSQEPLSVMAPLGAALLGMH
                     VGNAITWQLPNGEETRIEVLELLYQPEAAGEYHR"
     misc_feature    complement(319767..320174)
                     /locus_tag="PC1_0269"
                     /note="nucleoside diphosphate kinase regulator;
                     Provisional; Region: PRK05753"
                     /db_xref="CDD:180236"
     misc_feature    complement(320043..320168)
                     /locus_tag="PC1_0269"
                     /note="Rnk N-terminus; Region: Rnk_N; pfam14760"
                     /db_xref="CDD:258897"
     misc_feature    complement(319797..320030)
                     /locus_tag="PC1_0269"
                     /note="Transcription elongation factor, GreA/GreB, C-term;
                     Region: GreA_GreB; pfam01272"
                     /db_xref="CDD:250494"
     gene            complement(320345..320617)
                     /locus_tag="PC1_0270"
                     /db_xref="GeneID:8131183"
     CDS             complement(320345..320617)
                     /locus_tag="PC1_0270"
                     /inference="protein motif:TFAM:TIGR01003"
                     /note="TIGRFAM: phosphocarrier, HPr family;
                     PFAM: phosphoryl transfer system HPr;
                     KEGG: eca:ECA0284 phosphohistidinoprotein-hexose
                     phosphotransferase component of N-regulated PTS system
                     (Npr)"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system, phosphocarrier
                     protein HPr"
                     /protein_id="YP_003015865.1"
                     /db_xref="GI:253686675"
                     /db_xref="InterPro:IPR001020"
                     /db_xref="InterPro:IPR005698"
                     /db_xref="GeneID:8131183"
                     /translation="MTVRQTVEIKNKLGMHARPAMKLFELVQSFDAEVILRNDSGTEA
                     EASSVIAMLMLDSAKGRLIEVEATGPDEAQALAAVIGLFEAGFDED"
     misc_feature    complement(320369..320602)
                     /locus_tag="PC1_0270"
                     /note="Histidine-containing phosphocarrier protein
                     (HPr)-like proteins. HPr is a central component of the
                     bacterial phosphoenolpyruvate sugar phosphotransferase
                     system (PTS). The PTS catalyses the phosphorylation of
                     sugar substrates during their translocation...; Region:
                     PTS-HPr_like; cd00367"
                     /db_xref="CDD:238217"
     misc_feature    complement(320591..320602)
                     /locus_tag="PC1_0270"
                     /note="dimerization domain swap beta strand [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238217"
     misc_feature    complement(order(320456..320461,320468..320479,
                     320534..320536,320543..320545,320555..320560,
                     320564..320569,320573..320575))
                     /locus_tag="PC1_0270"
                     /note="regulatory protein interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238217"
     misc_feature    complement(320570..320572)
                     /locus_tag="PC1_0270"
                     /note="active site"
                     /db_xref="CDD:238217"
     misc_feature    complement(320474..320476)
                     /locus_tag="PC1_0270"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:238217"
     gene            complement(320649..321506)
                     /locus_tag="PC1_0271"
                     /db_xref="GeneID:8131184"
     CDS             complement(320649..321506)
                     /locus_tag="PC1_0271"
                     /inference="protein motif:PFAM:PF03668"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: eca:ECA0285 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015866.1"
                     /db_xref="GI:253686676"
                     /db_xref="InterPro:IPR005337"
                     /db_xref="GeneID:8131184"
                     /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPELANTL
                     AARNISAAVSIDVRNMPESPEIFEHAMEQLPPSFSPQLLFLDADRNTLIRRYSDTRRL
                     HPLSSKNLSLESAIDEESDLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKREREL
                     TMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVASFLDRHTEVHNF
                     IYQTRSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRGKNVQSRH
                     RTLEKRKPS"
     misc_feature    complement(320661..321506)
                     /locus_tag="PC1_0271"
                     /note="P-loop ATPase protein family; Region: ATP_bind_2;
                     pfam03668"
                     /db_xref="CDD:112483"
     gene            complement(321667..322167)
                     /locus_tag="PC1_0272"
                     /db_xref="GeneID:8131185"
     CDS             complement(321667..322167)
                     /locus_tag="PC1_0272"
                     /inference="protein motif:TFAM:TIGR01419"
                     /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
                     PtsN;
                     PFAM: phosphoenolpyruvate-dependent sugar
                     phosphotransferase system EIIA 2;
                     KEGG: eca:ECA0286 sugar-specific enzyme IIA component of
                     PTS"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS IIA-like nitrogen-regulatory protein PtsN"
                     /protein_id="YP_003015867.1"
                     /db_xref="GI:253686677"
                     /db_xref="InterPro:IPR002178"
                     /db_xref="InterPro:IPR006320"
                     /db_xref="GeneID:8131185"
                     /translation="MKASLSENKMNHDPVLQLSTVLRPECTRSTVHCQSKKRALEIIS
                     ELAARQLNIPSQIIFDAILTRERMGSTGIGGGIAIPHGKLEDDNALGAIGVFIQLEQP
                     IAFDAIDNQAVDLLFALLVPAEQCKTHLHTLSLVAKRLADKTVCRRLRAAQSDEELYQ
                     IMTEAG"
     misc_feature    complement(321685..322104)
                     /locus_tag="PC1_0272"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    complement(order(321925..321927,321973..321975))
                     /locus_tag="PC1_0272"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    complement(321925..321927)
                     /locus_tag="PC1_0272"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            complement(322237..322524)
                     /locus_tag="PC1_0273"
                     /db_xref="GeneID:8131186"
     CDS             complement(322237..322524)
                     /locus_tag="PC1_0273"
                     /inference="protein motif:TFAM:TIGR00741"
                     /note="TIGRFAM: ribosomal subunit interface protein;
                     PFAM: sigma 54 modulation protein/ribosomal protein S30EA;
                     KEGG: eca:ECA0287 putative sigma(54) modulation protein"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma 54 modulation protein/ribosomal protein
                     S30EA"
                     /protein_id="YP_003015868.1"
                     /db_xref="GI:253686678"
                     /db_xref="InterPro:IPR003489"
                     /db_xref="GeneID:8131186"
                     /translation="MQLNITGHHIEITEPLRDFVNGKFAKLEQYFDRINQVNVVLRVE
                     KVQQIAEATIHVNGGELHATSEAEDMYAAIDLLIDKLARQLNKHKDKLKQH"
     misc_feature    complement(322252..322521)
                     /locus_tag="PC1_0273"
                     /note="RaiA ('ribosome-associated inhibitor A', also known
                     as Protein Y (PY), YfiA, and SpotY,  is a stress-response
                     protein that binds the ribosomal subunit interface and
                     arrests translation by interfering with aminoacyl-tRNA
                     binding to the ribosomal...; Region: RaiA; cd00552"
                     /db_xref="CDD:238308"
     misc_feature    complement(order(322252..322254,322264..322269,
                     322309..322311,322318..322320,322324..322326,
                     322333..322335,322339..322341,322348..322359,
                     322366..322368,322393..322395,322405..322407,
                     322417..322422,322438..322440,322447..322449,
                     322501..322503,322507..322509,322513..322515))
                     /locus_tag="PC1_0273"
                     /note="30S subunit binding site; other site"
                     /db_xref="CDD:238308"
     gene            complement(322548..323981)
                     /locus_tag="PC1_0274"
                     /db_xref="GeneID:8131187"
     CDS             complement(322548..323981)
                     /locus_tag="PC1_0274"
                     /inference="protein motif:TFAM:TIGR02395"
                     /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN;
                     PFAM: sigma-54 DNA-binding domain protein; sigma-54 factor
                     core-binding region; sigma-54 factor;
                     KEGG: eca:ECA0288 RNA polymerase factor sigma-54"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-54 subunit RpoN"
                     /protein_id="YP_003015869.1"
                     /db_xref="GI:253686679"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR000394"
                     /db_xref="InterPro:IPR007046"
                     /db_xref="InterPro:IPR007634"
                     /db_xref="GeneID:8131187"
                     /translation="MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQEIQQALESN
                     PLLEQTDQHDEIESFEKADSDSLDTGEALEQRDMPEELPIDATWDEIYSAGTPSGTGT
                     DYRDEELPIYQGETTQTLQDYLMWQVELTPFSDTDAAIATSIVDAVDNTGYLTVPLED
                     ILDSIGDDDVTLEEVEAVLKRVQRFDPVGVAARDLRDCLLVQLSQFADSTPRLAEARL
                     IVSDHLDLLANHDFRSLIRVTRLKEEVLKEALALIQSLDPRPGQSINTGESEYVIPDV
                     LVRKVQGIWAVELNTDSIPRLQINQQYAALGNSARNDSDGQFIRSNLQEARWLIKSLE
                     SRNDTLLKVTRCIVEQQQDFFEQGEEFMKPMVLADIAQAVDMHESTISRVTTQKFLHS
                     PRGIFELKYFFSSHVNTDSGGEASSTAIRALVKKLIAAENPVKPLSDSKLTALLSDQG
                     IIVARRTVAKYRESLSIPPSNQRKQLI"
     misc_feature    complement(322554..323981)
                     /locus_tag="PC1_0274"
                     /note="RNA polymerase factor sigma-54; Reviewed; Region:
                     PRK05932"
                     /db_xref="CDD:235648"
     misc_feature    complement(323829..323975)
                     /locus_tag="PC1_0274"
                     /note="Sigma-54 factor, Activator interacting domain
                     (AID); Region: Sigma54_AID; pfam00309"
                     /db_xref="CDD:249760"
     misc_feature    complement(323070..323666)
                     /locus_tag="PC1_0274"
                     /note="Sigma-54 factor, core binding domain; Region:
                     Sigma54_CBD; pfam04963"
                     /db_xref="CDD:252909"
     misc_feature    complement(322557..323033)
                     /locus_tag="PC1_0274"
                     /note="Sigma-54, DNA binding domain; Region: Sigma54_DBD;
                     pfam04552"
                     /db_xref="CDD:252667"
     gene            complement(324031..324756)
                     /locus_tag="PC1_0275"
                     /db_xref="GeneID:8131188"
     CDS             complement(324031..324756)
                     /locus_tag="PC1_0275"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: eca:ECA0289 putative ABC transporter ATP-binding
                     protein YhbG"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_003015870.1"
                     /db_xref="GI:253686680"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8131188"
                     /translation="MATLTAENLAKAYKGRKVVENVSLTVNSGEIVGLLGPNGAGKTT
                     TFYMVVGIVPRDEGRIVIDDDDISLLPLHERALRGIGYLPQEASIFRRLSVYDNLMAV
                     LQIRKDLTTEQQEDRANELMEEFHIIHLRDSLGQSLSGGERRRVEIARALAANPKFIL
                     LDEPFAGVDPISVLDIKKIIEHLRDSGLGVLITDHNVRETLDVCERAYIVSQGNLIAH
                     GSPTDILADEQVKRVYLGEGFRL"
     misc_feature    complement(324034..324756)
                     /locus_tag="PC1_0275"
                     /note="lipopolysaccharide ABC transporter ATP-binding
                     protein; Provisional; Region: PRK10895"
                     /db_xref="CDD:182817"
     misc_feature    complement(324049..324747)
                     /locus_tag="PC1_0275"
                     /note="ATP-binding cassette component of YhbG transport
                     system; Region: ABC_YhbG; cd03218"
                     /db_xref="CDD:213185"
     misc_feature    complement(324628..324651)
                     /locus_tag="PC1_0275"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(order(324172..324174,324268..324273,
                     324502..324504,324625..324633,324637..324642))
                     /locus_tag="PC1_0275"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(324502..324513)
                     /locus_tag="PC1_0275"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(324316..324345)
                     /locus_tag="PC1_0275"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(324268..324285)
                     /locus_tag="PC1_0275"
                     /note="Walker B; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(324250..324261)
                     /locus_tag="PC1_0275"
                     /note="D-loop; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(324166..324186)
                     /locus_tag="PC1_0275"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213185"
     gene            complement(324760..325332)
                     /locus_tag="PC1_0276"
                     /db_xref="GeneID:8131189"
     CDS             complement(324760..325332)
                     /locus_tag="PC1_0276"
                     /inference="protein motif:TFAM:TIGR03002"
                     /note="TIGRFAM: lipopolysaccharide transport periplasmic
                     protein LptA;
                     PFAM: OstA family protein;
                     KEGG: eca:ECA0290 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide transport periplasmic protein
                     LptA"
                     /protein_id="YP_003015871.1"
                     /db_xref="GI:253686681"
                     /db_xref="InterPro:IPR005653"
                     /db_xref="InterPro:IPR014340"
                     /db_xref="GeneID:8131189"
                     /translation="MKSKTNNLMRNTLIASSLFAVSVSAFAVTGDSNQPIRIDSAQQS
                     LDMQGNTVTFTGNVVVKQGTIEVKADKVVVTRPQGTQGSEVVEGYGNPVTFYQMQDNG
                     KPVKGHAQKIRYELAKDLLVLTGNAYLEQQDSNVKGDRITYLVKQQQMEATSEKGKRV
                     TTVLVPSQLQDKENKSQPSRSQQPQPRVTE"
     misc_feature    complement(324802..325323)
                     /locus_tag="PC1_0276"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG1934"
                     /db_xref="CDD:224845"
     misc_feature    complement(324784..325320)
                     /locus_tag="PC1_0276"
                     /note="lipopolysaccharide transport periplasmic protein
                     LptA; Provisional; Region: PRK10894"
                     /db_xref="CDD:182816"
     gene            complement(325313..325879)
                     /locus_tag="PC1_0277"
                     /db_xref="GeneID:8131190"
     CDS             complement(325313..325879)
                     /locus_tag="PC1_0277"
                     /inference="protein motif:PFAM:PF06835"
                     /note="PFAM: protein of unknown function DUF1239;
                     KEGG: eca:ECA0291 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015872.1"
                     /db_xref="GI:253686682"
                     /db_xref="InterPro:IPR010664"
                     /db_xref="GeneID:8131190"
                     /translation="MSKTKRWLTAFLALLVLILIGWNIADDDTVAAPDANDPAVPVYT
                     SEKTNTQVYSPAGKLSYRLISEKAEYFNDEQLSWFTAPVATLFNEQGTATWSVRADRA
                     KLTKDKMLYLYGHVEVNSLTKDAQLQRITTNNAQVNLVTQDVSSDDEVTLYGTSFTSS
                     GMKMRGNLRNKTAELIEKVKTSYEIQNQ"
     misc_feature    complement(325316..325879)
                     /locus_tag="PC1_0277"
                     /note="lipopolysaccharide exporter periplasmic protein;
                     Provisional; Region: PRK10893"
                     /db_xref="CDD:236788"
     gene            complement(325876..326442)
                     /locus_tag="PC1_0278"
                     /db_xref="GeneID:8131191"
     CDS             complement(325876..326442)
                     /locus_tag="PC1_0278"
                     /EC_number="3.1.3.45"
                     /inference="protein motif:TFAM:TIGR01670"
                     /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
                     phosphatase, YrbI family; hydrolase, HAD-superfamily,
                     subfamily IIIA;
                     KEGG: eca:ECA0292 3-deoxy-D-manno-octulosonate 8-phosphate
                     phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonate 8-phosphate
                     phosphatase"
                     /protein_id="YP_003015873.1"
                     /db_xref="GI:253686683"
                     /db_xref="InterPro:IPR006549"
                     /db_xref="InterPro:IPR010023"
                     /db_xref="GeneID:8131191"
                     /translation="MSEVRAQTDTCYGPVDQQVLDKAREVRLLICDVDGVMSDGLIYM
                     GNHGEELKAFNVRDGYGIRCLLTSGIEVAIITGRSAKLLEDRCKTLGINHLYQGQSDK
                     VLAFNDLLDKLSVTANQVAYIGDDMIDWPVMAQVGLSVAVADAHPLLLPRADYVTRIA
                     GGRGAVRELCDLILFSQDKLEHAKGLSI"
     misc_feature    complement(325879..326427)
                     /locus_tag="PC1_0278"
                     /note="3-deoxy-D-manno-octulosonate 8-phosphate
                     phosphatase; Provisional; Region: PRK09484"
                     /db_xref="CDD:181898"
     gene            complement(326461..327552)
                     /locus_tag="PC1_0279"
                     /db_xref="GeneID:8131192"
     CDS             complement(326461..327552)
                     /locus_tag="PC1_0279"
                     /EC_number="5.3.1.13"
                     /inference="protein motif:TFAM:TIGR00393"
                     /note="KEGG: eca:ECA0293 D-arabinose 5-phosphate
                     isomerase;
                     TIGRFAM: KpsF/GutQ family protein;
                     PFAM: sugar isomerase (SIS); CBS domain containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="KpsF/GutQ family protein"
                     /protein_id="YP_003015874.1"
                     /db_xref="GI:253686684"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="InterPro:IPR004800"
                     /db_xref="GeneID:8131192"
                     /translation="MSQFEQDAHLKQQSDRALSDHATQADHAPQADHTRQKSHELPAD
                     FDFQQAGKQVISIERDGLAQLDQYIDDNFTLACKKIFDCQGKVVVMGMGKSGHIGCKM
                     AATFASTGTPAFFVHPGEASHGDLGMVTPHDIVIAISNSGESHEILSLIPVLKRQKVF
                     LICMTSAPESTMGKAADIHLCVHVPQEACPLGLAPTSSTTATLVMGDALAVALLQARG
                     FTAEDFALSHPGGALGRKLLLRVSDIMHSGDEIPHVPHDASLRDALVEITRKNLGMTV
                     ICEADMKIQGIFTDGDLRRIFDMNIDLNSARIADVMTAGGIRVAPQTLAVDALNLMQS
                     RHITSVLVAENDRLVGIVHMHDMLRAGVV"
     misc_feature    complement(326464..327435)
                     /locus_tag="PC1_0279"
                     /note="D-arabinose 5-phosphate isomerase; Provisional;
                     Region: PRK10892"
                     /db_xref="CDD:182814"
     misc_feature    complement(326917..327300)
                     /locus_tag="PC1_0279"
                     /note="KpsF-like protein. KpsF is an arabinose-5-phosphate
                     isomerase which contains SIS (Sugar ISomerase) domains.
                     SIS domains are found in many phosphosugar isomerases and
                     phosphosugar binding proteins. KpsF catalyzes the
                     reversible reaction of ribulose...; Region: SIS_Kpsf;
                     cd05014"
                     /db_xref="CDD:240145"
     misc_feature    complement(order(327136..327138,327268..327270))
                     /locus_tag="PC1_0279"
                     /note="putative active site [active]"
                     /db_xref="CDD:240145"
     misc_feature    complement(326473..326811)
                     /locus_tag="PC1_0279"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with KpsF/GutQ domains in the API [A5P (D-arabinose
                     5-phosphate) isomerase] protein.  These APIs catalyze the
                     conversion of the pentose pathway...; Region:
                     CBS_pair_KpsF_GutQ_assoc; cd04604"
                     /db_xref="CDD:239977"
     gene            complement(327593..328558)
                     /locus_tag="PC1_0280"
                     /db_xref="GeneID:8131193"
     CDS             complement(327593..328558)
                     /locus_tag="PC1_0280"
                     /inference="protein motif:TFAM:TIGR00367"
                     /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family;
                     PFAM: sodium/calcium exchanger membrane region;
                     KEGG: eca:ECA0294 putative calcium/sodium:proton
                     antiporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/Ca+ antiporter, CaCA family"
                     /protein_id="YP_003015875.1"
                     /db_xref="GI:253686685"
                     /db_xref="InterPro:IPR004481"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="GeneID:8131193"
                     /translation="MLFATLLLFVGLLLLVYGADRLVYGAAVLARSLGLPPFVIGITI
                     VGFGTSLPELIVSVTAALNDQNDMAVGNVIGSNIANILLILGSAALIRPLTVHSAILR
                     RELPLMLSVTLLCGVLLHDSYLSRADGMMLLFAAILCLVLILRMAQQAQREGGDSLTR
                     EQLAELPQDDSNQMVAVLWLILGMIILPMAARMVVDNATVIARYFDVSELTIGLTILA
                     IGTSLPELATAIVGTLKKEDDIALGNLIGSNIFNIAIVLGVPALLSPGALNPQVFQRD
                     YWVMLAASVLLTALCLSKKRRIGQGAGALLCCAFIAYLTVLFCFS"
     misc_feature    complement(327596..328558)
                     /locus_tag="PC1_0280"
                     /note="putative calcium/sodium:proton antiporter;
                     Provisional; Region: PRK10734"
                     /db_xref="CDD:182684"
     misc_feature    complement(328130..328510)
                     /locus_tag="PC1_0280"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     misc_feature    complement(327608..328006)
                     /locus_tag="PC1_0280"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     gene            328860..329672
                     /locus_tag="PC1_0281"
                     /db_xref="GeneID:8131194"
     CDS             328860..329672
                     /locus_tag="PC1_0281"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: eca:ECA0295 putative ABC transporter ATP-binding
                     protein YrbF"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="YP_003015876.1"
                     /db_xref="GI:253686686"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8131194"
                     /translation="MHHEATNLVEIRGLSFRRGEREIFTDITLNVPKGKVTAIMGPSG
                     IGKTTLLRLIGGQLQPDSGEIWFDGENIPRLSRSELYNARKKMSMLFQSGALFTDLNV
                     FDNVAWPLREHTRLPESLLRSIVMMKLEAVGLRGAAELMPAELSGGMARRAALARAIA
                     LDPQLIMFDEPFVGQDPITLGTLVKLIDELNHALGVTCIVVSHDVPEVMSIADYAYIV
                     ADKRVVAEGTADQLRANNDPQVRQFLDGIADGPVPFRFPAGDYKTSLLGSGG"
     misc_feature    328863..329669
                     /locus_tag="PC1_0281"
                     /note="putative ABC transporter ATP-binding protein YrbF;
                     Provisional; Region: PRK11831"
                     /db_xref="CDD:236997"
     misc_feature    328884..329588
                     /locus_tag="PC1_0281"
                     /note="ATP-binding cassette transport system involved in
                     resistant to organic solvents; Region:
                     ABC_Org_Solvent_Resistant; cd03261"
                     /db_xref="CDD:213228"
     misc_feature    328980..329003
                     /locus_tag="PC1_0281"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213228"
     misc_feature    order(328989..328994,328998..329006,329133..329135,
                     329364..329369,329466..329468)
                     /locus_tag="PC1_0281"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213228"
     misc_feature    329124..329135
                     /locus_tag="PC1_0281"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213228"
     misc_feature    329292..329321
                     /locus_tag="PC1_0281"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213228"
     misc_feature    329352..329369
                     /locus_tag="PC1_0281"
                     /note="Walker B; other site"
                     /db_xref="CDD:213228"
     misc_feature    329376..329387
                     /locus_tag="PC1_0281"
                     /note="D-loop; other site"
                     /db_xref="CDD:213228"
     misc_feature    329454..329474
                     /locus_tag="PC1_0281"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213228"
     gene            329680..330462
                     /locus_tag="PC1_0282"
                     /db_xref="GeneID:8131195"
     CDS             329680..330462
                     /locus_tag="PC1_0282"
                     /inference="protein motif:PFAM:PF02405"
                     /note="PFAM: protein of unknown function DUF140;
                     KEGG: eca:ECA0296 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015877.1"
                     /db_xref="GI:253686687"
                     /db_xref="InterPro:IPR003453"
                     /db_xref="GeneID:8131195"
                     /translation="MLLRTLASLGRQGISTSAAFGRAGLMLFNALVGKPEFRKQWPLL
                     VKQLYSVGVQSLLIIMVSGLFIGMVLGLQGYIVLTTYSAEASLGMMVALSLLRELGPV
                     VTALLFAGRAGSALTAEIGLMKATEQLSSMEMMAVDPLRRVVAPRFWAGLISMPLLAV
                     IFVAVGIWGGALVGVDWKGIDSGFFWSAMQGAVDWRQDVLNCVIKSVVFAITVTWIAL
                     FNGYDAIPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFGN"
     misc_feature    329695..330459
                     /locus_tag="PC1_0282"
                     /note="conserved hypothetical integral membrane protein;
                     Region: TIGR00056"
                     /db_xref="CDD:129166"
     gene            330467..331033
                     /locus_tag="PC1_0283"
                     /db_xref="GeneID:8131196"
     CDS             330467..331033
                     /locus_tag="PC1_0283"
                     /inference="protein motif:PFAM:PF02470"
                     /note="PFAM: Mammalian cell entry related domain protein;
                     KEGG: eca:ECA0297 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="mammalian cell entry related domain-containing
                     protein"
                     /protein_id="YP_003015878.1"
                     /db_xref="GI:253686688"
                     /db_xref="InterPro:IPR003399"
                     /db_xref="GeneID:8131196"
                     /translation="MQTKKTEVWVGVFMLIALAAILFLCLKVADLKSIGSEPTYRLYA
                     TFDNIGGLKARSPIRIGGVVIGRVADISLDEKTYLPRVAMDIQQRYDHIPDTSSLAIR
                     TSGLLGEQYLSLNIGFEDEDMGTTILKDGGVIQDTKSAMVLEDLIGQFLYKSGGNSED
                     NAGQSGTEPGADPAATSEHHNEPVPSHP"
     misc_feature    330467..>330970
                     /locus_tag="PC1_0283"
                     /note="ABC-type transport system involved in resistance to
                     organic solvents, periplasmic component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: Ttg2C; COG1463"
                     /db_xref="CDD:224380"
     misc_feature    330578..330811
                     /locus_tag="PC1_0283"
                     /note="mce related protein; Region: MCE; pfam02470"
                     /db_xref="CDD:251316"
     gene            331046..331675
                     /locus_tag="PC1_0284"
                     /db_xref="GeneID:8131197"
     CDS             331046..331675
                     /locus_tag="PC1_0284"
                     /inference="protein motif:PFAM:PF05494"
                     /note="PFAM: toluene tolerance family protein;
                     KEGG: eca:ECA0298 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="toluene tolerance family protein"
                     /protein_id="YP_003015879.1"
                     /db_xref="GI:253686689"
                     /db_xref="InterPro:IPR008869"
                     /db_xref="GeneID:8131197"
                     /translation="MFKRLLMVALLVVAPLANAADQTNPYRLMNEAAEKTFDRLKSEQ
                     PKIKQSPDYLRTVVREELLPYVQVRYAGALVLGRYYKDATPAQRDAYFKAFEAYLEQA
                     YGQALAMYNGQTYQIAPEQPLGNADIISIRVTIIDNGGRPPVRLDFQWRKNSKTGNWQ
                     AYDMIAEGVSMITTKQNEWATILRQKGVDGLTQQLESSAKQTITLDQKK"
     misc_feature    331046..331672
                     /locus_tag="PC1_0284"
                     /note="ABC transporter periplasmic binding protein MlaC;
                     Provisional; Region: PRK15117"
                     /db_xref="CDD:237912"
     gene            331683..331979
                     /locus_tag="PC1_0285"
                     /db_xref="GeneID:8131198"
     CDS             331683..331979
                     /locus_tag="PC1_0285"
                     /inference="similar to AA sequence:KEGG:ECA0299"
                     /note="KEGG: eca:ECA0299 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015880.1"
                     /db_xref="GI:253686690"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="GeneID:8131198"
                     /translation="MNMANALNWQAQDDTLALTGDLDRETLLPFWQQRESLLMGKTVL
                     DVSGLNRVDSAGLALLMHVYQQPSSGREITIVGASDRLKTLIALYNLNEIIPVS"
     misc_feature    331725..331973
                     /locus_tag="PC1_0285"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist) domain of anti-anti-sigma factors, key
                     regulators of anti-sigma factors by phosphorylation;
                     Region: STAS_anti-anti-sigma_factors; cd07043"
                     /db_xref="CDD:132914"
     misc_feature    order(331743..331745,331749..331757,331773..331775,
                     331833..331835,331839..331847,331851..331859,
                     331866..331871,331932..331934,331944..331949,
                     331953..331955)
                     /locus_tag="PC1_0285"
                     /note="anti sigma factor interaction site; other site"
                     /db_xref="CDD:132914"
     misc_feature    331842..331844
                     /locus_tag="PC1_0285"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:132914"
     gene            332114..332368
                     /locus_tag="PC1_0286"
                     /db_xref="GeneID:8131199"
     CDS             332114..332368
                     /locus_tag="PC1_0286"
                     /inference="protein motif:PFAM:PF01722"
                     /note="PFAM: BolA family protein;
                     KEGG: eca:ECA0300 putative BolA family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="BolA family protein"
                     /protein_id="YP_003015881.1"
                     /db_xref="GI:253686691"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="GeneID:8131199"
                     /translation="MENNEIKDVLMNALALEEAHVSGDGSHFQVIVVGGLFAGMSRVK
                     KQQAVYAPLMEYIADNRIHALSIKAYTPEEWQRDRKLNGF"
     misc_feature    332114..332353
                     /locus_tag="PC1_0286"
                     /note="Predicted transcriptional regulator, BolA
                     superfamily [Transcription]; Region: COG5007"
                     /db_xref="CDD:227340"
     gene            332451..333713
                     /locus_tag="PC1_0287"
                     /db_xref="GeneID:8131200"
     CDS             332451..333713
                     /locus_tag="PC1_0287"
                     /inference="protein motif:TFAM:TIGR01072"
                     /note="TIGRFAM: UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase;
                     PFAM: EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase);
                     KEGG: eca:ECA0301 UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="YP_003015882.1"
                     /db_xref="GI:253686692"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR005750"
                     /db_xref="GeneID:8131200"
                     /translation="MDKFRVQGPTRLAGEVTISGAKNAALPILFAALLAEEPVEIQNV
                     PKLRDIDTTMKLLGQLGARVERNGSVHVDASNVNVFCAPYDLVKTMRASIWALGPLVA
                     RFGQGQVSLPGGCAIGARPVDLHIYGLEQLGAQIVLEEGYVKATVDGRLKGAHIVMDK
                     VSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLNTLGAKISGAGSDKITIEGV
                     ARLGGGVYRVVPDRIETGTFLVAAAVSRGQIICRNTRPDTLDAVLAKLREAGAEIEIG
                     EDWISLDMHGKRPKAVTVRTSPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMH
                     VPELIRMGAQAEIESNTVICHGVDKLSGAQVMATDLRASASLVLAGCIAEGVTIVDRI
                     YHIDRGYDRIEDKLRALGANIERVKEHE"
     misc_feature    332466..333668
                     /locus_tag="PC1_0287"
                     /note="EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase); Region: EPSP_synthase;
                     pfam00275"
                     /db_xref="CDD:249736"
     misc_feature    332484..333677
                     /locus_tag="PC1_0287"
                     /note="UDP-N-acetylglucosamine enolpyruvyl transferase
                     catalyzes enolpyruvyl transfer as part of the first step
                     in the biosynthesis of peptidoglycan, a component of the
                     bacterial cell wall. The reaction is phosphoenolpyruvate +
                     UDP-N-acetyl-D-glucosamine =...; Region: UdpNAET; cd01555"
                     /db_xref="CDD:238796"
     misc_feature    order(332502..332513,333132..333143)
                     /locus_tag="PC1_0287"
                     /note="hinge; other site"
                     /db_xref="CDD:238796"
     misc_feature    order(332517..332519,332721..332723,332733..332735,
                     332808..332825,332928..332930,332937..332942,
                     333363..333365)
                     /locus_tag="PC1_0287"
                     /note="active site"
                     /db_xref="CDD:238796"
     gene            complement(333821..334933)
                     /locus_tag="PC1_0288"
                     /db_xref="GeneID:8131201"
     CDS             complement(333821..334933)
                     /locus_tag="PC1_0288"
                     /inference="protein motif:TFAM:TIGR02038"
                     /note="KEGG: eca:ECA0302 serine endoprotease;
                     TIGRFAM: periplasmic serine protease DegS;
                     PFAM: peptidase S1 and S6 chymotrypsin/Hap; PDZ/DHR/GLGF
                     domain protein;
                     SMART: PDZ/DHR/GLGF domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic serine protease DegS"
                     /protein_id="YP_003015883.1"
                     /db_xref="GI:253686693"
                     /db_xref="InterPro:IPR001254"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001940"
                     /db_xref="InterPro:IPR011783"
                     /db_xref="GeneID:8131201"
                     /translation="MLAKLLRSALFGALVAGIILAILPFIGSGTSFLKSSDRQTDGSP
                     ISYHQGVSRAAPAVVNIYNRVANQEKPSEVAIHPLGSGVIMNEKGYILTNKHVINNVQ
                     QIQIELSDGRLYEARVIGSDSLTDLAVLQIDGVNLPVIPINADRIPHVGDVVMAIGNP
                     YNLGQTITQGIISATGRVSLSAYGQQRSQVGRQNLLQTDASINHGNSGGALVNTLGEL
                     VGINTLSFDKSSNGETPEGISFAIPVALATKVMGKLIRDGRVVRGYIGVNGVQIENIE
                     NSTLANNRGVQGRLSGILVQTIDPGGPADKAGIRVEDVIVSVNNKPARSIIETMEQVS
                     EIHPGTVIPVTIERNNDNNDTKQITLQMTIQEFPTQ"
     misc_feature    complement(333824..334933)
                     /locus_tag="PC1_0288"
                     /note="serine endoprotease; Provisional; Region: PRK10898"
                     /db_xref="CDD:182820"
     misc_feature    complement(334271..334696)
                     /locus_tag="PC1_0288"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    complement(333884..334138)
                     /locus_tag="PC1_0288"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(333944..333949,333956..333961,
                     334118..334120,334124..334135))
                     /locus_tag="PC1_0288"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     gene            complement(335148..336518)
                     /locus_tag="PC1_0289"
                     /db_xref="GeneID:8131202"
     CDS             complement(335148..336518)
                     /locus_tag="PC1_0289"
                     /EC_number="3.4.21.108"
                     /inference="protein motif:TFAM:TIGR02037"
                     /note="KEGG: eca:ECA0303 exported protease;
                     TIGRFAM: protease Do;
                     PFAM: peptidase S1 and S6 chymotrypsin/Hap; PDZ/DHR/GLGF
                     domain protein;
                     SMART: PDZ/DHR/GLGF domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protease Do"
                     /protein_id="YP_003015884.1"
                     /db_xref="GI:253686694"
                     /db_xref="InterPro:IPR001254"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001940"
                     /db_xref="InterPro:IPR011782"
                     /db_xref="GeneID:8131202"
                     /translation="MKKTSLLFSALAMSIGLTLSTLPVANAALPAVVQGQQTPSLAPM
                     LEKVLPAVVSVHVEGTQVQRQRVPEEFKFFFGPNFPTDKQSSRPFEGLGSGVIIDAAK
                     GYVLTNNHVINNADKIRVQLNDGREYEAKLIGRDEQTDIALLQLNDAKNLVAVKMADS
                     DQLRVGDFAVAVGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGNSGGA
                     LVNLNGELIGINTAILAPGGGNIGIGFAIPSNMAQNLAQQLVEFGEVKRGLLGIKGSE
                     MTSEMAKAFNVDAQRGAFVSEVLPKSAAAKAGIKAGDVLTTLDGKPISSFAELRAKVG
                     TTAPGKTVKIGLLRDGKPQEVSVVLDNSSSASTSAETLSPSLQGASLTNGQLKDGSKG
                     VQIDNVAKDTPAAQVGLQKGDIIIGVNRERIENITQLRKLLEAKPSVLALNIVRGEET
                     IYLLLR"
     misc_feature    complement(335151..336518)
                     /locus_tag="PC1_0289"
                     /note="serine endoprotease; Provisional; Region: PRK10139"
                     /db_xref="CDD:182262"
     misc_feature    complement(335832..336242)
                     /locus_tag="PC1_0289"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    complement(335448..335717)
                     /locus_tag="PC1_0289"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(335529..335534,335541..335546,
                     335697..335699,335703..335714))
                     /locus_tag="PC1_0289"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     misc_feature    complement(335160..335363)
                     /locus_tag="PC1_0289"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     gene            complement(336794..337198)
                     /locus_tag="PC1_0290"
                     /db_xref="GeneID:8131203"
     CDS             complement(336794..337198)
                     /locus_tag="PC1_0290"
                     /inference="protein motif:PFAM:PF06295"
                     /note="PFAM: protein of unknown function DUF1043;
                     KEGG: eca:ECA0304 cytochrome d ubiquinol oxidase subunit
                     III"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015885.1"
                     /db_xref="GI:253686695"
                     /db_xref="InterPro:IPR009386"
                     /db_xref="GeneID:8131203"
                     /translation="MTWEYALIGLVVGIIIGAVAMRFGNRKLRQQQVLQNELEKSKTE
                     LEDYRQELVGHFARSAELLDNMADDYRQLYQHMAKSSNNLLPNVPGQDNPFKYRLTES
                     EADNDQAPVNMPPRDYSDGASGLLRGERPIRK"
     misc_feature    complement(336797..337198)
                     /locus_tag="PC1_0290"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11677"
                     /db_xref="CDD:236953"
     gene            337414..338565
                     /locus_tag="PC1_0291"
                     /db_xref="GeneID:8131204"
     CDS             337414..338565
                     /locus_tag="PC1_0291"
                     /inference="protein motif:PFAM:PF03969"
                     /note="PFAM: AFG1-family ATPase;
                     KEGG: eca:ECA0305 putative ATP/GTP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="AFG1-family ATPase"
                     /protein_id="YP_003015886.1"
                     /db_xref="GI:253686696"
                     /db_xref="InterPro:IPR005654"
                     /db_xref="GeneID:8131204"
                     /translation="MATPQTTRQQTTPLALYQQALSAGEYQPDEVQRQTVVRLEAIHQ
                     ALCERAADDNAGASGRVGKWRSWLGLREKRESAPVQGLYMWGGVGRGKTWLMDMFFHS
                     LPAERKMRLHFHRFMLRVHEELNQFQGQENPLEKVADGFKAETDVLCFDEFFVSDITD
                     AMLLAELLRALFARGIALVATSNIPPDDLYRNGLQRARFLPAIELIKQHCEVRNVDAG
                     IDYRLRTLTQAHLYLSPLNEDTEATMQQMFTRLTGKRWQTPGPVLEINHRPLATLGVS
                     EGVLAVDFHTLCTEARSQNDYIALSRLYHTMLLHNVTVMETKEENTARRFLALVDECY
                     ERRIKLIISAQASMFEIYQGEHLKFEYQRCLSRLQEMQSEEYLRQPHLA"
     misc_feature    337453..338559
                     /locus_tag="PC1_0291"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG1485"
                     /db_xref="CDD:224402"
     gene            338803..339231
                     /locus_tag="PC1_0292"
                     /db_xref="GeneID:8131205"
     CDS             338803..339231
                     /locus_tag="PC1_0292"
                     /inference="protein motif:TFAM:TIGR01066"
                     /note="TIGRFAM: ribosomal protein L13;
                     PFAM: ribosomal protein L13;
                     KEGG: eca:ECA0306 50S ribosomal protein L13"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="YP_003015887.1"
                     /db_xref="GI:253686697"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR005823"
                     /db_xref="GeneID:8131205"
                     /translation="MKTFTAKPETVKRDWYVVDANGKTLGRLATELARRLRGKHKAEY
                     TPHVDTGDYIIVLNADKVAVTGNKRNDKIYYHHTGHIGGIKQATFEEMIARRPERVIE
                     IAVKGMLPKGPLGRAMFRKLKVYAGTEHNHAAQQPQVLDI"
     misc_feature    338845..339183
                     /locus_tag="PC1_0292"
                     /note="Ribosomal protein L13.  Protein L13, a large
                     ribosomal subunit protein, is one of five proteins
                     required for an early folding intermediate of 23S rRNA in
                     the assembly of the large subunit. L13 is situated on the
                     bottom of the large subunit, near the...; Region:
                     Ribosomal_L13; cd00392"
                     /db_xref="CDD:238230"
     misc_feature    order(338872..338874,338878..338883,338890..338892,
                     338899..338901,338911..338913,338995..338997,
                     339001..339003,339085..339090,339106..339114,
                     339118..339126,339130..339138,339142..339144,
                     339148..339150,339160..339162,339169..339174)
                     /locus_tag="PC1_0292"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238230"
     misc_feature    339088..339090
                     /locus_tag="PC1_0292"
                     /note="L3 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238230"
     gene            339247..339639
                     /locus_tag="PC1_0293"
                     /db_xref="GeneID:8131206"
     CDS             339247..339639
                     /locus_tag="PC1_0293"
                     /inference="protein motif:PFAM:PF00380"
                     /note="PFAM: ribosomal protein S9;
                     KEGG: set:SEN3177 30S ribosomal subunit protein S9"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="YP_003015888.1"
                     /db_xref="GI:253686698"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="GeneID:8131206"
                     /translation="MAENQYYGTGRRKSSAARVFIKPGNGNIVINQRSLEQYFGRETA
                     RMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAG
                     FVTRDARQVERKKVGLRKARRRPQFSKR"
     misc_feature    339247..339636
                     /locus_tag="PC1_0293"
                     /note="30S ribosomal protein S9; Reviewed; Region: rpsI;
                     PRK00132"
                     /db_xref="CDD:178888"
     gene            339970..340611
                     /locus_tag="PC1_0294"
                     /db_xref="GeneID:8131207"
     CDS             339970..340611
                     /locus_tag="PC1_0294"
                     /inference="protein motif:PFAM:PF00043"
                     /note="PFAM: Glutathione S-transferase domain;
                     KEGG: eca:ECA0308 stringent starvation protein A"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase domain-containing
                     protein"
                     /protein_id="YP_003015889.1"
                     /db_xref="GI:253686699"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="GeneID:8131207"
                     /translation="MAVAANKRSVMTLFSGPSDIFSHQVRIVLAEKGVSVEIEQVDMD
                     NLPQDLIDLNPYGSVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGNSRLM
                     MHRIESDWYSLLKKITHGSAQEADAARKQLREELLAIAPVFNEAPYFMSEEFSLVDCY
                     LAPLLWRLPQLGIELSGSGAKELKGYMTRVFERDAFLASLTEVEREMRLQTRG"
     misc_feature    339970..340596
                     /locus_tag="PC1_0294"
                     /note="stringent starvation protein A; Provisional;
                     Region: sspA; PRK09481"
                     /db_xref="CDD:236537"
     misc_feature    340000..340218
                     /locus_tag="PC1_0294"
                     /note="GST_N family, Stringent starvation protein A (SspA)
                     subfamily; SspA is a RNA polymerase (RNAP)-associated
                     protein required for the lytic development of phage P1 and
                     for stationary phase-induced acid tolerance of E. coli. It
                     is implicated in survival...; Region: GST_N_SspA; cd03059"
                     /db_xref="CDD:239357"
     misc_feature    order(340018..340023,340030..340032,340036..340041,
                     340045..340050,340057..340062,340186..340188,
                     340195..340200)
                     /locus_tag="PC1_0294"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239357"
     misc_feature    order(340030..340032,340141..340149,340180..340185)
                     /locus_tag="PC1_0294"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239357"
     misc_feature    order(340135..340137,340168..340173,340186..340188,
                     340198..340200,340210..340212)
                     /locus_tag="PC1_0294"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239357"
     misc_feature    340246..340569
                     /locus_tag="PC1_0294"
                     /note="C-terminal, alpha helical domain of Stringent
                     starvation protein A; Region: GST_C_SspA; cd03186"
                     /db_xref="CDD:198295"
     misc_feature    order(340255..340257,340261..340263,340267..340272,
                     340282..340284,340294..340296)
                     /locus_tag="PC1_0294"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198295"
     misc_feature    order(340267..340269,340300..340302,340444..340449,
                     340456..340458,340468..340470,340546..340548,
                     340552..340554,340564..340566)
                     /locus_tag="PC1_0294"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198295"
     gene            340617..341120
                     /locus_tag="PC1_0295"
                     /db_xref="GeneID:8131208"
     CDS             340617..341120
                     /locus_tag="PC1_0295"
                     /inference="protein motif:PFAM:PF04386"
                     /note="PFAM: Stringent starvation protein B;
                     KEGG: eca:ECA0309 ClpXP protease specificity-enhancing
                     factor"
                     /codon_start=1
                     /transl_table=11
                     /product="Stringent starvation protein B"
                     /protein_id="YP_003015890.1"
                     /db_xref="GI:253686700"
                     /db_xref="InterPro:IPR007481"
                     /db_xref="GeneID:8131208"
                     /translation="MALSQLSPRRPYLLRAFYDWLLDNQLTPHLVVDVTLPGVMVPME
                     FARDGQIVLNIAPRAVGGLELADDSVRFNARFGGVPRQVYVPMAAVMAIYARENGAGT
                     MFEPEPAYEESAGEFEDFQEGAPSGTVMSIVDSSPDSEAPDGGSGSDDEPPQPPKGGR
                     PSLRVVK"
     misc_feature    340626..341117
                     /locus_tag="PC1_0295"
                     /note="ClpXP protease specificity-enhancing factor;
                     Provisional; Region: PRK11798"
                     /db_xref="CDD:236987"
     gene            complement(341202..341975)
                     /locus_tag="PC1_0296"
                     /db_xref="GeneID:8131209"
     CDS             complement(341202..341975)
                     /locus_tag="PC1_0296"
                     /inference="protein motif:TFAM:TIGR02415"
                     /note="TIGRFAM: acetoin reductase;
                     PFAM: short-chain dehydrogenase/reductase SDR; KR domain
                     protein;
                     KEGG: eca:ECA0310 acetoin reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin reductase"
                     /protein_id="YP_003015891.1"
                     /db_xref="GI:253686701"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002424"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="InterPro:IPR014007"
                     /db_xref="GeneID:8131209"
                     /translation="MAVEVALVTGAGQGIGRAIALRLAADGFAVAIVDYNQETAHSVA
                     QEIEKAGGQAIALQADVADREAVFAAVAAAKKRFGDFNVIVNNAGVAPSTLIEDITPE
                     VIDRVYNINVKGVIWGIQAALDAFKSLGHGGKIINACSQAGHVGNPELAVYSSSKFAV
                     RGLTQTAARDLAPLGITVNGYCPGIVKTPMWDEIDRKISESAGKPRGYATEEFAKRIT
                     LGRLSEPEDVAACVSYLASHDSDYMTGQSLLIDGGMVFN"
     misc_feature    complement(341205..341969)
                     /locus_tag="PC1_0296"
                     /note="acetoin reductase; Validated; Region: PRK08643"
                     /db_xref="CDD:181518"
     misc_feature    complement(341205..341969)
                     /locus_tag="PC1_0296"
                     /note="meso-2,3-butanediol dehydrogenase-like, classical
                     (c) SDRs; Region: meso-BDH-like_SDR_c; cd05366"
                     /db_xref="CDD:187624"
     misc_feature    complement(order(341403..341414,341418..341429,
                     341505..341507,341517..341519,341556..341564,
                     341646..341648,341709..341717,341793..341801,
                     341868..341876,341931..341939,341946..341948))
                     /locus_tag="PC1_0296"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187624"
     misc_feature    complement(order(341205..341213,341217..341234,
                     341238..341255,341259..341261,341274..341276,
                     341283..341288,341295..341297,341313..341315,
                     341319..341327,341460..341462,341466..341471,
                     341475..341483,341487..341495,341499..341504,
                     341511..341513,341523..341525,341529..341546,
                     341616..341621,341625..341630,341637..341642,
                     341652..341654,341661..341666,341673..341675,
                     341679..341681,341685..341690,341910..341912))
                     /locus_tag="PC1_0296"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187624"
     misc_feature    complement(order(341466..341471,341475..341483,
                     341487..341495,341499..341504,341511..341513,
                     341523..341525,341529..341546,341616..341621,
                     341625..341630,341637..341642,341652..341654,
                     341661..341666,341673..341675,341679..341681,
                     341685..341690))
                     /locus_tag="PC1_0296"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187624"
     misc_feature    complement(order(341505..341507,341517..341519,
                     341556..341558,341643..341645))
                     /locus_tag="PC1_0296"
                     /note="active site"
                     /db_xref="CDD:187624"
     misc_feature    complement(order(341403..341405,341424..341429,
                     341517..341519,341553..341558))
                     /locus_tag="PC1_0296"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187624"
     gene            342354..342767
                     /locus_tag="PC1_0297"
                     /db_xref="GeneID:8131210"
     CDS             342354..342767
                     /locus_tag="PC1_0297"
                     /inference="protein motif:PFAM:PF04828"
                     /note="PFAM: glutathione-dependent formaldehyde-activating
                     GFA;
                     KEGG: sse:Ssed_1053 glutathione-dependent
                     formaldehyde-activating, GFA"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-dependent formaldehyde-activating
                     protein"
                     /protein_id="YP_003015892.1"
                     /db_xref="GI:253686702"
                     /db_xref="InterPro:IPR006913"
                     /db_xref="GeneID:8131210"
                     /translation="MHQGRCLCGGVTISTAHSVRDVAACHCGMCQTWGGGPLMAVECT
                     DPAIEIEGEENITVWPSSEWAERGFCRVCGTHLFYRLRGGDAYHIPAGFFADETDKKL
                     ISQIYIDKKPGYYSFVEKTPTLTEQDIIALYAGKD"
     misc_feature    342354..342737
                     /locus_tag="PC1_0297"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3791"
                     /db_xref="CDD:226314"
     gene            complement(342834..344252)
                     /locus_tag="PC1_0298"
                     /db_xref="GeneID:8131211"
     CDS             complement(342834..344252)
                     /locus_tag="PC1_0298"
                     /inference="protein motif:TFAM:TIGR01318"
                     /note="TIGRFAM: glutamate synthase, small subunit;
                     PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     KEGG: eca:ECA0311 glutamate synthase subunit beta"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase, small subunit"
                     /protein_id="YP_003015893.1"
                     /db_xref="GI:253686703"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR006006"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:8131211"
                     /translation="MSQNVYQFIDLQRVDPPKKPLKIRKIEFVEIYEPFSESQSKAQA
                     DRCLACGNPYCEWKCPVHNYIPNWLKLANEGRIIEAAELSHQTNSLPEVCGRVCPQDR
                     LCEGSCTLNDEFGAVTIGNIERYINDKAIEMGWKPSVANVKPTGKRVAIIGAGPAGLA
                     CADVLARNGVQAVVFDRHPEIGGLLTFGIPSFKLEKEVMVKRREIFTEMGIEFRLNTE
                     VGKDVQMKALLDEYDAVFLGVGTYQSMRGGLDNEDAQGVYDALPFLIANTKQLMGFEA
                     AADEPYVSMQGKRVVVLGGGDTAMDCVRTSIRQGSTHVTCAYRRDEENMPGSKREVKN
                     AREEGVEFKFNLQPLSVEINGAGKVCGVKMARTALGAPDANGRRRPEIVEGSEHVLEA
                     DAVIMAFGFRPHKMAWLAEHDVKLDDQGRIVAPESCDNAFQTSNPKIFAGGDAVRGSD
                     LVVTAIAEGRKAADGIMNYLEV"
     misc_feature    complement(342837..344237)
                     /locus_tag="PC1_0298"
                     /note="glutamate synthase small subunit family protein,
                     proteobacterial; Region: gltD_gamma_fam; TIGR01318"
                     /db_xref="CDD:130385"
     misc_feature    complement(343848..344183)
                     /locus_tag="PC1_0298"
                     /note="Dihydroprymidine dehydrogenase domain II, 4Fe-4S
                     cluster; Region: Fer4_20; pfam14691"
                     /db_xref="CDD:258829"
     misc_feature    complement(343290..343805)
                     /locus_tag="PC1_0298"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(343164..343388)
                     /locus_tag="PC1_0298"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            complement(344262..348722)
                     /locus_tag="PC1_0299"
                     /db_xref="GeneID:8131212"
     CDS             complement(344262..348722)
                     /locus_tag="PC1_0299"
                     /EC_number="1.4.7.1"
                     /inference="protein motif:PRIAM:1.4.7.1"
                     /note="PFAM: ferredoxin-dependent glutamate synthase;
                     glutamate synthase alpha subunit domain protein; glutamate
                     synthase; glutamine amidotransferase class-II;
                     KEGG: eca:ECA0312 glutamate synthase subunit alpha"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase (ferredoxin)"
                     /protein_id="YP_003015894.1"
                     /db_xref="GI:253686704"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR002489"
                     /db_xref="InterPro:IPR002932"
                     /db_xref="InterPro:IPR006982"
                     /db_xref="GeneID:8131212"
                     /translation="MLYDASQERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGA
                     ILADGKTGDGCGLLLQKPDRFFRLVAEEHGWRLAKNYAVGMMFLNQDEELARATRRIV
                     EEELQNETLSVLGWREVPTNPDVLGEIALSSMPRIEQIFVNAPAGWRQRDMERRLFMA
                     RRRIEKRIEDKDFYVCSFSNLVTIYKGLCMPADLPRFYLDLADLRLESSICLFHQRFS
                     TNTVPRWPLAQPFRYLAHNGEINTIAGNRQWARARAYKFKTPLIPDLQDAAPFVNETG
                     SDSSSLDNMLELFLSGGMDIIRAMRLLVPPAWQNNPDMDPELRAFFDFNSMHMEPWDG
                     PAGIVMSDGRYAACNLDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEKGRVGP
                     GELMVIDTRSGRILHSAETDNDLKSRHPYKEWMEKNVKRLVPFEELPDDQVGSREFND
                     DLLETYQKQYGYSSEELDQVIRVLGENGQEATGSMGDDTPFAVLSSRPRIIYDYFRQQ
                     FAQVTNPPIDPLREAHVMSLATSIGREMNVFCEAEGQAHRLSFKSPILLYSDFTQLTS
                     QDELHYRADTLDLTFDPSQQTLQQTIEKLCDEAESKVRDGAVLLVLSDRGISESRLPV
                     PAPMAVGAVQRRLVEKSLRCDANIIVETASARDPHHFAVLLGFGATAIYPYLAYETLA
                     RMVDNHTIDKPYRAVMLNYRNGINKGLYKIMSKMGISTIASYRCSKLFEAVGLHKDVS
                     TQCFLGVVSRIGGANYSDFEQDLLNLSKRAWLKRKTLEQGGLLKFVHGGEYHAYNPDV
                     VTTLQTAVKSGEYSDYEQYAKLVNERPAATLRDLLALKPQEGAAIAIDSVEPASEMFK
                     RFDTAAMSIGALSPEAHESLAEAMNGLGGFSNSGEGGEDPARYGTNKVSRIKQVASGR
                     FGVTPAYLVNADVIQIKVAQGAKPGEGGQLPGDKVTPYIARLRYSVPGVTLISPPPHH
                     DIYSIEDLAQLIFDLKQVNPKAMISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGT
                     GASPLSSVKYAGCPWELGLVETQQALVSNGLRHKIRLQVDGGLKTGLDIVKAAILGAE
                     SFGFGTGPMVALGCKYLRICHLNNCATGVATQDEKLRRDHYHGLPERVTNYFQFIAHE
                     TRVLMAELGVSRLVDLIGRTDLLVELDGFSAKQNKLDLSPLLHAAQPQPGKALYCTES
                     NLSFDKGLLNKELLAQAQPHIDSKQGKALYFDIRNTDRSVGATLSGAIAEKHGDQGLA
                     GDPIKAYFSGTAGQSFGVWNAGGVELKLTGDANDYVGKGMAGGSISVRPPVGSAFRSH
                     EASIIGNTCLYGATGGKLFAAGRAGERFAVRNSGCITVVEGIGDNGCEYMTGGIVCVL
                     GRTGVNFGAGMTGGFAYVLDEDGEFRKRVNPELVEVLDVEELAIHEEHLRGLITEHVQ
                     NTGSHRGEEILANWPTWAPKFALVKPKSSDVKALLGHRSRSAAELRVQAQ"
     misc_feature    complement(344280..348722)
                     /locus_tag="PC1_0299"
                     /note="glutamate synthase subunit alpha; Provisional;
                     Region: gltB; PRK11750"
                     /db_xref="CDD:236968"
     misc_feature    complement(347466..348689)
                     /locus_tag="PC1_0299"
                     /note="Glutamine amidotransferases class-II (Gn-AT),
                     glutamate synthase (GltS)-type. GltS is a homodimer that
                     synthesizes L-glutamate from 2-oxoglutarate and
                     L-glutamine, an important step in ammonia assimilation in
                     bacteria, cyanobacteria and plants. The...; Region: GltS;
                     cd00713"
                     /db_xref="CDD:238365"
     misc_feature    complement(order(347889..347891,348006..348014,
                     348075..348077,348597..348599,348687..348689))
                     /locus_tag="PC1_0299"
                     /note="active site"
                     /db_xref="CDD:238365"
     misc_feature    complement(order(348057..348059,348309..348311,
                     348321..348323,348354..348356,348369..348371,
                     348375..348377,348414..348416,348426..348428,
                     348435..348437))
                     /locus_tag="PC1_0299"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238365"
     misc_feature    complement(346512..347366)
                     /locus_tag="PC1_0299"
                     /note="Glutamate synthase central domain; Region:
                     Glu_syn_central; pfam04898"
                     /db_xref="CDD:252865"
     misc_feature    complement(345216..346310)
                     /locus_tag="PC1_0299"
                     /note="Glutamate synthase (GltS) FMN-binding domain.  GltS
                     is a complex iron-sulfur flavoprotein that catalyzes the
                     reductive synthesis of L-glutamate from 2-oxoglutarate and
                     L-glutamine via intramolecular channelling of ammonia, a
                     reaction in the plant, yeast...; Region: GltS_FMN;
                     cd02808"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(345384..345386,345399..345401,
                     345417..345419,345441..345446,345507..345509,
                     345513..345515,345630..345638,345726..345728,
                     345852..345854,345912..345914,345930..345932,
                     345996..345998,346050..346052,346131..346142))
                     /locus_tag="PC1_0299"
                     /note="active site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(345441..345446,345507..345509,
                     345513..345515,345633..345638,345726..345728,
                     345930..345932,345996..345998,346050..346052,
                     346131..346142))
                     /locus_tag="PC1_0299"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(345630..345635,345852..345854,
                     345912..345914))
                     /locus_tag="PC1_0299"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(345384..345386,345399..345401,
                     345417..345419))
                     /locus_tag="PC1_0299"
                     /note="3Fe-4S cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239202"
     misc_feature    complement(344334..345086)
                     /locus_tag="PC1_0299"
                     /note="gltb_C. This domain is found at the C-terminus of
                     the large subunit (gltB) of glutamate synthase (GltS).
                     GltS encodes a complex iron-sulfur flavoprotein that
                     catalyzes the synthesis of L-glutamate from L-glutamine
                     and 2-oxoglutarate. It requires the...; Region: gltB_C;
                     cd00982"
                     /db_xref="CDD:238482"
     misc_feature    complement(order(344499..344510,344553..344555,
                     344562..344564,344571..344573,344610..344612,
                     344616..344621,344628..344639,344664..344666,
                     344670..344675,344682..344696,344721..344723,
                     344730..344732,344739..344741,344748..344759,
                     344814..344816,344823..344825,344838..344846,
                     344880..344882,344892..344897,344904..344906,
                     344961..344966,344973..344975,344982..344987))
                     /locus_tag="PC1_0299"
                     /note="domain interface; other site"
                     /db_xref="CDD:238482"
     gene            349374..350303
                     /locus_tag="PC1_0300"
                     /db_xref="GeneID:8131213"
     CDS             349374..350303
                     /locus_tag="PC1_0300"
                     /inference="protein motif:TFAM:TIGR01212"
                     /note="KEGG: eca:ECA0313 hypothetical protein;
                     TIGRFAM: conserved hypothetical protein;
                     PFAM: Radical SAM domain protein;
                     SMART: Elongator protein 3/MiaB/NifB"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015895.1"
                     /db_xref="GI:253686705"
                     /db_xref="InterPro:IPR005911"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:8131213"
                     /translation="MQLQKLINMFGGNLQRRYGEKIHKLTLHGGFNCPNRDGTLGRGG
                     CTFCNVASFADEQMQQRSIAQQLETQAGKVNRAKRYLAYFQAYTSTYAEVQVLESMYQ
                     EALKQAEMVGLCVGTRPDCVPDAVLDLLSRYHEQGYEVWLELGLQSACDKTLHRINRG
                     HDFACYQETTRRARERGLKVCSHLIVGLPGEDAQHCLSTLEQVVETGVEGIKLHPLHI
                     VEGSTMAKAWRAGRLPELALDRYVETAGEMIRHTPPEVIYHRISASARRPTLLAPLWC
                     ENRWTGMVELDRYLQTHGVQGSALGTPYRYDEV"
     misc_feature    349389..350279
                     /locus_tag="PC1_0300"
                     /note="radical SAM protein, TIGR01212 family; Region:
                     TIGR01212"
                     /db_xref="CDD:130279"
     misc_feature    349452..350108
                     /locus_tag="PC1_0300"
                     /note="Elongator protein 3, MiaB family, Radical SAM;
                     Region: Elp3; smart00729"
                     /db_xref="CDD:214792"
     gene            350423..352792
                     /locus_tag="PC1_0301"
                     /db_xref="GeneID:8131214"
     CDS             350423..352792
                     /locus_tag="PC1_0301"
                     /inference="protein motif:TFAM:TIGR00229"
                     /note="KEGG: eca:ECA0314 aerobic respiration control
                     sensor protein ArcB;
                     TIGRFAM: PAS sensor protein;
                     PFAM: ATP-binding region ATPase domain protein; response
                     regulator receiver; Hpt domain protein; PAS fold-4 domain
                     protein; PAS fold domain protein; histidine kinase A
                     domain protein;
                     SMART: ATP-binding region ATPase domain protein; response
                     regulator receiver; histidine kinase A domain protein; Hpt
                     domain protein; PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="multi-sensor hybrid histidine kinase"
                     /protein_id="YP_003015896.1"
                     /db_xref="GI:253686706"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR008207"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:8131214"
                     /translation="MKQIRLLAQYYVDLMVKLGLVRFSLLLASVLVLLAMVVQMAVTL
                     LLSGEVENIDVVRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSKLVAKLEEMRHRDL
                     ELNEQLQENIAQLNQEIADRIKAEDARVLVMSRLKEEMSRREQAQIELEQQSALLRSF
                     LDASPDLVYYRNEDKEFSGCNRAMELLVGKSQKQLIGLTPQDVYSPDIAEKVMETDEK
                     VFRHNVSLTYEQWLVYPDGRKACFELRKVPFYDRMGKRHGLMGFGRDITERKRYQDAL
                     ENASREKTTFISTISHELRTPLNGIVGLSRILLDTQLDPEQQKYLKTIHVSAITLGNI
                     FNDVIEMDKQERRKVQLDNQPIDFTGFLVDLENLGGLLAEPKGLKLIMDQHYPLPQKV
                     ITDGTRLRQILWNLLSNAVKFTPKGENGEKGEIVVRVWHEKGDRLSFEVEDSGMGIPA
                     DELEKIFAMYYQVKDQHGGKPATGTGIGLAVSKRLAQNMGGDIQVSSTQGKGSCFTLT
                     VIAPSVDEAGSGLDDDDDLPLPALHVLLVEDIELNVVVARSVLEKLGNSVDVAMTGQD
                     ALDMFDPDEFDLVLLDIQLPDMTGLDVARQLRARYGNRSLPPLVALTANVLKDKREYL
                     DAGMDDVLSKPLSVPALTAVIKQFWDTHTVWTEEPVIEEGTEMAKAEEDLLDIPMLEQ
                     YLDLVGPKLIHQSLEMFEQMMPGYLAILDSNMTARDQKGITEEGHKIKGAAGSVGLRH
                     LQQVAQQIQTSSLPAWWDNVQEWVDELKHDWRHDVQVLRDWVAKAEKES"
     misc_feature    350423..352786
                     /locus_tag="PC1_0301"
                     /note="aerobic respiration control sensor protein ArcB;
                     Provisional; Region: PRK11091"
                     /db_xref="CDD:236842"
     misc_feature    350912..351220
                     /locus_tag="PC1_0301"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(350960..350962,350972..350974,350990..350992,
                     351029..351040,351116..351118,351131..351133)
                     /locus_tag="PC1_0301"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(351020..351022,351032..351034,351056..351058,
                     351065..351070,351152..351154,351158..351160)
                     /locus_tag="PC1_0301"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    351260..351445
                     /locus_tag="PC1_0301"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(351278..351280,351290..351292,351302..351304,
                     351311..351313,351323..351325,351332..351334,
                     351380..351382,351392..351394,351401..351403,
                     351413..351415,351422..351424,351434..351436)
                     /locus_tag="PC1_0301"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    351296..351298
                     /locus_tag="PC1_0301"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    351617..351949
                     /locus_tag="PC1_0301"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(351635..351637,351647..351649,351656..351658,
                     351743..351745,351749..351751,351755..351757,
                     351761..351766,351848..351859,351905..351907,
                     351911..351913,351926..351931,351935..351937)
                     /locus_tag="PC1_0301"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    351647..351649
                     /locus_tag="PC1_0301"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(351755..351757,351761..351763,351848..351850,
                     351854..351856)
                     /locus_tag="PC1_0301"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    352025..352363
                     /locus_tag="PC1_0301"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(352034..352039,352166..352168,352190..352192,
                     352259..352261,352313..352315,352322..352327)
                     /locus_tag="PC1_0301"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    352166..352168
                     /locus_tag="PC1_0301"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(352175..352180,352184..352192)
                     /locus_tag="PC1_0301"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    352322..352330
                     /locus_tag="PC1_0301"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    352508..352726
                     /locus_tag="PC1_0301"
                     /note="Histidine Phosphotransfer domain, involved in
                     signalling through a two part component systems in which
                     an autophosphorylating histidine protein kinase serves as
                     a phosphoryl donor to a response regulator protein; the
                     response regulator protein is...; Region: HPT; cd00088"
                     /db_xref="CDD:238041"
     misc_feature    order(352601..352603,352610..352615,352658..352660,
                     352667..352669)
                     /locus_tag="PC1_0301"
                     /note="putative binding surface; other site"
                     /db_xref="CDD:238041"
     misc_feature    352601..352603
                     /locus_tag="PC1_0301"
                     /note="active site"
                     /db_xref="CDD:238041"
     gene            353254..353907
                     /locus_tag="PC1_0302"
                     /db_xref="GeneID:8131215"
     CDS             353254..353907
                     /locus_tag="PC1_0302"
                     /inference="protein motif:PFAM:PF01965"
                     /note="PFAM: ThiJ/PfpI domain protein;
                     KEGG: eca:ECA0316 isoprenoid biosynthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ThiJ/PfpI domain-containing protein"
                     /protein_id="YP_003015897.1"
                     /db_xref="GI:253686707"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="GeneID:8131215"
                     /translation="MKRVGIVLSGCGVYDGSEIHEAVLTLLALDRAGAQAVCFAPDKP
                     QLQVVNHLTGDVTGENRNVLAESARIARGKIQPLSTANAQDLDALIVPGGFGAAKNLS
                     DFATQGSACQIDETLQLLTQEIYKQNKPIGFICISPALLPTILGEPVRVTIGNDIDTA
                     EAVEEMGGIHVVCPVDDIVVDEEHKIVTTPAYMLANSISEAAQGIDKLVARVLDLTE"
     misc_feature    353254..353904
                     /locus_tag="PC1_0302"
                     /note="isoprenoid biosynthesis protein with
                     amidotransferase-like domain; Provisional; Region:
                     PRK11780"
                     /db_xref="CDD:236980"
     misc_feature    353263..353901
                     /locus_tag="PC1_0302"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in zebrafish ES1; Region: GATase1_ES1;
                     cd03133"
                     /db_xref="CDD:153227"
     misc_feature    353656..353658
                     /locus_tag="PC1_0302"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153227"
     gene            353904..354638
                     /locus_tag="PC1_0303"
                     /db_xref="GeneID:8131216"
     CDS             353904..354638
                     /locus_tag="PC1_0303"
                     /inference="protein motif:TFAM:TIGR02070"
                     /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
                     transglycosylase;
                     PFAM: glycosyl transferase family 51;
                     KEGG: eca:ECA0317 monofunctional biosynthetic
                     peptidoglycan transglycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="monofunctional biosynthetic peptidoglycan
                     transglycosylase"
                     /protein_id="YP_003015898.1"
                     /db_xref="GI:253686708"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR011812"
                     /db_xref="GeneID:8131216"
                     /translation="MKWSRGRGGLLAWLKRLIVRSVLVVIGAWLAGILLFSFLPVPFS
                     AVMVDRQISAWLKGEFSYVAHSDWVSMEEIAPEMALAVMAAEDQKFPDHWGFDLDAIG
                     QALKHNERNTQRIRGASTLSQQMVKNLFLWDGRSWVRKGLEAGITTGVELVWTKRRIL
                     TVYLNIAEFGPGIFGVEAAARRYFNKPASRLTASESALLAAVLPNPIRFRANAPSSYV
                     IQRQQWILRQMRQMGGDAFLRANNLN"
     misc_feature    353922..354629
                     /locus_tag="PC1_0303"
                     /note="monofunctional biosynthetic peptidoglycan
                     transglycosylase; Provisional; Region: mtgA; PRK00056"
                     /db_xref="CDD:234603"
     misc_feature    353925..>354605
                     /locus_tag="PC1_0303"
                     /note="Membrane carboxypeptidase (penicillin-binding
                     protein) [Cell envelope biogenesis, outer membrane];
                     Region: MrcB; COG0744"
                     /db_xref="CDD:223815"
     gene            354709..356004
                     /locus_tag="PC1_0304"
                     /db_xref="GeneID:8131217"
     CDS             354709..356004
                     /locus_tag="PC1_0304"
                     /inference="similar to AA sequence:KEGG:ECA0318"
                     /note="KEGG: eca:ECA0318 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015899.1"
                     /db_xref="GI:253686709"
                     /db_xref="GeneID:8131217"
                     /translation="MRLRYWSGLLVALCCVASVARADAEPKASSPDNPYAFLQQHQLS
                     SVKQQLQQKTEKPQTRMAYEQLISEADRALKIANPSVTEKKSTPPSGSKHDYLSLSAY
                     WWPDPDKADGLPWIRRDGQVNPASKDEETDGVRLAKFTAQTQALTLAWYFSGKQAYAD
                     KAISMIRTWFIDPATRMNPNLDFAQGVPGIAPGRGSGVLDGRYFSTRIVDSLLILRHA
                     PGWTTQDEQQMQKWMSDYLHWLQTSKLGKKEATAQNNHGSWYTVQVAGIAWYLGKIDV
                     VKSMAQLQREKLDHQLQPDGSQPEELARTRSFHYSYFNLQAITDMAILASRVGENIWQ
                     YQTPKGSSVIKALDFMAPYLDENKAWPRKTMDRQSSRLIPLLLQAERGVKAPRYQTQI
                     KQAGFAELLSGAASERDKEPSHISVETRRALWLLNPVAP"
     misc_feature    354946..355788
                     /locus_tag="PC1_0304"
                     /note="Alginate lyase; Region: Alginate_lyase; pfam05426"
                     /db_xref="CDD:253191"
     gene            complement(356131..356703)
                     /locus_tag="PC1_0305"
                     /db_xref="GeneID:8131218"
     CDS             complement(356131..356703)
                     /locus_tag="PC1_0305"
                     /inference="protein motif:PFAM:PF04972"
                     /note="PFAM: transport-associated;
                     SMART: Transport-associated and nodulation region;
                     KEGG: eca:ECA0319 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transport-associated protein"
                     /protein_id="YP_003015900.1"
                     /db_xref="GI:253686710"
                     /db_xref="InterPro:IPR007055"
                     /db_xref="InterPro:IPR014004"
                     /db_xref="GeneID:8131218"
                     /translation="MRISSAFAVLSIALLLQGCVGVVAVGSAVATKTATDPRTVGTQV
                     DDGTLEVRVTNAISKDEQLKKEARIIATAYQGKVLLTGQAPNTEMANRAKQIALGVEG
                     AAEVYNEIRQGTPVSMGTASMDTWITTKVRSQILASDTVKSSNVKVTTENGEVFLLGL
                     VTQREGTSAAEIASKVGGVKHVTTAFTYLQ"
     misc_feature    complement(356134..356703)
                     /locus_tag="PC1_0305"
                     /note="outer membrane lipoprotein; Provisional; Region:
                     PRK11023"
                     /db_xref="CDD:182907"
     misc_feature    complement(356371..356511)
                     /locus_tag="PC1_0305"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    complement(356155..356283)
                     /locus_tag="PC1_0305"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     gene            complement(356715..357305)
                     /locus_tag="PC1_0306"
                     /db_xref="GeneID:8131219"
     CDS             complement(356715..357305)
                     /locus_tag="PC1_0306"
                     /inference="similar to AA sequence:KEGG:ECA0320"
                     /note="KEGG: eca:ECA0320 DnaA initiator-associating
                     protein DiaA"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaA initiator-associating protein DiaA"
                     /protein_id="YP_003015901.1"
                     /db_xref="GI:253686711"
                     /db_xref="GeneID:8131219"
                     /translation="MLDRIKVCFTESIQTQIAAAEALPDAISRGAIAMVQSLLNGNKI
                     LCCGNGTSAANAQHFAASMINRFEAERPSLPAIALNADNVVLTAIANDRLHEEVYAKQ
                     VRALGQAGDVLLAISTRGNSRDIVKAVESAVTRDMTIVALTGYDGGELAGLLGPQDVE
                     IRIPSHRSARIQEMHMLTVNCLCDLIDNTLFPHQND"
     misc_feature    complement(356742..357281)
                     /locus_tag="PC1_0306"
                     /note="Phosphoheptose isomerase is a member of the SIS
                     (Sugar ISomerase) superfamily. Phosphoheptose isomerase
                     catalyzes the isomerization of sedoheptulose 7-phosphate
                     into D-glycero-D-mannoheptose 7-phosphate. This is the
                     first step of the biosynthesis of...; Region: SIS_GmhA;
                     cd05006"
                     /db_xref="CDD:240139"
     misc_feature    complement(order(356742..356744,356754..356756,
                     356766..356768,356775..356777,356787..356792,
                     357132..357137,357153..357155,357213..357215,
                     357222..357224,357258..357260,357270..357272))
                     /locus_tag="PC1_0306"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240139"
     misc_feature    complement(order(356790..356792,356802..356804,
                     356940..356942,356949..356957,357153..357161))
                     /locus_tag="PC1_0306"
                     /note="active site"
                     /db_xref="CDD:240139"
     gene            complement(357369..357725)
                     /locus_tag="PC1_0307"
                     /db_xref="GeneID:8131220"
     CDS             complement(357369..357725)
                     /locus_tag="PC1_0307"
                     /inference="protein motif:PFAM:PF02021"
                     /note="PFAM: protein of unknown function UPF0102;
                     KEGG: spe:Spro_4337 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015902.1"
                     /db_xref="GI:253686712"
                     /db_xref="InterPro:IPR003509"
                     /db_xref="GeneID:8131220"
                     /translation="MNQRAAGAVYEQQARRYLERAGLTFTAANVTLRGGELDLIMRDR
                     HIWVFVEVRYRRNAHFGDAAASVTRHKQQRLLHAAAVWLAQRGASFDTVDCRFDVLAI
                     TGDRFDWIPNAFATQG"
     misc_feature    complement(357384..357725)
                     /locus_tag="PC1_0307"
                     /note="hypothetical protein; Reviewed; Region: PRK12497"
                     /db_xref="CDD:237119"
     gene            complement(357722..359740)
                     /locus_tag="PC1_0308"
                     /db_xref="GeneID:8131221"
     CDS             complement(357722..359740)
                     /locus_tag="PC1_0308"
                     /inference="protein motif:PFAM:PF04348"
                     /note="PFAM: LppC family lipoprotein;
                     KEGG: eca:ECA0322 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LppC family lipoprotein"
                     /protein_id="YP_003015903.1"
                     /db_xref="GI:253686713"
                     /db_xref="InterPro:IPR007443"
                     /db_xref="GeneID:8131221"
                     /translation="MLPFHFVRTQAGRAIPVLLAALFLAGCPSQAPQSPPPEVQGKAD
                     ASSDYYLQQMQQSSDNNKADWQLLAIRSLLQEGKAPQASQQFNALPEKLSAAQKQEQQ
                     LLSAELSVAQNNMDAAKAALSQLDVSALSDQQKQRYYQTQIKTAQGRTSIELLRAYIA
                     QEPLLKGDEHQMNLDQTWLALTQMSPQESGALLINANENVLQGWVDLLNNYQNNRESP
                     DQLQSAIQDWQTRYPHHPAAKKLPTQLNQVINYQPSSVSSIALLLPLNGQAQVFANAI
                     QQGFNAAKNGQIATAPVSAPAAPVTDTTQDGQVTPSSDGQSAQSPAPYSDQAVASTTQ
                     APEAQPTSAGLSNSLPVKVYDTSSQPLANILTQAQQDGASLVIGPLLKNEVDQLANSQ
                     SPLNILALNQPEHVENSPNICYFALSPEDEARDAAKFIHQQGKQQPLVLAPRGALGDR
                     IVNAFAQAWNQQSGTSPLQQRFGNTAELKQAINSGAGLSLSGQPVSVSQQQAQPGTTI
                     GGLTIPSQVQPTVSSSVSGNIDAVYIIATPDELALIKPMIDMRTTSRARPALYASSRS
                     FQAGLGPDFRLEMEGLQFSDIPLLAGANPALMQQVSSQFKNDYSLVRLYAMGMDAWTL
                     ASHFGEMRQIPGHQIPGATGMLSSGPDCTINRQLTWQQYRQGQLVPVL"
     misc_feature    complement(357728..359740)
                     /locus_tag="PC1_0308"
                     /note="Putative lipoprotein [General function prediction
                     only]; Region: LppC; COG3107"
                     /db_xref="CDD:225649"
     misc_feature    complement(357761..358966)
                     /locus_tag="PC1_0308"
                     /note="Periplasmic binding component of lipoprotein LppC,
                     an immunodominant antigen; Region:
                     PBP1_YraM_LppC_lipoprotein_like; cd06339"
                     /db_xref="CDD:107334"
     misc_feature    complement(order(358049..358051,358130..358132,
                     358400..358402,358535..358540,358595..358603))
                     /locus_tag="PC1_0308"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107334"
     gene            359802..360689
                     /locus_tag="PC1_0309"
                     /db_xref="GeneID:8131222"
     CDS             359802..360689
                     /locus_tag="PC1_0309"
                     /inference="protein motif:PFAM:PF00590"
                     /note="PFAM: Uroporphyrin-III C/tetrapyrrole
                     (Corrin/Porphyrin) methyltransferase;
                     KEGG: eca:ECA0323 putative tetrapyrrole methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Uroporphyrin-III C/tetrapyrrole
                     (Corrin/Porphyrin) methyltransferase"
                     /protein_id="YP_003015904.1"
                     /db_xref="GI:253686714"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR008189"
                     /db_xref="GeneID:8131222"
                     /translation="MNQDQQADISASTLYIVPTPIGNLGDITQRALAVLASVDLIAAE
                     DTRHTGLLLQHFAINARLFALHDHNEQQKADVLLAKLQSGQSIALVSDAGTPLINDPG
                     YHLVRRCREAGVRVVPLPGACAAITALSASGLASDRFCYEGFLPAKTKARKDTLRDLG
                     EEPRTLIFYESTHRLLDSLQDISEVLGAERYVVLAREITKTWESIHGAPVGELLAWVK
                     EDENRRKGEMVLIVEGHQADDSALSAEALRTLMLLRAELPLKKAAALAAEIHGVKKNA
                     LYRYGLEQEGDSGESGDDK"
     misc_feature    359841..360503
                     /locus_tag="PC1_0309"
                     /note="Ribosomal RNA small subunit methyltransferase I,
                     also known as rRNA (cytidine-2'-O-)-methyltransferase
                     RsmI; Region: RsmI; cd11648"
                     /db_xref="CDD:212507"
     misc_feature    order(359862..359864,360078..360086,360093..360098,
                     360168..360173,360306..360308,360384..360386,
                     360390..360395,360480..360488)
                     /locus_tag="PC1_0309"
                     /note="putative SAM binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212507"
     misc_feature    order(359880..359891,359895..359897,360084..360101,
                     360108..360113,360117..360122,360153..360155,
                     360159..360170,360174..360179,360186..360191,
                     360216..360230)
                     /locus_tag="PC1_0309"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212507"
     gene            360775..361077
                     /gene="rnpB"
                     /locus_tag="PC1_R0014"
                     /db_xref="GeneID:8131223"
     ncRNA           360775..361077
                     /gene="rnpB"
                     /locus_tag="PC1_R0014"
                     /ncRNA_class="RNase_P_RNA"
                     /product="RNA component of RNaseP"
                     /note="Bacterial RNase P class A as predicted by
                     Rfam(RF000 10), score 268.28"
                     /db_xref="GeneID:8131223"
     gene            362525..363310
                     /locus_tag="PC1_0310"
                     /db_xref="GeneID:8131224"
     CDS             362525..363310
                     /locus_tag="PC1_0310"
                     /inference="protein motif:PFAM:PF02900"
                     /note="PFAM: Extradiol ring-cleavage dioxygenase class III
                     protein subunit B;
                     KEGG: eca:ECA0327 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Extradiol ring-cleavage dioxygenase class III
                     protein subunit B"
                     /protein_id="YP_003015905.1"
                     /db_xref="GI:253686715"
                     /db_xref="InterPro:IPR004183"
                     /db_xref="GeneID:8131224"
                     /translation="MSNTSRMPALFLGHGSPMNVLENNVYTQAWQTLGETLPRPKAII
                     AVSAHWYTRGTAVTAMENPRTIHDFGGFPQALFDTQYPAPGSPELAARIQQVLAPYPV
                     TADQSQWGLDHGSWGVLIKMYPDADIPVVQLSVDGTQPAAYHYELGRKLAALRDEGFM
                     IVASGNVVHNLRMVKWDGDAEPYPWAISFNQFVRDNLTYQGDDHPLVNFMQHEGAALS
                     NPTPDHYFPLLYVLGSWDGKEAISIPVDGLEMGSLSMLSVQVG"
     misc_feature    362546..363301
                     /locus_tag="PC1_0310"
                     /note="The Class III extradiol dioxygenase, 4,5-DOPA
                     Dioxygenase, catalyzes the incorporation of both atoms of
                     molecular oxygen into 4,5-dihydroxy-phenylalanine; Region:
                     45_DOPA_Dioxygenase; cd07363"
                     /db_xref="CDD:153375"
     misc_feature    order(362564..362572,362669..362671,362861..362863,
                     363029..363031,363194..363196,363278..363283)
                     /locus_tag="PC1_0310"
                     /note="putative active site [active]"
                     /db_xref="CDD:153375"
     misc_feature    order(362564..362566,362669..362671,363194..363196)
                     /locus_tag="PC1_0310"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153375"
     gene            complement(363380..364540)
                     /locus_tag="PC1_0311"
                     /db_xref="GeneID:8131225"
     CDS             complement(363380..364540)
                     /locus_tag="PC1_0311"
                     /EC_number="6.3.1.9"
                     /inference="protein motif:PRIAM:6.3.1.9"
                     /note="PFAM: glutathionylspermidine synthase;
                     KEGG: eca:ECA0328 putative glutathionylspermidine
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="Trypanothione synthase"
                     /protein_id="YP_003015906.1"
                     /db_xref="GI:253686716"
                     /db_xref="InterPro:IPR005494"
                     /db_xref="GeneID:8131225"
                     /translation="MKRIDITARPDWQEKATEFGFRFHTMYGEPYWSEEAYYQFTLAQ
                     IEELEETTAELHQMCLQVVEKVINSDALLAKFRIPKHTWEFVRHSWRTNQPSLYSRLD
                     LAYDGKSPAKLLENNADTPTSLYEAAFFQWLWLEDQINAGNLPQNSDQYNSIQEKLIE
                     RFEELKLNHGFGLLHFACCQDTEEDRGTVQYLQDCALEAGLPSEFLYIEEIGLGEKGQ
                     FTDPENQVISNLFKLYPWEFMLREMFSTKLEDAGVRWLEPAWKSIISNKALLPMLWEM
                     FPDHPNLLPAYFAEDEHPKLDSYVTKPLFSREGANIQIIENGKEIASADGPYGEEGMI
                     VQQYHPLPKFGDSYTLIGSWLVNDQPCGIGVREDRALITQDLSRFYPHTILD"
     misc_feature    complement(363383..364540)
                     /locus_tag="PC1_0311"
                     /note="Glutathionylspermidine synthase [Amino acid
                     transport and metabolism]; Region: Gsp; COG0754"
                     /db_xref="CDD:223825"
     gene            complement(364552..365226)
                     /locus_tag="PC1_0312"
                     /db_xref="GeneID:8131226"
     CDS             complement(364552..365226)
                     /locus_tag="PC1_0312"
                     /inference="protein motif:PFAM:PF06693"
                     /note="PFAM: protein of unknown function DUF1190;
                     KEGG: eca:ECA0329 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015907.1"
                     /db_xref="GI:253686717"
                     /db_xref="InterPro:IPR009576"
                     /db_xref="GeneID:8131226"
                     /translation="MKRTKNINQEMFRKEWRTHRLAPVALAVSAVFFLAGCEQTDETV
                     SLYQNADDCSSANPSMAAQCTTAYNNALKEAEKTAPKYATKEDCVAEFGEAQCTQTPA
                     PAQAGMAAESQQGGGMSWMPLMAGYMMGRMMGGGAGFAQQPLFSPKTPASPANGQFVD
                     ASGKNYGNATTGRTMTVPKTALAPKPATTSTITRGGFGETVAKQNSMQRSSASSSSSS
                     SRSMGG"
     misc_feature    complement(364555..365226)
                     /locus_tag="PC1_0312"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11653"
                     /db_xref="CDD:236948"
     gene            complement(365493..366884)
                     /locus_tag="PC1_0313"
                     /db_xref="GeneID:8131227"
     CDS             complement(365493..366884)
                     /locus_tag="PC1_0313"
                     /inference="protein motif:TFAM:TIGR01844"
                     /note="TIGRFAM: type I secretion outer membrane protein,
                     TolC family;
                     PFAM: outer membrane efflux protein;
                     KEGG: eca:ECA0330 outer membrane channel protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TolC family type I secretion outer membrane
                     protein"
                     /protein_id="YP_003015908.1"
                     /db_xref="GI:253686718"
                     /db_xref="InterPro:IPR003423"
                     /db_xref="InterPro:IPR010130"
                     /db_xref="GeneID:8131227"
                     /translation="MKKLLPLLIGLSLGGFSAMSQAENLLQVYQQAKSTNPDLRSSAA
                     TRDAAFEKINESRSPLLPQLGINAGYTYNKGYRDSNGVNNNEKSATLQLTQTLFDMSK
                     WRALTLQEKQAGIEDVTYQTAQQNLMLNTATAYFNVLRAIDSLSYINAQKQAIYRQLD
                     QTTQRFNVGLVAITDVQNARAQYDSVLANEVLTRNTLDNALESLRQITGNFYPQLAGL
                     NIERFSTQKPEAVNNLLKEAENRNLNLLSARLSQDLAREQIRSAETGYMPTLDLTAST
                     GVSDTRYSGSRTNSGNFNDTDAGQHRVGINFTLPLYSGGATNSQVKQAQHSYVSASEL
                     LESAHRSVIQTVRSSFNNISASISSINAYKQAEVSAQSSLDAMEAGYQVGTRTIVDVL
                     DATTTLYNAKQQLSSARYDYLINQLNIKSAQGTLNEADLQALNAALGQPVSTTPTVTD
                     NSAPLATTASAQR"
     misc_feature    complement(365541..366884)
                     /locus_tag="PC1_0313"
                     /note="outer membrane channel protein; Reviewed; Region:
                     tolC; PRK09465"
                     /db_xref="CDD:236529"
     misc_feature    complement(366258..366812)
                     /locus_tag="PC1_0313"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    complement(365619..366191)
                     /locus_tag="PC1_0313"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            complement(367019..367174)
                     /locus_tag="PC1_0314"
                     /db_xref="GeneID:8131228"
     CDS             complement(367019..367174)
                     /locus_tag="PC1_0314"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015909.1"
                     /db_xref="GI:253686719"
                     /db_xref="GeneID:8131228"
                     /translation="MADSAVIILIIVFERLLGVTSAKGISVHRITFRYLTEQQNVALD
                     HPTGQFT"
     gene            367217..367849
                     /locus_tag="PC1_0315"
                     /db_xref="GeneID:8131229"
     CDS             367217..367849
                     /locus_tag="PC1_0315"
                     /EC_number="3.6.1.13"
                     /inference="protein motif:PRIAM:3.6.1.13"
                     /note="PFAM: NUDIX hydrolase;
                     KEGG: eca:ECA0331 ADP-ribose pyrophosphatase NudF"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribose diphosphatase"
                     /protein_id="YP_003015910.1"
                     /db_xref="GI:253686720"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR004385"
                     /db_xref="GeneID:8131229"
                     /translation="MASSVSGPVTFTKDDVEIIARETLYDGFFSLELYRFRHRLFNGG
                     MSGEVSREILERGHAVVLLPYDPVRDEVVLIEQIRIAAYDTSASPWLFELVAGMIEPG
                     ESHEEVARREAQEEAGLRVGRCRPIINYLASPGGTSERLAVMVGEVDTRTAKGIHGLS
                     EENEDIRVHVVSREQSYQWVEEGIVDNAASVIALQWLTLHHEELKRAWVD"
     misc_feature    367241..367846
                     /locus_tag="PC1_0315"
                     /note="ADP-ribose pyrophosphatase NudF; Provisional;
                     Region: nudF; PRK10729"
                     /db_xref="CDD:182682"
     misc_feature    367382..367816
                     /locus_tag="PC1_0315"
                     /note="ADP-ribose pyrophosphatase (ADPRase) catalyzes the
                     hydrolysis of ADP-ribose and a variety of additional
                     ADP-sugar conjugates to AMP and ribose-5-phosphate. Like
                     other members of the Nudix hydrolase superfamily, it
                     requires a divalent cation, such as Mg2+; Region:
                     ADPRase_NUDT5; cd03424"
                     /db_xref="CDD:239516"
     misc_feature    order(367382..367384,367388..367390,367442..367444,
                     367448..367450,367454..367456,367484..367486,
                     367601..367612,367616..367618,367622..367636,
                     367706..367711,367715..367717,367754..367759,
                     367778..367780,367790..367792,367799..367801,
                     367811..367816)
                     /locus_tag="PC1_0315"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239516"
     misc_feature    order(367391..367393,367451..367453,367508..367510,
                     367550..367552,367562..367564,367631..367633)
                     /locus_tag="PC1_0315"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239516"
     misc_feature    order(367451..367453,367502..367510,367550..367552,
                     367562..367564,367631..367633,367706..367708)
                     /locus_tag="PC1_0315"
                     /note="active site"
                     /db_xref="CDD:239516"
     misc_feature    order(367505..367516,367520..367573)
                     /locus_tag="PC1_0315"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239516"
     misc_feature    order(367550..367552,367562..367564,367706..367708)
                     /locus_tag="PC1_0315"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239516"
     gene            367853..368284
                     /locus_tag="PC1_0316"
                     /db_xref="GeneID:8131230"
     CDS             367853..368284
                     /locus_tag="PC1_0316"
                     /inference="protein motif:PFAM:PF06853"
                     /note="PFAM: protein of unknown function DUF1249;
                     KEGG: eca:ECA0332 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015911.1"
                     /db_xref="GI:253686721"
                     /db_xref="InterPro:IPR009659"
                     /db_xref="GeneID:8131230"
                     /translation="MKRYTPDFPAMMRLCETNFMQLRRLLPKIDEVGEIAVYHVNNAI
                     YQLTILESTRYTSLVEIKQTAPAVSYWSLPMMSVRLYHDALVAEVCASQQIFRFKARY
                     DYPNKKLHQRDEKHQINQFLADWLKYCLAYGSMSIPVFDTQ"
     misc_feature    367853..368272
                     /locus_tag="PC1_0316"
                     /note="putative dehydrogenase; Provisional; Region:
                     PRK11039"
                     /db_xref="CDD:182921"
     gene            368392..369219
                     /locus_tag="PC1_0317"
                     /db_xref="GeneID:8131231"
     CDS             368392..369219
                     /locus_tag="PC1_0317"
                     /inference="protein motif:PFAM:PF08413"
                     /note="PFAM: Calcineurin phosphoesterase domain protein;
                     metallophosphoesterase;
                     KEGG: eca:ECA0333 cyclic 3',5'-adenosine monophosphate
                     phosphodiesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="Calcineurin phosphoesterase domain-containing
                     protein"
                     /protein_id="YP_003015912.1"
                     /db_xref="GI:253686722"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR013622"
                     /db_xref="GeneID:8131231"
                     /translation="MESLLTLPVASGARVRILQITDTHLFAGEHETLLGINTYRSYHA
                     VLNAIKARQDAFDLIVATGDLAQDHTLEAYHHFSRGIAQIPAPCVWLPGNHDFQPAMV
                     DALAEAGIAPSKHVLLGDKWQIILLDSQVFGVPHGELSEYQLEWLERSLKSQPDRFTL
                     LLLHHHPHPSGCTWLDQHSLRNAHSLSAVLDRYPQVNTVLCGHIHQEMDFDWHGRRLL
                     ATPSTCVQFKPHCTNFTIDDVAPGWRYLDLFPDGRLETEVYRLSGSEFLPDMDSDGY"
     misc_feature    368434..369216
                     /locus_tag="PC1_0317"
                     /note="Predicted phosphohydrolases [General function
                     prediction only]; Region: Icc; COG1409"
                     /db_xref="CDD:224327"
     misc_feature    368437..369150
                     /locus_tag="PC1_0317"
                     /note="Enterobacter aerogenes GpdQ and related proteins,
                     metallophosphatase domain; Region: MPP_GpdQ; cd07402"
                     /db_xref="CDD:163645"
     misc_feature    order(368455..368457,368461..368463,368581..368583,
                     368590..368592,368671..368676,368881..368883,
                     368998..369000,369004..369006,369064..369066)
                     /locus_tag="PC1_0317"
                     /note="active site"
                     /db_xref="CDD:163645"
     misc_feature    order(368455..368457,368461..368463,368581..368583,
                     368671..368673,368881..368883,368998..369000,
                     369004..369006)
                     /locus_tag="PC1_0317"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163645"
     misc_feature    order(368500..368502,368509..368511,368518..368523,
                     368530..368535,368590..368592,368599..368601,
                     368626..368628,368893..368895,368899..368904,
                     368983..368985,368989..368991,369010..369024,
                     369031..369039,369043..369045,369130..369132,
                     369139..369141,369145..369147)
                     /locus_tag="PC1_0317"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163645"
     gene            369219..369800
                     /locus_tag="PC1_0318"
                     /db_xref="GeneID:8131232"
     CDS             369219..369800
                     /locus_tag="PC1_0318"
                     /inference="protein motif:PFAM:PF05728"
                     /note="PFAM: protein of unknown function UPF0227;
                     KEGG: eca:ECA0334 esterase YqiA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015913.1"
                     /db_xref="GI:253686723"
                     /db_xref="InterPro:IPR008886"
                     /db_xref="GeneID:8131232"
                     /translation="MPTLLYLHGFNSTPQSAKATALKTWLAEQHPEIDMIIPQLPPYP
                     AEAAEMMESLIMERAGRPVGIVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLLDH
                     LGEYQNPYTGEQYVLESRHVYDLKVMQVDRLESPDLLWLLLQTGDEVLDYRQAVAYYT
                     ACRQTVESGGNHAFVGFEHFFTPIVNFLGLTTD"
     misc_feature    369219..369788
                     /locus_tag="PC1_0318"
                     /note="esterase YqiA; Provisional; Region: PRK11071"
                     /db_xref="CDD:182945"
     gene            369893..371788
                     /locus_tag="PC1_0319"
                     /db_xref="GeneID:8131233"
     CDS             369893..371788
                     /locus_tag="PC1_0319"
                     /EC_number="5.99.1.3"
                     /inference="protein motif:TFAM:TIGR01055"
                     /note="KEGG: eca:ECA0335 DNA topoisomerase IV subunit B;
                     TIGRFAM: DNA topoisomerase IV, B subunit;
                     PFAM: DNA topoisomerase type IIA subunit B region 2 domain
                     protein; DNA gyrase subunit B domain protein; ATP-binding
                     region ATPase domain protein;
                     SMART: DNA topoisomerase II; ATP-binding region ATPase
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit B"
                     /protein_id="YP_003015914.1"
                     /db_xref="GI:253686724"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR005737"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="GeneID:8131233"
                     /translation="MAQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNS
                     VDEALAGHARRIDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFS
                     GKNYQFSGGLHGVGISVVNALSTRVEVTVKRDGQVYDIAFANGDKVQDLTVTGTCGRR
                     NTGTRVHFWPDEKFFDSARFSVSRLTHLLKAKAVLCPGVEIIFKDKVNNTEQRWCYQD
                     GLNDYLCEAVNGLITLPEKPFLGSITGDTEAVDWALLWLPEGGELLMESYVNLIPTPM
                     GGTHVNGLRQGLLDAMREFCEFRNILPRGVKLSADDIWERCAYVLSVKMQEPQFAGQT
                     KERLSSRQCAAFVSGVVKDAFSLWLNQNVQAAEQLAELAISSAQRRMRAAKKVVRKKL
                     TSGPALPGKLADCTSQDLSRTELFLVEGDSAGGSAKQAREREFQAIMPLKGKILNTWE
                     VSSDEVLASQEVHDISVAIGIDPDSDDLSQLRYGKICILADADSDGLHIATLLCALFV
                     RHFRALVQGGHVYVAMPPLYRIDLGKEVYYALDEEEKAGVLEQLKRKKGKPNVQRFKG
                     LGEMNPLQLRETTLDPNTRRLVQLTIKEDDIDQTMAMMDMLLAKKRSEDRRNWLQEKG
                     DKAEIEV"
     misc_feature    369893..371782
                     /locus_tag="PC1_0319"
                     /note="DNA topoisomerase IV subunit B; Reviewed; Region:
                     PRK05559"
                     /db_xref="CDD:235501"
     misc_feature    370004..370297
                     /locus_tag="PC1_0319"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(370007..370009,370019..370021,370028..370030,
                     370094..370096,370100..370102,370106..370108,
                     370112..370117,370232..370243,370277..370279,
                     370283..370285)
                     /locus_tag="PC1_0319"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    370019..370021
                     /locus_tag="PC1_0319"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(370106..370108,370112..370114,370232..370234,
                     370238..370240)
                     /locus_tag="PC1_0319"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    370544..371053
                     /locus_tag="PC1_0319"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    370700..370702
                     /locus_tag="PC1_0319"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(370871..370873,370880..370885,370889..370891,
                     371024..371029,371039..371041,371051..371053)
                     /locus_tag="PC1_0319"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(370889..370891,370895..370897)
                     /locus_tag="PC1_0319"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    371129..371467
                     /locus_tag="PC1_0319"
                     /note="Topoisomerase-primase domain. This is a nucleotidyl
                     transferase/hydrolase domain found in type IA, type IIA
                     and type IIB topoisomerases, bacterial DnaG-type primases,
                     small primase-like proteins from bacteria and archaea, OLD
                     family nucleases from...; Region: TOPRIM; cl00718"
                     /db_xref="CDD:260587"
     misc_feature    order(371147..371152,371159..371161,371363..371365,
                     371369..371371,371375..371377)
                     /locus_tag="PC1_0319"
                     /note="active site"
                     /db_xref="CDD:173773"
     misc_feature    order(371147..371149,371363..371365)
                     /locus_tag="PC1_0319"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173773"
     misc_feature    371555..371755
                     /locus_tag="PC1_0319"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            371982..372995
                     /locus_tag="PC1_0320"
                     /db_xref="GeneID:8131234"
     CDS             371982..372995
                     /locus_tag="PC1_0320"
                     /inference="protein motif:PFAM:PF00248"
                     /note="PFAM: aldo/keto reductase;
                     KEGG: eum:ECUMN_1766 putative aryl-alcohol dehydrogenase
                     (NADP(+))"
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="YP_003015915.1"
                     /db_xref="GI:253686725"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="GeneID:8131234"
                     /translation="MQYTKLGNSDLTVSRICMGCMGFGDASTGQHSWTLGEAESREII
                     RYGLENGINFYDTAIAYQRGSSERYVGKALRDMAKRDDVVVATKFLPRTQQQISDGLS
                     GQHAIAQSLDQSLHNLGMDYIDLYICHIWDYNTPILDVLDALHRAVKAGKVRAIGISN
                     CHAWQLAKANAIAERENLTPFVSVQSHYNLIMREDERELFGLCAEDNIALTPYSALAS
                     GRLSRLEGVESLRLKEDTYAKGKYDTTAEQDRIIIDRVAELAARHRASMTEISLAWLL
                     TKVTAPVVGATKKHHIDGAVKAVNLTLSDDEIRYLEESYQPHRLVGVMAQNAPQTQAK
                     KQA"
     misc_feature    371988..372920
                     /locus_tag="PC1_0320"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    371988..372890
                     /locus_tag="PC1_0320"
                     /note="voltage-dependent potassium channel beta subunit,
                     animal; Region: Kv_beta; TIGR01293"
                     /db_xref="CDD:213602"
     misc_feature    order(372036..372044,372147..372149,372162..372164,
                     372243..372245,372366..372371,372456..372461,
                     372534..372536,372618..372635,372783..372785,
                     372828..372839,372852..372854,372861..372866)
                     /locus_tag="PC1_0320"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(372147..372149,372162..372164,372243..372245,
                     372366..372368)
                     /locus_tag="PC1_0320"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            373173..374069
                     /locus_tag="PC1_0321"
                     /db_xref="GeneID:8131235"
     CDS             373173..374069
                     /locus_tag="PC1_0321"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: eca:ECA0336 LysR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003015916.1"
                     /db_xref="GI:253686726"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:8131235"
                     /translation="MKVTLEELQAFVVVIDTGSITAAAEQLGQTTSGISRALRRLEDK
                     LGTTLLHRTTRRLSLSEEGTMFLEHARGVLHAVEHAEEQVLLRHEQPSGRLRVNSASA
                     FMQHVIVPLVPEFRRRYPKIILELNTDDFVIDLLEQHTDIAIRIGTLKDSTIHARPLG
                     ASKLHIVASPEYLQQHGTPRTVESLADHICLGFTQVESLNHWPLRHGLQNFYPITPAL
                     LASNGEILRQLALRGEGIVRMSTFLIRDDLAAGRLVPILTEETVEASLPVYAVYYRNS
                     QLAARITCFLDFMSETLTENPL"
     misc_feature    373182..374057
                     /locus_tag="PC1_0321"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    373185..373361
                     /locus_tag="PC1_0321"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    373443..374039
                     /locus_tag="PC1_0321"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(373497..373502,373506..373511,373518..373520,
                     373530..373532,373536..373556,373821..373838,
                     373854..373859,373863..373868)
                     /locus_tag="PC1_0321"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(374110..374691)
                     /locus_tag="PC1_0322"
                     /db_xref="GeneID:8131236"
     CDS             complement(374110..374691)
                     /locus_tag="PC1_0322"
                     /inference="protein motif:PFAM:PF02525"
                     /note="PFAM: NAD(P)H dehydrogenase (quinone);
                     KEGG: eca:ECA0337 putative modulator of drug activity B"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H dehydrogenase (quinone)"
                     /protein_id="YP_003015917.1"
                     /db_xref="GI:253686727"
                     /db_xref="InterPro:IPR003680"
                     /db_xref="GeneID:8131236"
                     /translation="MQNILLIDAGKSFAHSKGELNHTLTEVAASFLRDKGHDVRVTVV
                     DSGYDIEQEIQNYLWADTIIYQMPGWWMDTPWILKKYIDDVFTAGHGSLYASDGRSRS
                     DASKKYGSGGLLQGRKYMLSLTWNAPLEAFDDPEQFFHGVGVDGVYLPFHKANQFIGL
                     SPLPTFICNDVIKAPDVPAYLVNYRQHLDELFA"
     misc_feature    complement(374113..374685)
                     /locus_tag="PC1_0322"
                     /note="Putative NADPH-quinone reductase (modulator of drug
                     activity B) [General function prediction only]; Region:
                     MdaB; COG2249"
                     /db_xref="CDD:225158"
     gene            complement(374894..375757)
                     /locus_tag="PC1_0323"
                     /db_xref="GeneID:8131237"
     CDS             complement(374894..375757)
                     /locus_tag="PC1_0323"
                     /EC_number="4.1.2.40"
                     /inference="protein motif:TFAM:TIGR00167"
                     /note="KEGG: eca:ECA0338 hypothetical protein;
                     TIGRFAM: ketose-bisphosphate aldolase;
                     PFAM: ketose-bisphosphate aldolase class-II"
                     /codon_start=1
                     /transl_table=11
                     /product="ketose-bisphosphate aldolase"
                     /protein_id="YP_003015918.1"
                     /db_xref="GI:253686728"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="GeneID:8131237"
                     /translation="MLISMTDILKPTREHRFAIGAFNVADSCFIRAVVEEAEATNTPA
                     IISIHPSELEFVTDEFFAYVRERTLRSPVPFVIHLDHGASIAHVLRAIQCGFTSVMID
                     GSLLPYEENVALTREVVKLAHAVGVSVEGELGTIGDTGTTIEGGVSKVIYTDPEQAED
                     FVNRTGVDTLAVAIGTAHGIYPKDLKPELQMHILRDISQRVSIPLVLHGGSANPDAEI
                     AEAVTLGVGKINISSDMKFAYFQKAREILSRETWWDPNAIYPEPIKAAKEVIRYKMAL
                     FGSTGKASLYR"
     misc_feature    complement(374915..375745)
                     /locus_tag="PC1_0323"
                     /note="Tagatose-1,6-bisphosphate (TBP) aldolase and
                     related Type B Class II aldolases. TBP aldolase is a
                     tetrameric class II aldolase that catalyzes the reversible
                     condensation of dihydroxyacetone phosphate with
                     glyceraldehyde 3-phsophate to produce tagatose 1; Region:
                     TBP_aldolase_IIB; cd00947"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(375017..375019,375026..375028,
                     375038..375040,375047..375052,375056..375061,
                     375338..375340,375554..375559,375566..375568,
                     375578..375580,375590..375598,375605..375607,
                     375665..375667,375674..375682))
                     /locus_tag="PC1_0323"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(375059..375064,375068..375070,
                     375125..375127,375131..375136,375215..375217,
                     375221..375229,375515..375520))
                     /locus_tag="PC1_0323"
                     /note="active site"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(375134..375136,375224..375226,
                     375515..375517))
                     /locus_tag="PC1_0323"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(375125..375127,375131..375133,
                     375215..375217,375221..375223,375227..375229))
                     /locus_tag="PC1_0323"
                     /note="Na+ binding site [ion binding]; other site"
                     /db_xref="CDD:238477"
     gene            complement(375847..376698)
                     /locus_tag="PC1_0324"
                     /db_xref="GeneID:8131238"
     CDS             complement(375847..376698)
                     /locus_tag="PC1_0324"
                     /EC_number="4.1.2.40"
                     /inference="protein motif:PRIAM:4.1.2.40"
                     /note="PFAM: ketose-bisphosphate aldolase class-II;
                     KEGG: eca:ECA0339 sugar-bisphosphate aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="Tagatose-bisphosphate aldolase"
                     /protein_id="YP_003015919.1"
                     /db_xref="GI:253686729"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="GeneID:8131238"
                     /translation="MYAAMKALIDDAYQQQYAVLAINCFNLETARAAIAAAEQQRAPL
                     ILNVYQGHSAHFPPHLAVPLAKALAEQATVPVALSLDHGTAFSLIGQAFRAGFTGLMI
                     DASSHPLAENILRTQQVVTIAATAGVCVEGELGHIADAPVYDQEDAAVKMTQVEDVVP
                     FIRQTGIDLLAVSVGTAHGMYPPGVTPRIDFERLEALHRESTVPLALHGGSGTKADDI
                     RRVSRHGVAKINVGAAVFEAGKTALQQALHQHPTTELSDLLATMESACRDVVVDYLGW
                     SGSANKA"
     misc_feature    complement(375856..376686)
                     /locus_tag="PC1_0324"
                     /note="Tagatose-1,6-bisphosphate (TBP) aldolase and
                     related Type B Class II aldolases. TBP aldolase is a
                     tetrameric class II aldolase that catalyzes the reversible
                     condensation of dihydroxyacetone phosphate with
                     glyceraldehyde 3-phsophate to produce tagatose 1; Region:
                     TBP_aldolase_IIB; cd00947"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(375958..375960,375967..375969,
                     375979..375981,375988..375993,375997..376002,
                     376276..376278,376495..376500,376507..376509,
                     376519..376521,376531..376539,376546..376548,
                     376606..376608,376615..376623))
                     /locus_tag="PC1_0324"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(376000..376005,376009..376011,
                     376066..376068,376072..376077,376156..376158,
                     376162..376170,376453..376458))
                     /locus_tag="PC1_0324"
                     /note="active site"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(376075..376077,376165..376167,
                     376453..376455))
                     /locus_tag="PC1_0324"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(376066..376068,376072..376074,
                     376156..376158,376162..376164,376168..376170))
                     /locus_tag="PC1_0324"
                     /note="Na+ binding site [ion binding]; other site"
                     /db_xref="CDD:238477"
     gene            complement(376710..377801)
                     /locus_tag="PC1_0325"
                     /db_xref="GeneID:8131239"
     CDS             complement(376710..377801)
                     /locus_tag="PC1_0325"
                     /inference="protein motif:TFAM:TIGR01427"
                     /note="TIGRFAM: PTS system, fructose subfamily, IIC
                     subunit;
                     PFAM: phosphotransferase system EIIC;
                     KEGG: eca:ECA0340 PTS system, IIBC component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system fructose subfamily transporter
                     subunit IIC"
                     /protein_id="YP_003015920.1"
                     /db_xref="GI:253686730"
                     /db_xref="InterPro:IPR003352"
                     /db_xref="InterPro:IPR006327"
                     /db_xref="InterPro:IPR013014"
                     /db_xref="GeneID:8131239"
                     /translation="MNTRKITVGQEIKRHLLTGISWMIPLIVAAGICIALGQVIGGPD
                     VGKQTGSIAWMLNQIGGWGMGLIVPLISAAIAYSIADRPGFAPGLIVGFICGQIQTGF
                     IGGILGGFLVGYTVLLLRRYIKLPTSMQGLMPVMILPLLSTIIAGLLMMTFIGQPIVW
                     LQKSLIHLLESMQGGSKFLMGAILGAMATFDFGGPVNKTMSLFADGMLVDGIYGPEAV
                     KFVGSMIPPFGITLSFLLTRYKYTRAEKEALKAAFPMGICMITEGVIPIAARDLFRVV
                     ASCVVASAIAGGLIMVWGVEAPVPHGGMFVVPLFTKPLMFCLALGIGTAICGVMLSLI
                     KKRVTQADEEFDDVDDSSVRDEDIKFTLE"
     misc_feature    complement(376767..377771)
                     /locus_tag="PC1_0325"
                     /note="Phosphotransferase system, fructose-specific IIC
                     component [Carbohydrate transport and metabolism]; Region:
                     FruA; COG1299"
                     /db_xref="CDD:224218"
     gene            complement(377827..378141)
                     /locus_tag="PC1_0326"
                     /db_xref="GeneID:8131240"
     CDS             complement(377827..378141)
                     /locus_tag="PC1_0326"
                     /inference="protein motif:TFAM:TIGR00829"
                     /note="TIGRFAM: PTS system, fructose-specific, IIB
                     subunnit;
                     PFAM: phosphotransferase system PTS fructose-specific IIB
                     subunit;
                     KEGG: eca:ECA0341 PTS system, IIB component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system fructose-specific transporter subunit
                     IIB"
                     /protein_id="YP_003015921.1"
                     /db_xref="GI:253686731"
                     /db_xref="InterPro:IPR003353"
                     /db_xref="InterPro:IPR013011"
                     /db_xref="GeneID:8131240"
                     /translation="MNIVCVAACTAGIAHTYIAREKLIKGANALNYAIKVETQGTIGT
                     ENELTPDEIAAADVVILAIDIKITGEERFKGKPIVRVKTEVVIKSPIKFLEKVASSLA
                     GA"
     misc_feature    complement(377845..378135)
                     /locus_tag="PC1_0326"
                     /note="PTS_IIB_fructose: subunit IIB of enzyme II (EII) of
                     the fructose-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In this system, EII (also
                     referred to as FruAB) is a fructose-specific permease made
                     up of two proteins (FruA and...; Region: PTS_IIB_fructose;
                     cd05569"
                     /db_xref="CDD:99911"
     misc_feature    complement(order(378094..378102,378106..378117))
                     /locus_tag="PC1_0326"
                     /note="P-loop; other site"
                     /db_xref="CDD:99911"
     misc_feature    complement(order(378094..378099,378106..378111,
                     378115..378117))
                     /locus_tag="PC1_0326"
                     /note="active site"
                     /db_xref="CDD:99911"
     misc_feature    complement(378115..378117)
                     /locus_tag="PC1_0326"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99911"
     gene            complement(378155..378634)
                     /locus_tag="PC1_0327"
                     /db_xref="GeneID:8131241"
     CDS             complement(378155..378634)
                     /locus_tag="PC1_0327"
                     /inference="protein motif:TFAM:TIGR00848"
                     /note="TIGRFAM: PTS system, fructose subfamily, IIA
                     subunit;
                     PFAM: phosphoenolpyruvate-dependent sugar
                     phosphotransferase system EIIA 2;
                     KEGG: eca:ECA0342 PTS system, EIIA component"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PTS IIA-like nitrogen-regulatory
                     protein PtsN"
                     /protein_id="YP_003015922.1"
                     /db_xref="GI:253686732"
                     /db_xref="InterPro:IPR002178"
                     /db_xref="InterPro:IPR004715"
                     /db_xref="GeneID:8131241"
                     /translation="MDINKILNVNRVKLTMSATNKDEAINELTDLLYADGAITNKQDF
                     IHDVWLREAEGSTGFENHIAIPHGKSSAVKQTTLAIGRTRHDIPWETLDGSQVRCIIL
                     FAVRLEDQNTTHIRLLSQVASALADDEVIAQLLDESDPHKIIRLFSQYAETAPVTPT"
     misc_feature    complement(378194..378616)
                     /locus_tag="PC1_0327"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    complement(order(378434..378436,378482..378484))
                     /locus_tag="PC1_0327"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    complement(378434..378436)
                     /locus_tag="PC1_0327"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            complement(378682..380232)
                     /locus_tag="PC1_0328"
                     /db_xref="GeneID:8131242"
     CDS             complement(378682..380232)
                     /locus_tag="PC1_0328"
                     /inference="protein motif:PFAM:PF00874"
                     /note="PFAM: PRD domain protein; Helix-turn-helix type 11
                     domain protein; M trans-acting positive regulator;
                     regulatory protein DeoR;
                     KEGG: eca:ECA0343 PTS system regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional antiterminator BglG"
                     /protein_id="YP_003015923.1"
                     /db_xref="GI:253686733"
                     /db_xref="InterPro:IPR001034"
                     /db_xref="InterPro:IPR007737"
                     /db_xref="InterPro:IPR011608"
                     /db_xref="InterPro:IPR013011"
                     /db_xref="InterPro:IPR013196"
                     /db_xref="GeneID:8131242"
                     /translation="MMQPLTSRQNRLLKYLLQHQGYVTVKDIAHYLDVSEKTVYRDMQ
                     FVEAFLSVWNIYPDKKVGAGIMLTTDDDRHLTLLEQQIVVDDGETDALINNARRVKIA
                     SQLLSDTPHETSISKLSERYFISSASIVNDLKIIESWLHPLGLALVRSQSGTHIEGSE
                     NQVRHAMASLINDVMHHKEPGPLNHSRLDPGSYKALINYFGEEDVSFVESLLQDMERQ
                     LSYPLGEPYYINIFTHTLIMMHRIAQGKALMMAEESVHQQVDNRIFSIAQNMVSQIEQ
                     RVESTLPSDEVWFIYQYIISSGIVMEERADNQLLRYQFSNGESRRITHALTQIFSDLI
                     NIDLRTDKLLHEGLLIHIKPLLNRLKYQIHIRNPLLDDIKSEFIDIYDMTQQAMDEVC
                     QRFQLKPVAEDEIGYLTIHFQAALERQIAHKRILVVCSSGVGTSHLLKNRILRAFPDW
                     IIVGVVSASNMQRFCQQEEIELIISTIHLEEQHIPVVYVSAFFNDDDIKRVTEKVIAN
                     QLHQAVPH"
     misc_feature    complement(378718..380220)
                     /locus_tag="PC1_0328"
                     /note="Transcriptional antiterminator [Transcription];
                     Region: BglG; COG3711"
                     /db_xref="CDD:226234"
     misc_feature    complement(<380083..380205)
                     /locus_tag="PC1_0328"
                     /note="HTH domain; Region: HTH_11; pfam08279"
                     /db_xref="CDD:254705"
     misc_feature    complement(379723..>379905)
                     /locus_tag="PC1_0328"
                     /note="Mga helix-turn-helix domain; Region: Mga;
                     pfam05043"
                     /db_xref="CDD:252967"
     misc_feature    complement(379342..379608)
                     /locus_tag="PC1_0328"
                     /note="PRD domain; Region: PRD; pfam00874"
                     /db_xref="CDD:250194"
     misc_feature    complement(378988..379263)
                     /locus_tag="PC1_0328"
                     /note="PRD domain; Region: PRD; pfam00874"
                     /db_xref="CDD:250194"
     misc_feature    complement(378718..378966)
                     /locus_tag="PC1_0328"
                     /note="PTS_IIB_bgl_like: the PTS (phosphotransferase
                     system) IIB domain of a family of sensory systems composed
                     of a membrane-bound sugar-sensor (similar to BglF) and a
                     transcription antiterminator (similar to BglG) which
                     regulate expression of genes involved...; Region:
                     PTS_IIB_bgl_like; cd05568"
                     /db_xref="CDD:99910"
     misc_feature    complement(order(378925..378933,378937..378948))
                     /locus_tag="PC1_0328"
                     /note="P-loop; other site"
                     /db_xref="CDD:99910"
     misc_feature    complement(order(378925..378930,378937..378942,
                     378946..378948))
                     /locus_tag="PC1_0328"
                     /note="active site"
                     /db_xref="CDD:99910"
     misc_feature    complement(378946..378948)
                     /locus_tag="PC1_0328"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99910"
     gene            complement(380668..383070)
                     /locus_tag="PC1_0329"
                     /db_xref="GeneID:8131243"
     CDS             complement(380668..383070)
                     /locus_tag="PC1_0329"
                     /inference="protein motif:PFAM:PF00593"
                     /note="PFAM: TonB-dependent receptor; TonB-dependent
                     receptor plug;
                     KEGG: kpe:KPK_1035 TonB-dependent receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="YP_003015924.1"
                     /db_xref="GI:253686734"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR010917"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:8131243"
                     /translation="MLINKNLNKILLTGILTGVALNSMAADSTTGNNALNGKSQDNSA
                     AKAEQTDDVMTVKSPKIEKKAGSSTTLTAADMQKEGGNNFGTIMRYQPLVSATGASGG
                     SNTGKSGFDRGGYTGYNIRGIESNRVAIDTDGIALPNATGRSYASRAGFNTFGMGRDY
                     IDPYVYSSVDIESGVTSAENTINALGGSVSFRPKSADDYLKAGKQDYFGLQSDFDSAN
                     HGWHNGITAAGGDDELRGVVVLSRRDGQQTRNNSDEIAAYPANWHSNAILASGIWQAN
                     DEHQLTGTLDYYHKTNHTHYDYWGNLPSGNNTIYGTAQQSSETRRWTASLKDRWTPVN
                     NTLVDLVDSRIYFQNSESHDNTWLPATTGMAAADSHRVYSDYNVTTYGFDTHMVKSWD
                     RHEFSWGLNASQSKTERPFRQSPNQTGANNIMQPEADSNSYTVGGFVQDTVTWDLAGH
                     AFSVVPAVRAIHQRTKPTNTVRLSGDGSVISESDVNRLYGKANSDTQVLPALSFLYDI
                     TPTLTTYLQYRRGAQFPDASQLYGSTNLDANYAGPFQYAFIGNSDLKTETSNNVEWGL
                     KGEATEGITFRTALFYNTYKNFIANTRYRRSANPDKFTNVPSNISTIYQAENRDKAYI
                     YGGEVSSKIQLGTWFPAVDGLSTTLAFGYTKGQSQSRYLGDRYVDLDSVAPMKAVIGI
                     AYDDPSQRYGAAVTSTFQKGKQAKDTSRESYTNAGSAITTSSTEYMRIPGYGMVDLTA
                     YYRVTKNVKINGGVYNLTDRKYWDYLSSRQIETNDRQGQYDRALSVQPGRTFQLGVNV
                     DF"
     misc_feature    complement(380671..382878)
                     /locus_tag="PC1_0329"
                     /note="TonB-dependent hemoglobin/transferrin/lactoferrin
                     receptor family protein; Region: TonB-hemlactrns;
                     TIGR01786"
                     /db_xref="CDD:233577"
     misc_feature    complement(380671..382872)
                     /locus_tag="PC1_0329"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(382492..382518,382552..382584,
                     382660..382683,382702..382719,382786..382815,
                     382843..382872))
                     /locus_tag="PC1_0329"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(381943..381945,382015..382017))
                     /locus_tag="PC1_0329"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            383321..383656
                     /locus_tag="PC1_0330"
                     /db_xref="GeneID:8131244"
     CDS             383321..383656
                     /locus_tag="PC1_0330"
                     /inference="similar to AA sequence:KEGG:ECA0344"
                     /note="KEGG: eca:ECA0344 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015925.1"
                     /db_xref="GI:253686735"
                     /db_xref="GeneID:8131244"
                     /translation="MKLPTYETDHYELDDGEALNREYPDSFWIPDKEVRESLVPDDFV
                     KLIFRMEKTAGADELSVERMWVRVTTKYRALYQGVLDNTPTGSDCVRCGQIVTFHACH
                     VIGIYEKDE"
     misc_feature    383381..>383590
                     /locus_tag="PC1_0330"
                     /note="Infectious salmon anaemia virus haemagglutinin;
                     Region: ISAV_HA; pfam06215"
                     /db_xref="CDD:114907"
     gene            383757..384260
                     /locus_tag="PC1_0331"
                     /db_xref="GeneID:8131245"
     CDS             383757..384260
                     /locus_tag="PC1_0331"
                     /inference="similar to AA sequence:KEGG:Bcen2424_3695"
                     /note="KEGG: bch:Bcen2424_3695 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015926.1"
                     /db_xref="GI:253686736"
                     /db_xref="GeneID:8131245"
                     /translation="MSIEIPESVLPLFQAAGWPCATTQSVPPFVPENHPAFIILHTFG
                     GLTVGQCGAGEACASGDIIFGSSEDLQEDETLLEWQGILNTTLILIGETHHSHGALLM
                     DSAGICYGMSFIHEAFWFEGADFGTAVERILLGRKGKPMLRPDQSSISVYGETITADH
                     PNVYRYR"
     misc_feature    383772..384164
                     /locus_tag="PC1_0331"
                     /note="SUKH-3 immunity protein; Region: SUKH-3; pfam14433"
                     /db_xref="CDD:258587"
     gene            384435..386705
                     /locus_tag="PC1_0332"
                     /db_xref="GeneID:8131246"
     CDS             384435..386705
                     /locus_tag="PC1_0332"
                     /EC_number="5.99.1.3"
                     /inference="protein motif:TFAM:TIGR01062"
                     /note="KEGG: eca:ECA0345 DNA topoisomerase IV subunit A;
                     TIGRFAM: DNA topoisomerase IV, A subunit;
                     PFAM: DNA gyrase/topoisomerase IV subunit A; DNA gyrase
                     repeat beta-propeller;
                     SMART: DNA gyrase/topoisomerase IV subunit A"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="YP_003015927.1"
                     /db_xref="GI:253686737"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR005742"
                     /db_xref="InterPro:IPR006691"
                     /db_xref="GeneID:8131246"
                     /translation="MSEMTHDGAESLALRTFTENAYLNYSMYVIMDRALPFIGDGLKP
                     VQRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYP
                     LVDGQGNWGAPDDPKSFAAMRYTESRLSKYAEILLSELGQGTVDYTPNFDGTMQEPKM
                     LPARLPNILLNGTTGIAVGMATDIPPHNVREVAAAAVMLLENPKASLDDLLQHVQGPD
                     FPTEAEIITPRDEVRKLYQNGRGSVRMRAVWKKEDGDVVITALPHQVSGAKVLEQIAS
                     QMRAKKLPMVEDLRDESDHENPTRLVLVPRSNRIDMDQVMNHLFATTDLEKSYRVNMN
                     MIGLDGRPSVKGLVEILSEWLVFRRDTVCRRLNYRLEKVLKRLHILEGLLIAFLNIDE
                     VIHIIRTEDEPKPVLMRQFSLSETQAEAILELKLRHLAKLEEMKIRGEQDDLAKERDQ
                     LQALLASDRKLSNLIKKEIQADAQTYGDDRRSPLYERSEAKAMSEHDFVPSEPVTIVL
                     SEMGWVRSAKGHDIDPAGLSYKAGDSFRAAAKGKSNQPVVFIDSTGRSYALDPITLPS
                     ARGQGEPLTGKLTPPPGATIEQVLMAADDQPLLMASDAGYGFVCTFNDLVARNRAGKA
                     IITLPDNAKALAPMEIHGDDNLLMAITAAGRMLLFPVSDLPQLSKGKGNKIVSISSAD
                     FAEGKDRLTWLYLLPPQASVTLYFGKRKLVLRPNELQKYQGERGRKGTLLRGLQRIDR
                     IEVDAPQQISTGSSEE"
     misc_feature    384435..386657
                     /locus_tag="PC1_0332"
                     /note="DNA topoisomerase IV subunit A; Validated; Region:
                     PRK05561"
                     /db_xref="CDD:235503"
     misc_feature    384525..385847
                     /locus_tag="PC1_0332"
                     /note="DNA Topoisomerase, subtype IIA; domain A';
                     bacterial DNA topoisomerase IV (C subunit, ParC),
                     bacterial DNA gyrases (A subunit, GyrA),mammalian DNA
                     toposiomerases II. DNA topoisomerases are essential
                     enzymes that regulate the conformational changes...;
                     Region: TOP4c; cd00187"
                     /db_xref="CDD:238111"
     misc_feature    order(384525..384608,384621..384770,384774..384779,
                     384783..384833,384837..384908,384915..384917)
                     /locus_tag="PC1_0332"
                     /note="CAP-like domain; other site"
                     /db_xref="CDD:238111"
     misc_feature    384804..384806
                     /locus_tag="PC1_0332"
                     /note="active site"
                     /db_xref="CDD:238111"
     misc_feature    order(385596..385604,385611..385622,385644..385649,
                     385689..385739)
                     /locus_tag="PC1_0332"
                     /note="primary dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238111"
     gene            386857..387594
                     /locus_tag="PC1_0333"
                     /db_xref="GeneID:8131247"
     CDS             386857..387594
                     /locus_tag="PC1_0333"
                     /EC_number="2.3.1.51"
                     /inference="protein motif:TFAM:TIGR00530"
                     /note="KEGG: eca:ECA0346 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase;
                     TIGRFAM: 1-acyl-sn-glycerol-3-phosphate acyltransferase;
                     PFAM: phospholipid/glycerol acyltransferase;
                     SMART: phospholipid/glycerol acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="YP_003015928.1"
                     /db_xref="GI:253686738"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR004552"
                     /db_xref="GeneID:8131247"
                     /translation="MLSILRFLVVVIFSILVCIFGLFYCLFSPRNPRHVATFGHLFGR
                     LSTVFGLKVEMRIPEEAAHYGNCIYIANHQNNYDMVTVSKAVQPRTVTVGKKSLLWIP
                     FFGPLYWLTGNLLIDRENRAKAHGTIAQVVKHIKERNTSIWMFPEGTRSRGRGLLPFK
                     TGAFHAAISAEVPIVPICVSTTSNKVKLNRWNNGLVIVEMLPPIDTRAYTKDQVRELA
                     THCHDVMAAKIAELDAEVAAREAADKK"
     misc_feature    386998..387522
                     /locus_tag="PC1_0333"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    order(387073..387075,387082..387084,387088..387090,
                     387136..387147,387298..387306)
                     /locus_tag="PC1_0333"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     gene            387696..389111
                     /locus_tag="PC1_0334"
                     /db_xref="GeneID:8131248"
     CDS             387696..389111
                     /locus_tag="PC1_0334"
                     /inference="protein motif:PFAM:PF07732"
                     /note="PFAM: multicopper oxidase type 3; multicopper
                     oxidase type 2;
                     KEGG: eca:ECA0347 repressor protein for FtsI"
                     /codon_start=1
                     /transl_table=11
                     /product="multicopper oxidase type 3"
                     /protein_id="YP_003015929.1"
                     /db_xref="GI:253686739"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="GeneID:8131248"
                     /translation="MSLSRRQFIQASGLALCAGMTPLAAKASGNSAALPIPPLLESRR
                     GQPLFLTMQRAHWAFSGDRKTAIWGINGRYLGPTVRVYDGDDVKLIYSNRLNEPVAMT
                     IGGLQVPGPLMGGAARIISPGTDWSPVVPIRQPSATCWYHANTPNRMAPHIYNGLAGL
                     WLVEDRASKALPLPNHYGVDDFPLIIQDKRLDNFGVPIYSPPSNGGFVGDSLLVNGIQ
                     NPFVEVSRGWVRLRLLNASNSRRYVMRLSDGRAMHVIASDQGLLPAPMAVNQLSLAPG
                     ERREILIDMSQGEDVTLTAGESAGIMDRLRGLFEPSSILISTQILTLKPTGLLPLVTD
                     NLPMRLLADNIIEGSISRTREFRLGDSLPGINGAMWDMTRADVQTQLGRCERWIIHAD
                     TPQAFHIQGVKFLVRSANGGPPAVEDSGWKDTVWVDNDVELLVYFMQPSSMAFPFLYY
                     SQTLELADRGSTGQLIVQSAM"
     misc_feature    387696..389108
                     /locus_tag="PC1_0334"
                     /note="FtsI repressor; Provisional; Region: PRK10883"
                     /db_xref="CDD:182808"
     misc_feature    387831..388190
                     /locus_tag="PC1_0334"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:267468"
     misc_feature    388233..388670
                     /locus_tag="PC1_0334"
                     /note="The second Cupredoxin domain of the multicopper
                     oxidase CueO, the cell division protein FtsP, and similar
                     proteins; Region: CuRO_2_CueO_FtsP; cd13867"
                     /db_xref="CDD:259935"
     misc_feature    order(388239..388250,388260..388262,388326..388328,
                     388335..388346,388356..388358,388383..388385,
                     388389..388391,388395..388397,388467..388475,
                     388521..388523,388527..388529,388650..388652,
                     388656..388661)
                     /locus_tag="PC1_0334"
                     /note="Domain 1 interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259935"
     misc_feature    order(388410..388412,388416..388418,388455..388460,
                     388464..388478,388485..388493,388497..388499,
                     388509..388511,388515..388532)
                     /locus_tag="PC1_0334"
                     /note="Domain 3 interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259935"
     misc_feature    388749..389096
                     /locus_tag="PC1_0334"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:267468"
     gene            389479..390216
                     /locus_tag="PC1_0335"
                     /db_xref="GeneID:8131249"
     CDS             389479..390216
                     /locus_tag="PC1_0335"
                     /inference="protein motif:PFAM:PF07702"
                     /note="PFAM: UbiC transcription regulator-associated
                     domain protein; regulatory protein Crp; regulatory protein
                     GntR HTH;
                     SMART: regulatory protein GntR HTH;
                     KEGG: eca:ECA0348 GntR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_003015930.1"
                     /db_xref="GI:253686740"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR001808"
                     /db_xref="InterPro:IPR011663"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="GeneID:8131249"
                     /translation="MRELLLWVRDQLAGASSAPRYMQLASLLESEIGRRKALAGQFLP
                     AERLIAQQLGLSRVTVSRSLSLLEEKGLIVRQQGVGTRVTQRLNYALSAEDEGFTALV
                     LKQGGIAGSLWLDKVIQVPPAAIAAKMSLPEGEVVTYLRRVRLSNGEPVSLETTWIPQ
                     KFLPDPEALEQSLYQYWVSRGIAPDKKRYRFKAIACAAEIAARLGTAVGTPLLYCQLH
                     VYNEQGELLEYSEAHCRSDVYEIQFAD"
     misc_feature    389521..390201
                     /locus_tag="PC1_0335"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PhnF; COG2188"
                     /db_xref="CDD:225099"
     misc_feature    389533..389730
                     /locus_tag="PC1_0335"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(389533..389535,389539..389541,389608..389610,
                     389614..389619,389641..389655,389659..389664,
                     389671..389673,389701..389706,389710..389721)
                     /locus_tag="PC1_0335"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    389791..390198
                     /locus_tag="PC1_0335"
                     /note="The UbiC transcription regulator-associated (UTRA)
                     domain is a conserved ligand-binding domain; Region: UTRA;
                     smart00866"
                     /db_xref="CDD:214869"
     gene            complement(390259..391086)
                     /locus_tag="PC1_0336"
                     /db_xref="GeneID:8131250"
     CDS             complement(390259..391086)
                     /locus_tag="PC1_0336"
                     /EC_number="1.1.1.274"
                     /inference="protein motif:PRIAM:1.1.1.274"
                     /note="PFAM: aldo/keto reductase;
                     KEGG: eca:ECA0349 2,5-diketo-D-gluconate reductase A"
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-didehydrogluconate reductase"
                     /protein_id="YP_003015931.1"
                     /db_xref="GI:253686741"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="GeneID:8131250"
                     /translation="MTQPKVKLADGNIMPQLGLGVWRASSEDTVIAVTEALSIGYRAI
                     DTAAIYKNEEAVGQALSSANLPREEVFITTKLWNGDHTDPQKALEESLRKLRLDYIDL
                     YLIHWPLPQQNTFVDAWRGLIKLQEQGLAKSIGVSNFHIHHLQRLKEETGVLPVIDQV
                     ELHPLLQQRQLHAWNATHHIQTESWSPLAQGGEGIFDHPVIRKLATKYGKTPAQIVIR
                     WHLDSGLVVIPKSVTPSRIKENFEVFDFRLDKDELGEIAKLDSGKRLGSDPDEPRND"
     misc_feature    complement(390310..391059)
                     /locus_tag="PC1_0336"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(390367..390372,390379..390381,
                     390394..390405,390448..390450,390517..390534,
                     390610..390612,390673..390678,390766..390771,
                     390862..390864,390937..390939,390952..390954,
                     391021..391029))
                     /locus_tag="PC1_0336"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(390769..390771,390862..390864,
                     390937..390939,390952..390954))
                     /locus_tag="PC1_0336"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(391361..392524)
                     /locus_tag="PC1_0337"
                     /db_xref="GeneID:8131251"
     CDS             complement(391361..392524)
                     /locus_tag="PC1_0337"
                     /inference="protein motif:PFAM:PF00465"
                     /note="PFAM: iron-containing alcohol dehydrogenase;
                     KEGG: eca:ECA0350 putative iron-containing alcohol
                     dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-containing alcohol dehydrogenase"
                     /protein_id="YP_003015932.1"
                     /db_xref="GI:253686742"
                     /db_xref="InterPro:IPR001670"
                     /db_xref="GeneID:8131251"
                     /translation="MLNFTLHTPTKILFGEGQIAELGKEIPADARILITYGGGSVKHN
                     GVLDQVYRALEGRNVREFSGIEPNPTYETLMKAVEVVRAEKIDFLLAVGGGSVVDGTK
                     FIAAAADYQAAQDPWHILQTGGAEIDRGVAMAAVLTLPATGSESNNGAVITRKSTNDK
                     LAFRSRYTQPLFAVLDPVVTYTLPARQIANGVVDAFVHTVEQYLTYSVDAKVQDRFAE
                     GLLLTLVEEGPRALAEPENYKVRANVMWSATMALNGLIGAGVPQDWSTHMLGHELTAL
                     HGLDHAQTLAVVLPAMLAARKAQKRDKLLQYAERVWNLRDGSEDQRIDGAIAATRDFF
                     EKMGVPTRMSDYQLDGSSIPTLVAKLNEHGLTALGEHRDITLEESQKIYEAAR"
     misc_feature    complement(391373..392518)
                     /locus_tag="PC1_0337"
                     /note="Butanol dehydrogenase catalyzes the conversion of
                     butyraldehyde to butanol with the cofactor NAD(P)H being
                     oxidized in the process; Region: BDH; cd08187"
                     /db_xref="CDD:173946"
     misc_feature    complement(order(391787..391789,391796..391801,
                     391847..391849,391859..391861,392480..392485,
                     392489..392494,392498..392500))
                     /locus_tag="PC1_0337"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173946"
     misc_feature    complement(order(391682..391684,391724..391726,
                     391931..391933,391943..391945,391976..391981,
                     391988..391990,392045..392047,392072..392074,
                     392078..392080,392084..392086,392093..392095,
                     392099..392101,392108..392113,392228..392230,
                     392237..392245,392321..392326,392405..392413))
                     /locus_tag="PC1_0337"
                     /note="active site"
                     /db_xref="CDD:173946"
     misc_feature    complement(order(391682..391684,391724..391726,
                     391931..391933,391943..391945))
                     /locus_tag="PC1_0337"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173946"
     gene            complement(392528..393268)
                     /locus_tag="PC1_0338"
                     /db_xref="GeneID:8131252"
     CDS             complement(392528..393268)
                     /locus_tag="PC1_0338"
                     /inference="protein motif:PFAM:PF00881"
                     /note="PFAM: nitroreductase;
                     KEGG: eca:ECA0351 nitroreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="YP_003015933.1"
                     /db_xref="GI:253686743"
                     /db_xref="InterPro:IPR000415"
                     /db_xref="GeneID:8131252"
                     /translation="MNKTIELFTSHRSERSYLDKAIPDDVLDAIIQSAHLAPTSVNSQ
                     QVSLIVTRDPERKARIAELAGGQPWIAKAPVFITVVLDMHKTQVGIAMSGKQQHAHES
                     LESLIAGTTDVGIALGTLMAAARSFGLGIVPIGGIRREPQAMIDFLELPELTFPVAGV
                     AIGYVDTPAHQKPRLPLNSFRHDETYHQDVLPAAIEQYNQTLVTHWQQTGRADGDNWG
                     DNTASYYQHIYFPKVLPAILQQGFKLDK"
     misc_feature    complement(392594..393259)
                     /locus_tag="PC1_0338"
                     /note="This family contains NADPH-dependent flavin
                     reductase and oxygen-insensitive nitroreductase. These
                     enzymes are homodimeric flavoproteins that contain one FMN
                     per monomer as a cofactor. Flavin reductase catalyzes the
                     reduction of flavin by using NADPH as...; Region:
                     NfsA_FRP; cd02146"
                     /db_xref="CDD:239060"
     misc_feature    complement(order(392618..392620,392675..392677,
                     392723..392731,392744..392752,392825..392827,
                     392855..392857,392891..392893,392903..392905,
                     392912..392917,392924..392926,392945..392947,
                     393023..393025,393101..393103,393110..393115,
                     393119..393127,393131..393133,393137..393139,
                     393143..393145,393155..393166,393170..393172,
                     393236..393238,393242..393247,393257..393259))
                     /locus_tag="PC1_0338"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239060"
     misc_feature    complement(order(392747..392749,392753..392755,
                     392795..392797,392852..392857,392861..392866,
                     393062..393064,393068..393070,393224..393226,
                     393230..393232,393236..393238))
                     /locus_tag="PC1_0338"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239060"
     misc_feature    complement(order(392642..392644,392651..392656,
                     392753..392755,392759..392761,392852..392857,
                     393143..393145,393224..393226))
                     /locus_tag="PC1_0338"
                     /note="NADPH bind site [chemical binding]; other site"
                     /db_xref="CDD:239060"
     gene            393500..394489
                     /locus_tag="PC1_0339"
                     /db_xref="GeneID:8131253"
     CDS             393500..394489
                     /locus_tag="PC1_0339"
                     /inference="protein motif:PFAM:PF06719"
                     /note="PFAM: AraC-type transcriptional regulator domain
                     protein; helix-turn-helix- domain containing protein AraC
                     type;
                     SMART: helix-turn-helix- domain containing protein AraC
                     type;
                     KEGG: eca:ECA0352 AraC family transcription regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_003015934.1"
                     /db_xref="GI:253686744"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR009594"
                     /db_xref="GeneID:8131253"
                     /translation="MLTEGQCEGLVQNPADQKPIVQELTESQQTVRQRIVRQAIRCST
                     KNWATPSLVPQVKILYTEQHHPRVPVMYEPTIVIIFQGQKIGYVGGKTFQYDPENYLL
                     MTVPLPFECETIASAEHPLVGMAIRIDIQMLQDLLIDIGDDDSAVRPCSCTCGVNSAP
                     LTDEILCAVERLLDAMDNPRDARVLGPTIVREIIYHMLCGERGAALQALVNRHTHFSQ
                     IAKSLRRIENHYADNLNVEQLAAEVNMSISAFHHNFKAVTNTSPLQYLKSYRLHKARV
                     MMINEGLRAGVAAARVGYESVSQFSREFKRYFGATPSDEAARLKASNMVVEES"
     misc_feature    393650..394117
                     /locus_tag="PC1_0339"
                     /note="AraC-type transcriptional regulator N-terminus;
                     Region: AraC_N; pfam06719"
                     /db_xref="CDD:253876"
     misc_feature    394091..394471
                     /locus_tag="PC1_0339"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    394175..394300
                     /locus_tag="PC1_0339"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    <394364..394441
                     /locus_tag="PC1_0339"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(394519..395178)
                     /locus_tag="PC1_0340"
                     /db_xref="GeneID:8131254"
     CDS             complement(394519..395178)
                     /locus_tag="PC1_0340"
                     /inference="protein motif:PFAM:PF09335"
                     /note="PFAM: SNARE associated Golgi protein;
                     KEGG: eca:ECA0353 DedA family membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015935.1"
                     /db_xref="GI:253686745"
                     /db_xref="InterPro:IPR015414"
                     /db_xref="GeneID:8131254"
                     /translation="MSVVHDIIQALWQQDFSALADPHVIWVVYGILFTTLFLENGLLP
                     ASFLPGDSLLLLTGAMIAKGVMSFFPTMILLTIAASLGCWLSYLQGRWLSDTRLVKGW
                     LLQLPAHYHQRAHHLFHRHGLMALLVGRFLAFIRTLLPTMAGISGLNNTRFQIFNWLS
                     GLLWVGGIVTLGYALSHIPLVKRYEDQVMTALILLPIILLISGLIGMAVVVWRKKRAV
                     A"
     misc_feature    complement(394528..395106)
                     /locus_tag="PC1_0340"
                     /note="Uncharacterized membrane-associated protein
                     [Function unknown]; Region: DedA; COG0586"
                     /db_xref="CDD:223659"
     gene            complement(395500..396690)
                     /locus_tag="PC1_0341"
                     /db_xref="GeneID:8131255"
     CDS             complement(395500..396690)
                     /locus_tag="PC1_0341"
                     /inference="protein motif:TFAM:TIGR01324"
                     /note="TIGRFAM: cystathionine beta-lyase;
                     PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
                     protein;
                     KEGG: eca:ECA0354 cystathionine beta-lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase"
                     /protein_id="YP_003015936.1"
                     /db_xref="GI:253686746"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006233"
                     /db_xref="GeneID:8131255"
                     /translation="MTSKKTATALVAAGRSKKFTHGSVNPVIQRASSLVFDTVQDKKH
                     ATINRAKGALFYGRRGTLTHFAFQEAMVELEGGVGCALYPCGAAAISNAILSFVAAGD
                     HILVTESAYEPTQDFCTKVLNKLNVSTTYFNPLIGADIAELIQPNTKVVFLESPGSIT
                     MEVHDVPAIVQAVRRINPEIVIMIDNTWAAGILFKAFDFDIDISIQAGTKYIVGHSDA
                     MLGTAVANERCWAQLREHSYLMGQMVDADTAYVASRGLRTLGVRLKQHQESSIRIAKW
                     LAERPEVAVVNHPALPECKGHEFYVRDFNGCNGLFSFVLKEKLSKETLAHYLDHFEHF
                     SMAYSWGGFESLILANQPEELAAIRPASGVDFTGTLIRLHIGLEDSDDLIDDLAAGFS
                     RLSA"
     misc_feature    complement(395506..396690)
                     /locus_tag="PC1_0341"
                     /note="cystathionine beta-lyase; Provisional; Region:
                     PRK08114"
                     /db_xref="CDD:181231"
     misc_feature    complement(order(396061..396063,396070..396072,
                     396127..396129,396136..396138,396229..396231,
                     396421..396423,396430..396435))
                     /locus_tag="PC1_0341"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(396061..396063)
                     /locus_tag="PC1_0341"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(396934..398226)
                     /locus_tag="PC1_0342"
                     /db_xref="GeneID:8131256"
     CDS             complement(396934..398226)
                     /locus_tag="PC1_0342"
                     /inference="protein motif:TFAM:TIGR00786"
                     /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
                     subunit;
                     PFAM: TRAP C4-dicarboxylate transport system permease DctM
                     subunit;
                     KEGG: eca:ECA0355 DedA family membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP dicarboxylate transporter subunit DctM"
                     /protein_id="YP_003015937.1"
                     /db_xref="GI:253686747"
                     /db_xref="InterPro:IPR004681"
                     /db_xref="InterPro:IPR010656"
                     /db_xref="GeneID:8131256"
                     /translation="MDAFILIASLAVLLAVGVPVAYAVGLSAIVGALWIDLPLEAVMI
                     QVTNGVNKFSLLAIPFFILAGAIMAEGGIARRLVSFAYIFVGFIRGGLSLVNIVASTF
                     FGAISGSSVADTASIGSVMIPEMEKKGYPRDFSAAVTASGSVQAILTPPSHNSVIYSL
                     ATGGTVSIASLFIAGILPGLLLSLTMMVMCVGFAHRRGYPKGERVPFRQALKIFVDTL
                     WGLMTVVIIMGGILSGIFTATESAAIACLWSFFVTMFIYKDYKWSELPKLMYRTVKTV
                     TIVMILIGFAAAFGAIMTYMQLPARITEFFTSISDNKYVILMCINIMLLLLGTLMDMA
                     PLILILTPVLLPVALSLGIDPVHFGMIMLVNLGIGLITPPVGSVLFVASAVSKQKIEQ
                     VVKAMLPFYCGLFLVLMLVTYIPAISLWLPKLFGVHTG"
     misc_feature    complement(396976..398208)
                     /locus_tag="PC1_0342"
                     /note="DctM-like transporters; Region: DctM; pfam06808"
                     /db_xref="CDD:253922"
     misc_feature    complement(396949..398091)
                     /locus_tag="PC1_0342"
                     /note="TRAP-type C4-dicarboxylate transport system, large
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctQ; COG1593"
                     /db_xref="CDD:224509"
     gene            complement(398242..398748)
                     /locus_tag="PC1_0343"
                     /db_xref="GeneID:8131257"
     CDS             complement(398242..398748)
                     /locus_tag="PC1_0343"
                     /inference="protein motif:PFAM:PF04290"
                     /note="PFAM: Tripartite ATP-independent periplasmic
                     transporter DctQ component;
                     KEGG: eca:ECA0356 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Tripartite ATP-independent periplasmic
                     transporter DctQ component"
                     /protein_id="YP_003015938.1"
                     /db_xref="GI:253686748"
                     /db_xref="InterPro:IPR007387"
                     /db_xref="GeneID:8131257"
                     /translation="MAQSYLSSMDVLYRIAMWVSGLALLIMTIVIPVGIFARYVLNAA
                     LSWPEPISIICMVTFTFVGAAVSYRSNSHIAVSMLTDRLPESGKKICVHLSNLLMLLI
                     SLFILYYSTLLCLELWEQPVAEFPLLTAGESYLPLPIGSLITVLFIIEKMFFGPQDKR
                     PVVMLGSS"
     misc_feature    complement(398248..398748)
                     /locus_tag="PC1_0343"
                     /note="TRAP-type C4-dicarboxylate transport system, small
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctM; COG3090"
                     /db_xref="CDD:225632"
     gene            complement(398863..399840)
                     /locus_tag="PC1_0344"
                     /db_xref="GeneID:8131258"
     CDS             complement(398863..399840)
                     /locus_tag="PC1_0344"
                     /inference="protein motif:TFAM:TIGR00787"
                     /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
                     subunit;
                     PFAM: TRAP dicarboxylate transporter- DctP subunit;
                     KEGG: eca:ECA0357 substrate-binding periplasmic protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP dicarboxylate transporter subunit DctP"
                     /protein_id="YP_003015939.1"
                     /db_xref="GI:253686749"
                     /db_xref="InterPro:IPR004682"
                     /db_xref="GeneID:8131258"
                     /translation="MKLSKTLIGVCLGSTALLMSHAIQAQQIKASDVHPEGYPNVVAV
                     QKMGEKLKAATGGRLEIKTFPGGVLGDEKQMIEQAQIGAIDIIRVSMTPVAAILPEIE
                     VFTLPYIFRDEDHMHKVLDGKIGQEIGDKITQSSKSKLVFLGWMDAGTRNLITKEPVV
                     KPEDLKGMKIRVQGSPVALATLKAMGANSIAMGVSEVFSGMQTGVIDGTENNPPTFVA
                     HNYLPVVKNYTWSRHFIIPELFLYSKTKWDKLSKEDQDLILKLAKEAQQEQRVLWNEY
                     TQQSLDKMKAGGVQFHDIDTEYYFKATQPVRDQFGAKYQDLIKAVADVK"
     misc_feature    complement(398866..399840)
                     /locus_tag="PC1_0344"
                     /note="TRAP-type C4-dicarboxylate transport system,
                     periplasmic component [Carbohydrate transport and
                     metabolism]; Region: DctP; COG1638"
                     /db_xref="CDD:224553"
     gene            400541..401551
                     /locus_tag="PC1_0345"
                     /db_xref="GeneID:8131259"
     CDS             400541..401551
                     /locus_tag="PC1_0345"
                     /inference="protein motif:TFAM:TIGR02797"
                     /note="TIGRFAM: tonB-system energizer ExbB;
                     PFAM: MotA/TolQ/ExbB proton channel;
                     KEGG: eca:ECA0358 biopolymer transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="tonB-system energizer ExbB"
                     /protein_id="YP_003015940.1"
                     /db_xref="GI:253686750"
                     /db_xref="InterPro:IPR002898"
                     /db_xref="InterPro:IPR014164"
                     /db_xref="GeneID:8131259"
                     /translation="MKTAVSNTTQQVLSTWQKKRGAFSAFSRSVLVILLCTAGLSGNA
                     FAAPATAPLSTENAATASQPAVASPAAPVTADVQAPASALALPASAAPGTNNLMKTDL
                     SVWGMYQHADAVVKTVMIGLLLASVITWAIFFSKSVEMSGAKRRLRREYLALEQAKTL
                     DDALETADAFKTGSVAQQLLVDAQNELELSARSDDNNGIKERTAFRLERRVAATGRHM
                     GRGNGYLATVGAVAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIG
                     LVAAIPAVVIYNVFARSIASYKAMVGDVAAQVLLLQSRDLDVAASNDNRASSAAHKLR
                     VG"
     misc_feature    400820..401548
                     /locus_tag="PC1_0345"
                     /note="biopolymer transport protein ExbB; Provisional;
                     Region: PRK10414"
                     /db_xref="CDD:236685"
     gene            401555..401980
                     /locus_tag="PC1_0346"
                     /db_xref="GeneID:8131260"
     CDS             401555..401980
                     /locus_tag="PC1_0346"
                     /inference="protein motif:TFAM:TIGR02803"
                     /note="TIGRFAM: TonB system transport protein ExbD;
                     PFAM: Biopolymer transport protein ExbD/TolR;
                     KEGG: eca:ECA0359 biopolymer transport protein ExbD"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB system transport protein ExbD"
                     /protein_id="YP_003015941.1"
                     /db_xref="GI:253686751"
                     /db_xref="InterPro:IPR003400"
                     /db_xref="InterPro:IPR014170"
                     /db_xref="GeneID:8131260"
                     /translation="MAMHLKEDVSDDGEMHDINVTPFIDVMLVLLIIFMVAAPLATVD
                     IRVDLPASSAAPQPRPEKPLYLTVKADKQMFLGEEVVSEQSLAQVLDAKTSANKETTI
                     FFQADKSVDYETIMSVMDSLRKAGYLKVGLVGAETAAAK"
     misc_feature    401555..401977
                     /locus_tag="PC1_0346"
                     /note="biopolymer transport protein ExbD; Provisional;
                     Region: PRK11267"
                     /db_xref="CDD:183064"
     gene            complement(402090..403109)
                     /locus_tag="PC1_0347"
                     /db_xref="GeneID:8131261"
     CDS             complement(402090..403109)
                     /locus_tag="PC1_0347"
                     /inference="protein motif:TFAM:TIGR02417"
                     /note="KEGG: eca:ECA0360 sucrose operon repressor;
                     TIGRFAM: D-fructose-responsive transcription factor;
                     PFAM: regulatory protein LacI; periplasmic binding
                     protein/LacI transcriptional regulator;
                     SMART: regulatory protein LacI"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_003015942.1"
                     /db_xref="GI:253686752"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="InterPro:IPR012781"
                     /db_xref="GeneID:8131261"
                     /translation="MKPTKRITISDIAALAGVSKSTASLVLNGRSKEFRVSDETRDRI
                     LAVAHEQRYQPSIHARSLRSSRSNTLGLVVPEMTNYGFAVISRELEMLCREAGLQLLI
                     ACTDENASQEMMAVNSLVQRQVDGLIVASSLLSDIEYQKINQQLPVIQFDRVIGDSTL
                     PMVISEAVESTAEMVERIARQHRDEFYFLGGQPRISPTRHRLEGFQLGLARTGIDCKP
                     EWIIHGSYHPSAGYEMFAQLCATLGRPPKALFVAACGLMEGVLRYMNQHNLMESGIRL
                     CCFDDHYLFDCLPLKIDTVAQDCENLARNSFEMVTSLIAQQPLEEDRRYIPTRIHWRH
                     PDSRA"
     misc_feature    complement(402108..403088)
                     /locus_tag="PC1_0347"
                     /note="D-fructose-responsive transcription factor; Region:
                     fruct_sucro_rep; TIGR02417"
                     /db_xref="CDD:131470"
     misc_feature    complement(402918..403079)
                     /locus_tag="PC1_0347"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(402921..402926,402930..402935,
                     402942..402944,402951..402953,402990..402992,
                     402999..403004,403026..403028,403035..403040,
                     403044..403058))
                     /locus_tag="PC1_0347"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(402924..402953)
                     /locus_tag="PC1_0347"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(402117..402905)
                     /locus_tag="PC1_0347"
                     /note="Ligand binding domain of DNA transcription
                     repressor specific for fructose (FruR) and its close
                     homologs; Region: PBP1_FruR; cd06274"
                     /db_xref="CDD:107269"
     misc_feature    complement(order(402243..402245,402249..402251,
                     402336..402338,402744..402746,402798..402800,
                     402804..402806,402813..402815,402828..402830,
                     402837..402842,402846..402851,402879..402881))
                     /locus_tag="PC1_0347"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107269"
     misc_feature    complement(order(402270..402272,402351..402353,
                     402507..402509,402615..402626,402657..402662,
                     402855..402857,402867..402869))
                     /locus_tag="PC1_0347"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107269"
     gene            complement(403140..404549)
                     /locus_tag="PC1_0348"
                     /db_xref="GeneID:8131262"
     CDS             complement(403140..404549)
                     /locus_tag="PC1_0348"
                     /inference="protein motif:TFAM:TIGR01322"
                     /note="KEGG: eca:ECA0361 sucrose-6-phosphate hydrolase;
                     TIGRFAM: sucrose-6-phosphate hydrolase;
                     PFAM: Glycosyl hydrolase family 32 domain protein;
                     SMART: glycoside hydrolase family 32"
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose-6-phosphate hydrolase"
                     /protein_id="YP_003015943.1"
                     /db_xref="GI:253686753"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR006232"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="GeneID:8131262"
                     /translation="MKEVHLLKRMAHALMSGHSRKQEDPYRPEWHLSPCVGLLNDPNG
                     FIHHKGRYHLFYQWNPLSCAHGAKFWGHWSSADLVNWTHEPVALVPSESYESHGCYSG
                     SAVVDQGAIMLMYTGNVKYDDGSRTAFQCLARENPNGEYDKLGAVLTLPDGYTGHVRD
                     PKVWRHDDHWYMVLGAQDLDLQGKVLLYRSDDLLAWEKVGEIAGSRLGGLGDFGYMWE
                     CPDLFPLDGKDVLICCPQGVPAEEERYLNTFQAGYVIGSLNYNNGAYPHQDFHELDLG
                     FEFYAPQTTLSEDGRRLLFGWMSIPDENEFFEPTIEYGWIHTMTCPRELTLRGDRVYQ
                     RPARELQQLRRQHYTWHGAADYASPLHTSSAEILIAVQGEFQLSLASQLVLCWDGERV
                     TLSRRNRRTGEPEHRYWRGELSQLQILCDRSSVEIFINDGEAVMSARYFPESEATMTF
                     SGSGRLTLQHWLLAPCVIE"
     misc_feature    complement(403224..404510)
                     /locus_tag="PC1_0348"
                     /note="sucrose-6-phosphate hydrolase; Region: scrB_fam;
                     TIGR01322"
                     /db_xref="CDD:233357"
     misc_feature    complement(403533..404441)
                     /locus_tag="PC1_0348"
                     /note="Glycosyl hydrolase family 32, beta-fructosidases;
                     Region: GH32_B_Fructosidase; cd08996"
                     /db_xref="CDD:185737"
     misc_feature    complement(order(403896..403898,404070..404075,
                     404247..404252,404379..404381,404427..404432))
                     /locus_tag="PC1_0348"
                     /note="substrate binding [chemical binding]; other site"
                     /db_xref="CDD:185737"
     misc_feature    complement(order(403896..403898,404070..404072,
                     404427..404429))
                     /locus_tag="PC1_0348"
                     /note="active site"
                     /db_xref="CDD:185737"
     misc_feature    complement(403254..403454)
                     /locus_tag="PC1_0348"
                     /note="Glycosyl hydrolases family 32 C terminal; Region:
                     Glyco_hydro_32C; pfam08244"
                     /db_xref="CDD:254688"
     gene            complement(404549..405919)
                     /locus_tag="PC1_0349"
                     /db_xref="GeneID:8131263"
     CDS             complement(404549..405919)
                     /locus_tag="PC1_0349"
                     /inference="protein motif:TFAM:TIGR01996"
                     /note="TIGRFAM: PTS system, sucrose-specific IIBC subunit;
                     PTS system, glucose-like IIB subunint; PTS system, maltose
                     and glucose-specific subfamily, IIC subunit;
                     PFAM: phosphotransferase system EIIC; phosphotransferase
                     system PTS EIIB protein;
                     KEGG: eca:ECA0362 PTS system, sucrose-specific IIBC
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system sucrose-specific transporter subunit
                     IIBC"
                     /protein_id="YP_003015944.1"
                     /db_xref="GI:253686754"
                     /db_xref="InterPro:IPR001996"
                     /db_xref="InterPro:IPR003352"
                     /db_xref="InterPro:IPR004719"
                     /db_xref="InterPro:IPR010973"
                     /db_xref="InterPro:IPR011535"
                     /db_xref="InterPro:IPR013013"
                     /db_xref="GeneID:8131263"
                     /translation="MDINKTAAALIPLLGGKENIASAAHCATRLRLVLNDDNLADKKA
                     IENVDGVKGCFQNAGQMQIIFGTGLVNKVYAEFIKAAGISESSKSEAASIAAKKLNPL
                     QRLARLLSNIFVPIMPAIIASGLLMGLLGMIKTYGWVDASSAIFVMLDMFSSAAFIIL
                     PILIGFTAAREFGGNPYLGATLGGILTHPALTNAWGVAGGFQTMHFFGMDIAMIGYQG
                     TVFPVLLAVWFMSIVEKRLRKIVPDALDIIVTPFLTVIISGFVAMLIIGPAGRALGDG
                     ISFLLSTLITHAGWLAGLLFGGLYSAIVITGVHHSFHAIEAGLLGNPNIGVNFLLPIW
                     AMANVAQGGACLAVYFKTRDAKTRAIAVPAGLSCLLGITEAAIFGINLRFIKPFLAAL
                     AGGALGGAWVVFNHVNMTAVGLTGFPGLAIVQGGSMLNYLIGMFIAFGAAFTLSLLLK
                     YKTDSE"
     misc_feature    complement(404573..405916)
                     /locus_tag="PC1_0349"
                     /note="PTS system, sucrose-specific IIBC component;
                     Region: PTS-II-BC-sucr; TIGR01996"
                     /db_xref="CDD:131051"
     misc_feature    complement(405674..405910)
                     /locus_tag="PC1_0349"
                     /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIB_glc; cd00212"
                     /db_xref="CDD:238130"
     misc_feature    complement(405827..405847)
                     /locus_tag="PC1_0349"
                     /note="active site turn [active]"
                     /db_xref="CDD:238130"
     misc_feature    complement(405842..405844)
                     /locus_tag="PC1_0349"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238130"
     misc_feature    complement(404564..405637)
                     /locus_tag="PC1_0349"
                     /note="Phosphotransferase system IIC components,
                     glucose/maltose/N-acetylglucosamine-specific [Carbohydrate
                     transport and metabolism]; Region: PtsG; COG1263"
                     /db_xref="CDD:224183"
     gene            complement(405999..407534)
                     /locus_tag="PC1_0350"
                     /db_xref="GeneID:8131264"
     CDS             complement(405999..407534)
                     /locus_tag="PC1_0350"
                     /inference="protein motif:PFAM:PF02264"
                     /note="PFAM: porin LamB type;
                     KEGG: eca:ECA0363 putative sucrose porin"
                     /codon_start=1
                     /transl_table=11
                     /product="porin LamB type"
                     /protein_id="YP_003015945.1"
                     /db_xref="GI:253686755"
                     /db_xref="InterPro:IPR003192"
                     /db_xref="GeneID:8131264"
                     /translation="MKPSHLAVTIGLLLSSPFYVSAANTDSIEARLNAMEQRLQQAEA
                     RAQAAEARADAAEKQTQQLATRTTQTEQKTQQVEQRTTALAKQKSFADGFEFHGYARS
                     GLSINDSATSSKTDIGPGMSPAGQTGGHIGRLGNEDDTYVEIKLEHKQKLDNGATTRF
                     KVMMADGQRSYNDWTATTSDLNIREAFVELGSLPTFTGAFKDTTLWAGKRFDRDNFDI
                     HWLDSDVVFLAGTGGGIYDVKWADSAKSNFSLYGRSLGEITSLDNDIKNYVFTANNYV
                     GPFQFMLSGLTAKNNDVKQNTGTSRDNTFVTNTNAGDKGYHAMVAYHGDSFYGLRDGT
                     SKTAILYGHGLGGEVKNIGADGNLTNDANTWRFATYGTTALNKTWSFAPSILAQTSKD
                     RYVNGDSYEWVTFNARLIQEITENFALAYEGSYQYMDLDPRGYRSLNQVSGGFYKLTF
                     APTFKVGDIGNFFSRPELRVFASYMDWDKRLDNYSSEDTFGSTGFKAGGEWNFGIQME
                     TWF"
     misc_feature    complement(406005..407294)
                     /locus_tag="PC1_0350"
                     /note="maltoporin; Provisional; Region: lamB; PRK09360"
                     /db_xref="CDD:236481"
     misc_feature    complement(406002..407255)
                     /locus_tag="PC1_0350"
                     /note="The Maltoporin-like channels (LamB porin) form a
                     trimeric structure which facilitate the diffusion of
                     maltodextrins and other sugars across the outer membrane
                     of Gram-negative bacteria. The membrane channel is formed
                     by an 18-strand antiparallel...; Region: Maltoporin-like;
                     cd01346"
                     /db_xref="CDD:238656"
     misc_feature    complement(order(406002..406004,406008..406010,
                     406014..406016,406020..406022,406131..406133,
                     406137..406139,406170..406175,406287..406289,
                     406731..406733,406737..406739,406773..406787,
                     406836..406850,406902..406904,406908..406916,
                     406920..406922,406965..406967,406971..406979,
                     406983..406988,407031..407033,407037..407045,
                     407055..407057,407061..407063,407109..407117,
                     407217..407225,407229..407231,407247..407249))
                     /locus_tag="PC1_0350"
                     /note="trimer interface; other site"
                     /db_xref="CDD:238656"
     misc_feature    complement(order(406854..406856,406863..406865,
                     406869..406871,406890..406892,406902..406904,
                     406983..406985,407106..407108,407112..407114,
                     407232..407234))
                     /locus_tag="PC1_0350"
                     /note="sugar binding site [chemical binding]; other site"
                     /db_xref="CDD:238656"
     gene            complement(407733..408656)
                     /locus_tag="PC1_0351"
                     /db_xref="GeneID:8131265"
     CDS             complement(407733..408656)
                     /locus_tag="PC1_0351"
                     /inference="protein motif:PFAM:PF00294"
                     /note="PFAM: PfkB domain protein;
                     KEGG: eca:ECA0364 aminoimidazole riboside kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="PfkB domain-containing protein"
                     /protein_id="YP_003015946.1"
                     /db_xref="GI:253686756"
                     /db_xref="InterPro:IPR002139"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="GeneID:8131265"
                     /translation="MANRIWVMGDAVVDLIPEDAERYLKCPGGAPANVAVGIARLGGN
                     SAFIGRVGDDVFGHFLKTVLEQENVDTHHMAHDRFHRTSTVVVSLDEAGERAFTFMVR
                     PSADLFLQPEDLPIFNRGEWLHLCSIALSQEPSRSTAFEAMRQIKAAQGRVSFDPNIR
                     DDLWQSEQELRDCLTQALMLADVVKLSREELAFLCSTPDVEAGIQQFMQRYPTQLLLV
                     TLGSEGVWLHDRHQLRHFAAPSVTPVDTTGAGDAFVAGLLHGLAQYDDLSQPLSWDPI
                     IAQAQRCGALATTAKGAMTALPYAQQLHALP"
     misc_feature    complement(407775..408647)
                     /locus_tag="PC1_0351"
                     /note="Fructokinases (FRKs) mainly from bacteria and
                     plants are enzymes with high specificity for fructose, as
                     are all FRKs, but they catalyzes the conversion of
                     fructose to fructose-6-phosphate, which is an entry point
                     into glycolysis via conversion into...; Region: bac_FRK;
                     cd01167"
                     /db_xref="CDD:238572"
     misc_feature    complement(order(407904..407906,407913..407915,
                     408558..408560))
                     /locus_tag="PC1_0351"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238572"
     misc_feature    complement(order(407898..407900,407907..407912,
                     407919..407921,408000..408002,408096..408098))
                     /locus_tag="PC1_0351"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238572"
     gene            409126..409677
                     /locus_tag="PC1_0352"
                     /db_xref="GeneID:8131266"
     CDS             409126..409677
                     /locus_tag="PC1_0352"
                     /inference="protein motif:PFAM:PF04519"
                     /note="PFAM: protein of unknown function DUF583;
                     KEGG: eca:ECA0365 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015947.1"
                     /db_xref="GI:253686757"
                     /db_xref="InterPro:IPR007607"
                     /db_xref="GeneID:8131266"
                     /translation="MFSFDKNKKDAKEPQERSEINSSPAISPSNELINSVNPVRVKKD
                     TFISQGARMTGSLAVDGNITVEGRVEGDVQCDNTIKVEHTGQVNGEMKSQQIIINGRV
                     EGRIAASVVAILAQGKVFGDIFTDELSIEKGGVFTGQSHPLTPPTQNQEKLTYVDKEK
                     EKAAKAPAEQENVVALAGNVPTE"
     misc_feature    409255..409551
                     /locus_tag="PC1_0352"
                     /note="Polymer-forming cytoskeletal; Region: Bactofilin;
                     pfam04519"
                     /db_xref="CDD:252647"
     gene            409860..410318
                     /locus_tag="PC1_0353"
                     /db_xref="GeneID:8131267"
     CDS             409860..410318
                     /locus_tag="PC1_0353"
                     /inference="similar to AA sequence:KEGG:ECA0368"
                     /note="KEGG: eca:ECA0368 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015948.1"
                     /db_xref="GI:253686758"
                     /db_xref="GeneID:8131267"
                     /translation="MKVEAAESSVFASQQVMAKRSTEHAEKAALSEQLQSYQAGSGAV
                     PVGQTTRYDFTRISPAELYETVEGLVSSGRLGREEGSALLGFISSPRENVGSVPPSNV
                     FQPINVFDTIQQGVAGASSRSEVQNTESLQRAAEALNRFQGQVSSISVYV"
     gene            complement(410394..411746)
                     /locus_tag="PC1_0354"
                     /db_xref="GeneID:8131268"
     CDS             complement(410394..411746)
                     /locus_tag="PC1_0354"
                     /inference="protein motif:PFAM:PF00282"
                     /note="PFAM: Pyridoxal-dependent decarboxylase;
                     KEGG: eca:ECA0369 putative pyridoxal-dependent
                     decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyridoxal-dependent decarboxylase"
                     /protein_id="YP_003015949.1"
                     /db_xref="GI:253686759"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="GeneID:8131268"
                     /translation="MSELTLLADADERGRRYLAENAQRRVFPDAAALAALARFDEALP
                     QQGFSPESTLTLLDEVGSPATTASNGPNYFGFVIGASLPVAAASERLMIAWDQCASTF
                     DNSPVSATLERLASRWVLDALNLPKDSAVGFGTSATACTLSCLAAARRALLAKQGWDF
                     DNDGLNGAPEITVVISELTHITVKKALRVLGFGLRHLRIAPVNAYGQIDVAQLPPLDD
                     RTILCLQAGEVNTGEFDDFAQIIPIAKAAGAWVHVDGAFGLWARASSHATLTEGIELA
                     DSWTTDAHKWLNTPYDCAMAICRDADALAEAMNADAVYSSAARDAQKNLTLEFSRRPR
                     GIPVWAVLRTLGRDGVAEMVERHCRQAAFIADGLRHAGFEVLNRVVLNQVLLRGETDG
                     QTTAIRDALQASGKAWFGGTVWQGRPALRISVSSWRTQDDNVQALITLLTEIKARTPR
                     "
     misc_feature    complement(410406..411632)
                     /locus_tag="PC1_0354"
                     /note="Glutamate decarboxylase and related PLP-dependent
                     proteins [Amino acid transport and metabolism]; Region:
                     GadB; COG0076"
                     /db_xref="CDD:223154"
     misc_feature    complement(order(410892..410894,410901..410903,
                     410976..410978,410985..410987,411072..411074,
                     411327..411329,411333..411335))
                     /locus_tag="PC1_0354"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(410892..410894)
                     /locus_tag="PC1_0354"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(411804..413072)
                     /locus_tag="PC1_0355"
                     /db_xref="GeneID:8131269"
     CDS             complement(411804..413072)
                     /locus_tag="PC1_0355"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: eca:ECA0370 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_003015950.1"
                     /db_xref="GI:253686760"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:8131269"
                     /translation="MKANIMKTSPIHTTSSVTECDLYSTQTTLPRALVLLFACASALS
                     VANVYYAQPLLDALSVDFHISIAAVGGVMSATQLGCALALILLVPLGDILNRRYLMLS
                     QLGALIVALIAVGLSTTSLALLIGMLAVGMLGTAMTQGLIAYAATAAAPQERGRVVGA
                     AQGGVVIGLLLARVLSGFIADVAGWRSVYFFSALLMLLLAVLLWRTLPHQLLARQRPH
                     YSALLLSMLTLLRQERVLQIRGTIALLMFAALSIFWSALVLPLSREPYFFSHTVIGAF
                     GLVGILGALAAVKAGSLADKGREQWVSGIALLLLLTSWLPLWLAPYSLLALVVGIIVL
                     DLGGQAIHVTNQSMIFKTHPDAHSRLVGCYMLFYSIGSGLGAMATTAAYDAAGWSGVC
                     LLGAAVSLTALLFWKVTLHASAPSPAASTP"
     misc_feature    complement(411855..412985)
                     /locus_tag="PC1_0355"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     misc_feature    complement(411855..412973)
                     /locus_tag="PC1_0355"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(411957..411959,411966..411971,
                     411978..411983,411990..411995,412023..412025,
                     412032..412037,412047..412049,412056..412061,
                     412068..412070,412212..412214,412224..412226,
                     412233..412235,412245..412247,412257..412259,
                     412299..412301,412308..412313,412320..412325,
                     412332..412334,412566..412568,412584..412589,
                     412596..412601,412635..412637,412644..412649,
                     412656..412661,412668..412673,412809..412814,
                     412818..412823,412833..412835,412842..412847,
                     412854..412856,412905..412910,412914..412922,
                     412929..412931))
                     /locus_tag="PC1_0355"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            413208..413654
                     /locus_tag="PC1_0356"
                     /db_xref="GeneID:8131270"
     CDS             413208..413654
                     /locus_tag="PC1_0356"
                     /inference="protein motif:PFAM:PF01638"
                     /note="PFAM: helix-turn-helix HxlR type;
                     KEGG: eca:ECA0371 putative transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="YP_003015951.1"
                     /db_xref="GI:253686761"
                     /db_xref="InterPro:IPR002577"
                     /db_xref="GeneID:8131270"
                     /translation="MVKRKSLKEDACPVARALDVVGDRWALLIIRDAFDNRRRFSDFQ
                     RSLGVAKNILTDRLRTLVDEGILSVQPVSDSSAYQEYVLTPKGEQLFPLVVALRQWGE
                     QQLFAEGEPHSLLLDRHTGQPLQAMLPHSAQGQPVVGQDTFVQKVD"
     misc_feature    413211..413564
                     /locus_tag="PC1_0356"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1733"
                     /db_xref="CDD:224647"
     gene            413664..414125
                     /locus_tag="PC1_0357"
                     /db_xref="GeneID:8131271"
     CDS             413664..414125
                     /locus_tag="PC1_0357"
                     /inference="similar to AA sequence:KEGG:ECA0372"
                     /note="KEGG: eca:ECA0372 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015952.1"
                     /db_xref="GI:253686762"
                     /db_xref="GeneID:8131271"
                     /translation="MQKEPKETGSDLEAISRYLKKLHVLTLCVGENSELWCASCFYTY
                     DDQLIAFYLMTELQTRHGEMMVRLPQVAGTVSGQPKSVMLIKGVQFRGQAVLLEGDEA
                     HQARARYNTRFPIARASQAPIWRLDLTEIKMTDNALGFGKKRYWQRDEQVQ"
     misc_feature    413679..414110
                     /locus_tag="PC1_0357"
                     /note="hypothetical protein; Provisional; Region:
                     PRK03467"
                     /db_xref="CDD:235127"
     gene            414220..414873
                     /locus_tag="PC1_0358"
                     /db_xref="GeneID:8131272"
     CDS             414220..414873
                     /locus_tag="PC1_0358"
                     /inference="protein motif:PFAM:PF01118"
                     /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
                     KEGG: eca:ECA0373 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Semialdehyde dehydrogenase NAD - binding"
                     /protein_id="YP_003015953.1"
                     /db_xref="GI:253686763"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="GeneID:8131272"
                     /translation="MSRVLLLGATGLVGHELLQLLKANNRVETIYAPTRKPLASSEKV
                     VNPHGPDLSAALAQLTDPVDIAFCCLGSTLKTAGSKQAFRYVDYTLVVEGSKVALALG
                     ATHLLVVSSLSANATSPFFYSRVKGETERSLRQQGWQHLTLAQPSMLLGEREDSRPLE
                     SLAAPLFRLFPAKWRAIEGKTVAQALLNQAFSPEPKARVTVLESDQLRSLGKLPALQ"
     misc_feature    414223..>414849
                     /locus_tag="PC1_0358"
                     /note="Predicted nucleoside-diphosphate-sugar epimerases
                     [Cell envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: COG0702"
                     /db_xref="CDD:223774"
     misc_feature    414226..414840
                     /locus_tag="PC1_0358"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(414241..414243,414247..414252,414256..414258,
                     414319..414327,414424..414432,414544..414552,
                     414583..414585,414595..414597,414655..414666)
                     /locus_tag="PC1_0358"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(414478..414480,414550..414552,414583..414585,
                     414595..414597)
                     /locus_tag="PC1_0358"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(414885..415349)
                     /locus_tag="PC1_0359"
                     /db_xref="GeneID:8131273"
     CDS             complement(414885..415349)
                     /locus_tag="PC1_0359"
                     /inference="protein motif:TFAM:TIGR02491"
                     /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
                     reductase activating protein;
                     KEGG: eca:ECA0374 anaerobic ribonucleotide
                     reductase-activating protein"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside-triphosphate reductase
                     activating protein"
                     /protein_id="YP_003015954.1"
                     /db_xref="GI:253686764"
                     /db_xref="InterPro:IPR001989"
                     /db_xref="InterPro:IPR012837"
                     /db_xref="GeneID:8131273"
                     /translation="MNYHQYYPVDVVNGPGTRCTLFVAGCVHECVGCYNKSTWRLNSG
                     QPFTQEQEDRIIADLQDTVIPRQGISLSGGDPLHPRNVPDILRLVERIRAECPGKDIW
                     VWTGYVLAELTPEQQRVVDLINVLVDGKFVQDLKDPALIWRGSSNQVVHRLR"
     misc_feature    complement(414888..415346)
                     /locus_tag="PC1_0359"
                     /note="anaerobic ribonucleoside-triphosphate reductase
                     activating protein; Region: NrdG; TIGR02491"
                     /db_xref="CDD:233893"
     misc_feature    complement(<414939..415286)
                     /locus_tag="PC1_0359"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(414972..414974,415032..415040,
                     415125..415130,415134..415136,415248..415256,
                     415260..415262,415266..415268,415272..415274))
                     /locus_tag="PC1_0359"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(415431..417569)
                     /locus_tag="PC1_0360"
                     /db_xref="GeneID:8131274"
     CDS             complement(415431..417569)
                     /locus_tag="PC1_0360"
                     /EC_number="1.17.4.2"
                     /inference="protein motif:TFAM:TIGR02487"
                     /note="KEGG: eca:ECA0375 anaerobic ribonucleoside
                     triphosphate reductase;
                     TIGRFAM: anaerobic ribonucleoside-triphosphate reductase;
                     PFAM: formate C-acetyltransferase glycine radical;
                     ATP-cone domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside-triphosphate reductase"
                     /protein_id="YP_003015955.1"
                     /db_xref="GI:253686765"
                     /db_xref="InterPro:IPR001150"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="InterPro:IPR012833"
                     /db_xref="GeneID:8131274"
                     /translation="MKPVVIKRDGCQVPFDEVRIKEAVERAAHAAGVNDADYCATVAC
                     AVAQQMQDKSRVDIREIQDAVENLLMSGNYKKLARTYIEYRHDRDIARERHGRLNQEI
                     RGLVEQSNMALLNENANKDSKVIPTQRDLLAGIVAKHYAKQYILPRDVVLAHERGEIH
                     YHDLDYSPFFPMFNCMLIDLNGMLTNGFKMGNAEIEPPKSISTATAVTAQIIAQVASH
                     IYGGTTINRIDEILAPFVTASHAKHKAVAEEWQIPDADNYALTRTEKECYDAFQSLEY
                     EVNTLHTANGQTPFVTFGFGLGVSWESRLIQESILRNRIAGLGKNHKTAVFPKLVFAI
                     RDGLNHKAGDPNYDIKQLALECASKRMYPDILNYDQVVNVTGSFKTPMGCRSFLGVYE
                     ENGQQIHDGRNNLGVISLNLPRIALEAEGNEDRFWTLLDQRLALAKKALMTRIARLES
                     VKARVAPILYMEGACGVRLKADDSIADIFKNGRASISLGYIGLHETINALFGNQTHVF
                     DDETLRAKAIAIIACLKDATEQWKDETGYGFSLYSTPSENLCDRFCRLDTAEFGVVQG
                     VTDKGYYTNSFHLDVEKKVNPYQKIDFELPYPPLANGGFICYGEYPNLQHNLKALEDV
                     WDYSYSRVPYYGTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDSARVSVTRRVCGY
                     LGSPDARPFNAGKQEEVKRRIKHLGNGQLG"
     misc_feature    complement(415437..417569)
                     /locus_tag="PC1_0360"
                     /note="anaerobic ribonucleoside triphosphate reductase;
                     Provisional; Region: PRK09263"
                     /db_xref="CDD:236436"
     misc_feature    complement(417300..417563)
                     /locus_tag="PC1_0360"
                     /note="ATP cone domain; Region: ATP-cone; pfam03477"
                     /db_xref="CDD:251987"
     misc_feature    complement(415515..417224)
                     /locus_tag="PC1_0360"
                     /note="Class III ribonucleotide reductase; Region:
                     RNR_III; cd01675"
                     /db_xref="CDD:153084"
     misc_feature    complement(order(415914..415916,415923..415934,
                     416844..416846,416940..416942,416949..416954,
                     416961..416963,416973..416987,417081..417086,
                     417090..417092))
                     /locus_tag="PC1_0360"
                     /note="effector binding site; other site"
                     /db_xref="CDD:153084"
     misc_feature    complement(order(415929..415931,415938..415940,
                     416352..416354,416418..416423,416700..416702,
                     416904..416906,417045..417047))
                     /locus_tag="PC1_0360"
                     /note="active site"
                     /db_xref="CDD:153084"
     misc_feature    complement(order(415575..415577,415584..415586,
                     415629..415631,415638..415640))
                     /locus_tag="PC1_0360"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:153084"
     misc_feature    complement(415524..415538)
                     /locus_tag="PC1_0360"
                     /note="glycine loop; other site"
                     /db_xref="CDD:153084"
     gene            complement(417973..418710)
                     /locus_tag="PC1_0361"
                     /db_xref="GeneID:8131275"
     CDS             complement(417973..418710)
                     /locus_tag="PC1_0361"
                     /inference="protein motif:PFAM:PF00227"
                     /note="PFAM: 20S proteasome A and B subunits;
                     KEGG: eca:ECA0376 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="20S proteasome A and B subunits"
                     /protein_id="YP_003015956.1"
                     /db_xref="GI:253686766"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="GeneID:8131275"
                     /translation="MTYCVAMCLSDGLVFASDSRTNAGVDHIATFKKLYVFQHENERV
                     LVIQCAGNLATTQSIISLLNARIDAQHTPNLMQVNSMYDAAMLLGETVREVIHRDSSV
                     QQNGSNTNFGCNLLLGGQIGGETHRLFHIYPEGNFIEATPDTPYFQIGESKYGKPIID
                     RVLTMDTPLEQAMCCALISIDSTLRSNLSVGLPLDVMIYRTGSFASTEQQRITENNAY
                     FTTIRKAWSEGLLNTFRQLPPFPDIQP"
     misc_feature    complement(417997..418707)
                     /locus_tag="PC1_0361"
                     /note="Bacterial proteasome, beta subunit. The 20S
                     proteasome, multisubunit proteolytic complex, is the
                     central enzyme of nonlysosomal protein degradation in both
                     the cytosol and nucleus. It is composed of 28 subunits
                     arranged as four homoheptameric rings that...; Region:
                     proteasome_beta_bacterial; cd03765"
                     /db_xref="CDD:239734"
     gene            complement(418734..419555)
                     /locus_tag="PC1_0362"
                     /db_xref="GeneID:8131276"
     CDS             complement(418734..419555)
                     /locus_tag="PC1_0362"
                     /inference="protein motif:PFAM:PF08379"
                     /note="PFAM: transglutaminase domain protein;
                     transglutaminase domain protein;
                     SMART: transglutaminase domain protein;
                     KEGG: eca:ECA0377 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase domain-containing protein"
                     /protein_id="YP_003015957.1"
                     /db_xref="GI:253686767"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="InterPro:IPR013589"
                     /db_xref="GeneID:8131276"
                     /translation="MKLTINHLTHYRYDEEVKFSTQYLRLTPQNSAHQKIREWKLTLP
                     TSAVQTTDAYGNVLHVLTLDHPHQDITIHAEGVVDILDSGAAENPEIQDGLSPLVFLR
                     PTPLTEADGEIRAFAQRYYRPDAAEESLNTLMAELRLKMPYTPGATQVQDTAAAAFAM
                     QKGVCQDHTHVFLACCRSLSIPARYVSGYVYSQDTHHVAMHAWAEVWLNGYWQGFDIT
                     NSTRQLHQHLWLAVGMDYMDACPVRGTRLGGGCEEMFSEAEVRLFERQQQVQQQQ"
     misc_feature    complement(418791..419555)
                     /locus_tag="PC1_0362"
                     /note="Transglutaminase-like enzymes, putative cysteine
                     proteases [Amino acid transport and metabolism]; Region:
                     COG1305"
                     /db_xref="CDD:224224"
     misc_feature    complement(419319..419552)
                     /locus_tag="PC1_0362"
                     /note="Bacterial transglutaminase-like N-terminal region;
                     Region: Bact_transglu_N; pfam08379"
                     /db_xref="CDD:254765"
     misc_feature    complement(418908..419216)
                     /locus_tag="PC1_0362"
                     /note="Transglutaminase-like superfamily; Region:
                     Transglut_core; pfam01841"
                     /db_xref="CDD:250908"
     gene            complement(419552..420481)
                     /locus_tag="PC1_0363"
                     /db_xref="GeneID:8131277"
     CDS             complement(419552..420481)
                     /locus_tag="PC1_0363"
                     /inference="protein motif:PFAM:PF04168"
                     /note="PFAM: protein of unknown function DUF403;
                     KEGG: eca:ECA0378 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015958.1"
                     /db_xref="GI:253686768"
                     /db_xref="InterPro:IPR007296"
                     /db_xref="GeneID:8131277"
                     /translation="MLSRTASELYWMARYLERAESLARVLDVTYKLSMMPRHSQQQRD
                     LALPLNLTATHELFQQRYTRFSMNNLLNFFALDSQNPSSIYNCIEMAWNNAHAVRGSL
                     SSEVWECINATRIDIRNLRHQGVDNVGIDAFFDWVKERSHLFRGAMFGTLLRNDAQCF
                     IRVGTLIERAYATAQLLKVKHQQLNNDPDPVREYYRLDTLLRAVSAREAYHSIYRQPI
                     SPETVTELLVLREDVPRSLHACIGDLVLQLEAIGSQRAKVPHRLAHLLHVELRFSTLD
                     DILAQDLSTYLNNFMIKINELADSIRHTYLEAL"
     misc_feature    complement(419564..420481)
                     /locus_tag="PC1_0363"
                     /note="A predicted alpha-helical domain with a conserved
                     ER motif; Region: Alpha-E; pfam04168"
                     /db_xref="CDD:252423"
     gene            complement(420475..421914)
                     /locus_tag="PC1_0364"
                     /db_xref="GeneID:8131278"
     CDS             complement(420475..421914)
                     /locus_tag="PC1_0364"
                     /inference="protein motif:PFAM:PF04169"
                     /note="PFAM: protein of unknown function DUF404; protein
                     of unknown function DUF407;
                     KEGG: eca:ECA0379 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015959.1"
                     /db_xref="GI:253686769"
                     /db_xref="InterPro:IPR007297"
                     /db_xref="InterPro:IPR007302"
                     /db_xref="GeneID:8131278"
                     /translation="MIKMKLPSAPYYDEMLSSQGQQRQHYNSYWQWLQQTDQQAIKQK
                     KEQAELLFHRVGITFNVYGEEGGTERLIPFDSVPRIIPAHEWQLLDRGIRQRVQALNA
                     FLYDIYHHQHILKAGIIPSEQVLANEQYQPCMQGVNLHNNIYAHITGIDMVRNSDGHY
                     YVLEDNLRTPSGVSYMLENRKMMMRLYPDLFASQHIAPVERYPSYLLQTLRESTLVDD
                     PTVVVMTPGRFNSAYFEHSFLAQQMGVELVESADLFVKEGAVYMRTTEGPCQVDVIYR
                     RVDDAFLDPLAFRADSMLGVPGLLSVYRAGGVVLANAIGTGVADDKSIYPYVPEMIRF
                     YLSEEPILHNIPTWQCRNPSDLSYVLDHLDSMVVKEVHGAGGYGMLVGPRATRGEIET
                     FRQRLLAHPNNYIGQETLALSTCPTFIDDGLAPRHIDLRPFALSGEEIRLVPGGLTRV
                     ALTEGSLVVNSSQGGGTKDTWVMEEDESC"
     misc_feature    complement(420487..421905)
                     /locus_tag="PC1_0364"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2308"
                     /db_xref="CDD:225190"
     gene            complement(422136..422522)
                     /locus_tag="PC1_0365"
                     /db_xref="GeneID:8131279"
     CDS             complement(422136..422522)
                     /locus_tag="PC1_0365"
                     /inference="protein motif:TFAM:TIGR00004"
                     /note="TIGRFAM: endoribonuclease L-PSP;
                     PFAM: Endoribonuclease L-PSP;
                     KEGG: eca:ECA0380 putative endoribonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="YP_003015960.1"
                     /db_xref="GI:253686770"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="GeneID:8131279"
                     /translation="MSRTISTEHAPAAIGPYVQGVDLGSMIITSGQIPVNPKSGLVAD
                     NITAQTRQSLENVQAIVEAAGLKVSDIVKTTVFVKDLHDFTLVNTAYEAFFNEHDAPF
                     PARSCVEVARLPKDVKIEIEAIAVRR"
     misc_feature    complement(422148..422474)
                     /locus_tag="PC1_0365"
                     /note="YjgF, YER057c, and UK114 belong to a large family
                     of proteins present in bacteria, archaea, and eukaryotes
                     with no definitive function. The conserved domain is
                     similar in structure to chorismate mutase but there is no
                     sequence similarity and no...; Region:
                     YjgF_YER057c_UK114_family; cd00448"
                     /db_xref="CDD:100004"
     misc_feature    complement(order(422151..422153,422157..422159,
                     422163..422165,422193..422216,422250..422252,
                     422259..422261,422292..422294,422298..422300,
                     422304..422309,422313..422315,422430..422435,
                     422439..422441,422445..422447,422454..422456,
                     422460..422462,422469..422474))
                     /locus_tag="PC1_0365"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100004"
     misc_feature    complement(order(422163..422165,422208..422210,
                     422259..422261,422271..422273,422472..422474))
                     /locus_tag="PC1_0365"
                     /note="putative active site [active]"
                     /db_xref="CDD:100004"
     gene            complement(422621..423085)
                     /locus_tag="PC1_0366"
                     /db_xref="GeneID:8131280"
     CDS             complement(422621..423085)
                     /locus_tag="PC1_0366"
                     /inference="protein motif:TFAM:TIGR00240"
                     /note="TIGRFAM: aspartate carbamoyltransferase, regulatory
                     subunit;
                     PFAM: aspartate transcarbamylase regulatory subunit;
                     KEGG: eca:ECA0381 aspartate carbamoyltransferase
                     regulatory subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase, regulatory
                     subunit"
                     /protein_id="YP_003015961.1"
                     /db_xref="GI:253686771"
                     /db_xref="InterPro:IPR002801"
                     /db_xref="GeneID:8131280"
                     /translation="MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTATDQRITI
                     GLNLPSNHLGRKDLIKIENIFLTEEQANQLAIYAPQATVNQIDDYDVVRKLVPTLPEH
                     ITGVLTCPNSNCISRSEPVSSSFSVKQRDGDVHLKCKYCEKEFERQAVLQDR"
     misc_feature    complement(422633..423082)
                     /locus_tag="PC1_0366"
                     /note="aspartate carbamoyltransferase regulatory subunit;
                     Reviewed; Region: PRK00893"
                     /db_xref="CDD:234859"
     misc_feature    complement(422789..423076)
                     /locus_tag="PC1_0366"
                     /note="Aspartate carbamoyltransferase regulatory chain,
                     allosteric domain; Region: PyrI; pfam01948"
                     /db_xref="CDD:250987"
     misc_feature    complement(422630..422785)
                     /locus_tag="PC1_0366"
                     /note="Aspartate carbamoyltransferase regulatory chain,
                     metal binding domain; Region: PyrI_C; pfam02748"
                     /db_xref="CDD:251511"
     gene            complement(423101..424036)
                     /locus_tag="PC1_0367"
                     /db_xref="GeneID:8131281"
     CDS             complement(423101..424036)
                     /locus_tag="PC1_0367"
                     /EC_number="2.1.3.2"
                     /inference="protein motif:TFAM:TIGR00670"
                     /note="KEGG: eca:ECA0382 aspartate carbamoyltransferase
                     catalytic subunit;
                     TIGRFAM: aspartate carbamoyltransferase;
                     PFAM: aspartate/ornithine carbamoyltransferase carbamoyl-P
                     binding domain; aspartate/ornithine carbamoyltransferase
                     Asp/Orn-binding region"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="YP_003015962.1"
                     /db_xref="GI:253686772"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="GeneID:8131281"
                     /translation="MVNPLYQKHIISINDLSREDLELTLRVAASLKAKPQPELLKHKV
                     IASCFFEASTRTRLSFETAMHRLGASVVGFADSNNTSLGKKGETLADTISVISQYVDA
                     IVMRHPQEGASRLATEFSGGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLNNINIAM
                     VGDLKYGRTVHSLTQALAKFEGNRFYFIAPDALAMPDYILSMLKEKNIAYSLHNSIDE
                     VVGELDILYMTRVQKERLDPSEYINIKSQFVLRAADLHSARPNLKVLHPLPRVDEITI
                     DVDATPYAYYFQQAGNGIYARQALLALVLNRELVL"
     misc_feature    complement(423119..424036)
                     /locus_tag="PC1_0367"
                     /note="Aspartate carbamoyltransferase, catalytic chain
                     [Nucleotide transport and metabolism]; Region: PyrB;
                     COG0540"
                     /db_xref="CDD:223614"
     misc_feature    complement(423593..424015)
                     /locus_tag="PC1_0367"
                     /note="Aspartate/ornithine carbamoyltransferase,
                     carbamoyl-P binding domain; Region: OTCace_N; pfam02729"
                     /db_xref="CDD:251498"
     misc_feature    complement(423125..423577)
                     /locus_tag="PC1_0367"
                     /note="Aspartate/ornithine carbamoyltransferase, Asp/Orn
                     binding domain; Region: OTCace; pfam00185"
                     /db_xref="CDD:249663"
     gene            complement(424184..424306)
                     /locus_tag="PC1_0368"
                     /db_xref="GeneID:8131282"
     CDS             complement(424184..424306)
                     /locus_tag="PC1_0368"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015963.1"
                     /db_xref="GI:253686773"
                     /db_xref="GeneID:8131282"
                     /translation="MHRYTKKSAAYVGSQPQLPSGSQPAFSFPLLNYFIKKAPQ"
     gene            424456..424587
                     /locus_tag="PC1_0369"
                     /db_xref="GeneID:8131283"
     CDS             424456..424587
                     /locus_tag="PC1_0369"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015964.1"
                     /db_xref="GI:253686774"
                     /db_xref="GeneID:8131283"
                     /translation="MGSSLFRINALAGVTFGEYKDYKTEFHFFYQRGFYDYWQCPPP"
     gene            424559..425023
                     /locus_tag="PC1_0370"
                     /db_xref="GeneID:8131284"
     CDS             424559..425023
                     /locus_tag="PC1_0370"
                     /inference="protein motif:PFAM:PF04074"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: eca:ECA0383 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015965.1"
                     /db_xref="GI:253686775"
                     /db_xref="InterPro:IPR004375"
                     /db_xref="GeneID:8131284"
                     /translation="MITGNVHHLELVPYLPAKLREAIEYVKKNITADTPLGKHDIEGN
                     SVFVLISNDSTDLLEKRRAEYHAKYLDIQIVLSGVEGMTFSNLPAGKPDTDWLADKDI
                     AFLPSGEQEKQFVMQEGDFVVFFPGEVHKPLCAVGEPAHVRKAVVKIDASLV"
     misc_feature    424559..425017
                     /locus_tag="PC1_0370"
                     /note="Beta-galactosidase, beta subunit [Carbohydrate
                     transport and metabolism]; Region: EbgC; COG2731"
                     /db_xref="CDD:225345"
     gene            425373..426056
                     /locus_tag="PC1_0371"
                     /db_xref="GeneID:8131285"
     CDS             425373..426056
                     /locus_tag="PC1_0371"
                     /inference="protein motif:PFAM:PF00196"
                     /note="PFAM: regulatory protein LuxR;
                     SMART: regulatory protein LuxR;
                     KEGG: plu:plu2006 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_003015966.1"
                     /db_xref="GI:253686776"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="GeneID:8131285"
                     /translation="MTQITLPDRLIAMFESDPLVGWAIKDTNSRFVYVNNTFKTWQTI
                     STRYDYEGLNIRDIPVPVAEFSDIFNQQEREIERTGKAVRAITTHIQGTEKIMQPAYN
                     IQEPIYDEHRNCIGTVISVRHVRIITPTSLLNGTIIQHSTFEPPSTIFTEKEWEVIYL
                     LVCGMMLKDISSILSITVDAVNSRLRSCYRKTGLNSVSGLKEYCRDNRFDNYIPLFFL
                     KKGHIIIRG"
     misc_feature    425412..425744
                     /locus_tag="PC1_0371"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    <425718..425960
                     /locus_tag="PC1_0371"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    425820..425960
                     /locus_tag="PC1_0371"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(425823..425831,425868..425876,425898..425903,
                     425907..425912,425916..425930)
                     /locus_tag="PC1_0371"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     gene            426061..426726
                     /locus_tag="PC1_0372"
                     /db_xref="GeneID:8131286"
     CDS             426061..426726
                     /locus_tag="PC1_0372"
                     /inference="protein motif:PFAM:PF08448"
                     /note="PFAM: PAS fold-4 domain protein;
                     KEGG: plu:plu0925 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PAS/PAC sensor protein"
                     /protein_id="YP_003015967.1"
                     /db_xref="GI:253686777"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="GeneID:8131286"
                     /translation="MDPDLTPVEYYFDNSLFGWAIKDCNSQYVYGNKMACQYFGVTEN
                     KLVGCLDTDLTPDISEHYGHILYDDQKILTTNEMSIVLKTFDYGRRNRLRSFLVEKRP
                     WRLNDGSDGIVCTYIEITNVYFSTFLMPCERKPIVFTRPANIFTDKEWEAVLLLQSGV
                     KQNRIPDILGISSSTLRNRITRCCDKAGVANSTALIQHCNQKGWDNYIPPFFLIKGHV
                     SIT"
     misc_feature    426094..426429
                     /locus_tag="PC1_0372"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    426493..426654
                     /locus_tag="PC1_0372"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cl17315"
                     /db_xref="CDD:266624"
     misc_feature    order(426496..426504,426541..426549,426571..426576,
                     426580..426585,426589..426603,426634..426636)
                     /locus_tag="PC1_0372"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(426529..426531,426535..426537,426541..426543,
                     426634..426642,426649..426651)
                     /locus_tag="PC1_0372"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            426849..427035
                     /locus_tag="PC1_0373"
                     /pseudo
                     /db_xref="GeneID:8131287"
     gene            complement(427088..428095)
                     /locus_tag="PC1_0374"
                     /db_xref="GeneID:8131288"
     CDS             complement(427088..428095)
                     /locus_tag="PC1_0374"
                     /inference="protein motif:TFAM:TIGR00658"
                     /note="TIGRFAM: ornithine carbamoyltransferase;
                     PFAM: aspartate/ornithine carbamoyltransferase
                     Asp/Orn-binding region; aspartate/ornithine
                     carbamoyltransferase carbamoyl-P binding domain;
                     KEGG: eca:ECA0384 ornithine carbamoyltransferase subunit
                     I"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="YP_003015968.1"
                     /db_xref="GI:253686778"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR002292"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="GeneID:8131288"
                     /translation="MQPFYKRHFLRLMDFTPAEIANLLALSTKLKADKKNGTEVRRLQ
                     GKNIALIFEKDSTRTRCSFEVAAYDQGAQVTYLGPSGSQIGHKESIKDTARVLGRMYD
                     GIQYRGYGQQIVETLAQYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKPLSEMALV
                     YVGDARNNMGNTMLEAAALTGLDLRLVAPKACWPDAGLVAECQAAAEQTGGSITLTED
                     IATGVAGADFIYTDVWVSMGEPKETWQERIALLKPYQVNAAMIAATGNPQVKFLHCLP
                     AFHDDQTTMGQQMAEQYGLHGGMEVTDEVFESAHSIVFDQAENRMHTIKAVMVATLAQ
                     D"
     misc_feature    complement(427091..428095)
                     /locus_tag="PC1_0374"
                     /note="ornithine carbamoyltransferase subunit I;
                     Provisional; Region: PRK03515"
                     /db_xref="CDD:179587"
     misc_feature    complement(427652..428077)
                     /locus_tag="PC1_0374"
                     /note="Aspartate/ornithine carbamoyltransferase,
                     carbamoyl-P binding domain; Region: OTCace_N; pfam02729"
                     /db_xref="CDD:251498"
     misc_feature    complement(427103..427621)
                     /locus_tag="PC1_0374"
                     /note="Aspartate/ornithine carbamoyltransferase, Asp/Orn
                     binding domain; Region: OTCace; pfam00185"
                     /db_xref="CDD:249663"
     gene            428257..428682
                     /locus_tag="PC1_0375"
                     /db_xref="GeneID:8131289"
     CDS             428257..428682
                     /locus_tag="PC1_0375"
                     /inference="protein motif:PFAM:PF06877"
                     /note="PFAM: protein of unknown function DUF1260;
                     KEGG: eca:ECA0385 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015969.1"
                     /db_xref="GI:253686779"
                     /db_xref="InterPro:IPR009671"
                     /db_xref="GeneID:8131289"
                     /translation="MANRELLEEQREETRLIIEELLDDGSDPDALYTIEHHFSAEKFE
                     VLEKVAVEAFKLGYEVTDAEELEVEDGVLLMCCDAISEVALNAELIDAQVEQLLALAE
                     RHGVNYDGWGTYFEDPDGEGEEDGDDEDFYDEDDDGKRH"
     misc_feature    428257..428601
                     /locus_tag="PC1_0375"
                     /note="RNase E inhibitor protein; Provisional; Region:
                     PRK11191"
                     /db_xref="CDD:236876"
     gene            complement(428751..429254)
                     /locus_tag="PC1_0376"
                     /db_xref="GeneID:8131290"
     CDS             complement(428751..429254)
                     /locus_tag="PC1_0376"
                     /inference="protein motif:PFAM:PF00583"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: eca:ECA0386 putative acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-like N-acetyltransferase"
                     /protein_id="YP_003015970.1"
                     /db_xref="GI:253686780"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:8131290"
                     /translation="MTTATSAKLQVRPITAHDDAAIARVIRQVSAEFGLTADKGYTVS
                     DPNLDALFALYSQPQSAYWVIEYEGCVVGGGGIAPLVAGDEDVCELQKMYFLPIARGK
                     GLARQLAIQALDFARQHGFRRCYLETTGHLTSAIRLYESLGFEPIPHSMGNTGHTDCE
                     VTMLKVL"
     misc_feature    complement(428823..429203)
                     /locus_tag="PC1_0376"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    complement(428874..429071)
                     /locus_tag="PC1_0376"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(428937..428942,428970..428978))
                     /locus_tag="PC1_0376"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            429549..430730
                     /locus_tag="PC1_0377"
                     /db_xref="GeneID:8131291"
     CDS             429549..430730
                     /locus_tag="PC1_0377"
                     /inference="protein motif:PFAM:PF05987"
                     /note="PFAM: protein of unknown function DUF898
                     transmembrane;
                     KEGG: eca:ECA0387 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003015971.1"
                     /db_xref="GI:253686781"
                     /db_xref="InterPro:IPR010295"
                     /db_xref="GeneID:8131291"
                     /translation="MTINTSENNTQHRVKFHGKAGEYFAIWLVNALLTVITLGIYSAW
                     ATVRRRRYFYGNTEINGDRFDYHADPIQILKGRLLVIAGIILFYIILAMSPTLGTIIA
                     LAFAALIPIIVIRNWRYNAIMSSYRGVRFNYDCQTGRAYWVLLFCPILLMLAFYIALV
                     VVVMIGMQSNSPILIGFIALAIAIPGFAAVNGIMKMMQLDFYVNNLSFGKTAFKAELT
                     KAAFIKFALVSLLIFVPFLIAALSFMSSFIFTLFQTIMMGGGNEDLILMMLLSNAFNF
                     IMMFIVALLGVLVSSSYLVVAQRNYLFNQTSLNGDVKLHSSMQTLSYMGLLITNSLIT
                     IFSLGWAAPVAEIRHARYIANATAVEGDLALLHVQAHQDTANSALAEEAVQALDLGVG
                     L"
     misc_feature    429573..430709
                     /locus_tag="PC1_0377"
                     /note="Bacterial protein of unknown function (DUF898);
                     Region: DUF898; pfam05987"
                     /db_xref="CDD:253494"
     gene            430747..431784
                     /locus_tag="PC1_0378"
                     /db_xref="GeneID:8131292"
     CDS             430747..431784
                     /locus_tag="PC1_0378"
                     /inference="protein motif:PFAM:PF01435"
                     /note="PFAM: peptidase M48 Ste24p;
                     KEGG: eca:ECA0388 putative peptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M48 Ste24p"
                     /protein_id="YP_003015972.1"
                     /db_xref="GI:253686782"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="GeneID:8131292"
                     /translation="MNIEGHYQYPGLAARVAASLHLADNGSMMVLNTGSSNTTFSLEQ
                     VTVSDALGSIPLTLTFPDGGRFVPADDPTFRAWYSARRRPGLVHRLERHKRGVILTLF
                     ATILVIINYVYVVLPWASSALALRIPTAIEQQLGQHTLTLLRHSDFTPSKLPIERQQA
                     MQALFQQVMPADMREDKTPLRLEIMSAPIGPNAFMLADGTLIISDDLVTLAKSDNELA
                     AVMLHEMGHHAYRHPMRMVVRSSLVSLTFMWMTGDVSGVGDTVLQSAAFINEMQFSRD
                     MEREADAWAIAEMQQQGRSLQSMQAMYQALVANDRSHDEVESLDLPDWLSTHPDMDER
                     LKVIEREMNKH"
     misc_feature    431035..431778
                     /locus_tag="PC1_0378"
                     /note="Zn-dependent protease with chaperone function
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: HtpX; COG0501"
                     /db_xref="CDD:223575"
     gene            432150..433229
                     /locus_tag="PC1_0379"
                     /db_xref="GeneID:8131293"
     CDS             432150..433229
                     /locus_tag="PC1_0379"
                     /EC_number="2.3.1.31"
                     /inference="protein motif:PRIAM:2.3.1.31"
                     /note="PFAM: alpha/beta hydrolase fold;
                     KEGG: eca:ECA0389 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Homoserine O-acetyltransferase"
                     /protein_id="YP_003015973.1"
                     /db_xref="GI:253686783"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="GeneID:8131293"
                     /translation="MINRILSGVVGAFLLMLSPLTHAQANFPEPKEGDWIAPEFTFNS
                     GEKLKDLRIHYYTIGDKTKPAVLLLHGTNQPIKALLANGFGGELFGPGQALDSSKYFI
                     IMPESIGSGKSSKPSDGLRMKFPQYDYNDMVQAQYRLVKEGMGINHLRLVMGYSMGGM
                     QTWLWGEKYPDMMDALVPMASLPNELSGRNWMMRRILIESIKNDPVWNNGDYTQQPPT
                     LKTASIMFSIATTGGTLAYQSKAPTRAQADKLVEDRLAAPSNSDANDFIYIWGSSANY
                     NAAPELNKIKASVLVINSADDERNPVETGILDNELKKIKQATLFLIPASKDTSGHGTM
                     MSAKFYKDELQRFLEKNQSQKNNKK"
     misc_feature    432153..433211
                     /locus_tag="PC1_0379"
                     /note="hypothetical protein; Provisional; Region:
                     PRK06489"
                     /db_xref="CDD:235815"
     misc_feature    432231..433196
                     /locus_tag="PC1_0379"
                     /note="Homoserine acetyltransferase [Amino acid transport
                     and metabolism]; Region: MET2; COG2021"
                     /db_xref="CDD:224932"
     gene            433449..435068
                     /locus_tag="PC1_0380"
                     /db_xref="GeneID:8131294"
     CDS             433449..435068
                     /locus_tag="PC1_0380"
                     /inference="protein motif:PFAM:PF00015"
                     /note="PFAM: chemotaxis sensory transducer; histidine
                     kinase HAMP region domain protein;
                     SMART: chemotaxis sensory transducer; histidine kinase
                     HAMP region domain protein;
                     KEGG: eca:ECA0390 methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_003015974.1"
                     /db_xref="GI:253686784"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:8131294"
                     /translation="MFRKIKIRTALSMMVFSLAALLLFVGVLGLVAVQSGNKSFARVD
                     MEVLPGLVALNDSSELLLRGRLDLRLYESLMGKGDVEAAKVALGRARTKVDGASEKWQ
                     EYLKYPQSDEEKVISADMAEKRNTLMQDFIDPAFAALNAGNLDEYRQRAGKSTVLYAA
                     FDKSSKALVAFKLKSIDEAYADSNGRVNLMETILYTAIACALLLAALAWSVMTNMIVK
                     PLNQAISVFDRIAEGDLRAQIDSSGKNEIAHLFAAVQRMRDGLENMVRVVRNGTDAIS
                     VGVEEIASGNIDLSSRTEQQAASLDETASSMEQIMSTVKNNEDNTRKANDLALKASNS
                     ASRGGNVVSEVVDTMRSIKQSSAKISDIVGVIDGIAFQTNLLALNAAVESARAGQYGK
                     GFAVVASEVRMLAARSATAAKEIGTMIDDSLSRIEKGAGLVEVAGNTMDEVLMDVKKV
                     VDIMDEITLASSEQSRGISQINIAINQMDGVTQQNASLVSEVATSANALQEQVVNLQQ
                     SVSRFQIARENMEMDNVLPGLRQNIALADAR"
     misc_feature    433542..433895
                     /locus_tag="PC1_0380"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    434094..434234
                     /locus_tag="PC1_0380"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(434094..434099,434106..434111,434115..434120,
                     434127..434132,434136..434138,434184..434189,
                     434193..434198,434205..434210,434214..434219,
                     434226..434231)
                     /locus_tag="PC1_0380"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    434250..434990
                     /locus_tag="PC1_0380"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    434328..434927
                     /locus_tag="PC1_0380"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(434352..434357,434364..434369,434376..434378,
                     434385..434390,434394..434399,434406..434408,
                     434415..434420,434427..434429,434436..434441,
                     434448..434453,434460..434462,434469..434474,
                     434478..434483,434493..434495,434499..434504,
                     434511..434513,434520..434525,434532..434537,
                     434544..434546,434553..434555,434562..434567,
                     434574..434576,434586..434588,434595..434597,
                     434616..434618,434628..434630,434637..434639,
                     434646..434651,434658..434660,434667..434672,
                     434679..434684,434688..434693,434700..434705,
                     434742..434747,434754..434756,434763..434768,
                     434775..434777,434784..434789,434793..434798,
                     434805..434810,434817..434819,434826..434831,
                     434838..434840,434847..434852,434856..434861,
                     434868..434873,434877..434882,434889..434891,
                     434898..434903,434910..434912,434919..434924)
                     /locus_tag="PC1_0380"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    434562..434663
                     /locus_tag="PC1_0380"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(435146..435706)
                     /locus_tag="PC1_0381"
                     /db_xref="GeneID:8131295"
     CDS             complement(435146..435706)
                     /locus_tag="PC1_0381"
                     /inference="protein motif:PFAM:PF01885"
                     /note="PFAM: phosphotransferase KptA/Tpt1;
                     KEGG: eca:ECA0395 RNA 2'-phosphotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase KptA/Tpt1"
                     /protein_id="YP_003015975.1"
                     /db_xref="GI:253686785"
                     /db_xref="InterPro:IPR002745"
                     /db_xref="GeneID:8131295"
                     /translation="MSNTKHADVSKFLSYVLRHKPEAIGLTLNSGGWANIAELISCAA
                     KDGRLLTREVIQSVVDNSDKKRFSISADGLSIRAAQGHSSAQVDMRYEPKVPPEFLYH
                     GTATRFIDSINQQGLRPGSRQYVHLSADEATAITVGQRHGKPTVLKIKTLEMHQQGFI
                     FYQADNGVWLTLTVPVPFIDSTPFID"
     misc_feature    complement(435185..435685)
                     /locus_tag="PC1_0381"
                     /note="RNA 2'-phosphotransferase, Tpt1 / KptA family;
                     Region: PTS_2-RNA; pfam01885"
                     /db_xref="CDD:250941"
     gene            complement(435844..435915)
                     /locus_tag="PC1_0382"
                     /pseudo
                     /db_xref="GeneID:8131296"
     gene            436273..437457
                     /locus_tag="PC1_0383"
                     /db_xref="GeneID:8131297"
     CDS             436273..437457