GenomeNet

Database: RefSeq
Entry: NC_012917
LinkDB: NC_012917
Original site: NC_012917 
LOCUS       NC_012917            4862913 bp    DNA     circular CON 01-MAR-2015
DEFINITION  Pectobacterium carotovorum subsp. carotovorum PC1, complete genome.
ACCESSION   NC_012917
VERSION     NC_012917.1  GI:253686409
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02598478
            Assembly: GCF_000023605.1
KEYWORDS    RefSeq.
SOURCE      Pectobacterium carotovorum subsp. carotovorum PC1
  ORGANISM  Pectobacterium carotovorum subsp. carotovorum PC1
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Pectobacterium.
REFERENCE   1  (bases 1 to 4862913)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H.,
            Bruce,D., Goodwin,L., Pitluck,S., Munk,A.C., Brettin,T.,
            Detter,J.C., Han,C., Tapia,R., Larimer,F., Land,M., Hauser,L.,
            Kyrpides,N., Mikhailova,N., Balakrishnan,V., Glasner,J. and
            Perna,N.T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Pectobacterium carotovorum subsp. carotovorum
            PC1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4862913)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H.,
            Bruce,D., Goodwin,L., Pitluck,S., Munk,A.C., Brettin,T.,
            Detter,J.C., Han,C., Tapia,R., Larimer,F., Land,M., Hauser,L.,
            Kyrpides,N., Mikhailova,N., Balakrishnan,V., Glasner,J. and
            Perna,N.T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUL-2009) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4085667
            Source DNA and bacteria available from Nicole T. Perna
            (ntperna@wisc.edu)
            Contacts: Nicole T. Perna (ntperna@wisc.edu)
                      David Bruce (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Metadata-START##
            Organism Display Name :: Pectobacterium carotovorum carotovorum PC1
            GOLD Stamp ID         :: Gi04239
            Oxygen Requirement    :: Facultative
            Cell Shape            :: Rod-shaped
            Motility              :: Motile
            Sporulation           :: Nonsporulating
            Temperature Range     :: Mesophile
            Gram Staining         :: gram-
            Biotic Relationship   :: Free living
            Diseases              :: Soft rot
            Habitat               :: Host
            Phenotypes            :: Pathogen
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 02/27/2015 20:47:16
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 460460)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,295
            CDS                          :: 4,180
            Pseudo Genes                 :: 14
            CRISPR Arrays                :: 1
            rRNAs                        :: 22 ( 5S, 16S, 23S )
            tRNAs                        :: 78
            ncRNA                        :: 1
            Frameshifted Genes           :: 9
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4862913
                     /organism="Pectobacterium carotovorum subsp. carotovorum
                     PC1"
                     /mol_type="genomic DNA"
                     /strain="PC1"
                     /sub_species="carotovorum"
                     /db_xref="taxon:561230"
     gene            72..1469
                     /gene="dnaA"
                     /locus_tag="PC1_RS00005"
                     /old_locus_tag="PC1_0001"
     CDS             72..1469
                     /gene="dnaA"
                     /locus_tag="PC1_RS00005"
                     /old_locus_tag="PC1_0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010281224.1"
                     /note="binds to the dnaA-box as an ATP-bound complex at
                     the origin of replication during the initiation of
                     chromosomal replication; can also affect transcription of
                     multiple genes including itself; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_012772748.1"
                     /db_xref="GI:502364539"
                     /translation="MSLSLWQQCLARLHDELPATEFSMWIRPLQAELSDNTLALYAPN
                     RFVLDWVRDKYLNNINVLLNDFCGMDAPLLRFEVGSKPLVQAISQPAQPHHKQVSAAP
                     QQQVRSAPVRPSWDNSPAQAEHTYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPG
                     GAYNPLFLYGGTGLGKTHLLHAVGNGIIARKPNAKVVYMHSERFVQDMVKALQNNAIE
                     EFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGV
                     EDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVREL
                     EGALNRVIANANFTGRSITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADL
                     LSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESH
                     DIKEDFSNLIRTLSS"
     gene            1474..2574
                     /locus_tag="PC1_RS00010"
                     /old_locus_tag="PC1_0002"
     CDS             1474..2574
                     /locus_tag="PC1_RS00010"
                     /old_locus_tag="PC1_0002"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976672.1"
                     /note="binds the polymerase to DNA and acts as a sliding
                     clamp; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_012772749.1"
                     /db_xref="GI:502364541"
                     /translation="MKFIVERERLLKPLQQVSSPLGGRPTLPILGNLLIQVTEDALSL
                     TGTDLEMEMVAKVALTQPHEPGATTVPARKLFDICRGLPEGAEITIMLDGDRMLVRSG
                     RSRFSLSTLPAADFPNLDDWQSDVEFSLPQATMKRLIEATQFSMAHQDVRYYLNGMLF
                     ETEGEELRTVATDGHRLAVCSMPVGQSLPSHSVIVPRKGVMELVRLLDGGDTPLQLQI
                     GSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEASCDLLKQAFSRAAILSNE
                     KFRGVRLHLIQNQLKITANNPEQEEAEEILDVQYDGTEMEIGFNVSYVLDVLNALKCE
                     GVRLLLTDSVSSVQIEDSASRAAAYVVMPMRL"
     gene            2624..3709
                     /gene="recF"
                     /locus_tag="PC1_RS00015"
                     /old_locus_tag="PC1_0003"
     CDS             2624..3709
                     /gene="recF"
                     /locus_tag="PC1_RS00015"
                     /old_locus_tag="PC1_0003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976674.1"
                     /note="Required for DNA replication; binds preferentially
                     to single-stranded, linear DNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein RecF"
                     /protein_id="WP_010281217.1"
                     /db_xref="GI:497967061"
                     /translation="MALTRLLIKDFRNIEAADLALVPGFNFLVGANGSGKTSVLEAIY
                     TLGHGRAFRSIQAGRVIRHDQPEFVLHGRIDGTETERSVGLSKNRQGDSKVRIDGSDG
                     HKVAELAQLLPIQLITPEGFTLLNGGPKFRRAFLDWGCFHNEPGFFAAWSNMKRLLRQ
                     RNAALRQVSHYGQLRAWDQELVPLAERISEWRAQYSAAIANDIATTCTQFLPEFSLSF
                     SFQRGWDKESEYAELLERQFERDRMLGYTALGPHKADFRIRASGVAVEDMLSRGQLKL
                     LMCALRLAQGEFLTRQNGLRCLYLIDDFASELDSTRRRLLAERLKATHAQVFVSAVSA
                     EQIEDMVGEKGKMFRVEQGKITVQSQD"
     gene            3728..6145
                     /gene="gyrB"
                     /locus_tag="PC1_RS00020"
                     /old_locus_tag="PC1_0004"
     CDS             3728..6145
                     /gene="gyrB"
                     /locus_tag="PC1_RS00020"
                     /old_locus_tag="PC1_0004"
                     /EC_number="5.99.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772750.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_012772750.1"
                     /db_xref="GI:502364552"
                     /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
                     DNAIDEALAGYCKDIIITIHADNSVSVQDDGRGIPTGIHEEEGISAAEVIMTVLHAGG
                     KFDDNSYKVSGGLHGVGVSVVNALSEKLKLVIHRDGKLHEQTYKHGVPQAPLAVTGET
                     NRTGTTVRFWPSHETFTNVVEFEYEILAKRLRELSFLNSGVSIRLIDEREKDKADHYH
                     YDGGIKAFVDYLNRNKTPIHPNVFYFSTVKDDIGVEVALQWNDGFQENIYCFTNNIPQ
                     RDGGTHLAGFRAAMTRTLNTYMDKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFS
                     SQTKDKLVSSEVKTAVESLMNEKLVDYLMENPSDAKIVVGKIIDAARAREAARKARDM
                     TRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGK
                     ILNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGSHIR
                     TLLLTFFYRQLPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQIMLALDGAT
                     LHTNAQAPALAGEPLEKLVSEHYAVQKLIGRMERRFPRALLNRLIYQPTLSEADLNER
                     ENVQAWAESLVNSLNESELHGSTYSFVIHHDEERGVFEPALRVRTHGVDTDYPLGAGF
                     VAGSEYRKLNQLGEKLRGLIEEDAYIERGERRQPVASFEQALEWLVKESRRGLTVQRY
                     KGLGEMNPDQLWETTMDPNSRRMLRVTVKDAIAADELFTTLMGDAVEPRRAFIEENAL
                     KAMNIDI"
     gene            complement(6488..7678)
                     /locus_tag="PC1_RS00025"
                     /old_locus_tag="PC1_0005"
     CDS             complement(6488..7678)
                     /locus_tag="PC1_RS00025"
                     /old_locus_tag="PC1_0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012772751.1"
                     /db_xref="GI:502364554"
                     /translation="MKFIKLPLLAQISSAHLVSHFHMMVLPALIPLLSAQRDISFVEL
                     GFALSVFNIVSACVQTPIGFMVDRIGARRTLTAGLALGSLCFLSLGFSDSYVWLVAAM
                     GLAGVANAVYHPADYALLSRGIDEKRMGRAFSVHTFSGFLGTAIAPGILLSIAAFSGI
                     NSAFIVSGVIGLLTIPLLLTDRDEPSRVKPAAATGTQPGKSRAPVFTLPILALLILFL
                     LLNLSTGSIQNFSVTALVTGYDLSLSQANVALTAFLFASAFGVLAGGSLADKTKRHGL
                     VATAALAVTAVLVSIVAMYSLPTIVLVPLLAAAGFLSGMIAPSRDMLVRAASPPGAEG
                     RVFGIVSTGFNIGGAAGPVLFGWLLDHGHPHAIFWSAVIFMLITAFITLLQEMRSAKR
                     RALA"
     gene            7843..8211
                     /locus_tag="PC1_RS00030"
                     /old_locus_tag="PC1_0006"
     CDS             7843..8211
                     /locus_tag="PC1_RS00030"
                     /old_locus_tag="PC1_0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010281208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-5-phosphate 3-epimerase"
                     /protein_id="WP_012772752.1"
                     /db_xref="GI:502364556"
                     /translation="MTIKSYLGGCLCGQIRFRASGEPGNPHACSCTFCQQHSGAPTLL
                     WVEFPRSAVEWIGEGGEPARYRSSDYSSRAFCPHCGSTLGAIDDEPTIALTIGNFDEK
                     NSPELKPTSHSFEDCCPRWE"
     gene            complement(8261..10264)
                     /locus_tag="PC1_RS00035"
                     /old_locus_tag="PC1_0007"
     CDS             complement(8261..10264)
                     /locus_tag="PC1_RS00035"
                     /old_locus_tag="PC1_0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_043881696.1"
                     /db_xref="GI:762766796"
                     /translation="MSTTLLPVNHSNPSIHSSPTASKRKLSTRMLMLLAGVSTIALGF
                     ILTIGLLIWQSGQQQKTIAQHYLEQTAYTNSYLIQQKLDVALHAARNLVQSVVSLQEA
                     GNADRKTAETLLKNALKSHPDFLSMSLAWEPDAFDGKDREYAGQPDQDPQGRFVRYVD
                     RDTAGNVALHNLVDYETPGSGDYYLLPKKLQKEVILEPYSYPYNGVDVLLTSIAVPII
                     INNKFYGSVTADFSLDTLQQLTNNIKPYEGTGYAQLLSHSGAYISHPEKARVTKKIEN
                     DPTLLEHVTTGQPYQIERDNAVLNTPAFNVYVPVTIGNTGTPWMLGLSAPVNVVMAET
                     VRQRNIGLLLMVLSIVVVSGVLGIIFNRKVARPIGGEPAQAAQIALSVAQGDLTQTIP
                     VQPKDDSSIFYAMNAMQSQLRDIAEQLISTSESVSHGATEIAAGNTDLASRTEQQAAA
                     LEETAASMEQITATVKQNADNAHNATTLAQNAAHIAQKGDKIVGQVVHIMSEIDDSSK
                     KIADITSIINGIAFQTNILALNAAVEAARAGEQGRGFAVVANEVRNLAQRSASAVKDI
                     TALITESANRVDSGVTLVQSAGETMQDMLRAVTSVKDIMDEIVSASDEQSRGISQVTQ
                     AVHEMDGVTQQNAALVQEATAAAASLEEQARQLAQTVLVFKLS"
     gene            complement(10548..11561)
                     /locus_tag="PC1_RS00040"
                     /old_locus_tag="PC1_0008"
     CDS             complement(10548..11561)
                     /locus_tag="PC1_RS00040"
                     /old_locus_tag="PC1_0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_012772754.1"
                     /db_xref="GI:502364560"
                     /translation="MVTMLDVAKKAGVSKATVSRVLTGNNYVSKTTRDRVFRAIEDIG
                     YRPNLLARQLATSKSQIIGLVVTNTLYSGPYFSELLFQTATMTEKYGRQLIMADGKHS
                     AEEEREAIQFLLDLRCDAVIIYPRFLSIDALESIIEQHEQPIMVVNRTLHRHGDNGIC
                     ADHQQHCHDAVNYLITQGHRDIAFICGSPNSPTGTSRLAGYRQALEENGIPYSDSLVA
                     PGDWTHDSGYSAAKTLLQRSTTFSALVASNDDMAIGAAKALREHGLAIPQDVSLLGFD
                     DLPMASWFYPPLTTVHVPVAEMINYTLEKLLCRLEGETVEPAPDFKGELIIRDSVSKG
                     PAT"
     gene            11776..12081
                     /locus_tag="PC1_RS00045"
                     /old_locus_tag="PC1_0009"
     CDS             11776..12081
                     /locus_tag="PC1_RS00045"
                     /old_locus_tag="PC1_0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcmE"
                     /protein_id="WP_012772755.1"
                     /db_xref="GI:502364563"
                     /translation="MNKILLCCAAGMSTSMLVQRMEKVAEQKAIAVEIKAVGFEEFSE
                     LIDEYDCCLLGPQIKYKLPEFKVIADEKEKPIAVINMVDYGMMNGEKVLNDALAMIA"
     gene            12098..13411
                     /locus_tag="PC1_RS00050"
                     /old_locus_tag="PC1_0010"
     CDS             12098..13411
                     /locus_tag="PC1_RS00050"
                     /old_locus_tag="PC1_0010"
                     /EC_number="2.7.1.69"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS cellobiose transporter subunit IIC"
                     /protein_id="WP_012772756.1"
                     /db_xref="GI:502364566"
                     /translation="MSKLTESLFSVIENRISPIAAKLSSQRHVVAIKDGFIASMPFLI
                     VGSFMMLFAHPPFSPNSEWAFAQWWLGMVERHGEQIMMPYNMTMGIMAVYITSAIAYN
                     LAQSYKMNGFMAASLALMSFMVVAAPQIDKSLPVGSLGGEGIFTAIIVAIYSTELMHF
                     LQKHNIGIRLPEQVPPKIRQSFDLLIPILAIFLTLFPLSLFMQSQFGMLLPQAIMAVF
                     APIISASDSLPAILIAVLLCHLLWFAGIHGAVIVGGILQAFWLTNLGINQEAFNAGAP
                     ITKIFIEPFWQFFITVGGSGATMGLVFLYLRSRSAHLRSIGKLAVVPSMFNINEPVIF
                     GSPVVMNPLLFIPFITAPLVNAILAYIALKTDLVHRVISLAPWTTPGPIGAAWSTGWD
                     WRAVVLVGVLIVVSSLIYYPFFKMYERQLIEQEVGTAEEAVSDAR"
     gene            13401..13727
                     /locus_tag="PC1_RS00055"
                     /old_locus_tag="PC1_0011"
     CDS             13401..13727
                     /locus_tag="PC1_RS00055"
                     /old_locus_tag="PC1_0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone TorD"
                     /protein_id="WP_012772757.1"
                     /db_xref="GI:502364573"
                     /translation="MLDETTIMELIIYAGEARSSSMEALSAARKYDWDKAEELLNAAS
                     VAARKAHQIQTALIGADEGSGKIPVNLILVHAQDHLMNAMLCRELVEELIQLHREISS
                     LKQLIN"
     gene            13760..15202
                     /locus_tag="PC1_RS00060"
                     /old_locus_tag="PC1_0012"
     CDS             13760..15202
                     /locus_tag="PC1_RS00060"
                     /old_locus_tag="PC1_0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="WP_012772758.1"
                     /db_xref="GI:502364575"
                     /translation="MSVQQLPKDFLWGGAVAAHQVEGGWDQGGKGVSICDVLSGGAHG
                     VDRVITDGVQPGVSYPNHQAVEFYSHYKQDVALFAEMGFKCFRTSIAWTRIFPNGDEL
                     EPNEAGLQFYDDLFDELLKYNIEPVITLSHFEMPHHLVKQYGGWLNRKVVDFFVRYSE
                     VVMKRYQSKVKYWMTFNEINNQRNWQYPLFGYCCSGVIFTDHDKPEQAMYQTLHHQFV
                     ASAKVVKLGHEINPNFKIGCMLALVPIYPWSCHPDDVMFAQEAMRERHLFGDVQLRGY
                     YPSYILKEWARKGYQIDMQPEDEQTLRDGCTDYLGFSYYMSSAVQLAAKGQKKEDSIT
                     GFDGGVKNPHVKASEWGWQIDPVGLRYTLNSFYERYQKPMFIVENGFGAVDKVEADGS
                     INDDYRIEYLKAHIDQMKKAVVEDGVELMGYTPWGCIDCVSFTTGQYSKRYGFIYVDK
                     HDDGTGTFKRSKKKSFDWYKKVISSNGAEL"
     gene            15358..16173
                     /locus_tag="PC1_RS00065"
                     /old_locus_tag="PC1_0013"
     CDS             15358..16173
                     /locus_tag="PC1_RS00065"
                     /old_locus_tag="PC1_0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011095887.1"
                     /note="YidA; catalyzes the dephosphorylation of erythrose
                     4-phosphate (preferred substrate), mannose 1-phosphate and
                     p-nitrophenyl phosphate; hydrolyzes the
                     alpha-D-glucose-1-phosphate but not the beta form; member
                     of the haloacid dehalogenase-like hydrolases superfamily
                     and Cof family of proteins; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate phosphatase"
                     /protein_id="WP_012772759.1"
                     /db_xref="GI:502364577"
                     /translation="MSVKLIAIDMDGTLLTPQNQISPAVKAAIAAAREKGVQVVLATG
                     RPYIGVERYLMELDLQQEGCYCITNNGALVQRTVNGDCVAQTALSFDDYLYFEALACK
                     LGVHFHALDFNFVYTANKDISPYTIHESHLTGMPLKYRAVEEMDRSLTFPKVMMIDEP
                     EILDRAISQIPPEAFERYTIMKSAEYYLEILDKRVNKGEGVKMLAEHLGIPRESVMTL
                     GDQQNDLAMIRYAGIGVAMGNAIDEVKEASQFVTKSNTEDGVAYAIEKFVLNA"
     gene            complement(16319..17215)
                     /locus_tag="PC1_RS00070"
                     /old_locus_tag="PC1_0014"
     CDS             complement(16319..17215)
                     /locus_tag="PC1_RS00070"
                     /old_locus_tag="PC1_0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012772760.1"
                     /db_xref="GI:502364579"
                     /translation="MRINPRQVEAFHKVILTGGITAAANMMYITQPAVSRLIKDFEDA
                     LNLKLFDRDGRGLIPRAEAMKLYREVERLYLGLDQIGLIADEIRHAKGSVLRIAAVQA
                     LSFLCSDQVLPTLLKKYPDLSLFLDIESSSRITDAIAENHYDVGFIFGQPGIKGLEAE
                     PLADASAVAVLAMGHPLATADEITLADLAGTRAILPGRTTPLRAQIDISARKEQIYLH
                     NPIETSMANCCVLASRNVGIGVVDFITALNSPSPVIVKPFNPDIKMAYCAVYPPQIPR
                     SQVVNHITQVMKEKIADSLELK"
     gene            17358..18908
                     /locus_tag="PC1_RS00075"
                     /old_locus_tag="PC1_0015"
     CDS             17358..18908
                     /locus_tag="PC1_RS00075"
                     /old_locus_tag="PC1_0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012772761.1"
                     /db_xref="GI:502364580"
                     /translation="MKKSTLALLFTVLFSSSPLVYSADLNIGLASSTTSMDPQFYVSG
                     ANSAMARNIFDGLVVQDEKQQIAPALATSWKVIDDKTWEFVLRPGVKFHDGSDFTAKD
                     VIASIKRVALASKNSPSSYAPYVSDIAEVIEVNPLTVRIKTKEASPLLLNNLSRISIL
                     PARLENVPTETLNSGKDVIGTGPFKFVSWVPDDRVVLSRNDDYWGGKAEWDNVTVRVF
                     KNSSARVAAVLSGDVDMIENVPTADSSNIEKNQQLKTISTPGNRVIYLHMDQQREESP
                     FAKGPDGKNPLLKKEVRQAMSLAINRQAIVDRVMEGQAVVASQLVPKGYPGYSASIPA
                     PVYNPEKAKQELAAAGYPDGFTLTFHASNDRYPNDSKIAQAIGQMFTRAGIKTEVVTM
                     PGSVYFSRASRLEFSLIMGGAAIETGEASGVLGPLLETFGPNAGQGNRGRYSNPAFDK
                     ALSEARVTLDETKRDALLAEAMNIGMNDLGVIPVMFLSNTWAMKKQYTYVGRSDAYTL
                     PYFVRSAK"
     gene            18978..19862
                     /locus_tag="PC1_RS00080"
                     /old_locus_tag="PC1_0016"
     CDS             18978..19862
                     /locus_tag="PC1_RS00080"
                     /old_locus_tag="PC1_0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="WP_012772762.1"
                     /db_xref="GI:502364582"
                     /translation="MNTFSGVFPYLVSPVRPDGQVDKPVLAQLTEHLIQCGVHGVVPL
                     GSTGEFAYLSAAQRLDVVKTVIETTAGRVPVIAGVASTTIQDAVEQTKRYVELGADGI
                     LAVLEAYFPLKDEGVEQYFRAIAEAAQGKPVVLYTNPQFQRSDLSLPVIERLSHVSNI
                     RYIKDASTNTGRLLSIIERTRGRMDVFSASAHIPACVMLIGGVGWMAGPACIVPKQSI
                     ALYEAARAGDWNKAMELQRPLWRINEIFARYSIAGCIKAALQLQGFAVGDPLPPQLPL
                     DEKARKEIADVLASVDSL"
     gene            19965..20918
                     /locus_tag="PC1_RS00085"
                     /old_locus_tag="PC1_0017"
     CDS             19965..20918
                     /locus_tag="PC1_RS00085"
                     /old_locus_tag="PC1_0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-uridine preferring nucleoside hydrolase"
                     /protein_id="WP_012772763.1"
                     /db_xref="GI:502364583"
                     /translation="MSALPIIIDCDPGIDDAIALLSAFVAPELDIRGICTVCGNQPLD
                     KTLRNALQIVELGQRTDIPVFAGCHRPLLRDPIHGQFHGESGLGQTVLPAPQKQAEAQ
                     HAVSFIIAQCKQAIADGTPITLCTLGPLTNVAMALRMAPEIADGIARIVMMGGAYREA
                     GNRSLTSEFNMIADPQAAKVVFDSSIALVALPLDVTHQVILTPELVARFIALSGRISA
                     PLGEMMAFWDRNDIRRYGSRGGPLHDPLVIAWVLAPHCFTTEKASVYIEQESELCMGQ
                     TVADWYGKTDRQPNVDVVTGVDAKQVVELFADLLSRYGEGV"
     gene            20920..21927
                     /locus_tag="PC1_RS00090"
                     /old_locus_tag="PC1_0018"
     CDS             20920..21927
                     /locus_tag="PC1_RS00090"
                     /old_locus_tag="PC1_0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-uridine preferring nucleoside hydrolase"
                     /protein_id="WP_012772764.1"
                     /db_xref="GI:502364584"
                     /translation="MVQERIIIDTDPGVDDAIAIWLALASPELDVLGITVVAGNVPLA
                     ATLSNACNVVGVTGRTDVPIFAGASRPLIRDQVFGKYAHIGKFSADWVPESTLSPEQE
                     HAVDFLVRMTRQAAADNNPITICALGPLTNLALALCFHPDVARGIKQIVSMSCAFTAM
                     GNRVPWADFNVYADPHAAEIVFSSGVPIVIMPLDMTFQALIQTEQVDDIERSGGAPGK
                     AMAALLRMFDRSEVDRFGREGGPIHDATVIAWLLKPELFKSKRARIGVEVAGRTAGYA
                     FADFYHKLGEPENALVMREIDEQGFLGLIAERLRRYGSEEIEGSEKKDSSEALNGSGG
                     R"
     gene            21927..22904
                     /locus_tag="PC1_RS00095"
                     /old_locus_tag="PC1_0019"
     CDS             21927..22904
                     /locus_tag="PC1_RS00095"
                     /old_locus_tag="PC1_0019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010296900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012772765.1"
                     /db_xref="GI:502364585"
                     /translation="MIAYLLSRIGQTLLTLAVMSVLVFVGVYLVGNPVDMLLGATATP
                     AERLAVIQSFGLDKPVWEQYGLFVWNAFQGDMGNSFIFNQPALTLIFQRMPATLELAM
                     VAFVMALIVGIPLGIYAGLKPDSAVSKSIMTFSILGFSLPTFWIGLVMIMLFSVKLGW
                     LPSSGRGDVHELFGIPFSFLTRDGLEHLLLPAFNLALFKISLVIRLMRAGVMECLQQD
                     YVQFARAKGLSETRIVLVHVLRNTLIPLITVLGLELGSLIAFAVVTETIYAWPGMGKL
                     IIDSIAVLDRPVILAYLMITVVMFSVINLLVDLLYVLVDPRVRLGGDKG"
     gene            22901..23809
                     /locus_tag="PC1_RS00100"
                     /old_locus_tag="PC1_0020"
     CDS             22901..23809
                     /locus_tag="PC1_RS00100"
                     /old_locus_tag="PC1_0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_012772766.1"
                     /db_xref="GI:502364587"
                     /translation="MTGNTIHQPAAVQKAVHPVMRVVMALINDRLALFGLIMLAIFVL
                     LALLAPLLSPQNPYDLMQLDIMDGRLVPGSSSMSGMTYWLGTDDQGRDLFSAILYGTR
                     ISLMVGFTSAVFALLIGASLGLISAYVGGKTDATIMRIVDIQLSFPPILIALILLAVL
                     GQGVDKIIMALVVTQWAYYARTIRGSALVERRRSYVDAARSMALSNRRILFRHILPNC
                     LAPLIVVATMRIAYAIMLEATLSFLGIGLPVTEPSLGLLISNGFEYLMSGDYWISFFP
                     GLTLLLLIVAINLVGDALRDILNPRN"
     gene            23849..25657
                     /locus_tag="PC1_RS00105"
                     /old_locus_tag="PC1_0021"
     CDS             23849..25657
                     /locus_tag="PC1_RS00105"
                     /old_locus_tag="PC1_0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772767.1"
                     /note="with GsiBCD is involved in glutathione import; GsiA
                     contains 2 ATP-binding domains; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione ABC transporter ATP-binding protein"
                     /protein_id="WP_043881697.1"
                     /db_xref="GI:762766805"
                     /translation="MTAPIMSVSHLTTAFQVNGEWMNVVRDLSFTIGEKETVAVVGES
                     GSGKSVMAKSIMRLLPPGQSRIEGQIHFGDTELLSLPSKAMQDVRGNRIGMIFQEPMT
                     SLNPVLPIGYQITEVLRRHRGMGKAEARAEAVRLLEKVRIPAAKSRLNEYPQSFSGGM
                     RQRVVIAIALACHPKLLIADEPTTALDVTIQAQILTLIKTLQEEEGMSVLFITHDMGV
                     VAEVSDRTLVMYQGEMVENAVTREIFHHPQQPYTRMLLSAVPKLGSMSGSAWPQRFPL
                     IDLKTGERQSVPDAVNTVSGEEPVLTVKNLVTRFDIRSGFFRRLSGRVHAVENVSFDL
                     WPGETLALVGESGCGKSTTGRSIIRLNDAVSGDIQLLGKNILTADKRELTESRRQIQM
                     VFQDPYESLNPRMRIGEAIAEPMLLHGLATRQNVSARVSELLEQVGLSGDMASRFPHQ
                     FSGGQRQRVCIARALALEPKVIIADESVSALDVSVKAQVINLMLDLQQKLGLSFLFIS
                     HDMAVVERISHRVAVMYLGEIVEIGPRSAIFDNPQHDYTRRLISAVPVPDPDTRPVRN
                     ITNDELRSPVRAPDFHPPVRRYKQVGEGHFVLETVA"
     gene            complement(25733..25990)
                     /locus_tag="PC1_RS00110"
                     /old_locus_tag="PC1_0022"
     CDS             complement(25733..25990)
                     /locus_tag="PC1_RS00110"
                     /old_locus_tag="PC1_0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772768.1"
                     /db_xref="GI:502364592"
                     /translation="MKNVKFFAAAVVLSTLSFGAFAAEQVSSQQAQGLEKVGVVSATA
                     RSLDSLQAQLAQKAEKAGASAFTITSATGDNQLRGVAVIYK"
     gene            complement(26163..26963)
                     /gene="ssuB"
                     /locus_tag="PC1_RS00115"
                     /old_locus_tag="PC1_0023"
     CDS             complement(26163..26963)
                     /gene="ssuB"
                     /locus_tag="PC1_RS00115"
                     /old_locus_tag="PC1_0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772769.1"
                     /note="part of the ABC type transport system SsuABC for
                     aliphatic sulfonates; with SsuA being the periplasmic
                     substrate-binding subunit, SsuB the ATP-binding subunit
                     and SsuC the permease; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aliphatic sulfonate ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_012772769.1"
                     /db_xref="GI:502364595"
                     /translation="MTAFTDSATRAHSPSPLTKGTPLALDAITKHYGHRTVLNDVQLR
                     IPSGQFVAIVGRSGCGKSTLLRLLAGLEAASSGELLTGTAPLSSAKDDTRLMFQEARL
                     LPWKKVIDNVGLGLRGNWREKAQEALASVGLADRASDWPAALSGGQKQRVALARALIH
                     HPRLLLLDEPLGALDALTRIEMQSLIENLWLQHGFTVLLVTHDVSEAIALADRVILIE
                     EGRVGLDITVDLPRPRRRGSAKLAELEARVLERVLAPASSPLPQQAVI"
     gene            complement(26960..27754)
                     /gene="ssuC"
                     /locus_tag="PC1_RS00120"
                     /old_locus_tag="PC1_0024"
     CDS             complement(26960..27754)
                     /gene="ssuC"
                     /locus_tag="PC1_RS00120"
                     /old_locus_tag="PC1_0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976731.1"
                     /note="part of the ABC type transport system for
                     alkanesulfonate SsuABC; SsuB the ATP-binding subunit and
                     SsuC the permease; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonate ABC transporter"
                     /protein_id="WP_012772770.1"
                     /db_xref="GI:502364598"
                     /translation="MARTPSSLAQRLAPFLLPVTLLVAWQVAVEFGWLSNRILPAPSS
                     VITAGWSLIYSGELWQHLAISGWRALIGFAIGGTIGLTLGFITGLSRWGERLLDSSVQ
                     MIRNVPHLALIPLVILWFGIDEAAKIFLVALGTLFPVYLNTYHGIKNIDRGLLEMARS
                     YGLSGLSLFYQVVLPGALPSIMVGIRFALGFMWLTLIVAETISANSGIGYLAMNAREF
                     LQTDVVVVAIILYALLGKLADISAQGLERIWLRWNPAYQTSSGDAS"
     gene            complement(27765..28907)
                     /locus_tag="PC1_RS00125"
                     /old_locus_tag="PC1_0025"
     CDS             complement(27765..28907)
                     /locus_tag="PC1_RS00125"
                     /old_locus_tag="PC1_0025"
                     /EC_number="1.14.14.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010281139.1"
                     /note="catalyzes the release of sulfite from
                     alkanesulfonates; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkanesulfonate monooxygenase"
                     /protein_id="WP_012772771.1"
                     /db_xref="GI:502364608"
                     /translation="MSLNVFWFLPTHGDGRYLGSTEGARHVDYGYLQQVAQAAERQGF
                     GGVLLPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGVISPTIAARQAATLDRLSNGR
                     ALFNLVTGGDPEELAAEGLFLSHEERYEASAEFTHIWRRLLEGETVDFAGKHIQVKDA
                     KLLYPPVQQPRPPLYFGGSSEAAQNLAAEQVDLYLTWGEPPEQVKEKLAEVRDKAAAQ
                     GREVRFGIRLHVIVRETTEEAWQAADRLISHLDEKTIADAQAALARFDSVGQQRMAAL
                     HGGKKDKLEISPNLWAGIGLVRGGAGTALVGDGPTVAERIQEYADLGIDTFILSGYPH
                     LEEAYRVGELLFPHLDLAQQPTPLHAVNNAGEVVANRYVPRKVSQS"
     gene            complement(28966..29988)
                     /locus_tag="PC1_RS00130"
                     /old_locus_tag="PC1_0026"
     CDS             complement(28966..29988)
                     /locus_tag="PC1_RS00130"
                     /old_locus_tag="PC1_0026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010281136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012772772.1"
                     /db_xref="GI:502364612"
                     /translation="MSLMMKKSVTEIREKRTPLWKNVATQLRRIPTLLVASAVLFMST
                     AYAQDSVPTQLRIGYQKGSISLVLAKSHLLLEKQFPNTKISWIEFPAGPQMLEALNVG
                     SIDLGGTGDIPPIFAQAAGADLLYVGVEPPKPQAEVILVREDSPVKTVADLKGRKVAF
                     QKGSSAHNTLLRALQRDGLKFTDIKPTYLTPADARAAFQQGNVDAWAIWDPYYSAALL
                     EGGVRVLVDSSGLEKTGSFYLAGRPYAEAHGTFIRQVLDELTKADALTISDRAQSVTL
                     LANAVGLPEKVIETALDHRPPTTIEPLDAATIKAQQSTADLFYENRLVPVKVNIAERV
                     WRPKAN"
     gene            30438..31883
                     /locus_tag="PC1_RS00135"
                     /old_locus_tag="PC1_0027"
     CDS             30438..31883
                     /locus_tag="PC1_RS00135"
                     /old_locus_tag="PC1_0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012772773.1"
                     /db_xref="GI:502364615"
                     /translation="MALTDSSQDKAPRQEHSDSGRISGLALLVASAFFMEFLDGTVIA
                     TALPDMAKAFGVTAIDLNIGISAYLLTLAVLIPANGWVAERFGARNVFTLALCIFTLS
                     SLLCGLSHNVTEFVLMRILQGVGGAMMVPVGRLVVLRTTPKDQLIKAIATLTWPALVA
                     PIIGPPLGGFITTYASWHWIFFLNVPLGLIAIVLSLRMMPNQSANESKPFDFPGFIAT
                     GVTMLCLVVGLEMLSQQNVSLIGAAVTIAIGLATLVWSVRHLLTCKTPLIGLSSLSVP
                     SFRISMRGGFILRATISSAPFMLPLMFQVGFGMNAFEAGSMVLAVFAGNLAMKPATTP
                     LIRYFGFRKLLISNGIACVLTLLLCALLTPDSPHLITLTLLFLGGLSRSMQFTSISSL
                     AFAEVPSQEMSSANTLFSTSLQLASGLGVTMGALSIRLGNILSDELGYTAVPGMGFRL
                     GFVVIAIITAFGVYDMTRLAPNAGINVSQKK"
     gene            32281..32544
                     /locus_tag="PC1_RS00140"
                     /old_locus_tag="PC1_0028"
     CDS             32281..32544
                     /locus_tag="PC1_RS00140"
                     /old_locus_tag="PC1_0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010296885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS lactose transporter subunit IIB"
                     /protein_id="WP_043881857.1"
                     /db_xref="GI:762768335"
                     /translation="MKEAASTRGLDVDIAAYAAHEFDEQVGKYDVVLLGPQVKYMLAS
                     FQEKAEGKGVPVAAIDMMDYGMQRGDNVLDFAFSLIEKSGQPL"
     gene            32541..33863
                     /locus_tag="PC1_RS00145"
                     /old_locus_tag="PC1_0029"
     CDS             32541..33863
                     /locus_tag="PC1_RS00145"
                     /old_locus_tag="PC1_0029"
                     /EC_number="2.7.1.69"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS cellobiose transporter subunit IIC"
                     /protein_id="WP_012772775.1"
                     /db_xref="GI:502364623"
                     /translation="MSGLYQSMVNIIEQKITPLAGVVGQQRHIIAIRDGFIAALPFMI
                     IGSFMLVFIFPPFAPDTTLGFARAWLDFSVAYREQLMLPYYLSMGVMTFFISVGIGAS
                     LGKHYKLDPIMTGLLALMAFLLVAAPYHDKQISTQYFSGEGIFTAILTSIYAGEVYAW
                     LKKRNITIRLPKEVPTGVARSFEILIPVLVIVATLHPFNLFIQSATGMIIPEAIMHLL
                     APLISASDSLPAILISVFICQILWFAGIHGALIVTGIMNPFWMTNLALNQAALSAGAP
                     LPHIYLQGFWDHYLLIGGVGSTLPLAFLLLRSRAVHLRTIGRMGVVPSFFNINEPILF
                     GAPIIMNPLLFLPFIFVPMVNAVIAYTATKLGWIAQVVSLTPWTTPAPIGASWAANWA
                     FSPVIMCLLCMVMSAAMYYPFLKVYERTLLKQEQEKQQQAAGEASASA"
     gene            33889..35301
                     /locus_tag="PC1_RS00150"
                     /old_locus_tag="PC1_0030"
     CDS             33889..35301
                     /locus_tag="PC1_RS00150"
                     /old_locus_tag="PC1_0030"
                     /EC_number="3.2.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="WP_012772776.1"
                     /db_xref="GI:502364634"
                     /translation="MHDHLQKDFRFPANFWWGSASSAPQTEGESLNYGKSATVWDEWF
                     ATQPGRFHQQVGPADTSTFYQHWREDIALLKTLNHNTFRTSISWARLIPDGVGEPNPQ
                     AVAFYNQVIDEMLAQGITPFINLFHFDMPMVMQRLGGWENRAVVVAYAGYAATCFRLF
                     GDRVKHWFTFNEPVVPVEGGYLYDFHYPNVVDFKRAATVAYHTMLAHSLAVKAYREQS
                     QGGEIGIILNLTPSYPRSQHPADVKAANIADLMFNRSFLDPALRGEYPQELVDLLQRY
                     GQLPSCQPDDRALLADGVVDLLGINYYQPRRIQCRDSLVNPDSPFMPEWFFSSYEMPG
                     RKMNPYRGWEIYEPGIYDILTNLRVNYGNPRCFISENGMGVENEQRFDANGQIQDDYR
                     IDFVREHLKYVHKGIAEGSNCLGYHMWTFIDNWSWSNAYKNRYGFVQLDLVTQKRTVK
                     KSGEWFATIAAENGFQDVTS"
     gene            complement(35464..35721)
                     /locus_tag="PC1_RS00155"
                     /old_locus_tag="PC1_0031"
     CDS             complement(35464..35721)
                     /locus_tag="PC1_RS00155"
                     /old_locus_tag="PC1_0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772777.1"
                     /db_xref="GI:502364637"
                     /translation="MKNVKTIAAAVVLATMTFGASAAEYVAPSQTQNLEKVGVVTATA
                     QDLSSLQAQLAAKAEKAGAKAYTITSATGNDQLRGSAVIFN"
     gene            36126..37238
                     /locus_tag="PC1_RS00160"
                     /old_locus_tag="PC1_0032"
     CDS             36126..37238
                     /locus_tag="PC1_RS00160"
                     /old_locus_tag="PC1_0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter Tol"
                     /protein_id="WP_043881698.1"
                     /db_xref="GI:762766819"
                     /translation="MIYRATAGAHVGVVTCSPQEPLRYVFIHGPENPDGEWQYDFHHR
                     RGTIVADCQRDEAITLDAFSITSPYQAGALRGGTHVHVFSPDASRLSFTYNDHVLHER
                     DPALNLRNVGVAVPLQAVTVEKRHPREYDGSHYCVLVSQTTPQPQPGSDEINRAYEEG
                     WVGTVGYIRQDGSRQRWALAFIGDTRAADGTTVPEIFIVDLPDALEDYAKEGDAPLAG
                     TATSMPAPPAGVQQRRLTFTHSRRYPGLVNQPRHWLRASPDGSEIAFLMRDEAGVVQL
                     WTISPNGGEPRQVTHTEHGVQSAFNWHPDGRSLAFVCDNSIMLCEAKSGELVRLTART
                     DSAPSADAVVFSPDGKHIAYMREIDGFNQLFVVTSA"
     gene            complement(37274..37666)
                     /locus_tag="PC1_RS00165"
                     /old_locus_tag="PC1_0033"
     CDS             complement(37274..37666)
                     /locus_tag="PC1_RS00165"
                     /old_locus_tag="PC1_0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772779.1"
                     /db_xref="GI:502364645"
                     /translation="MTLLKSALFSFIITGSGAVATSGCSSVMTHTGSDQGYYSGMRAS
                     MDMLRDDDTSWAMMPLVVIDLPFSAVADTVLLPYDYYRSGSDKNKMSTRERISHSEEQ
                     NQTASSQLATMPHNDTMPHNNTMPHNQL"
     gene            38051..38464
                     /locus_tag="PC1_RS00170"
                     /old_locus_tag="PC1_0034"
     CDS             38051..38464
                     /locus_tag="PC1_RS00170"
                     /old_locus_tag="PC1_0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6CYV2.1"
                     /note="with IbpB associates with aggregated proteins to
                     stabilize and protect them from irreversible denaturation
                     and extensive proteolysis during heat shock and oxidative
                     stress; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat-shock protein IbpA"
                     /protein_id="WP_005976748.1"
                     /db_xref="GI:492821570"
                     /translation="MRNPDFSPLYRSAIGFDRLFNLLETGQTQSNGGYPPYNVELVDE
                     NQYRIAIAVAGFAEQELDITAHDNLLIVKGAHAGEQVARNYLYQGIAERNFERKFQLA
                     EHIQVKGANLENGLLYIDLERIVPEAMKPRRIEIK"
     gene            38620..39069
                     /locus_tag="PC1_RS00175"
                     /old_locus_tag="PC1_0035"
     CDS             38620..39069
                     /locus_tag="PC1_RS00175"
                     /old_locus_tag="PC1_0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DGL1.1"
                     /note="16 kDa heat shock protein B; associates with
                     aggregated proteins, together with ibpA, to stabilize and
                     protect them from irreversible denaturation and extensive
                     proteolysis during heat shock and oxidative stress;
                     ATP-independent; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat-shock protein IbpB"
                     /protein_id="WP_012772780.1"
                     /db_xref="GI:502364657"
                     /translation="MRNYDLSPLLRQWIGFDKLASSMQGSQEPIDFPPYNIEKKDDNH
                     YRITLALAGFRQSDLDIEVEGPRLTVKGSPAPTEKAVEYLHQGLVFKPFTLSFTLAEH
                     LHVSDAHFENGLLHIDLVRDVPEALQPQRIAIGGGRPALNQQPAEDA"
     gene            39247..40905
                     /locus_tag="PC1_RS00180"
                     /old_locus_tag="PC1_0036"
     CDS             39247..40905
                     /locus_tag="PC1_RS00180"
                     /old_locus_tag="PC1_0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010296867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_012772781.1"
                     /db_xref="GI:502364660"
                     /translation="MSDIALTVSMLALVAVLGLWIGNWRIYGVGLGIGGVLFGGIIVG
                     HVAHQYQIQLNDDMLHVIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNAFALLTVF
                     LGCVVTVLLHKLLNIPLPIILGIFSGAVTNTPSLGAGQQILTDLGSSAALVNQMGTGY
                     AMAYPLGICGILLVMWLMRVLFRVAVENEAKQFEVSNGQHHEQLHTMNVSVTNTNLQG
                     LAIQDVPILNRDTIVCSRLKRGDELMVPSPQTLIQLGDYLHLVGAKNDLEQARLVIGH
                     EVETSLSTRGTDLHVERVVVTNEKVLGRKIRELNLKQNYDVVISRLNRAGVELVASNQ
                     ASLQFGDILNLVGRKTAIDAVADIVGNAQQKLQQVQMLPVFIGIGLGVLLGSVPLMIP
                     GFPVALRLGLAGGPLVVALVLGRIGGIGKLHWFMPPSANLALRELGIVLFLSVVGLKS
                     GGDFIDTLLNGDGVWWIGYGALITIVPLLLVGILARTLGKMNYLTLCGMLAGSMTDPP
                     ALAFANGLHPTSGAAALSYATVYPLAMFLRIMSPQLLAVLFLTL"
     gene            41490..42902
                     /locus_tag="PC1_RS00185"
                     /old_locus_tag="PC1_0037"
     CDS             41490..42902
                     /locus_tag="PC1_RS00185"
                     /old_locus_tag="PC1_0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011095861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate translocator"
                     /protein_id="WP_012772782.1"
                     /db_xref="GI:502364663"
                     /translation="MSANNSRFIKLLIILCIAGGLWLLPVPDGVKPDAWHLMAIFIAT
                     VVGLILSPYPLGAMAMFSLTSVAILGLLSIKDVLAGFSDPTIWMIACAFFISRGFIKT
                     GFGRRIGLLFISKLGNSSLGLAYGLVFTDLLFAPAMPSTSARCGGIITPLFRSIAEAY
                     DSTPEKGTQRRIGAFLVQSIFQCNAVTSAMFMTSMAGNPMVAKLASQFGIHISWTDWA
                     LATLLPGFLSLALIPYLIYRFYPPELKKTSEMRAIAVERLREMGKMTRDEWVVLGVFL
                     GLVTFWVLGSTLNIDATLTALAGLSVLLLSRALSWDDVVGEKEAWHTVVWFAVLMTLA
                     GQLNKMGLIAWLGGLAGSAVSGMHWLPMLGLLLLVYYYSHYLMASAIAHISAMYAIFV
                     SIALAAGAPPMLTVLVFGIFSNLFMSTTHYSSGPAPILFGTGYMPLGTWWKIGFSISL
                     VIIPIWLGVGSMWWKVLGFW"
     gene            43093..44721
                     /locus_tag="PC1_RS00190"
                     /old_locus_tag="PC1_0038"
     CDS             43093..44721
                     /locus_tag="PC1_RS00190"
                     /old_locus_tag="PC1_0038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772783.1"
                     /note="C4-dicarboxylate-sensing histidine kinase; part of
                     two-component regulatory system with DcuR; regulates
                     anaerobic fumarate respiration; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_012772783.1"
                     /db_xref="GI:502364666"
                     /translation="MGKKKAPLKLGTSVFLMVSVVLGAVLLVVYSLLFFRINQLSEDH
                     LREKAFAIARTFAASPVVIDELKGIGRPEEVQIAAETIRQRNQLLFVTVTDMDAVRHS
                     HPEPERIGEHFAGRDIYPALLGMENTAINRGTLDPALRVFTPVFDSNHKQVGVVALGI
                     ALTSVQKVISDNRWMIPWTLLAGALVGWLGTLILVKVLKRIMLGFEPFEISNLFEQRN
                     AMLKHIKEGVIAVDQNGRITVINDEARRLFRQNKPQGSETPSSKPAERVSEQWLEHLH
                     LKQVLESGTPRRDEEINFNGHLLLTNTVPVFVKGDIIGAIATFRDKTEISQLLQRLSG
                     MSYYADALRAQSHEFMNKLHVILGMLHLKYYSQLEDYILKTANNYQAEIGSIIRKVKS
                     PVIAGFLLGKINRARDLGITLSISEESLLPDTDDVDATNELITVLGNLIENAMDAIDG
                     QENCEISVSFHHQNGRLHCTVGDDGPGISPESQARIYEQGFSTKGSGRGIGLFLTKQS
                     LEKIGGTIEFESEPEVYTQFFVTIPYQARLFDHD"
     gene            44714..45436
                     /locus_tag="PC1_RS00195"
                     /old_locus_tag="PC1_0039"
     CDS             44714..45436
                     /locus_tag="PC1_RS00195"
                     /old_locus_tag="PC1_0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976762.1"
                     /note="response regulator in two-component regulatory
                     system with DcuS; phosphorylated DcuR activates
                     transcription of genes involved in anaerobic fumarate
                     respiration; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_010281107.1"
                     /db_xref="GI:497966951"
                     /translation="MINVLIVDDDAMVAELNKSYLNQVSGFSCYATVPTLQQARNLLM
                     QPDSEIDLVLLDIYMQQDNGLDLLPTIREFSEKTDVIIISSASDVYTIKKALHYGVVD
                     YLIKPFQFSRFEQALTAYREEANLFKHRDFVGQSDIDNLIRRTSSSTVSERKKLPKGL
                     TSLTLRTVCEWIEGNQGIEFSTEMLANAIGISRVSCRKYLIYLSDTGILTTNILYGST
                     GRPVYLYRLLPEKQDSLRQYCE"
     gene            complement(45514..45918)
                     /locus_tag="PC1_RS00200"
                     /old_locus_tag="PC1_0040"
     CDS             complement(45514..45918)
                     /locus_tag="PC1_RS00200"
                     /old_locus_tag="PC1_0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772784.1"
                     /db_xref="GI:502364670"
                     /translation="MKKALSVLLLSGLLATSATISAQEIDPHAVPLATASEFIATGKS
                     YNVDFGDQKFRLDFKSPAEMTFTSPDGKNKADVAITTTKVGDGVYMIYWSRRAGQHVV
                     HVDDFKNGVSYTNIVLPDGSISRRQGTLIEIK"
     gene            complement(45955..46509)
                     /locus_tag="PC1_RS00205"
                     /old_locus_tag="PC1_0041"
     CDS             complement(45955..46509)
                     /locus_tag="PC1_RS00205"
                     /old_locus_tag="PC1_0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="WP_012772785.1"
                     /db_xref="GI:502364673"
                     /translation="MTNVAVVYFSGYGHTRRIAEDVAEGADAVLVAIDDDGHVDEQGW
                     ETLNAADAIIFGAPTYMGSVPWQFKKFADATSKAWFTRAWQDKIFGGFTNSASLNGDK
                     QVTLIYLQTLASQHGGIWVSLGLAPSNALATTRNDVNNLGGSVGLLVQSPSDAGAEAI
                     PSGDLDTARHYGKRVADIARRFKD"
     gene            46614..47012
                     /locus_tag="PC1_RS00210"
                     /old_locus_tag="PC1_0042"
     CDS             46614..47012
                     /locus_tag="PC1_RS00210"
                     /old_locus_tag="PC1_0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="WP_012772786.1"
                     /db_xref="GI:502364683"
                     /translation="MTKNSATERKETEAGEQRYNVYLQGCPARMVLERLADKWALLIV
                     GLLRTGPLRFNQLRREIEGVSQKALSQTLKKLERDGLLSRKAFPTVPVTVEYALTPLG
                     KTLSEAVEPLARWAEKNIEDVLLAQSHYDQ"
     gene            complement(47050..48393)
                     /locus_tag="PC1_RS00215"
                     /old_locus_tag="PC1_0043"
     CDS             complement(47050..48393)
                     /locus_tag="PC1_RS00215"
                     /old_locus_tag="PC1_0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-malate permease"
                     /protein_id="WP_012772787.1"
                     /db_xref="GI:502364686"
                     /translation="MKKIETDILCENNLALETQESFIGSFFKKKVGSVPVALFMAIAA
                     IVAIAAYEGYLPKNMIGGFAVIMTMGFLLAHIGSNIPVFKDIGGPAILCLMVPSVMVY
                     FDLFNDNTMKTVHLLMKEANFLYFVIACLVVGSILGMNRKILIQGMVRMFVPLVIGTA
                     TALATGLLVGKLCGYSFYHTFFFIIVPIIGGGIGEGILPLSLAYSAILGQTPDVYVAQ
                     LAPAAVVGNIFAILCAGVLSRLGMRRKDLNGEGRLVRSDEDNAMFAVNEAPKPVDFHL
                     MGGGLLMICAFFIVGGLFEKLVHIPGPVLMILIAVFCKYGRVIPAIMETGAHSVYKFV
                     SSSLVWPLMIGLGMLYIPLESVVAVFSVGYVIVCGSVVLSMALVSFLIAPYLNMYPIE
                     ASIVTTCHSGLGGTGDVAILSASNRMSLMPFAQIATRIGGASTVIAATLLLGWFA"
     gene            49825..51432
                     /locus_tag="PC1_RS00220"
                     /old_locus_tag="PC1_0044"
     CDS             49825..51432
                     /locus_tag="PC1_RS00220"
                     /old_locus_tag="PC1_0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012821902.1"
                     /note="DppABCDF is involved in the transport of
                     dipeptides; also binds heme and mediates chemotaxis to
                     dipeptides; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012772788.1"
                     /db_xref="GI:502364689"
                     /translation="MEKSLVKSRVLKFGLGLLAMSVAAGVQAKTLVYCSEGSPEGFNP
                     QLFTSGTTFDASSIPIYNRLVEFKDGTTDTSPGLAEKWDISEDGKTYTFHLRKGVKWQ
                     DSKDFKPSREFNADDVIFSFMRQQDANHPYHKVSGGSYEYYQGMGMPELVSKIEKVDD
                     YTVRFVLNRPEAPFLANLAMDFASILSAEYADQMLKAGTPEKIDLNPIGTGPFQLQQY
                     QKDSRILYKAFEGYWGSKPGVDRLVFSITPDASVRYAKLQKDECQIMPYPNPADLAKM
                     KEDKNITLMEQPGLNVGYLAYNVEKKPLDNVKIRQALNYAVNKTAIIEAVYQGAGQAA
                     TNLIPPTMWGYNNDVKDYSYDPEKAKALLKEAGMADGFSIDLWAMPVQRPYNPNARRM
                     AEMIQSDWAKVGVKAKIVTYEWGEYLKRAKDGEHQTVLMGWTGDNGDPDNFFATLFSC
                     DAAKNGSNYSKWCYKPFEDLIQPARAVSDHEKRIELYKQAQVVMHDQAPALIVAHSTV
                     YEPVRKNVKGYVVQPRGVHSFNNVTLD"
     gene            51666..52685
                     /locus_tag="PC1_RS00225"
                     /old_locus_tag="PC1_0045"
     CDS             51666..52685
                     /locus_tag="PC1_RS00225"
                     /old_locus_tag="PC1_0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009110842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_012772789.1"
                     /db_xref="GI:502364694"
                     /translation="MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGI
                     SAERHAQLLAEMGLDKPLWQQYIHYIGGVLQGDLGISLKSRIPVWEEFVPRFKATLEL
                     GICAMLFAIAVGIPVGVLAAVKRGSIFDHTSVGLALTGYSMPIFWWGMMLIMLVSVQL
                     NLTPVSGRISDTIFLDDSMPLTGFMLIDTLFWGEKGDFIDAVEHMILPAIVLGTIPLA
                     VIVRMTRSAMLEVLGEDYIRTARAKGLSRLRVIVVHALRNAMLPVVTVIGLQVGTMLA
                     GAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLLVDVLYGVVNPR
                     IRHKK"
     gene            52699..53601
                     /locus_tag="PC1_RS00230"
                     /old_locus_tag="PC1_0046"
     CDS             52699..53601
                     /locus_tag="PC1_RS00230"
                     /old_locus_tag="PC1_0046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter"
                     /protein_id="WP_012772790.1"
                     /db_xref="GI:502364698"
                     /translation="MTQVTEPVVNSAPKPMTPLQEFWHYFKRNKGAVVGMVYVVLMLV
                     IAIGANVLAPHAPAEQFRDALLRPPVWQEGGSWQFILGTDDVGRDVLSRLMYGARLSL
                     LVGCLVVALSLVLGVIFGLLAGYFGGVVDALIMRIVDIMLALPSLLLALVLVAVFGPS
                     IVNASLALTFVALPHYVRLTRAAVLVEVNRDYVTASRVAGAGSARQMFVNILPNCLAP
                     LIVQASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAI
                     LLTVLAFNLMGDGLRDALDPKLKQ"
     gene            53615..54595
                     /gene="dppD"
                     /locus_tag="PC1_RS00235"
                     /old_locus_tag="PC1_0047"
     CDS             53615..54595
                     /gene="dppD"
                     /locus_tag="PC1_RS00235"
                     /old_locus_tag="PC1_0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004957243.1"
                     /note="DppD and DppF are the ATP-binding components of the
                     ABC dipeptide transport system DppABCDF; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_012772791.1"
                     /db_xref="GI:502364709"
                     /translation="MALLNVDKLSVHFGDEDLPFRAVDRISYQVEEGQVVGIVGESGS
                     GKSVSSLAIMGLIDYPGKVMADKLEFNQRDLKKISEKERRNLVGSEVAMIFQDPMTSL
                     NPCYTVGYQIMEAIKVHQGGNRKTRRQRAIDLLTLVGIPDPASRLDVYPHQLSGGMSQ
                     RVMIAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQRENMALILITHDLALVA
                     EAAHHIIVMYAGQVVESGKAADIFSAPRHPYTQALLRALPEFAADKSRLASLPGVVPG
                     KYDRPNGCLLNPRCPYAQDRCRQEEPALRDIPGRQVKCHTPLDDAGRPTL"
     gene            54592..55602
                     /gene="dppF"
                     /locus_tag="PC1_RS00240"
                     /old_locus_tag="PC1_0048"
     CDS             54592..55602
                     /gene="dppF"
                     /locus_tag="PC1_RS00240"
                     /old_locus_tag="PC1_0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772792.1"
                     /note="Part of the ABC transporter complex DppABCDF
                     involved in the transport of dipeptides; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_012772792.1"
                     /db_xref="GI:502364712"
                     /translation="MSELNATSQPYLLHAIDLKKHYPVKKGFFAPERMVKALDGVSFT
                     LERGKTLAVVGESGCGKSTLGRLLTMIETPSDGELYYQGQDLLKPDPEAQKLRRQKIQ
                     IVFQNPYGSLNPRKKVGQILEEPLLINTELSKAERREKALAMMAKVGLKTEHYDRYPH
                     MFSGGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQDLGLSYVFI
                     SHDLSVVEHIADEVMVMYLGRCVEKGSKDAIFNNPRHPYTQALLSATPRLNPDLRRER
                     IKLTGELPSPLNPPPGCAFNARCQRCFSTCTQFQPQLKTYGEQQVACFAVDQDEQGIA
                     VA"
     gene            complement(56142..56579)
                     /locus_tag="PC1_RS00245"
                     /old_locus_tag="PC1_0050"
     CDS             complement(56142..56579)
                     /locus_tag="PC1_RS00245"
                     /old_locus_tag="PC1_0050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772793.1"
                     /db_xref="GI:502364715"
                     /translation="MNKLIELASKYGEIKRQEIKLSECLSAITNFGYLVSDGLISFLQ
                     EYNGLQGNHSAYKNNDAPSKYFYINPEKAILELYREQVESYEQITQCPLVPIGECDNG
                     YIILMYGDGVIYGVFDECVYKYGQDIESCFDTLINGKEVAEIS"
     gene            complement(<56956..60897)
                     /locus_tag="PC1_RS00250"
                     /old_locus_tag="PC1_0051"
     CDS             complement(<56956..60897)
                     /locus_tag="PC1_RS00250"
                     /old_locus_tag="PC1_0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772794.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein Rhs"
                     /protein_id="WP_043881858.1"
                     /db_xref="GI:762768338"
                     /translation="MLSDILNRVARVGAMHAGKGPTPPAERPQPGQGKAPTSPGKTIK
                     HKSFLGALAGAIAGAVVAAVVFAAAAAVAGAIAVAVVGTGGMGAALVVGAVKLAVGFG
                     AVSLLGGLISSVSSKVSAMVDSGSPPFGPVSSGSGTVFAEKQKISRAEVDTVACTKHN
                     SPQLIAQGSETVYVNGSPAARIDDKTVCGATIKEGASTVFFGSGQQTCLKISDEFSWW
                     EKALLIAVEFLVPPSRGMFKGLGKLFTRGPTAVLKGIRMGALRTAVGLRKAVRCASKG
                     FKNNKGLARIKEATRGFLKDPVYIPSGNVIEMRQDIELGQTLPLLFERTYRSSSTHTG
                     LLGRGWYDTWSETAQVSRDGLNTHVVITLAQGYDIDFTFHQDVQSVFCPLYPAFTLYR
                     RAKGFSLWDRDSLTWREFDVPQGDRLLLSSIHDPHDNRITLIRDPKGYLRKIRHSDDI
                     ELLLVWRGESLHQIQRIDTGQKTLLAEYRQDEQGRLIEADAAHAYHLFYDYDSENRLT
                     RWHDNDQTWARYEYDYQGRCVYTTCADGYLTAHFEYLDDRVVMTDGLGQRSEFGFNAL
                     SLMSWEKSPLGRITRYDYDDHGNLLREISPAGRVVEFRYLDDSGLVSAFTDGSGHTWA
                     YDYDEAQRLCGITDPLGRIWQWAFDETGNPEKLTGPDTREVRFTWNRHGLLTQVSDQA
                     GEVQARLRYDHRQRLLSASDALGRTQQLRYDQQDRVVQWQRPDGAQYRLGYRRASWKL
                     PEQLVRPDEKEEKRQYDKHNNLLSYVDGNGALWRQSYGPFDLLTSRTDAQERTWRYEY
                     DKESQQLVAVIAPDGSRWQWWLDADARVIRERDMAGTDTHYTYDEDGHCIAIRNGEGE
                     TRHFLYDGRGLLIKETAPDDTQYYRYDAAGRLTEVTSTTSHVQLEYDLRDRVVREWLN
                     GTLLTRQFDDTARTVTRTLVWENESDNALVSAFSYSAAGELQQVQLPDGAELTLAHDA
                     AGRESSRSGGAFVQHREYDVMGWLAREMSGQQQDGRLHATQTKEYLYDGAGNLAGVRH
                     NRETRGYRLDATGRVLSVLSGGAGRTVDTDEAYRYTRNGLPQETSRLTEWQAGRLTQH
                     DDTHYQYDKAGRLIRKQVVQPGYRPQVWHYRWDSRNQLRVVDTPTGERWFYRYDPFGR
                     RTGKRCEQTQDDIRYLWDGDQIAEVRHYRNGKQIARRHWVHNGWELLVQQRQNTDGRW
                     ETDFVTSSQNGEPQALYKPDGTLRWQAPKSTLWGQRPGSTEDSADPGLAFAGQYRDSE
                     SGLCYNRFRYYDPNGGCYVSPDPIGVLGGESNYAYVPNPNTWVDPFGLAGCS"
     gene            complement(60909..61316)
                     /locus_tag="PC1_RS00255"
                     /old_locus_tag="PC1_0052"
     CDS             complement(60909..61316)
                     /locus_tag="PC1_RS00255"
                     /old_locus_tag="PC1_0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772795.1"
                     /db_xref="GI:502364721"
                     /translation="MYQMNEGTLAIPADWRDESLHVFVLPGDAINLVVNRTPIDFGLT
                     AETVYQQTLAQFAAHLKGYEERGVWTLTLDGQPAHGLEYTWRSPEGPMHQVVVMQVRG
                     ELLLTFTVTVAGELSAEQKTAMLAVVETFKAAT"
     gene            complement(61325..63178)
                     /locus_tag="PC1_RS00260"
                     /old_locus_tag="PC1_0053"
     CDS             complement(61325..63178)
                     /locus_tag="PC1_RS00260"
                     /old_locus_tag="PC1_0053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein Rhs"
                     /protein_id="WP_012772796.1"
                     /db_xref="GI:502364725"
                     /translation="MANSTGLQFTVKVGALPASTFAVVDFQLSEALNQPFALSLNLAS
                     PLPGIDFGAVLDQPCELLVWYEGELQRRVSGIVSAFAQGDTGFRRTRYQAEVRPTLWR
                     LGLRTNARIFQAQKPEAIIGALLEEAGITDYAFALRNEHAVREYCVQYRESDLAFIAR
                     LAAEEGLFFFHEFEEGKHRVVFADDAGALAKGPELFFNLATQGLSEGAYVRRFRYAEA
                     VSTAEVALKDYSFKTPAYGLLHQKISGELEHQRESYQHFDYPGRFKQDPSGKAFTGYR
                     LDALRAGAMTGSGESNAAELMPGSSFTLTEHPNLALNIGWQLVAITHSGQQPQALEEE
                     SGGEPTTYSNSFEVVKASTTWRADLPYKPMVDGPQIATVVGPAGEEIYCDQYGRVKLQ
                     FPWDRYGASDDQSSCWVRVSQGWAGGQYGLIAIPRIGHEVIVSFLEGDPDQPIVTGRT
                     FHATNPSPYPLPANKTRTTLRTTTHKGAGFNELRFEDQAGQEEVFIHAQKDMNTVVLN
                     NRSTSVNVDHNENIGRDQTVVVQQNQTVSVIADQVTEIQGEQTVVVKKNRSTVVEDNE
                     TLRVTNNIFIHAEDGSIQIGTGAGYISIKHSGDIEIVGNNLTLNGTRIDLN"
     gene            complement(63269..63787)
                     /locus_tag="PC1_RS00265"
                     /old_locus_tag="PC1_0054"
     CDS             complement(63269..63787)
                     /locus_tag="PC1_RS00265"
                     /old_locus_tag="PC1_0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005967076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772797.1"
                     /db_xref="GI:502364728"
                     /translation="MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEF
                     KHIVTVPTDPQSGQPSGQRVHKPFKFTVALNKAVPLMYNALASGEMLPTVTLKWYRTS
                     VEGKQEHFFSTVLTDSTIVDINCQMPHCQDPSKLDYTQLIEVSLAYRKIDWEHTVAGT
                     SGSDDWRAPIEA"
     gene            complement(64344..65594)
                     /gene="avtA"
                     /locus_tag="PC1_RS00270"
                     /old_locus_tag="PC1_0055"
     CDS             complement(64344..65594)
                     /gene="avtA"
                     /locus_tag="PC1_RS00270"
                     /old_locus_tag="PC1_0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010301248.1"
                     /note="transaminase C; catalyzes transamination of
                     alanine, valine, and 2-aminobutyrate with their respective
                     2-keto acids; also catalyzes terminal step in valine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valine--pyruvate aminotransferase"
                     /protein_id="WP_012772798.1"
                     /db_xref="GI:502364731"
                     /translation="MNFSLFGKKFTRHAGITQLMDDLNEGLRTPGAIMLGGGNPAHIP
                     EMDSYFQQLCQDMLEQGKLTEALCNYDGPQGKDTLLKALAELLSNELGWQIGPQNIAL
                     TNGSQSAFFYLFNLFAGRHSDGSLKKVLFPLAPEYIGYSDSGLDDNMFVSVRPQIELL
                     PEGQFKYHVDFDNLSITDDIGLVCVSRPTNPTGNVLTDDELMRLDILAQQHKVPLLID
                     NAYGVPFPGIIFTDATPLWNPNIILCMSLSKLGLPGSRCGIVIADEKVISAIGNMNGI
                     ISLSPGAVGPALAHEMIQRGDLLRLSNDVIRPFYQQRVMETIAIIRRYLSPEQCLIHK
                     PEGAIFLWLWFKDLPITTEILYQRLKKRGVLMVPGHYFFPGLDQGWPHAHQCMRMNYV
                     PEPEKIEQGIAILAEEVEKAMQEG"
     gene            65988..67196
                     /locus_tag="PC1_RS00275"
                     /old_locus_tag="PC1_0056"
     CDS             65988..67196
                     /locus_tag="PC1_RS00275"
                     /old_locus_tag="PC1_0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010681421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772799.1"
                     /db_xref="GI:502364734"
                     /translation="MKKLLAIGITLALTSWQLSAQTFVLTDAESSVEKGNWQIGSDAL
                     KIKNQHFSIEQKVLHGGRQEGSKVITITSQDGLKIALSPTRGMNLLHVTGKNIRLGWD
                     SPVDEVVNPNTINLESRNGLGWLEGFNEMMVRCGFEWTGHPVVSEGMIYTLHGRAGNT
                     PASKVVVEVSDSAPHTITVRGLLKENSFKKSNLETWTELRYVPGSESFTVHDVLTNKA
                     DYARDYQIIYHSNFGTPILEDGARFIAPVKEISPFNDHAKAGLATWQTYKGPTKDFDE
                     MVFNITPYTDGQGKTLAALVNKAGDKGVSIAFDTHQLPLLTLWKNTDTEKQGYVTGIE
                     PGTNYAYPVTIEREQGRVKKLQPGQSTTFELTYSLLSSAEAVQKTEQKVKAIQGDNKT
                     TLTEKPIAIE"
     gene            67360..68271
                     /locus_tag="PC1_RS00280"
                     /old_locus_tag="PC1_0057"
     CDS             67360..68271
                     /locus_tag="PC1_RS00280"
                     /old_locus_tag="PC1_0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-acetylserine/cysteine export protein"
                     /protein_id="WP_012772800.1"
                     /db_xref="GI:502364739"
                     /translation="MSVKDALLALCVVVLWGVNFVVIKVGLNDMPPFLLAGLRFSLVA
                     LPAIFFVPFPRIPLKWLIAYGMTISFGQFGFLFLAIKLGMPAGIASLVLQAQAFFTLL
                     VGAVLLSEKLRWNHVVGILVAAIGMVVLAEGRTALQMSSGMTTTTLLLTLAAALSWAV
                     GNIVNKVIMSKNSDVRIMSLVVWGALVPVVPFFISSWLFEGRDAIVHSLTTIQLPTIL
                     SLAYLAFAATIIGYGIWGSLLARYETWRVAPLSLLVPVVGLVSAAVFLGESLSLLQIM
                     GAVLIMAGLLVNVFGARLRSWLPVRQL"
     gene            complement(68345..69790)
                     /locus_tag="PC1_RS00285"
                     /old_locus_tag="PC1_0058"
     CDS             complement(68345..69790)
                     /locus_tag="PC1_RS00285"
                     /old_locus_tag="PC1_0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772801.1"
                     /note="catalyzes the formation of D-tagaturonate from
                     D-altronate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="altronate oxidoreductase"
                     /protein_id="WP_012772801.1"
                     /db_xref="GI:502364742"
                     /translation="MKTLNRKDFPGACYPTKVIQFGEGNFLRAFVDWQLDVLNEKTDL
                     QAGVTIVRPINTDFPPSLNTQDGLYTTVIRGLNEQGEAVSDARLIRSVNNEINPYQHF
                     ADYLALAHNAAIRFVFSNTTEAGISYHAGDSVNDTPPVSFPAKLTRLLLERFTHFNGE
                     NDKGWVIIPCELIDYNGEALKALVLRYAQEWQLSPAFLDWIETANTFCSTLVDRIVTG
                     YPREESSAQEEELGYHDAFLDTAEHFYLFVIQGPGWLADELKLAECPLNIRIVDDIRP
                     YKERKVAILNGAHTALVPVAWLCGLDTVGEAMQDADVRRFVENTLHQEIIPVLDLPAN
                     ELREFADAVTGRFQNPYIRHQLLSIALNGMTKFRTRILPQLLAGQRDARFPARLTFAL
                     AALIVFYRGERAGETYPLQDDEQWLTRYRQLWPRVGTDLTVHELVNEVLADTAHWGED
                     LTQRSGLVEQVAADLGNILTQGMRQALKAQG"
     gene            complement(69804..70826)
                     /locus_tag="PC1_RS00290"
                     /old_locus_tag="PC1_0059"
     CDS             complement(69804..70826)
                     /locus_tag="PC1_RS00290"
                     /old_locus_tag="PC1_0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactonate oxidoreductase"
                     /protein_id="WP_012772802.1"
                     /db_xref="GI:502364745"
                     /translation="MSTMNTLICQEPKKLIWKKREIPIPGEGETLIKIKSVGICGTDI
                     HAWGGNQPFFSYPRVLGHEICGEVVDTGKNVHQFKKGQQVAVIPYVACQQCPACKSGR
                     TNCCEKISVIGVHQDGGFSEYLAVPATNVLLAEGIDPQAAALIEPYAISAHAVRRAKV
                     LQGEQVLVVGAGPIGLGAAAIAKADGAHVVVADTSAARREHVIAHLNLSVVDPSAEDF
                     EAQLRAEFGGSLAEKVIDATGNQHAMNNTINLIRHGGSIVFVGLFKGDLQFSDPDFHK
                     KETTMMGSRNATPEDFSKVGRLMSEGKLTAEMMLTHRYSFSTLADIYEKDVINNRELI
                     KGVITF"
     gene            70969..71883
                     /locus_tag="PC1_RS00295"
                     /old_locus_tag="PC1_0060"
     CDS             70969..71883
                     /locus_tag="PC1_RS00295"
                     /old_locus_tag="PC1_0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_012772803.1"
                     /db_xref="GI:502365198"
                     /translation="MSRSQNLRHNVINQIIDDMARGHIPSPLPSQNALAEMYNISRTT
                     VRHILVHLCDCGVLIQVGSDYVIARKPDHDDGFTCITAPMAEQNRIFEQAFFTMINQR
                     LLRVGETFSELQLARDAGVSPVVVREYLLKFGRYNLIQNEKRGQWSMKEFDQAYAEQL
                     FELREMLETHALQHFLNLPDDDPRWLEAKTLLERHRMLRDSIGNSFRMFSQLDRSFHA
                     LLLSAAENVFFDQSLEIISVIFHFHYQWDESDLKQRNIIAIDEHMTILSALICRSDLD
                     ATLALRNHLNSAKQSMIRSINQTVRADY"
     gene            72097..73446
                     /locus_tag="PC1_RS00300"
                     /old_locus_tag="PC1_0061"
     CDS             72097..73446
                     /locus_tag="PC1_RS00300"
                     /old_locus_tag="PC1_0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011095841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012772804.1"
                     /db_xref="GI:502365200"
                     /translation="MEKNNITLDPRSSFDTRSSAPPEGIIQRSSRIKRIQTTAMILLF
                     FAAVINYLDRSSLSVANLTIRQELGLSATEIGALLSVFSLAYGIAQLPCGPLLDRKGP
                     RIMLGLGMFFWSLFQALSGMVHSFTQFVLVRIGMGIGEAPMNPCGVKVINDWFNIKER
                     GRPMGFFNAASTIGVAISPPILAAMMLVMGWRGMFITIGLFGILLAIGWYMLYRNREQ
                     IELTADEQAYLNAGSVNARRDPLSFIEWRSLFRNRTMWGMMLGFSGINYTAWLYLAWL
                     PGYLQTAYNLDLKSTGLMAAIPFLFGAAGMLVNGYVTDWLVKRGMEPIKSRKICIIAG
                     MLCSAAFTFVVPQATTSIEAVLLISMALFCIHFAGTSCWGLIHVAVASRMTASVGSIQ
                     NFASFICASFAPIVTGFIVDTTHSFRLALIICGCVTVLGALAYVFLVRQPISDPRKD"
     gene            73711..75489
                     /locus_tag="PC1_RS00305"
                     /old_locus_tag="PC1_0062"
     CDS             73711..75489
                     /locus_tag="PC1_RS00305"
                     /old_locus_tag="PC1_0062"
                     /EC_number="2.3.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase"
                     /protein_id="WP_012772805.1"
                     /db_xref="GI:502365203"
                     /translation="MKTKNTTSGKWLLSLSVAALLVSGAVQAASAPAVEAKNGMVVSS
                     QYLASQIGVDIMKMGGNAIDAAVAVGYAQAVVNPCCGNIGGGGFMTLHLADGKDTFIN
                     FRETAPAAASANMYLNADGSVKKDASLYGYLAAGVPGTVLGLDTALQKYGKLTREQVM
                     APAIKLAREGFELTRADTDILDTTVKRFKADPEAARIFLRPDGSPLQPGDKLVQTDLA
                     NTLAAIAAKGPDAFYKGEIPQAVEKAAKQGGGILTAADFADYRITETAPVTCNYRGYQ
                     FVSSPPPSSGGVTMCEILNIVEGYDMKSTGFNSAATVHVLTEAMRHAYMDRNTYLGDP
                     AFVSNPVERLLSKDYAAEIRKQIEPENATPSKNVQPGVGPHERPETTHYSIVDNQGNA
                     VSTTYTVNGRFGSVVIAPGTGFFLNNEMDDFTVKVGEKNLYGLVQGERNSIAPGKRPL
                     SSMSPSLVTKDGKVFMVLGSPGGSRIITITLQTALNIIDHGMAPQEAVDAPRIHHQWL
                     PDEVYYEQRGLSADTLNLLKQRGYKMVEQTPWGAAELILVGLPGAAGVTPADSGNDSA
                     VSGKVREGYLYGANDIRRPAGAAIGY"
     gene            complement(75526..75849)
                     /locus_tag="PC1_RS00310"
                     /old_locus_tag="PC1_0063"
     CDS             complement(75526..75849)
                     /locus_tag="PC1_RS00310"
                     /old_locus_tag="PC1_0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter substrate-binding protein"
                     /protein_id="WP_012772806.1"
                     /db_xref="GI:502365206"
                     /translation="MNKNEIYVKMLILAIPYIRNVQSHKGRTDRSCYHEAELVHNLAY
                     TILTPGFEDHDIYFLNNQARYYIENCSDEIALNYNEHKRLITELIKAVPCDLKDKLTW
                     AGPTQ"
     gene            complement(75934..76398)
                     /locus_tag="PC1_RS00315"
                     /old_locus_tag="PC1_0064"
     CDS             complement(75934..76398)
                     /locus_tag="PC1_RS00315"
                     /old_locus_tag="PC1_0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772807.1"
                     /db_xref="GI:502365209"
                     /translation="MNTVNSRITPPNPNYETCLECRAKLLIYPGEMHPDEVSAILNIE
                     PTQKNIIGDRKTNSLGRTREVKISGWFLSSEDFISSKDLRDHIDWIIAKLDPCQEGLK
                     KLQNIPGVKMTLSCVWWSAVGHCGPVLWPEQMKALADLDLECAFDIYFFPEE"
     gene            complement(<77067..81566)
                     /locus_tag="PC1_RS00320"
                     /old_locus_tag="PC1_0065"
     CDS             complement(<77067..81566)
                     /locus_tag="PC1_RS00320"
                     /old_locus_tag="PC1_0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772808.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemagglutinin"
                     /protein_id="WP_043881859.1"
                     /db_xref="GI:762768342"
                     /translation="MEKFNNRATRGLSYLLIYLTAIQPLHPAFAALTPDGPRTQVNNA
                     GAVPVINIATPNAAGVSHNTYKDFSVGTPGAVLNNSIAAGQSQLAGQLNANANLNGKA
                     AELIINEVTGSTRSDLQGKIEVFGHKANVLIANPNGITCDGCGFINTPSATLTTGKPV
                     LDQQGALEALEVKKGSITIGGKGLDGSATDYVDILSRATELNGKINAKNLTLTQGSNR
                     VDVKTGTVAPIAGEGAKPLLAVDTKALGGMYAERIRLVATEDGVGANVANLTSSQQGI
                     TLDSKGKIQLGNVHAKTDLNLTAQQVDIAAGNTVKSDRDITLASTVLNNRGNIIAGED
                     MRLFNDSLTNTQATIQANNNLWIQKDATGNKGVKVENRSGTIKTNTGDLVIRTEQLDN
                     VVEQFSVNKISTPANSTSIDGQFGIMIDGTGPDSFVTIYTGVVDDRNLRWIGSFKFTE
                     SPYANTEKNKYTFISSREGNISSGKNIYINSSELNNKYSTISALGDIISTGKNANILN
                     HSIGDSNSYVKLALKFDERDIGIDISPIPAGFNVDEYPLWGDAPVPLVRDGNKKTWFE
                     KEYVSSKIHAGGSLVLDFTDTIKIEDNAPENLTELSEKIYSTPHSYSITGKEIIFKSK
                     DIKNQSSVKSTGNLSLLSEGNIKLTGGELNSAGDLSILASNGIDANQNKFLGRNITII
                     SREGDTSLYTDSAAKHFSVDGVRQFSTLNATENLSIQSGKDILLNGIEIGKAKNISLI
                     SGNNITVKNDEAILDPQKIGSTFTDPEKQKKFDYAFNHLGNITSTDSITLNARNVLDI
                     AGISLEATKDINLTAGDNINLNPREVNTIPEALFANSRQTELSSTINAGNQLLISSGK
                     DLLAQSASLSANGNVALLAGNSLKLLATAYSAIDSQNDNNKDDRNVTAKVHAGKNLTV
                     ASNGELIATGTDFSSGGDMTLSSGGKMEFNAVANHIYREGSNEYSESVTQKNVVLNSS
                     GILTLLSNGSILFQATQLLAKGTLDAAAKGGFLYAQAVEESNHYEKTTTKRKWYGKKT
                     TIRQTSHNVTNKVTEFTAGGDINLLSRDDSTYEASKINAGKNAKLTSTQGSINFKAVK
                     DTAFEQTITTSKGFFIKSNDKGYTKDTWLLPSIYSGGQLTIDAATGITADAKTQNAQS
                     LQNALLTLGNNPGTAWLKDLNARPDVQWNAVQDAYSTWNHTTQSLNPVVGAVIAIAVA
                     AVTAGTGLAAAAGQLAAGAVGTGASATTIAVVNGAAYSGMTALTSQAAVALVDNKGNL
                     SKTFQAMSSSDSVKSLVTSMVIGGALAGFDEVMQFSQAANGTTVIDPAKAKLPMLSNG
                     DWSKVAQRVAGQSVISSSIGTAINGGSFKDNFTTALLSNIGSQINAEGAKFIGDKGEV
                     LGITGKTISHAVVAGVAAEISGGNVKGAAAGALAAELAAISLGNTFVDPALREIQITS
                     TGRIIGALAGAAITGKATGVNSGASAAESVLLYNFLMHDEPKTLAEKYAACKGSSDCE
                     SNVRKE"
     gene            complement(81606..83300)
                     /locus_tag="PC1_RS00325"
                     /old_locus_tag="PC1_0066"
     CDS             complement(81606..83300)
                     /locus_tag="PC1_RS00325"
                     /old_locus_tag="PC1_0066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide transporter"
                     /protein_id="WP_043881699.1"
                     /db_xref="GI:762766836"
                     /translation="MAFILCKTLSFISLIFLILCSSTFAATPISPTDRDALELQQKSL
                     LEQAKQQRLSLENSTTLTIPTVTASTAKDAVCFPIQRITFHDADALSIKDRTAIQQRY
                     QNRCLDLATVHNAVRETTNAYLNRGFVTSQAYLQEQDLSSGTLIISISEGKIEAIRME
                     GETPLAIKMAFPGLEGRILNLRDIEQGMEQLNRLPSRQVAIDIQPGKQAGSSIVYLKR
                     ITKAHPATLSLSADNSGQKNTGREQLSTHLTLDNPLRLADRWWLTASRDSAFSHSYGS
                     KALSGGMSLPYGYWTLGYQYAWNDFFQPIPIGSSAYRYEGQSNTHRLSLNRTLYRDGK
                     QKLALDSALSRRRTENRMAGERLEISSPTVSSASIGLSYSTTLAGGYFTLNPMLSHGL
                     RSWGATDDTKENRDLPRSEFRKFSASSSYFYPLTPSLYFLTSLYGQTTPDNLYTSERV
                     SLGGEYSVRGFKEQTLTGNRGFYWRNELNWQFTTLPFLGDIALTTAVDSGWIAGKTGK
                     VDGGNMTGTSVGLSASSRWVSQSVSLGVPLHFPDDLHPDNAVVYWQVTLPVTALFD"
     gene            complement(83546..84889)
                     /locus_tag="PC1_RS00330"
                     /old_locus_tag="PC1_0067"
     CDS             complement(83546..84889)
                     /locus_tag="PC1_RS00330"
                     /old_locus_tag="PC1_0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="WP_012772810.1"
                     /db_xref="GI:502365241"
                     /translation="MATRSTIMDTNSFRAEHADALSADIRTLTDKRSRVLGESYRLFY
                     RKPVHLVRGEGQYLWDADGKKYLDVYNNVASIGHCHPAVIEAVHQQMTMLNTHTRYLH
                     ERILDYSEQLLATAPAAINRAMYMCTGSEANDLAIRVARAWSGGTGVIVTREAYHGTS
                     DLTSGASPALGSGQPLAATTRLVPPPDAYRVNTPDLGVWFANEIQKQIDDMAAHGIKF
                     AAFLADSIFSSDGVHPNPRGFLRPVVDVVHRNGGIFIADEVQPGFARTGDAFWGFARH
                     DVVPDIITTGKPMGNGIPVSGLLAKSDVLAAFSDQIPYFNTFGGNPVAMAAAQAVLKV
                     IHDEQLQEHSRVVGAQLLAELTTLQDKYASVGNVRGAGLFIGFELVSDRDSKTPDKTL
                     ALNLTEALRDRGVLTSVAGPYGNVLKLRPPLAFQTQDIDWLVGALDDCLGALTHA"
     gene            complement(84922..86283)
                     /locus_tag="PC1_RS00335"
                     /old_locus_tag="PC1_0068"
     CDS             complement(84922..86283)
                     /locus_tag="PC1_RS00335"
                     /old_locus_tag="PC1_0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011095838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine permease"
                     /protein_id="WP_012772811.1"
                     /db_xref="GI:502365243"
                     /translation="MTSKLKPTLGTLHLWGIAVGLVISGEYFGWSYGWGVAGTLGFLV
                     TTLFIAAMYTCFIFSFTELTTAIPHAGGPFAYSRLAFGDLGGLIAGMATLIEFVFAPP
                     AISMAIGAYLNVQYPELNPKFAAVGAYLIFMSLNILGVKLAAMFELVVTLLAVMELLV
                     FMGVVAPGFSLSNFVAHGWAGQHEFSPAAISGMFAAIPFAIWFFLAIEGAAMAAEEAK
                     DPKRTIPRAYVSGILTLVVLAIGVMLMAGGVGDWRQLSDLNDPLPQAMKLIVGENSNW
                     MHMLVWIGLFGLIASFHGIILGYSRQFFALARAGYLPPGLAKLSRFHTPHRAILAGGA
                     IGIAAIFCDGINLQGMNLTAAMITMAVFGAIVMYIMSMLSLFRLRRSAPNMARSYRAP
                     GYPIVPAFALVCAIICLIAMLWFNPVIGGLFCTFMLLGYLYFLTTKARREHLLEPLVA
                     DAN"
     gene            86542..87549
                     /locus_tag="PC1_RS00340"
                     /old_locus_tag="PC1_0069"
     CDS             86542..87549
                     /locus_tag="PC1_RS00340"
                     /old_locus_tag="PC1_0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine kinase"
                     /protein_id="WP_012772812.1"
                     /db_xref="GI:502365244"
                     /translation="MSAKQYDTLSNAEITALAHRALACYPAAVQGEVRLLCRSENATF
                     LVSSAGKRYALRLHRSHYHQKAEIESELLWLDALRETGIAVPEAVRNVDGERVQSLGL
                     SDGSCRYAVLFHWIDGEMPTTSIDPRAFQQLGEITARLHQHSRQWQKPDGFQRIVWDH
                     HTMVSAQSHWGNWRDAPNLSRGEHGIVEEAIGRMAAEMAEFGKAPHRYGLIHADLRLT
                     NLLLHRGETRVIDFDDCGMGWYLHDLAAAISFVEHHPRASEWVENWLCGYERVAHVSD
                     EELALLPTLLIQRRIQLTAWVGSHAETEMAQSLGPDWAKHSVRLCRRYLETSDLPIGV
                     A"
     gene            87722..88780
                     /locus_tag="PC1_RS00345"
                     /old_locus_tag="PC1_0070"
     CDS             87722..88780
                     /locus_tag="PC1_RS00345"
                     /old_locus_tag="PC1_0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_012772813.1"
                     /db_xref="GI:502365245"
                     /translation="MENMTYSSALNAAFSRNCGVLAAAATGLGDFIHDSGGDADRIFG
                     ISGVDPEQLASPTLSLGLVNYCRVMEEAARNSGVDNFGLRYGKQFKPQSLGLIGYIGL
                     CSDTLEQALHNVVKAFPCHQHDTLTRMVDKGDCWRLDYQVRHGAILHRRQDAELTLGM
                     FLNLIRHVLGKHWAPREVHFEHPRPEMWHEHCKVFDAPVYFDQPYNSLLIPKHQLVRT
                     MPDRDMTLLLVMQDAIRRLNETSPQQSIVEQVRTQVHLLLMQKEPTLEEVAEKVGLSS
                     WSLQRRLREEGLSFSLLVDKLRCEMATHYLQQKQLPISEMALLLGYSEVSAFSRAFRR
                     WFGISPRQWRKGEALNLS"
     gene            89012..90043
                     /locus_tag="PC1_RS00350"
                     /old_locus_tag="PC1_0071"
     CDS             89012..90043
                     /locus_tag="PC1_RS00350"
                     /old_locus_tag="PC1_0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter"
                     /protein_id="WP_012772814.1"
                     /db_xref="GI:502365246"
                     /translation="MFNINEVKSSFTDDKYGFTASLLSYINDLNKIPSKKLAASIDDL
                     LFEAYEKSSVEAQRVVQNALFMIYQTNLSNPLSNPAKVQHDETLCLLRKKIEEKWLGD
                     EFKNIKPQKEPPDEENFAKFLITVWQEHRASHHELFDFLENEATSEQLYLFFKSDSAL
                     NLIFFDLVAYTLIGSQPETRGTISENLWDEIGHGDNYFTHVNLYKNVLERRDISLPDN
                     HYIDLYGVDALAGHNAFMLGAINRSHYYKLLGVMAMTEVLDPPQYTKLVKGCMRLGLL
                     DKDVHYYSEHITIDIKHGDDWLYNVINVITDAHPESKNEFYLGSLLRLQTAERYYDNL
                     MKEMKKIAK"
     gene            90232..91119
                     /locus_tag="PC1_RS00355"
                     /old_locus_tag="PC1_0072"
     CDS             90232..91119
                     /locus_tag="PC1_RS00355"
                     /old_locus_tag="PC1_0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012772815.1"
                     /db_xref="GI:502365247"
                     /translation="MAYLFLTLAAVFWGGNYVAGHILVQYINPYALSIIRWGLTTLLM
                     FSFYWKVIKKEWSILYGNIRINTVYAFLGQVCFPLTLYIGLQYTSSLNAAIYISSTPC
                     LVLIINAVFFKEKISLRNILGVAVSTVGVIYLAFSNAERGNQLSAFGIGDVLTIASAL
                     SWAFYCALLRLKDKRVTNTAFVGFSSLIGTVIMVPIYLCYTFSSGDHFFFTTTPSVYP
                     LLGVAYLVVFPSWLAYVFWNKGVSLIGTTRSEIYTHIIPLSGGLLSIALLGEKLHMYH
                     IISLLLIVVGIICCSGKKK"
     gene            complement(91166..94660)
                     /locus_tag="PC1_RS00360"
                     /old_locus_tag="PC1_0073"
     CDS             complement(91166..94660)
                     /locus_tag="PC1_RS00360"
                     /old_locus_tag="PC1_0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase"
                     /protein_id="WP_012772816.1"
                     /db_xref="GI:502365248"
                     /translation="MHNNTVNWLRFLPLLLVAAPQAYSAEIASPEQFLMEQVRLGEAS
                     NKDDLVRQSLYRLELIDPNNPEVIAARLRLALRQGDQAQARQQLDKLKAVAPDSATYR
                     QSATTLALTQDAARQQLQQARLLSTAGRYAEAKVQYDALFHGDPPTLELAVEYWRLVS
                     RLPDQQPLAIKQLEALDQVYPNNVPLRMVLARLLFSQNRNEQAYPLLKQLSNDPVGRS
                     QAASLWLEIIGRMLVTPQSVAELNRFLTVFDEGEQADTARKELSRQQGILADPVYQGR
                     LRALAQIEDGGGNSATLSELNKALAATPNDPELIGAIGLVYLRAGDRAKALTQFQKAL
                     QADVNRLNSGKWEGLIQSTQYWTTIAEGDNALKANNLSLARQKYQQARQMDNTNAYAL
                     IGLGDVAVASKNDAAAQPLYQQALHLEPGNDNALRGLVGIYQRQSPEKALAYLNSLPR
                     SQQNTMRETLAALQLNILKQQADQLSEQQQWTQAEEKYRQASQQDPNDIWLAYHYAQT
                     LRQLGQTQQADSVVQRATAVPPTSAEKNYVYSLYLSSTNRDEQALAHLNTLPTAQWSD
                     DMRELSQRLTIQTTLAKAEAMRDAGDEPAAIAFLRQQPADTRIDLLLADWALARGEYA
                     TALAEYQRIRTREPQNPDAQLGEIDAFIAQGRQDDARQRLNQLPTQAVDTLNSQRRVA
                     NAWQAVGNPQKSAALFRQLKIDAQKEPVGQTPIDQTTALIYRDAARVEQQQSQPEQAQ
                     QDYKQAMVASGIAPTLPQSDDDYTRLTRNKSSDDWLQRSIRADAADLYRKQDITVTLD
                     HDYSSSSGTGGISDLSAHNTLLQVDMPLYDGRAFLRTDTVQMNAGSFSTGSNGAYRET
                     FGTCATRDCFDGKSQKTTGTSVAAGWKNDRWSADLGTTPLGFDVVDVVGGASYSGDWR
                     QIGWTATASRRPISSSLLAFGGTKDPGTGITWGGVRATGVSLGLSYDRGEAHGVWSDF
                     SLHQITGKNVADNDRARAMAGYYYKLINEDNRRVTVGLNSMWWRYQKDLSGYSLGQGG
                     YYSPQQYFSLGVPVNYRQRTENWSWELGGSLSWSRSSTKDQRRYPLTGLLGNAALTDR
                     DTIEQGSSSSGFGYTARALVERRLSSHWTLGVGIDIQQAKDYTPSHGLIYLRYSASGW
                     QGDLDSPPQPLTPYADFK"
     gene            complement(94642..95757)
                     /locus_tag="PC1_RS00365"
                     /old_locus_tag="PC1_0074"
     CDS             complement(94642..95757)
                     /locus_tag="PC1_RS00365"
                     /old_locus_tag="PC1_0074"
                     /EC_number="3.2.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917069.1"
                     /note="catalyzes the hydrolysis of 1,4-beta-D-glucosidic
                     linkages in cellulose, lichenin and cereal beta-D-glucans;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease III"
                     /protein_id="WP_012772817.1"
                     /db_xref="GI:502365249"
                     /translation="MPRVLRYLIPTLLWLWASQATAAVCDWPAWEQYKQHYISAEGRV
                     IDTSTPNKITTSEGQSYAMFFALVANDRVMFDRLLQWTENNLSAGDLRAHLPAWLWGE
                     NKDKQWTVLDPNSASDADLWIAYSLLEAGRLWKEARYQTVGTALLARIAKEEVVNIPG
                     LGVMLLPGKVGFAEKESWRLNPSYLPPQLLARFAPLSETWKAMQRTTQRLLLETAPKG
                     FSPDWVIWQKDKGWQPDTTKPNIGSYDAIRVYLWAGMMADSSKGKTDLIKQFQPMVQQ
                     TIEQGLPPEKTDTATGTVTGQGSVGFSASLLPMLSRQSDALATQRQRLADNPPGDDAY
                     FSASLTLFGQGWDQKRYRFTSQGQLLPSRGSQCTTTP"
     gene            complement(95764..98082)
                     /locus_tag="PC1_RS00370"
                     /old_locus_tag="PC1_0075"
     CDS             complement(95764..98082)
                     /locus_tag="PC1_RS00370"
                     /old_locus_tag="PC1_0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917068.1"
                     /note="binds the cellulose synthase activator, bis-(3'-5')
                     cyclic diguanylic acid (c-di-GMP); Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic di-GMP regulator CdgR"
                     /protein_id="WP_012772818.1"
                     /db_xref="GI:502365250"
                     /translation="MTKKIIWFTALALGVSSLSQAVTAPHAQTPATGDAAQPSATATS
                     ATAMPAVPLAQPSTNAAVRNVMLPFAQIAPAPGTFALRGINPDGQIEFGVRSDEVVTQ
                     ASLDLEFTPSPALIPTESHIKVYLNNELMGVTPLGKEQMGKSNRVRIPIDPRYITDFN
                     RLQLVFVGHYQNICENPASTSLWLDVSKASTLNLQFQKLTLKDDLSPFPAPFFDSRDT
                     RPLTLPIVFAGQPDLVQQRAAAMLASWFGSKAQWRGQSFPALFNQLPESHGIVFATND
                     KRPDFLRDTPAVNGPTVSIVSHPSDPHIKLLLVQGRDDNELLTAVQGIAQGNTLFRGQ
                     SVTIDKVEQLAPRQPYDAPNWVRTDRPMTFAELQQYNEQLQTDGIVPRPISLTMNLPP
                     DLFLIRSQGIDMRLKYRYTAPQIQDGSRLSINLNNQFVQAFSLAPEHDQNSLLMRLPL
                     TQGLWDSNKSLSIPALKLGTTNQLRFDFNYTTLLSSGTADRCETYTPVVNHAVIDSNS
                     TINFSGYRHFMAMPDLRAFANAGYPFSRLADLSQTLVLVNKQPQPAQVSAMLNAIGNI
                     GAQTGYPALAVQLSDDWTQIDKQDSDILMIGAIPPALHDDSKINLLVEQTQSWIKQPT
                     RQTAVLDIDPPDADAKPDSKTTVSGDGPMSAIIGFQSPYHDQRSVVALLADSPQGYTL
                     LNNALIDSEKRASLFGSVSVIRESGINNLRVGDIYYVGHLPWWERIWHALAQHPVWLA
                     IISTLTVVIVAWLLWRGLKFFSRRRLSPDERD"
     gene            complement(98157..100856)
                     /gene="bcsA"
                     /locus_tag="PC1_RS00375"
                     /old_locus_tag="PC1_0076"
     CDS             complement(98157..100856)
                     /gene="bcsA"
                     /locus_tag="PC1_RS00375"
                     /old_locus_tag="PC1_0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917067.1"
                     /note="polymerizes uridine 5'-diphosphate glucose to
                     cellulose; acts with BcsB, BcsZ and BcsC in cellulose
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase catalytic subunit"
                     /protein_id="WP_012772819.1"
                     /db_xref="GI:502365251"
                     /translation="MSGILRLFLVPPARQAIQQRYRGYRQQGASAFAAFFATLFAILG
                     WIFLRLESEGWQQIRAQRTYWFPHILPQRPRPADILRYLTQGLWLLTIKNGQLPTSRR
                     NYFSALPRWRQRYMNAQQALFVRFSHANADDREDSESDSAKTNSLQRLVTVILSLLCA
                     ALALLCITQPFDLLSQFIFMLLLWGIAMLVRNMPGRMPTLMMIALSFTVSCRYLWWRY
                     TETLNWDDPLSLVCGMLLLAAETYAWVVLVLGYFQTIWPLNRHPVSLPEDSKTWPTVD
                     LMIPTYNEPLSVVKPTVYAALGIDWPKDKLNIYILDDGGRAEFKAFAEEVGVHYIARV
                     THEHAKAGNINNALKQAEGEFVAIFDCDHVPTRSFLQLTMGWFFKDKKLAMLQTPHHF
                     FSPDPFERNLGRFRRTPNEGTLFYGLVQDGNDMWDATFFCGSCAILRRKPLDEIGGIA
                     VETVTEDAHTSLRLHRRGYSSAYIRIPQAAGLATESLSAHIGQRIRWARGMVQIFRLD
                     NPLLGKGLKLGQRLCYANAMMHFLSGIPRLIFLTAPLAFLLLHAYIIFAPALAIALYV
                     LPHMVHASLTNSRIQGRYRHSFWSEIYETVLAWYIARPTTVALFNPHKGKFNVTAKGG
                     LVEEQHVDWVITRPYLVLVLLNIAGVVYGVWRLIYGPSEELMTVIISLIWVAYNMTIL
                     GGAVAVAVEAKQVRQAHRVEMSMSAAILRPDGHLFPCVLRDYSDGGVGIETRESGILQ
                     VGDSVSLLLKRGQQEYAFPFSVTRAFDNKIGLRMTNLTIRQHIDFIQCTFARADTWAL
                     WQDSFAQDKPVESLVDVLALGFRGYLRLADYAPPIIRSIILVFLNIVVWVVSFIPRYV
                     GKRTVTDQSGTALPEKAAHQGKTPFAHETRFAQENLFAEKTVA"
     gene            complement(100853..101590)
                     /locus_tag="PC1_RS00380"
                     /old_locus_tag="PC1_0077"
     CDS             complement(100853..101590)
                     /locus_tag="PC1_RS00380"
                     /old_locus_tag="PC1_0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010681409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein"
                     /protein_id="WP_012772820.1"
                     /db_xref="GI:502365252"
                     /translation="MPVIALQGIRGGVGTTSIAAALGWAFQRLGEPALVIDFSPDNLL
                     RINFNMPFEQRRGWARAEADDAPWQTGAMQYLPGLDFLPFGRLNAQEVATLQQHYHQH
                     PALWQNKLAQLSAAGRHRWILIDVPADNSPLTRQALATANTVFQVVVADANCHSRLHQ
                     QALPRQCHFLVNQFSTLSTLQQDLHQLWLHTLSHLLPLVVHRDEALAESLMLKQPLGE
                     CRPDSVAAEEIMTLANWCLIHVKESGV"
     gene            complement(101593..101802)
                     /locus_tag="PC1_RS00385"
                     /old_locus_tag="PC1_0078"
     CDS             complement(101593..101802)
                     /locus_tag="PC1_RS00385"
                     /old_locus_tag="PC1_0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772821.1"
                     /db_xref="GI:502365253"
                     /translation="MNNEPTRRDTSARADLTENARTEDDLRVLSQAFSLPEINYIDIA
                     RQARLSQMMARWPLLDELKEPAGSD"
     gene            102133..103737
                     /locus_tag="PC1_RS00390"
                     /old_locus_tag="PC1_0079"
     CDS             102133..103737
                     /locus_tag="PC1_RS00390"
                     /old_locus_tag="PC1_0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010301208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose biosynthesis protein BcsE"
                     /protein_id="WP_012772822.1"
                     /db_xref="GI:502365255"
                     /translation="MKQNFSLGIRDLWDELVTLQQAGFYWVNIDRQVDAALFCQQIIH
                     VQNNDARMALIGCGERSDSLLTTLFSNEINGAEKKQLSCYILPENKAALLNLTDDLMR
                     ALRPKNRLLVLYAPASLWRDISPERLQRWVDDTAAWLHQRQCTLVVIGHSTGVTRLRN
                     MLISQHRGLYGLASLQWQQDRAQYLVSWWATERGVRANQVQMLQSDNDGWHMLTEEQP
                     ILTPSLDDDGLFLIEKSVLEGAPALSENWQLMDDNAILVQTGMLTHAATLVFALNQTS
                     QVDTLVKQVHSLRRQRGELLKIVVREMKPCLRASDERLLLACGANIIVSHSEPLSRFL
                     ARIESVQGQRFTKHVPVDVEVLLTTMRPLQIKGYQPPETFRQSVQMLIDSTLMPEGSK
                     GVLVALRPVPGVRAAQALTLCTLRRFGDVVTIVQDRLFLFLSNCRLNELDIALKSIFR
                     LPVNEVFSNRIVWSQDLQILAEVKSLAQDGTPGQEQQLNDYVQLQKAESAPRGQTPRR
                     EPIAIDLLNPDLLQPDLLARAPGEPS"
     gene            103734..103952
                     /locus_tag="PC1_RS00395"
                     /old_locus_tag="PC1_0080"
     CDS             103734..103952
                     /locus_tag="PC1_RS00395"
                     /old_locus_tag="PC1_0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010681406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772823.1"
                     /db_xref="GI:502365256"
                     /translation="MNLLDIVQLVLLSAVVFFTLGYLAHRVIPHWLQYWKNRLLSPRY
                     LQPASVWMRSPSSTKTVSTKPTSAETKK"
     gene            103954..105615
                     /locus_tag="PC1_RS00400"
                     /old_locus_tag="PC1_0081"
     CDS             103954..105615
                     /locus_tag="PC1_RS00400"
                     /old_locus_tag="PC1_0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012772824.1"
                     /db_xref="GI:502365257"
                     /translation="MDEKTRLQQPHMQKQQNLWRYWRGLGAWNLYFLLKFALLWFGYL
                     NFHPLLNLVFLAFLLFPIPNVTLHRWRHIIAIPLGIGLFYHDTWLPGINSIVSQGTQV
                     AGFSASYLLELLTRFINWQMVGAAVVITVAYLFFAQWIRITVFTVAALAWLNIVNLAG
                     PAVSLMPAASTTTAPSAATSPTGGDAALPEATLPPTNANLTAYLNQFYTREKARTTAF
                     PAALPQDAQPFDLLIINICSLSWSDLDVAQLDNHPLWKKFDILFRQFNSATAYSGPAS
                     IRLLRASCGQQSHTDLYQPVNQQCYLFSNLVKLGFEEQLMLDHSGVFGNYLREVREEG
                     DIQIPMLSQEGISHQITSFDGEPIYNDLELLNRWLGERDKATTTRNATFFNLIPLHDG
                     NRFVGTNQSADYAPRAKILFDQLDAFFDVLQKSGRKVMVVVVPEHGAALAGDKMQMSG
                     LRDIPSPSITHIPVGVKLFGLQAPHQGNALEVTSPSSYLAISELVARMVDGKVFTAPS
                     VDWQTLTSALPQTEAISENENAIVMQYQGKPYIRLNGGDWVPYPQ"
     gene            106001..107152
                     /locus_tag="PC1_RS00405"
                     /old_locus_tag="PC1_0082"
     CDS             106001..107152
                     /locus_tag="PC1_RS00405"
                     /old_locus_tag="PC1_0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_043881860.1"
                     /db_xref="GI:762768346"
                     /translation="MTAVSAVALVTISLFIVIQLFHFVHQRREDYSRQLESIAYSVRQ
                     PLTDAVLQGEVQRAGNILDSLLPVAFLSRADVLLPDDFQTLHANFPKERPVPDWIARV
                     FRLPIRISIPLYSPPQTQYSAPLAHLVLQADSYRMYQFIVSTFSTMLATYLLLALIMS
                     IAITWCMNRLLIHPLRGIIIELQNLPPDAMLHRPLTLPPWHHDDELGALVRSYNRNQQ
                     LLEQSLSAGTEGVGLPDKAHFMRRLEQRLADATPFSLLVFGLDSSASKQGDMATLATQ
                     LRVVIEEQNEAGLTCLARLDCDEFALIGKTLGSAGQAQDWAQNVMLAINLPFLPADAQ
                     PARAVSVGILTITDPRPEAAALLLSQARFAMQLARHDKKCGIHCLTVPS"
     gene            107472..108764
                     /locus_tag="PC1_RS00410"
                     /old_locus_tag="PC1_0083"
     CDS             107472..108764
                     /locus_tag="PC1_RS00410"
                     /old_locus_tag="PC1_0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DGQ8.1"
                     /note="involved in the transport of C4-dicarboxylates
                     across the membrane; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate transporter"
                     /protein_id="WP_012772826.1"
                     /db_xref="GI:502365259"
                     /translation="MKTSIFKSLYFQVLAAITIGILLGHFYPQLGEQMKPLGDGFVKL
                     IKMIIAPVIFCTVVTGIAGMESMKSVGRTGAVALLYFEIVSTIALIIGLVVVNIVQPG
                     AGMNIDPSTLDASAVAVYTQQASQQGLIPFLMDVIPASVVGAFASGNILQVLLFAVMF
                     GFALHRLGAKGKVIFDVIDSFSKVIFGVINMIMKLAPLGAFGAMAFTIGKYGVGTLVQ
                     LGQLIACFYITCVLFIFLVLGSIAKATGFSIFKFIRYIREELLIVLGTSSSESVLPRM
                     LEKMEKVGCKKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLV
                     VLLLSSKGAAGVTGSGFIVLAATLSAVGHLPVAGLALILGIDRFMSEARALTNLIGNG
                     VATIVVAKYCRELDEKKLDAELSGTNKSDNAATPTAQS"
     gene            109118..110635
                     /locus_tag="PC1_RS00415"
                     /old_locus_tag="PC1_0084"
     CDS             109118..110635
                     /locus_tag="PC1_RS00415"
                     /old_locus_tag="PC1_0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772827.1"
                     /db_xref="GI:502365260"
                     /translation="MQGTKKALFVGGLLLAVVSSSVQAEALQPDPAWQQGKLDNGFTW
                     QLLTTPQRPGDRVELRLVVNAGSLLENAQQVGFAHFLPRLALAPGDKLSAAQRPSTWM
                     SDANGSRVLPPAIISYDFTSYNLSLPNNRPELLKEALTWLAESAGQMTFDEKSLQAAL
                     KVPDQVATFPVNPQDPSWRYRLKGSPLLAHDPAQDVKPPLNGEQLQQFYKTWYTPDAM
                     TLYIVGHVDNRSVIEQIGKVFSPLEGKREAPAPLPTLSPLPTQAISLMNNNVQKDTLS
                     LMWDAPWHPIRESQALVRYWLGDMTREAMFWHLQQVLEKSPQKGNNLRFDCNVFYTRS
                     QCAIHMDVPNSEGVEPGVTFMARELATLREKGLTQQEFDALIARKTDELNKLFATYAR
                     TSTDILMDQRLRSQQNGVVDIAPEQYQKLRQSYLSALTLDMLNQELHQQLVQDTTLML
                     IQQPGEPEANMKALQEAYDRIMTPATEPAASAATAAPEGAVPEGKKPQETAPAAQ"
     gene            complement(111251..112183)
                     /locus_tag="PC1_RS00420"
                     /old_locus_tag="PC1_0086"
     CDS             complement(111251..112183)
                     /locus_tag="PC1_RS00420"
                     /old_locus_tag="PC1_0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917059.1"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-D-gluconate-6-phosphate from
                     2-dehydro-3-deoxy-D-gluconate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketodeoxygluconokinase"
                     /protein_id="WP_012772829.1"
                     /db_xref="GI:502365262"
                     /translation="MTTTNIAVIGECMIELSQKGTDLNRGFGGDTLNTAVYIARQVNA
                     DKLGVHYVTALGTDSFSTEMVAAWQKEGVKTDLIQRLDNKLPGLYFIETDASGERTFY
                     YWRNDAAARYWLDSPEAEKIGQSLAHFDYLYLSGISLAILNAESRQRLLALLRACRAN
                     GGKVTFDNNYRPRLWQSKEETQQAYTDILSCTDIAFLTLDDEDMLWGTKPLEAVLERT
                     HGLGVSEVVIKRGADSCIVSERGQALVDVPAIKLPKEKVVDTTAAGDSFSAGYLSVRL
                     NGGSTQEAAQRGHLTASTVIQYRGAIIPLEAMPA"
     gene            complement(112331..113347)
                     /locus_tag="PC1_RS00425"
                     /old_locus_tag="PC1_0087"
     CDS             complement(112331..113347)
                     /locus_tag="PC1_RS00425"
                     /old_locus_tag="PC1_0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010681400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012772830.1"
                     /db_xref="GI:502365263"
                     /translation="MPVPADPDRQSTSSTPEGDTSPQKPLSFLDKSKRLAARIQAIPS
                     VAHLIRAGERFNDRMGNQFGAAITYFSFLSLIPILMVSFAAVGFVLASNPDLLTGLIN
                     RIVNSISDPNLANTLKNTVNTAVQQRTTVGITGLLIALYSGISWMGNLREAIRAQSRD
                     VWERSPKDEEKIYFQYTRDFLSLTGLVIALIITLFLTSVAGTAQNMIVTALGLDGIEW
                     LRPALTLIALSISIFANYLLFLWIFFVLPRHKPKRKALFRGTLIAAVGFEVIKFAMTV
                     ALPKLASSPSGAAFGSVIGLMAFFYFFARLTLFCAAWIATANYKGDTSTDRNEQEKEP
                     PSDR"
     gene            113478..114677
                     /locus_tag="PC1_RS00430"
                     /old_locus_tag="PC1_0088"
     CDS             113478..114677
                     /locus_tag="PC1_RS00430"
                     /old_locus_tag="PC1_0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011095821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012772831.1"
                     /db_xref="GI:502365264"
                     /translation="MPTPSPSEPALSGLRLNLRIVSIVAFNFASYLNIGLPLAVLPGY
                     VHDHLGYSAFWAGLVISLQYFSTLLTRPHAGRSADEKGPKKIVVWGLAGVMLSGVFYL
                     LAAFSDASPAITLLLLCLGRVVLGAGQSFAGTGATLWGVGVVGSRHIGRVISWNGIAT
                     YGAMAIGAPLGVWLNHIGGLKLLSVCIILIAAVAIVLALPRPTVQVAPGKKIPFREVL
                     GKVWVYGIILAIASAGFGVIATFITLFYADRNWEGAALTLTIFSCAFVGARLVFPNSI
                     QRFGGLRVAMACFVVEIVGLLLVWGAALPLMAEVGAFLAGAGFSLVFPALGVVAVQAV
                     SPQNQGSALATYTIFLDLSLGIVGPVAGVLMAYTGIASIYLAAALLGLCGLALTWRLT
                     QRTAVKE"
     gene            complement(114723..115289)
                     /locus_tag="PC1_RS00435"
                     /old_locus_tag="PC1_0089"
     CDS             complement(114723..115289)
                     /locus_tag="PC1_RS00435"
                     /old_locus_tag="PC1_0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772832.1"
                     /db_xref="GI:502365265"
                     /translation="MSNVIKYLGVGLLVGLLAACDGKTDDAAKAGAQDKPAAEASAGQ
                     NIELMEGKIAFTLPADMRDQSGKVGTQANNMHVYANDNGQKAVIVILGDNTTEELTVL
                     AQRLEDQQRTRDANLQVVTNKTIDVDGKKLQQLDSIITSSGQQAYSSVVLGKVENQLL
                     TLQITLPASNQQQAQSEAEGIIHTLKLK"
     gene            complement(115476..116153)
                     /locus_tag="PC1_RS00440"
                     /old_locus_tag="PC1_0091"
     CDS             complement(115476..116153)
                     /locus_tag="PC1_RS00440"
                     /old_locus_tag="PC1_0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012772834.1"
                     /db_xref="GI:502365267"
                     /translation="MYRFTPQQRLTALIWLSLFHVLIITSSNYLVQLPVLIFGFHTTW
                     GAFTFPFIFLATDLTVRIFGAPMARRIILTVMVPALVISYLVSSLFYQGSWQSFEALS
                     QVNIVVARIACASFMAYVLGQILDVHVFNRLRQNRAWWVAPAVSTVFGNFSDTLAFFF
                     IAFYHSTDAFMAANWVEIAMVDYAFKLLISLAFFLPMYGVMLNMVLKRLSEQKGSADY
                     HSVSSHH"
     gene            116370..116612
                     /locus_tag="PC1_RS00445"
                     /old_locus_tag="PC1_0092"
     CDS             116370..116612
                     /locus_tag="PC1_RS00445"
                     /old_locus_tag="PC1_0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976412.1"
                     /note="TusA; transfers sulfur to TusBCD complex; involved
                     in thiouridation of U34 position of some tRNAs; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase TusA"
                     /protein_id="WP_012772835.1"
                     /db_xref="GI:502365268"
                     /translation="MTDPFTNPDKTLDAQGLRCPEPVMMVRKTVRQMETGQTLLIIAD
                     DPATTRDIPGFCVFMEHELLAQETEQLPYRYLLRKG"
     gene            complement(116672..119035)
                     /gene="zntA"
                     /locus_tag="PC1_RS00450"
                     /old_locus_tag="PC1_0093"
     CDS             complement(116672..119035)
                     /gene="zntA"
                     /locus_tag="PC1_RS00450"
                     /old_locus_tag="PC1_0093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772836.1"
                     /note="P-type ATPase involved in the export of lead,
                     cadmium, zinc and mercury; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc/cadmium/mercury/lead-transporting ATPase"
                     /protein_id="WP_012772836.1"
                     /db_xref="GI:502365269"
                     /translation="MHSHQHHSAEKSACCNNGVHHAPRSTAHSTKSCCNEHAQHSNHA
                     DHSCCSTKHTSDAAVQSACGTEQHSSDSGGSADSDDPDGGDSDRPRSNQRFSWKISGM
                     DCPSCARKIENAVKNLTGIEQAKVLFATEKLVVDAYIDIRPQVQHAVQQAGFTLQDTA
                     LPVVPPNTSTVRRFVHEYGFLLLFTLLAAASWGLSLLSERGGQIAFIATTIVGLIPIL
                     KKAIQLIRTGTPFAIETLMSVASIGALLIGATTEATVILLLFMLGEYLESYAANRARR
                     GVTALMALLPEDATAIVNGQRRLVPVASLVPGDVIEVAPGGRLPADAELLNSDASFDE
                     SALTGESVPVERTPGEKIAAGSLCVDRVVQLRVVSQPGNSAIDRILQLIEEAEERRAP
                     IERFLDKFSRYYTPAIMLLSLLVILVPPLLLAQPWQEWIYRGLTLLLIGCPCALVIST
                     PAAITSGLAAATRRGALIKGGAALESLGSIKTIAFDKTGTLTEGKPQVTDVLPAAGIS
                     ETALLTRTAAVESGSHHPLAKAIVQHALSSSTFLPLAENRKALAGVGVEGTIGGKRIQ
                     VSAPTRVASDLLDADWLQQIDALENEGKTVVVVQEDDRLLGLLALSDTLRHDAREALD
                     ALQQLGIRGVMLTGDNPRAAAAIAARLGIDYRASLLPADKVTAVSDLSKQHPVAMVGD
                     GINDAPAMKAATIGIAMGSGTDVALETADAALTHSRLTGLAAMISLSRATQRNIRQNI
                     TIALGLKAVFLVTSILGITGLWLAVLADSGATALVTANALRLLRKQD"
     gene            complement(119130..119759)
                     /locus_tag="PC1_RS00455"
                     /old_locus_tag="PC1_0094"
     CDS             complement(119130..119759)
                     /locus_tag="PC1_RS00455"
                     /old_locus_tag="PC1_0094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012772837.1"
                     /db_xref="GI:502365270"
                     /translation="MLWSFIAVLFSGWLYVDASYRGPTWQRWLFKPVTMLLLLALAWQ
                     TPLLGVPGYLIVLGLLATLVADTLLLLPTQRLLYAFGAYFLSHLLYTVSFFTGQIALT
                     FFWPLALTLVILAAILIAIIWGRLDTQRWPACAFIIMTTLMVWIAGERYFALGTNANF
                     SLLTGTVLLFIAHAAWLIHHYRFPFRAHQAIVAAGYFGGHFLIVRSLYF"
     gene            119951..120271
                     /locus_tag="PC1_RS00460"
                     /old_locus_tag="PC1_0095"
     CDS             119951..120271
                     /locus_tag="PC1_RS00460"
                     /old_locus_tag="PC1_0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772838.1"
                     /db_xref="GI:502365271"
                     /translation="MSSESALYRIQFINNGKNYQLYVRELVQSSLFGFIEIADFVFDS
                     QSAVLVDPSTEKLKTEFSGVSRSFIPLQAIIRIDAVTEKGSARISDLGDNVTAFPYLP
                     GKKP"
     gene            120271..120630
                     /locus_tag="PC1_RS00465"
                     /old_locus_tag="PC1_0096"
     CDS             120271..120630
                     /locus_tag="PC1_RS00465"
                     /old_locus_tag="PC1_0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772839.1"
                     /db_xref="GI:502365272"
                     /translation="MNDFPWLLALAVGAILVLAARQYRRQRQRDAQNDAAPLRIVAAE
                     VKHKREFPLTRRRARAHQMMAVEDMRYEVTFRPITGGATITLRLENADYHQLDTGMQG
                     SLQLKGTRFIRFVPQQR"
     gene            complement(120634..120912)
                     /locus_tag="PC1_RS00470"
                     /old_locus_tag="PC1_0097"
     CDS             complement(120634..120912)
                     /locus_tag="PC1_RS00470"
                     /old_locus_tag="PC1_0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010306572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012772840.1"
                     /db_xref="GI:502365273"
                     /translation="MILINLGRLLMLGVWGFLLLNLIQPFPKPLNIFMTVAMVFMILM
                     HGFQLLLLKSSQPKDSPALNRALQARIFLFGVFELLAWQKKQPKPPKP"
     gene            complement(120939..121514)
                     /gene="rsmD"
                     /locus_tag="PC1_RS00475"
                     /old_locus_tag="PC1_0098"
     CDS             complement(120939..121514)
                     /gene="rsmD"
                     /locus_tag="PC1_RS00475"
                     /old_locus_tag="PC1_0098"
                     /EC_number="2.1.1.52"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772841.1"
                     /note="catalyzes the methylation of 16S rRNA at position
                     G966; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_012772841.1"
                     /db_xref="GI:502365274"
                     /translation="MAKKNASSAAGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETL
                     FNWLAPIIQQARCLDCFAGSGALGLEALSRYAAHATLLEMERAVAQQLTQNLALLRAE
                     NAEVVNTDALSWLAQPGTPFDVVFLDPPFRKELLNNTLVLLEQQGWLAPDAWIYVETE
                     AENAQLTIPENWQLHREKIAGQVAYRLYIRQ"
     gene            121864..123351
                     /locus_tag="PC1_RS00480"
                     /old_locus_tag="PC1_0099"
     CDS             121864..123351
                     /locus_tag="PC1_RS00480"
                     /old_locus_tag="PC1_0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsY"
                     /protein_id="WP_012772842.1"
                     /db_xref="GI:502365275"
                     /translation="MSKEKKRGFFSWLGLGKQEEKQQEQPQEKPVVQEKIVVEEQSPA
                     AESDAAASAHQTVEHAPEQVEKPLPEEPVVEAEELTQSVAERDVTAAADESAVVAPEA
                     NVSESIASEPAVSTPAISETDDRDLIDRDVIDRDAADPIVQTEIAESATVVEAEPDVA
                     QQEEHEYEEQELAQPDDVPVVAQEQERPTKEGFFARLKRSLVKTRQNLGSGFIGLFRG
                     KKIDDDLFDELEEQLLVADVGVETTRKIITSLTEHASRRQLKDADTLFVKLKDEMAEI
                     LAKVDAPLNIEGKTPYVILMVGVNGVGKTTTIGKMARQFQAQGKSVMLAAGDTFRAAA
                     VEQLQVWGQRNNVAVVAQHTGADSASVIFDAIQAAKARGVDVLIADTAGRLQNKAHLM
                     EELKKIVRVMKKLDEDAPHEVMLTLDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTA
                     KGGVIFAIADQFAIPIRYIGVGEGIEDLRPFKADDFIEALFARED"
     gene            123357..124028
                     /locus_tag="PC1_RS00485"
                     /old_locus_tag="PC1_0100"
     CDS             123357..124028
                     /locus_tag="PC1_RS00485"
                     /old_locus_tag="PC1_0100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772843.1"
                     /note="ATP-binding protein of an ATP-binding cassette
                     transporter; when bound to FtsX, FtsEX localizes to the
                     cell division site and plays a role in the assembly or
                     stability of the septal ring under low-salt growth
                     conditions; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsE"
                     /protein_id="WP_012772843.1"
                     /db_xref="GI:502365276"
                     /translation="MIRFEQVSKAYLGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTL
                     LKLICGIERPSAGQILFGGHNISRLKKREVPFLRRQIGMIFQDHHLLMERTVYDNVAM
                     PLIIAGASSEDIRRRVSAALDKVGLLDKAKNYPIQLSGGEQQRVGIARAVVNKPAVLL
                     ADEPTGNLDEALSEGILRLFEEFNRVGVTVLMATHDTGLIARRNYRVLTLSDGRMVGG
                     NHDGE"
     gene            124018..124986
                     /gene="ftsX"
                     /locus_tag="PC1_RS00490"
                     /old_locus_tag="PC1_0101"
     CDS             124018..124986
                     /gene="ftsX"
                     /locus_tag="PC1_RS00490"
                     /old_locus_tag="PC1_0101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012821944.1"
                     /note="ABC transporter, membrane protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsX"
                     /protein_id="WP_012772844.1"
                     /db_xref="GI:502365277"
                     /translation="MANNVRNAKKPVAKSKALRGGWQEQWRYAWTNTLADMLRQPLAT
                     FLTVMVIAISLALPSICYLVWKNVSQAATQWYPSPQLTVYLDKSLDDNAAQAVVTQLQ
                     SEDGVDKVNYLSRNEAMGEFRNWSGFGGALDMLEENPLPAVAIITPKMSFQDSTTLTT
                     LRDRVAATQGVDEVRMDDSWFARLVALTNLVGQISATIGILMIVAVFLVIGNSVRLSI
                     FSRRETINVMKLIGATDGFILRPFLNGGAAMGVGGAVLSLILSQALVWKLDAVVAQVA
                     SVFGTTFAVKGLSWDESLLLLLIAGMIGWLAAWLATVQHLRRFTPQ"
     gene            125319..126176
                     /locus_tag="PC1_RS00495"
                     /old_locus_tag="PC1_0102"
     CDS             125319..126176
                     /locus_tag="PC1_RS00495"
                     /old_locus_tag="PC1_0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011409952.1"
                     /note="binds with the catalytic core of RNA polymerase to
                     produce the holoenzyme; this sigma factor is responsible
                     for the expression of heat shock promoters; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-32"
                     /protein_id="WP_012772845.1"
                     /db_xref="GI:502365278"
                     /translation="MTKDMQTFTLVPQGSLEGYIRAANAYPMLTAEEERALAERLHYQ
                     GDLDAAKHLILSHLRFVIHVARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLV
                     SFAVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKTRLGWFNQDEVELVARE
                     LGVTSKDVREMESRMAAQDMTFDPTPEEDSHDGKAMSPMLYLQDKSSDFADGIEEDNW
                     DTHAADKLTYALEGLDERSQHIIRARWLDDDNKSTLQELADQYGVSAERVRQLEKNAM
                     KKLRAAIEA"
     gene            complement(126260..126706)
                     /locus_tag="PC1_RS00500"
                     /old_locus_tag="PC1_0103"
     CDS             complement(126260..126706)
                     /locus_tag="PC1_RS00500"
                     /old_locus_tag="PC1_0103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_012772846.1"
                     /db_xref="GI:502365279"
                     /translation="MKLTVECLTQFSPQDKIDLAKIWPHQNIDLLEAGLKPTRRLFAA
                     RFNDRLLGGMLVEIAGDYAELSDMMVREVTRRRGVGQLLVDEARRQLPEVNEWWLATA
                     NHAAIKEEVLARFMVSCGFSPVSGGWRYIRRKETPLILDDINSEKP"
     gene            127111..128223
                     /locus_tag="PC1_RS00505"
                     /old_locus_tag="PC1_0104"
     CDS             127111..128223
                     /locus_tag="PC1_RS00505"
                     /old_locus_tag="PC1_0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010306545.1"
                     /note="with LivFGHM is involved in the high affinity
                     leucine transport; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012772847.1"
                     /db_xref="GI:502365280"
                     /translation="MKFSKGKVLLMGCMAAAFSHAVSAADIKVAVVGAMSGPVAQYGD
                     MEFIGARQAIADINAKGGVNGNKLVGVEYDDACDPKQAVAVANKVINDGIRYVIGHLC
                     SSSTQPASDIYEEEGVIMITPAATNADLTTRGYKMVLRTTGLDSDQGPTAAKYIVETI
                     KPQRIAVVHDKQQYGEGLARSVQDSLKKAGANVVLFEGVTAGDKDFSTLVARLKKENV
                     DFVYFGGYYPEMGQILRQSRQAGMTTKFMGPEGVGNSSLSNIAGDASEGMLVTLPKRY
                     DQVPANQPIVDALKAKKLDPTGPFVWTTYAALQSLTTAMTRTGSDEPEKLVADLKAKS
                     VDTVMGPLSWDAKGDLKGFEFGVFEWHKDGTSSAVK"
     gene            128379..129305
                     /locus_tag="PC1_RS00510"
                     /old_locus_tag="PC1_0105"
     CDS             128379..129305
                     /locus_tag="PC1_RS00510"
                     /old_locus_tag="PC1_0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003852206.1"
                     /note="LivHMGF is the membrane component of the LIV-I/LS
                     branched-chain amino acid transporter; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transporter permease
                     subunit LivH"
                     /protein_id="WP_012772848.1"
                     /db_xref="GI:502365283"
                     /translation="MSEQFLYFFQQMFNGLTLGSTYALIAIGYTMVYGIIGMINFAHG
                     EVYMIGSYVSFIVIAALMMMGIDAGWLLIGAAFIAAVVISSAYGWSIERVAYRPVRTS
                     KRLIALISAIGMSIFLQNYVSLNQGSRDVALPSLVTGQWVLGESNGFAATISSMQLII
                     WIVTFLAMLALTLFIRYSRMGRACRACAEDLKMASLLGISTDRVISLTFVIGALMAAV
                     AGVLLGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLILGVAEALTSAYLS
                     TEYKDAVSFALLIVVLLVMPTGILGRPEVEKV"
     gene            129302..130576
                     /gene="livM"
                     /locus_tag="PC1_RS00515"
                     /old_locus_tag="PC1_0106"
     CDS             129302..130576
                     /gene="livM"
                     /locus_tag="PC1_RS00515"
                     /old_locus_tag="PC1_0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976438.1"
                     /note="Part of the ABC transporter complex LivFGHMJ and
                     LivFGHMK involved in the high-affinity transport of
                     branched-chain amino acids; LivFGHMK is specific for the
                     transport of leucine, while LivFGHMJ is a transporter for
                     leucine, isoleucine, and valine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine transporter permease
                     subunit"
                     /protein_id="WP_012772849.1"
                     /db_xref="GI:502365286"
                     /translation="MKQLNLFNALVSAFMLLVLASFLMGMQLALDGTKLVVRGADEVR
                     WYWIGAGCVVVFFFQLIRPFFQQSIKKFSAPPLVLPSFDGSTPRQKVLAAALIIAAIA
                     WPFLVSRGTVDIATLTLIYVMLGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLNHYY
                     GLGFWESLPLAGMAAALSGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGG
                     PNGISQIPKPTFFGLEFSRSARDGGWDTFHNFFGLQYDPSDRIIFLYLVALLLVVLTL
                     FVINRLLRMPLGRAWEALRDDEIACRSLGLSPTRIKLTAFTISAAFAGFAGTLFAARQ
                     GFVSPESFTFAESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDLNEYSMLLLGA
                     LMVLMMIWRPQGLLPMKRPEMKLKVAKKEEQA"
     gene            130573..131343
                     /gene="livG"
                     /locus_tag="PC1_RS00520"
                     /old_locus_tag="PC1_0107"
     CDS             130573..131343
                     /gene="livG"
                     /locus_tag="PC1_RS00520"
                     /old_locus_tag="PC1_0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772850.1"
                     /note="Part of the ABC transporter complexes LivFGHMJ and
                     LivFGHMK involved in the high-affinity transport of
                     branched-chain amino acids; LivFGHMK is specific for the
                     transport of leucine, while LivFGHMJ is a transporter for
                     leucine, isoleucine, and valine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_012772850.1"
                     /db_xref="GI:502365288"
                     /translation="MSAQPLLSVRGLMMRFGGLLAVNNVEMDIHAGEIVSLIGPNGAG
                     KTTVFNCLTGFYRPSGGTIMLRDRHLEGLPGQAIARMGVVRTFQHVRLFREMTVIENL
                     LVAQHQHLKSGVFAGLLKTPGFRRAEADAQERAAVWLERIGLLDLANRQAGNLAYGQQ
                     RRLEIARCMVTRPELLMLDEPAAGLNPKETDELNQLIAELRDSHQVSVLLIEHDMKLV
                     MGISDRIYVVNQGTPLAQGTPAEIRNNPDVIRAYLGEG"
     gene            131349..132050
                     /gene="livF"
                     /locus_tag="PC1_RS00525"
                     /old_locus_tag="PC1_0108"
     CDS             131349..132050
                     /gene="livF"
                     /locus_tag="PC1_RS00525"
                     /old_locus_tag="PC1_0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004171217.1"
                     /note="with LivGHMJ and LivGHMK is part of the
                     high-affinity branched-chain amino acid transport system;
                     LivFGHMK is specific for the transport of leucine, while
                     LivFGHMJ is a transporter for leucine, isoleucine, and
                     valine; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_012772851.1"
                     /db_xref="GI:502365291"
                     /translation="MLSLHQVSAHYGKIQALHQVSLHINQGEIVTLIGANGAGKTTLL
                     GTLCGDPRATEGTITFDGKDITNWQTAQIMREAIAIVPEGRRVFSRMTVEENLAMGGF
                     FADREQYQERIARVYDLFPRLYERRAQRSGTMSGGEQQMLAIGRALMSQPRLLLLDEP
                     SLGLAPIIILQIFDTIQQLREEGMTIFLVEQNANQALKLADRGYVLENGHVVLEDTGA
                     ALLANEAVRSAYLGG"
     gene            132080..133270
                     /locus_tag="PC1_RS00530"
                     /old_locus_tag="PC1_0109"
     CDS             132080..133270
                     /locus_tag="PC1_RS00530"
                     /old_locus_tag="PC1_0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_012772852.1"
                     /db_xref="GI:502365294"
                     /translation="MAIEGLLAHRIAQLKSSAIRELLKHSKMENIISLAGGIPSDALF
                     DFEGLSQATHLAITEQPKTAFQYGLTEGSGVLRDRIAELCAVRGVKTRGDDIVVTAGS
                     QQALDLIMRSMVDPGDVFVVERPTYLAALQTLELAQAQVMSVSSDANGMVVDELEELL
                     KKQRIKGVYIVPNFGNPSGVTLSYERRLQLIQLAERYGFVIIEDDPYGELRFTEERNP
                     TLFQLAQEKLGSTEYVLYTSTFSKVLAPGLRLGWAILPDWLLHKVAIIKQAADLHASA
                     LSQTVAECYLGLGRLDSQIEKIRHAYKHKGELLAQLVEKELGDVITFNQPKGGMFLWA
                     KFRQNDFNTTEWLKKTLDQGVVFVPGEFFFPDNVDYSTLRLSFATATDEQMHEAVARL
                     RRAL"
     gene            complement(133360..135006)
                     /locus_tag="PC1_RS00535"
                     /old_locus_tag="PC1_0110"
     CDS             complement(133360..135006)
                     /locus_tag="PC1_RS00535"
                     /old_locus_tag="PC1_0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011095799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_012772853.1"
                     /db_xref="GI:502365296"
                     /translation="MKNMSLGKMLGTGFTLIIVIGFLVAILGRVQLEKLGGNIQLLSQ
                     MRITNLLLMQEVKDNVNIAARSIRNIALLSDQQQMKVEKDRIEQTIARNSELLAKIRK
                     NLVDDDAKTLLSTLDQVRPAYTSSMKKATELAMSNEHDAFRNFLLTEVRTTQASVFDI
                     LDKMVEMQKQLTVELANDSENNALHAGTLMLIIALCSALLGGVVAWWITRKIKRQLGG
                     EPAYTLEVTRQVAQGNLAIAIDRRDGDTTSVLAAMEEMRQSLSNIVGQVHQSSESIAT
                     GASQIAIGNTDLSQRTEEQAANLQETAASMEEMNTTVKQNADTVRSAAQLANAASAAA
                     RKGGDVVNNVVRTMEEITASSRKIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRG
                     FAVVAGEVRSLAQRSASAAREIKDLISISVGKVEAGELLVNEAGVTIEEVVEQSQRVA
                     NLINEIGLTTHEQEQGVSQVNDAVNQLDQVTQQNAALVEESASAADSLNQQARHLVEL
                     MSVFKIDGIQPQRAAPQAATLPRPKLALAANSSHTNWETF"
     gene            complement(135598..137268)
                     /locus_tag="PC1_RS00540"
                     /old_locus_tag="PC1_0111"
     CDS             complement(135598..137268)
                     /locus_tag="PC1_RS00540"
                     /old_locus_tag="PC1_0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_012772854.1"
                     /db_xref="GI:502365301"
                     /translation="MNLIKNSSLGKMLGTGFTLVIAIGFLVAVFGRIQLDKLGENIQL
                     LSQVRITNLIMMQEFKDNINTNAIAIRNLTMQEDSRQMQQEKVRIEEMVSRNNALLTK
                     IHDSATEKHAQELVAELERVRPAYSSSYTNAITLAMTNKNSEAQHLLLTDVRAKQEAV
                     FKALNDMVNWQEKLTVDIADQSLKNATHAGTLMVIIALLSVVLGAMISWWITRTIKRQ
                     LGGEPAYTLEVTRQVAQGNLAVAIELRDGDTTSVLAAMEDMRQNLSNLVGQVHQSSES
                     IATGATQIAMGNTDLSQRTEEQAANLQETAASMEQMNTTVKQNAATVRTATELAHSAS
                     TTAQKGGDAVNNVVRTMEDITASSRKIGDIIGVIDSIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRSLAQRSASAAREIKDLINASVANVEMGEKMVNDAGITIKDIVEKSQ
                     HVANLLSEIGLTTHEQEQGVAQVNDAVNQLDQVTQQNAALVEESASAADSLSQQARTL
                     LELMGVFKISGVQAQAPRLSAQVKQPTAPRLALASQSGSTSSDNWETF"
     gene            complement(138182..139852)
                     /locus_tag="PC1_RS00545"
                     /old_locus_tag="PC1_0112"
     CDS             complement(138182..139852)
                     /locus_tag="PC1_RS00545"
                     /old_locus_tag="PC1_0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_012772855.1"
                     /db_xref="GI:502365304"
                     /translation="MQHTKKMKLGTQVGSGFAIVIIIGLLVAIFGRMHLVGLGNTTDR
                     LAKHHLANLIVLQELKDNLNVTIKATLRMLIATEQKVLEDNQKLIETTSAKNTQLVTQ
                     LETNLRATEVRNILGELQQNRTEFARVGRQAVALSLSNRQAESIELVKTQLEPIQTKL
                     FNNLNTMIQLQRDYTTQTATNAIEESYYDGNSLLILAVIASLFGAGIAWLITRHIKKQ
                     LGGEPAYATQVTQEIAQGNLAIPVDLASGDNTSLLFAMNNMRKSLSSIVEQVRESSES
                     IATGARQIAAGSADLSQRTEEQAANLQQTAASTEEMSQTVRQNTDTVRNAAQLAQAAS
                     NTAAKGGEAVGNIVVTMKEITDSSHKINDIISVIDGIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRSLAQRSATAAKEIKELIGHSVEKVETGSALVSDAGTTIEELVRQAR
                     HVADLINEIGITTQEQESGVSQIHEAVNQLDQVTQQNAALVEQSASAADSLSEQAAHL
                     VELMKVFIVEGGAPQRLAPQLKRPDSAKLSLANPKSTTGSDKQNWETF"
     gene            complement(140132..141811)
                     /locus_tag="PC1_RS00550"
                     /old_locus_tag="PC1_0113"
     CDS             complement(140132..141811)
                     /locus_tag="PC1_RS00550"
                     /old_locus_tag="PC1_0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010681383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_012772856.1"
                     /db_xref="GI:502365307"
                     /translation="MNFLAKMKLGTMLGAGFASVIIIGLMVAVLGRAHLVDLGEDIES
                     LSEKNLTSLILIQDAKNGFDAVARSVRNIGLTDDRSRIQEEKRLIDQQIARNTEILTK
                     LYEHMSEPETRDTLESLTQARPAYRDTVNKAVELGLSENAEERARAVQIMVNEMQVTQ
                     APVFAALDSMREFQKTRTLDMTTSAMQEARSDGNMLIVFAAIAVLVGILVSVLITRTI
                     KGLLGGEVAYAAQIAQAVAQGNLAVAVNLRPGDDRSVLAAMNGMRKSLSSIVEQVRES
                     SESIATGASQIAAGSTDLSQRTEEQAANLQQTAASMEEMSQTVRQNSDTVRNAAQLAQ
                     AASNTAAKGGEAVGNIVVTMKEITDSSHKIGDIISVIDGIAFQTNILALNAAVEAARA
                     GEQGRGFAVVAGEVRSLAQRSATAAKEIKELIGHSVEKVETGSALVSDAGTTIEELVR
                     QARHVADLINEIGVTTQEQESGVSQIHDAVNQLDQVTQQNAALVEQSASAADSLSDQA
                     AHLVELMKVFVVEGGSSQRLAPQLKRPDSAKLSLANSRSRAGSDTQNWEQF"
     gene            complement(142116..143474)
                     /locus_tag="PC1_RS00555"
                     /old_locus_tag="PC1_0114"
     CDS             complement(142116..143474)
                     /locus_tag="PC1_RS00555"
                     /old_locus_tag="PC1_0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772857.1"
                     /note="member of the Gnt family of gluconate transporters;
                     not involved in gluconate transport; unknown function;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_012772857.1"
                     /db_xref="GI:502365309"
                     /translation="MATSLLLCIAIAGVLLLLLMVIKFKIQPFVALLVVSLLVALATG
                     IPTEEIMKVMSSGMGGVLGSITMIIGLGAMLGRMIEISGGAESLARKFTQTLGEKRVI
                     AALTMAAFILGIPVFFDVGFIILAPIIYGFAKVAKVSPLKFGLPVAGVMLTVHVALPP
                     HPGPVAAASLLKADVGWLTILGLAISIPVGIIGFWVAKYINRRQYALSVDVLEQLQLT
                     KTEDKSEAVQHKNAPSASLVTALIVIPIAIIMLGTVAATLFPVGHPLRNITTLVGSPA
                     VALLIALALAFYFIAMRRGWSLEKTGNVMGDAMPAAAVVIMVTGAGGVFGKVLVESGV
                     GKALADTLTSIHLPLVPAAFLLSLALRASQGSATVAILTTCGLLSEAVSGLNQMQLVL
                     VTLSACFGGLGLSHVNDSGFWIVTKYLGLSVADGLRTWTVLTTILGLAGFLFTWALWL
                     VM"
     gene            complement(143665..144447)
                     /locus_tag="PC1_RS00560"
                     /old_locus_tag="PC1_0115"
     CDS             complement(143665..144447)
                     /locus_tag="PC1_RS00560"
                     /old_locus_tag="PC1_0115"
                     /EC_number="5.3.1.22"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772858.1"
                     /db_xref="GI:502365313"
                     /translation="MPKFAANLSMLFTDVPFLDRFKAAADAGFTSVEYLFPYEYPAPL
                     LAEKLRENGLKQVLFNTAPGNIAAGEWGVSALPDRIEDARRDIDNALEYALALNCPSV
                     LVMGGVVPPGEDRAAYQQTFIDNLRYAADKFAPHGINIMIEALSAKVKPNYLFASQYQ
                     ALELSNLIDRPNVYIQLDFFHAQIVDGNLTQIIHDLDGRIGHIQIASVPARHEPDEGE
                     INYPFIFAELDRVNYGGWVGCEYNPRGKTEDGLGWIKPWLKK"
     gene            complement(144481..145137)
                     /locus_tag="PC1_RS00565"
                     /old_locus_tag="PC1_0116"
     CDS             complement(144481..145137)
                     /locus_tag="PC1_RS00565"
                     /old_locus_tag="PC1_0116"
                     /EC_number="4.1.2.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="WP_012772859.1"
                     /db_xref="GI:502365316"
                     /translation="MSEKHHNTEAALNSEQRARAEMVKLGASFFQRGYATGSAGNLSL
                     LLDDGTLLATPTGSCLGDLDAERLSKVSLSGEWISGDKPSKEVSFHLSIYRNDPECKA
                     IVHLHSTYLTALSCLEGLDTQDAIKPFTPYVVMRVGKVPVVPYYRPGDARLGEDLAKL
                     ASRYKAFLLANHGPVVTGKDLRAAADNMEELEETAKLIFILDDRKIRYLTADDIAELS
                     "
     gene            complement(145134..146408)
                     /locus_tag="PC1_RS00570"
                     /old_locus_tag="PC1_0117"
     CDS             complement(145134..146408)
                     /locus_tag="PC1_RS00570"
                     /old_locus_tag="PC1_0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011095792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012772860.1"
                     /db_xref="GI:502365327"
                     /translation="MIKLGVIADDFTGATDIASFLVNNGLPTVQLNGVPPSDFKVDTQ
                     AVVISLKSRSCPAEQAVADSLKALAWLQQQGCQQFYFKYCSTFDSTAKGNIGPVTDAL
                     LEQLGETQTIISPALPVNGRTVYQGHLFVMDQLLSESGMRHHPVTPMTDSNLMRVMEQ
                     QAAGQCGLVPYAVMDQGAEAVKQRLAQLKEQGIRYVVLDTLNEQHLLTQGEALRDMKL
                     VTGGSGLAIGLARQLADSTKQTGSATEAGKPQSGAGVVLSGSCSVMTNKQVAHYLKQA
                     AGRAIDVARCLESDDAQQAYVQELADWVKAHRDDALAPLLYATSSPDELAQIQQRWGA
                     EASSQAVEKLFAAVARQLQQDGFQRFIIAGGETSSIVVQTLGIHAFHIGPSISPGVPW
                     VRSTNHPLSLALKSGNFGDEDFFARAQKEFAA"
     gene            complement(146405..147319)
                     /locus_tag="PC1_RS00575"
                     /old_locus_tag="PC1_0118"
     CDS             complement(146405..147319)
                     /locus_tag="PC1_RS00575"
                     /old_locus_tag="PC1_0118"
                     /EC_number="1.1.1.60"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_012772861.1"
                     /db_xref="GI:502365330"
                     /translation="MKKTSDYAVAVIGLGSMGFGAAASCINAGLTTYGVDINPQALER
                     LRQAGAAQADTRIDAFADKLDAVVLLVVNAAQVNGILFGEPQVAAKLKPGTVVMVSST
                     ISAQDAKNIEQRLAEHQLIMLDAPVSGGAAKAAAGDMTVMASGSDLAFEKLKPVLDAV
                     AGKVYRIGEEIGLGATVKIIHQLLAGVHIAAGAEAMALAARADIPLDIMYDVVTNAAG
                     NSWMFENRMRHVVDGDYTPKSAVDIFVKDLGLVTDTAKSLHFPLPLASTAFNMFTAAS
                     NAGFGKEDDSAVIKIFNGITLPEKKEAP"
     gene            147656..148414
                     /locus_tag="PC1_RS00580"
                     /old_locus_tag="PC1_0119"
     CDS             147656..148414
                     /locus_tag="PC1_RS00580"
                     /old_locus_tag="PC1_0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_012772862.1"
                     /db_xref="GI:502365333"
                     /translation="MIPVERHQQILALIAERGVVSINELTERLGVSHMTVRRDVQKLE
                     QDGLLLSVSGGVRSPERLAIEPSHQDKSVMFSQQKAAMGKLAAQHIPLNSCIYLDAGT
                     TTLSLARELAERDDLLIVTNDFAIAAFLIESSQCRMIHTGGTLCRENRSCIGEAVAQA
                     LRNLFIDIAFISASSWSLRGLSTPNEDKVVVKRAAVEASSKCVLLCDTSKYGRIATHL
                     ATPLSVFDSIITDDGLPAAAKEALSKMGVEVLVA"
     gene            148530..149225
                     /locus_tag="PC1_RS00585"
                     /old_locus_tag="PC1_0120"
     CDS             148530..149225
                     /locus_tag="PC1_RS00585"
                     /old_locus_tag="PC1_0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772863.1"
                     /db_xref="GI:502365336"
                     /translation="MSVRSEIIDGRQASGVTYGLIYTEVLGWIDLGHAKGDDIKDIIQ
                     QMYVGENTEDGMPYYDVTYKQGMIGLRRSVTINRFIKWRIKKGRSLQERHSIALAMML
                     TVAKRFESMQASFPFNLVTDSGFSGEDLVSDLLGFYRVVSTPNPFYLLRPVSKEEALK
                     RWDFYGPIGNFKNIGFRPILFPDPELMSYAQPRLGFLPSFMQTIQPYNDFESGNVGIA
                     SYDGTELTTNFFK"
     gene            149227..149643
                     /locus_tag="PC1_RS00590"
                     /old_locus_tag="PC1_0121"
     CDS             149227..149643
                     /locus_tag="PC1_RS00590"
                     /old_locus_tag="PC1_0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010303231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772864.1"
                     /db_xref="GI:502365339"
                     /translation="MKKKIIIPLVISLLIALPLIYYWPAMVILTEGSSRYTEQDTRRY
                     EMLTDEIIKNCPRISSIYDFGYATVDGPALEVSNITFQNTNDATSIRGYLASLGFTLS
                     YTDTAGEYWKSTDSDKTIHIGIINDPKTVIVDVIRK"
     gene            149754..150032
                     /locus_tag="PC1_RS00595"
                     /old_locus_tag="PC1_0122"
     CDS             149754..150032
                     /locus_tag="PC1_RS00595"
                     /old_locus_tag="PC1_0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772865.1"
                     /db_xref="GI:502365342"
                     /translation="MKPETKEAPINIRAKASQWDLIDRAANLVSKSRTDFMLEAACRE
                     AQDILLDQRLFILDNEQFDGLLAELDAPITAERHARINDLMCRQSPWE"
     gene            complement(150108..150401)
                     /locus_tag="PC1_RS00600"
                     /old_locus_tag="PC1_0123"
     CDS             complement(150108..150401)
                     /locus_tag="PC1_RS00600"
                     /old_locus_tag="PC1_0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010303225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_012772866.1"
                     /db_xref="GI:502365348"
                     /translation="MYKLSNLAAEDFAGIFEYTLINYGISQADNYTESLENTLILLAE
                     SPYIGQEYPEISQGVRRFDHRQHAIFYRIREEDLLIIRILHQQMEPMCHFFDI"
     gene            complement(150394..150636)
                     /locus_tag="PC1_RS00605"
                     /old_locus_tag="PC1_0124"
     CDS             complement(150394..150636)
                     /locus_tag="PC1_RS00605"
                     /old_locus_tag="PC1_0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin"
                     /protein_id="WP_012772867.1"
                     /db_xref="GI:502365354"
                     /translation="MPRTTSITIGEQLDDFVSKLIDSGRYSSTSEVIRSALRLLEQQE
                     SKTEALKKAIYAGEQSGESSLTLREIAAKKKRERNV"
     gene            150833..152167
                     /locus_tag="PC1_RS00610"
                     /old_locus_tag="PC1_0125"
     CDS             150833..152167
                     /locus_tag="PC1_RS00610"
                     /old_locus_tag="PC1_0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6CZ31.1"
                     /note="with UgpACE is involved in the uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_012772868.1"
                     /db_xref="GI:502365362"
                     /translation="MFNNTTRKTHAIRTAAACVALALMSASAQAATEIPFWHSMEGEL
                     GKEVNSLADRFNKAHSDVKIVPVYKGNYEQNLAAGIAAYRAGNAPAILQVYEVGTATM
                     MASKAIKPVYEVFKESGINFDESVFVPTVSGYYTDAKSGHLLSQPFNSSTPVLYYNKD
                     AFKKAGLDPEQPPKTWQQMAEYTAKLRAAGMKCGYASGWQGWIQIENFSAWHGLPVAS
                     KNNGFDGTDAVLEFNKPTQVKHIQLLQDMNKKGDFTYFGRKDEPTEKFYNGDCAITTA
                     SSGSLANIREHAKFNYGVGMMPYDADAKGAPQNAIIGGASLWVMGGKDAATYKGVAEF
                     MKFLAEPENAAEWHQKTGYLPITTAAYELTQKQGFYEKNPGADIATRQMLNKPPLPFT
                     KGLRLGNMPQIRTVVDEELESVWTGKKTPQQALDSAVERGNALLRRFEQSTK"
     gene            152240..153127
                     /locus_tag="PC1_RS00615"
                     /old_locus_tag="PC1_0126"
     CDS             152240..153127
                     /locus_tag="PC1_RS00615"
                     /old_locus_tag="PC1_0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6CZ32.1"
                     /note="with UgpEC is involved in the uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter permease"
                     /protein_id="WP_012772869.1"
                     /db_xref="GI:502365365"
                     /translation="MTSSRPVFRSSWLPYVLVLPQLLITVIFFIWPAGQALWYSVQNL
                     DPFGLSSEFVGMENFKQLFNNPYYLDSFYTTLIFSFLVAGFGMLISLFLAALVDYVIR
                     ASRLYQTLIILPYAVAPAVAAVLWMFLFNPGLGLITHFLGLMGYTWNHAQHSGQAMFL
                     VVLASVWKQISYNFLFFLAALQSIPRSLVEAGAIDGAGPVRRFFNLVLPMISPVSFFL
                     LVVNLVYAFFDTFPIIDAATAGGPVQSTTTLIYKIYREGFAGLDLSSSAAQSVVLMML
                     VIGLTIIQFRFVERKVNYQ"
     gene            153140..153985
                     /locus_tag="PC1_RS00620"
                     /old_locus_tag="PC1_0127"
     CDS             153140..153985
                     /locus_tag="PC1_RS00620"
                     /old_locus_tag="PC1_0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6CZ33.2"
                     /note="with UgpABC is involved in uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter membrane
                     protein"
                     /protein_id="WP_012772870.1"
                     /db_xref="GI:502365368"
                     /translation="MIENRRGLDIFSHVMLIVGILAVLFPLYVGFVAATLDNQEVFQA
                     PMTLIPGTHLWENLRYIWLHGAGNNTTPFGLMLLNSFVMALAITVGKITVSILSAYAI
                     VYFRFPLRNLFFWMIFLTLMLPVEVRIFPTVEVIARLDMMDSYTGLTLPLMASATATF
                     LFRQFFMTLPDELMEAARIDGASPMRFFFDMVLPLSKTNLAALFVITFIYGWNQYLWP
                     LLIISDANLGTAVAGIKSMIASGDGATQWNQVMAAMLLTMLPPLLVVLLMQRWFVRGL
                     VDSEK"
     gene            154011..155084
                     /gene="ugpC"
                     /locus_tag="PC1_RS00625"
                     /old_locus_tag="PC1_0128"
     CDS             154011..155084
                     /gene="ugpC"
                     /locus_tag="PC1_RS00625"
                     /old_locus_tag="PC1_0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6CZ34.1"
                     /note="part of the UgpABCE glycerol-3-phosphate uptake
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_012772871.1"
                     /db_xref="GI:502365371"
                     /translation="MACLKLQAVTKSYDGKIQIIQPIDLDVADGEFVVMVGPSGCGKS
                     TLLRMVAGLERTTSGDIYIDNQRVTDLEPKDRGIAMVFQNYALYPHMNVFDNMAYGLK
                     IRGFGKAQIRERVEDAARILELMPLLQRKPRELSGGQRQRVAMGRAIVREPAVFLFDE
                     PLSNLDAKLRVQMRLELQQLHQRLKTTSLYVTHDQVEAMTLAQRVIVMNKGIAEQIGA
                     PADIYRRPASLFVASFIGSPAMNLWSGRISDDGCRFEIGGDIALALPEPKPQWRGKAL
                     TLGVRPEHIQLATRETDGIPLQIDTLELLGADNLAHGKWGGQNVIARLSYEHCPAIGS
                     TLWLHLPTSSWHLFDSQSGLRME"
     gene            155084..155833
                     /gene="ugpQ"
                     /locus_tag="PC1_RS00630"
                     /old_locus_tag="PC1_0129"
     CDS             155084..155833
                     /gene="ugpQ"
                     /locus_tag="PC1_RS00630"
                     /old_locus_tag="PC1_0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011095782.1"
                     /note="hydrolyzes diesters during transport at the inner
                     face of the cytoplasmic membrane to glycerol-3-phosphate
                     and alcohol; induced when cells are starved for inorganic
                     phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="WP_012772872.1"
                     /db_xref="GI:502365374"
                     /translation="METIWPYPNIVAHRGGGSLAPENTLAAIDVGASLGHKMIEFDAK
                     LSQDGQIFLLHDDTLERTSNGWGIAGELPWDKLVGLDVGGWYGHKFVGERLPLLSEVA
                     KRCVQYGMAANIEIKPTTGYETETGRVIALAARQLWADHPVAPLLSSFSIDALEAAQQ
                     AAPELPRGLLLDEWDEDWLTLTQRLGCVSIHLNHQLLTAERVAELKAAGLRILVYTVN
                     QPDRAQTLLDWGVDCICTDRIDLIGASFATG"
     gene            155909..156865
                     /locus_tag="PC1_RS00635"
                     /old_locus_tag="PC1_0130"
     CDS             155909..156865
                     /locus_tag="PC1_RS00635"
                     /old_locus_tag="PC1_0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012772873.1"
                     /db_xref="GI:502365376"
                     /translation="MPAFIVSLWHQIFLSLPLFVLIALGYSLIRYGKWPTTVTDGMTR
                     FVFSVAMPAMLFRLMSDFSQRPVVDARLLIAFFGGCLLVFVLGRIVARKIFHLDGVSG
                     SLFALSGIFSNNVMLGLPIATLMLGEEAIPSVALVVVFNGLILWTLVTVSVEWARNGA
                     LSLQGFTKTALGVLKNPLIIGILSGTAFSLTGLPLPSYIDQPLSMLGQIAAPLSLVAL
                     GMGLAEYRVRDGWQISTAICTIKLLVQPLVIWGIAIALSLPEMETRAVVLLGSMAVGV
                     NVYLMSRQFGVLGGPVASSLLLSTAMAALTTPLILTLMGVRL"
     gene            complement(156879..157175)
                     /locus_tag="PC1_RS00640"
                     /old_locus_tag="PC1_0131"
     CDS             complement(156879..157175)
                     /locus_tag="PC1_RS00640"
                     /old_locus_tag="PC1_0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772874.1"
                     /db_xref="GI:502365379"
                     /translation="MKHPTTLLACTVLLGLPLLASANTTQAPTPQQQFESGISSQKQL
                     QQNMQQSQKVQQQQLNQQLQQRNQQLQQQRQQQLQKDLERSQRTTPPPPIKQNP"
     gene            157372..157836
                     /locus_tag="PC1_RS00645"
                     /old_locus_tag="PC1_0132"
     CDS             157372..157836
                     /locus_tag="PC1_RS00645"
                     /old_locus_tag="PC1_0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772875.1"
                     /note="member of the SPOUT superfamily of RNA
                     methyltransferases; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA methyltransferase"
                     /protein_id="WP_012772875.1"
                     /db_xref="GI:502365382"
                     /translation="MFHIALYEPQIAPNTGNIIRLAANNGCTLHLIEPLGFDFEEKKL
                     RRAGLDYHDLANVSRHKNYQDFLAAVPGKRIFACTTKGSRPYDQPAYQPGDVLLFGSE
                     TSGLPDEIRNGFESDFRIRIPMQSNNRSLNLSNAVAIISYEAWRQNGFGGCL"
     gene            complement(157847..158647)
                     /locus_tag="PC1_RS00650"
                     /old_locus_tag="PC1_0133"
     CDS             complement(157847..158647)
                     /locus_tag="PC1_RS00650"
                     /old_locus_tag="PC1_0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772876.1"
                     /db_xref="GI:502365386"
                     /translation="MGRQARLLLVTPSIVLACILSFCTQATSVNAAPSTVNAANTTVD
                     ATRYQDFWLWAAVKPQPILHQAQTLYLHQGEVARRQGKVVFLRQGIPPSQLRVNRVWL
                     AFRMTTLELSDRHLNRMLKLREKWQRHGNQIVGIQIDFDAKSYQLAGYVAFLTQLRER
                     LPEDCQLSITGLLDWSKTGDVSALNRLQGKLDEVVVQTYQGRNTITNYAEYLPALMKL
                     TLPFRVGLVQNGKWEPQWQQRLATSPYYRGEVVFLVNPPLKKSATGRL"
     gene            complement(158617..160791)
                     /locus_tag="PC1_RS00655"
                     /old_locus_tag="PC1_0134"
     CDS             complement(158617..160791)
                     /locus_tag="PC1_RS00655"
                     /old_locus_tag="PC1_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010308730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772877.1"
                     /db_xref="GI:502365389"
                     /translation="MKGVTLLAGVLTALMSSQAFSSSDGVCGFSDSECGMSALPYLQP
                     GNDTRTNLMLLQSRLHGISLPLPHPLPDQARSRIDPFTAYRVMGIAATETPQTSESGE
                     DVTADAPYLSTLNKAKQLHLPLSVQSTISTFSPDDNEGRHISNALSTLEAFFDVLLAD
                     KPLTEEQRTLLAHQRVNILNPLYTKDALNEGLASLPDEGHAGALMQYLFAVLAFYQGH
                     FDEAESGFQALVSSPQPWVAETSRYMLIRVAINKAMENALDEYNMFDAGKADKATAQL
                     AVQHIDDYLKQYPEGQYVDSANGLYRRAYWIMNDTNALAKTYQHELDGTTDVEDLLEL
                     NDEIDNKLLENRQFTSAPGSAPLTMVQDLKRLRSDEGWLALPALSTEELAAQKPLFEQ
                     DNMQDAFSYLQAAQLFYGQKDYAAVVNSVPATQENDLTDTVRFSLQVLRGRALVRLER
                     WDEAEVHWRQLLTRKMGYTQNQFLQLALAETLVKAGHPERIFTADSPVKNLRFRSAVL
                     KISANADLLRQQTGAQQSHEERAIALHTLLTKSLTHGDYASYLKDVQLRKDIAPLVSS
                     ENQSWNQEDLTAFDWDGSDTEEDYQCPALNDVVTTLNQRPNDARAINCLGEFFLRTNN
                     SVGFDWGEGSMLSGLTNAPTQFVGTEYNRLDGYMKVIADPKAPPEDKTYALYRAVYCY
                     APSGYNDCGPQEISKATRKAWFTQLKTKYKGSVWADKLDYYW"
     gene            complement(160982..162352)
                     /gene="cpxA"
                     /locus_tag="PC1_RS00660"
                     /old_locus_tag="PC1_0135"
     CDS             complement(160982..162352)
                     /gene="cpxA"
                     /locus_tag="PC1_RS00660"
                     /old_locus_tag="PC1_0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976471.1"
                     /note="part of two-component CpxA/CpxR system; senses
                     envelope stress; upregulates a number of periplasmic
                     folding and trafficking factors; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_010281575.1"
                     /db_xref="GI:497967419"
                     /translation="MINSLTARIFAIFWLTLALVLMLVLMVPKLDSRQLTALLENEQR
                     QGIMLEQHIEADLANTPANDLRWWLRLFWVLEKWAPPGQRLFLVTSEGRIFGVEKHET
                     PIVRNFIGLSDNADHPQKKNYGRIELLGPFAIRDGDDNYQLYLIRPASSPQSDFISLL
                     FDRPLLLLIFTMLISSPLLLWLAWSLAKPARKLKHAADEVAKGNLRQHPELESGPQEF
                     QATGVSFNQMVSALERMVTAQQRLLSDISHELRTPLTRLQLATALLRRRQGEGNELNR
                     IETETQRLDSMINDLLVLSRNQHKNELTREFLRADELWGNVLDDAAFEAEQMGKTLEV
                     PYPPGPWTLFGNPASLDSALENIVRNALRYSHNHIEVAFSVDNQGITIKVDDDGPGVS
                     PEDREQIFRPFYRTDEARDRESGGSGLGLAIVETAITQHKGWVKAEDSPLGGLRLIIW
                     LPLHQR"
     gene            complement(162349..163047)
                     /locus_tag="PC1_RS00665"
                     /old_locus_tag="PC1_0136"
     CDS             complement(162349..163047)
                     /locus_tag="PC1_RS00665"
                     /old_locus_tag="PC1_0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772878.1"
                     /note="response regulator in two-component regulatory
                     system with CpxA; part of the envelope stress response
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012772878.1"
                     /db_xref="GI:502365396"
                     /translation="MNKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQALQVLDNT
                     IDLLLLDVMMPKKNGIDTLKELRQQHQTPVIMLTARGSELDRVLGLELGADDYLPKPF
                     NDRELVARIRAILRRSNWTDQQQAGDNSAPTLEVDGLRLNPGRQEASFDDIVLDLTGT
                     EFTLLYLLAQRLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERKDGLPWF
                     KTLRGRGYLMVSAA"
     gene            163201..163725
                     /gene="cpxP"
                     /locus_tag="PC1_RS00670"
                     /old_locus_tag="PC1_0137"
     CDS             163201..163725
                     /gene="cpxP"
                     /locus_tag="PC1_RS00670"
                     /old_locus_tag="PC1_0137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772879.1"
                     /note="repressor of the Cpx envelope stress response
                     pathway which occurs via periplasmic interactions with
                     CpxA; CpxP is degraded by DegP protease especially in the
                     presence of misfolded substrates; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_012772879.1"
                     /db_xref="GI:502365398"
                     /translation="MQQFATLSLASLLMLGTFTAVAAESGDAPASGWHIDDSATKGVS
                     GQQGMFDGVRLTEQQRQQMRDLMHQSRQDKPAFNAEDVKAMHKLVTAETFDEAAVRAQ
                     ITRMMSVQIERQIQMTRVRNQMYNLLTPAQKEILDVKHKQRMKEMQQQISMFNQMAAP
                     APGTTNQTETENPE"
     gene            164123..165310
                     /locus_tag="PC1_RS00675"
                     /old_locus_tag="PC1_0138"
     CDS             164123..165310
                     /locus_tag="PC1_RS00675"
                     /old_locus_tag="PC1_0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose transporter"
                     /protein_id="WP_012772880.1"
                     /db_xref="GI:502365400"
                     /translation="MTRSSRSTAWLRVVSLSLAAFIFNTAEFAPVALLSDIAASFSMS
                     AAQVGLIITIYAWVVGLMSLPCMLLSSDMERRSLLIKIFILFAISNVLSGLAWNYWVL
                     VIARIGVALAHAIFWSITASLVVRLAPADKKAQALSLLATGTALALVLGLPLGRVVGQ
                     YLGWRVTFVLIGLIAAAIMVGLMKLLPVLPSSNSGSLKSLPLLLKRPALLCVYGLIVM
                     IVTAHFTAYSYIEPFIQKVALLSENFTTILLLIFGGAGIIGSMLFSRYSSKYPAGFLI
                     VSFAFLAVCLLLLLPLSFSGWSLSTLCIVWGIAIMALSLGMQVKVLTLASDATDVAMA
                     LYSGIYNIGIGGGALLGNQVIIHLGLPDIGFMGAAMAMLATVCCILTFVRYSRVLKTS
                     LTS"
     gene            165354..166256
                     /gene="fieF"
                     /locus_tag="PC1_RS00680"
                     /old_locus_tag="PC1_0139"
                     /gene_synonym="yiiP"
     CDS             165354..166256
                     /gene="fieF"
                     /locus_tag="PC1_RS00680"
                     /old_locus_tag="PC1_0139"
                     /gene_synonym="yiiP"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DHK1.1"
                     /note="member of cation diffusion facilitator family; CDF;
                     membrane-bound; induced by both zinc and iron, but does
                     not induce resistance to zinc; can transport zinc(II) in a
                     proton-dependent manner; instead this protein induces iron
                     resistance; forms dimers; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation-efflux pump FieF"
                     /protein_id="WP_012772881.1"
                     /db_xref="GI:502365402"
                     /translation="MNPHYARLVTLAAVSATAVALVLFIMKVFAWWHTGSVSLLASLV
                     DSLVDIAASLVNLLVVRYSLQPADTEHAFGHGKAESLAALAQSMFISGSALFLILTGL
                     QHSLEPQTLHAPEVGMWVTLIALVATLLLVSFQRWVVKRTHSQAVRADMLHYQSDLLM
                     NGAILVALALSWKGITRADSLFALGIGGYILYSALRMGYDAVQSLLDRALPDDEHRAI
                     AEVIVNWPGIRGAHALRTRRSGPTRFIQLHLEMDDALPLVQAHQIADDLEQALLKRFP
                     GADIIIHQDPVSAVPENQRGRLTA"
     gene            166464..167426
                     /locus_tag="PC1_RS00685"
                     /old_locus_tag="PC1_0140"
     CDS             166464..167426
                     /locus_tag="PC1_RS00685"
                     /old_locus_tag="PC1_0140"
                     /EC_number="2.7.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010281567.1"
                     /note="catalyzes the formation of D-fructose
                     1,6-bisphosphate from D-fructose 6-phosphate in
                     glycolysis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent 6-phosphofructokinase"
                     /protein_id="WP_012772882.1"
                     /db_xref="GI:502365404"
                     /translation="MIRRIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVYGIYDGYQG
                     LYEDRMEQLDRYSVSDVINRGGTFLGSARFPQFRDEAVRQVCVENMKRRGLDALVVIG
                     GDGSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYFTALETVLEAIDRLRDTSSS
                     HQRISIVEVMGRHCGDLTLAAAIAGGCEFIVLPEVPFSPEDLVCEIKAGIEKGKKHAI
                     VAITELVCDVDELAKYIEKETGRETRATVLGHIQRGGSPVAYDRILASRMGAYSIELL
                     QQGYGGRCVGIQNEKMVHHDIVDAIENMKRPFKGDWLDTAKKLF"
     gene            167946..168875
                     /locus_tag="PC1_RS00690"
                     /old_locus_tag="PC1_0141"
     CDS             167946..168875
                     /locus_tag="PC1_RS00690"
                     /old_locus_tag="PC1_0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010308942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012772883.1"
                     /db_xref="GI:502365407"
                     /translation="MNIDLRQLRHFIALIEHRNFTSAAQAMKLSQSAFSRSIQSLEQT
                     IGTRLIDRMNQLEPTPKGLVVLEHARRLINQTHDLFNDIQQFNEKEAGEVNFGCGPAP
                     AAWLMPQVIGDFSRHYPKVRMVFRVDNWQALGHRLMAEELDFIVADMRNFEFDTRYRV
                     QPLSQHRWGFCCRSGHPLAAQEEITVEQFFSYPLAATIRPPNLHRALVQLSGKLDIRT
                     SIECENGYSLLDVVRHSDAIGTTNHFNEPERHGLHMLKIAGLDDNTDEFYTHYGIIYL
                     ADARLSLLARKLIDTFVQVDSDLHGTPAVLTAE"
     gene            complement(168862..169590)
                     /locus_tag="PC1_RS00695"
                     /old_locus_tag="PC1_0142"
     CDS             complement(168862..169590)
                     /locus_tag="PC1_RS00695"
                     /old_locus_tag="PC1_0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010281565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772884.1"
                     /db_xref="GI:502365410"
                     /translation="MPPPGGTLQDITMTDPGCTENTLLLSLQADDTHDIIDSPHRSTF
                     IWSTDSIGQPLRWQVEQEDPDRTTIQTTPEHLALESAAGLTIWLDAPLSGTYRIAFTR
                     EVLVADRPYDRVSDLNQFWGARDLHHPNLFTRYGKLNEYDSLNLYYVGMGGNWNSTTR
                     FRYYDGHGERLLLGEYTDATHLLRPNHRYRIVIEVDRRETRFWVDDVLYFHASYPNIP
                     APGYFGFRTVFSRQEISDFSITPL"
     gene            complement(169590..172349)
                     /locus_tag="PC1_RS00700"
                     /old_locus_tag="PC1_0143"
     CDS             complement(169590..172349)
                     /locus_tag="PC1_RS00700"
                     /old_locus_tag="PC1_0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772885.1"
                     /db_xref="GI:502365414"
                     /translation="MNKMPYSRRRFLRDSTLLALSAPFWNATAPRASAYAGESAPQVN
                     LRWLDGQRPRAFTGVTWGVPWPQGAVRNDSGFQLHDAQQHAYDLQSWPLARWPDGSIK
                     WSAHALGGDTPPEDGLTLRPIPAKDGSMGSAMVREHEHGWTVETGRIRYEIPRSGTRL
                     ISEIWRNNRLALTNGRLVLRMQRGAETESTLTLDAYQGVIDTVTVEQNGAQRTVIALR
                     GTHHAPQQGVTRIPFIIRLYSYANTDSLRVLHTLIYDNDDDLVSLKGLGLAFDVPLQG
                     ELHDRHIRFVSDQGGLFREAVRGLSGLRRDPGSAVIAAQLAGQATPPIADFSPEVGKR
                     LDYIPAFGSYRLTQHHPDGFQIHKRTVAGQGWLLSATGERAAGVGYLGTPTGGVAFGI
                     RHFWQSYPACLEIDNAHTDVATVTLWLWSPWAEPMDMRFYHDGLGQDTHDKQREGLAI
                     TYEDYEPGFGSAVGVARTSELFIDVLPATPDAEDLVNRARRMQQPPLLVADAQDLQRA
                     QAFGSMWAPSSATTPARIRLEKQLDAYFDVYQQEVEQRKWYGFWDFGDVMHTYDSDRH
                     VWRYDVGGYAWDNSELSTDLWLWYYFLHSGRAEAFRLAEAMTRHTGEVDVHHLGRFSP
                     LGSRHNVRHWGDSAKQLRISTVANRRFLYYLTADERIGELMDEQVEALRTLSAVLPGR
                     KIGQTHPDSPNHISLGFGTDWGAVAAAWLTAWERHSDPSMRERLLNSMQTLASQPHGF
                     FTGSAAIDPDTGRFLPAPADQVEISHLSAVFGLTEICSELVEALPDPAFTRAWLDYCR
                     LYNDPIALSTAVGKTVKKLNLAQGHARLTAFAARRLNDRALAQRAWAEFTAGSGGIAH
                     PTLEQRRVTPPAVLYPINEPVIDSTIDKHSGSTMAVNLATNAVAQWGLTAIALLALLD
                     DIPSS"
     gene            complement(172354..174624)
                     /locus_tag="PC1_RS00705"
                     /old_locus_tag="PC1_0144"
     CDS             complement(172354..174624)
                     /locus_tag="PC1_RS00705"
                     /old_locus_tag="PC1_0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_012772886.1"
                     /db_xref="GI:502365417"
                     /translation="MYLKKHQQYLKEHQRKITSGILMSCVLTLPAMARAADPQITTDN
                     VPRTEATTAAPVQLKRVKVNAQRTPVQPPTTLASVIDGKTLEEERVYRFEELSQLVTG
                     LDVDTVDVMDTTVTIRGIGDGGESGTNIGMPGSVGLFVDGVYLSRPGVISNDLLDIDS
                     TRVLKGPQGAAYGFNTTGGAIDIRTRKPTFTPEYSLEQSFGQRGYLQSKLMASGPLSD
                     HWAGRINLSRTERGGNVTNIENGHKLGGSTNNGVRGQLLYQPNDSFSLRITGDYSDST
                     QRPVSVLVSATDDFRNRAQQTGLKVVGDRQVAMDDENVIRVAQGGGSVEANWRLKNGY
                     SVNSLSSLRYFRVLPSTADNWNIPLYHDSGADVRDRVWSQSFWLDSPKGNTFDYSLGV
                     DYWGENLDTEANSRYYNDNRVRTWVGNGYQGINVQRFGTLDDTVYSVYGRGTWHAADK
                     LDVIVGLRQTYEKKEGTFVRKNRATFDSGPLSQTNRLPSGSISLNWFAAPNVTPYVTL
                     GYGEKSGGLNVSSGAARQLGIDSLYVDPEKTRSAELGVKTHWLQRKVEWNTALFWSVV
                     EDFQNNAYDEETDTSYLINAGKFRSRGGETQLTVRPIDGLSISLAGTVLDARYLNFPN
                     ARCPAEISAVSCDMSGKRVFKSPTLSYNTRVRYQWDTPNNLQASVSGQWSWRSWAYGT
                     LDDSEYNRIPAYGVLNLSSGLSGKQGDNRWNVSLWVKNALDKNYYRSVRGSSATTGVI
                     GEPRMVGISVGYDFKG"
     gene            complement(174710..175717)
                     /locus_tag="PC1_RS00710"
                     /old_locus_tag="PC1_0145"
     CDS             complement(174710..175717)
                     /locus_tag="PC1_RS00710"
                     /old_locus_tag="PC1_0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012772887.1"
                     /db_xref="GI:502365436"
                     /translation="MKTSGRKWLVTSLLAMGMAWSGIASAITEIRIAAPDIGAGTKPS
                     GGGLLDVIHSQKLLEREFGKDGISVRWTFIKGAGPVINEAFGNHQVDVAYLGDLASII
                     GRARGLDTRVIAVASRGINHYLAVAKGSGIEKIADLKGKRIGIFRGTAGELSFVSALD
                     SQGLKPSDVKLINLDFAAASAALAAGQIDATWGGSNTLSLRDKGLADIPLSSRDLNGA
                     GQLSGFLLVDEKFAKGNEDILRRLVKVQREAANWASDEKNKDEFIRLLATQSGYPENI
                     LRVEWDTLPPLTERLSPELDPAFVEKLKRAVTLAYESRLIRQPFDVDKWLDDSYLKAT
                     Q"
     gene            176370..177233
                     /locus_tag="PC1_RS00715"
                     /old_locus_tag="PC1_0146"
     CDS             176370..177233
                     /locus_tag="PC1_RS00715"
                     /old_locus_tag="PC1_0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope biogenesis protein TonB"
                     /protein_id="WP_012772888.1"
                     /db_xref="GI:502365440"
                     /translation="MTELLYAGAVSGSRSYSPEPTPHASRVNGVVQSRVPALNTTVSS
                     RPERWLAAIATLLLHAAVLALFSSASTPPVTVPARPQPISIELVAAVAEPVLQAEPAE
                     PEVVAPPPELTPPVVDKPVDDNALLPPEPEKKEPERKAPEKKPEPAPKKVAVKKNPPA
                     PTPKPQAETVSASAPVTPAPVAQQAVAPPVDAPLTPPLANADYLHNPAPSYPDVAISR
                     GYEGTVLLNVQVRADGKVQTIRIHQSSGYPSLDEAARDTVLRWSFVPARRGNQPVSGW
                     VVVPVDFSLNS"
     gene            177245..177961
                     /locus_tag="PC1_RS00720"
                     /old_locus_tag="PC1_0147"
     CDS             177245..177961
                     /locus_tag="PC1_RS00720"
                     /old_locus_tag="PC1_0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbB"
                     /protein_id="WP_012772889.1"
                     /db_xref="GI:502365444"
                     /translation="MTLGHIELFSAEGAVILLLLLFSLVTWGLGLLKFVQYGRAQRRD
                     RRFRAAFWQQDDVSQTPETSAKQPGSLANLALAAVKAPEQMSGQLALNIHLPDRVERA
                     LQQQIQRERRTLESGLAVLASIGSTSPFIGLFGTVWGIMAALQEIGLSGSASLDTVAG
                     PIGNALIATGIGIAVAVPAVLIYNYFLRRLKLAVADMDDFAHDVYSVMQAHDFHVSTV
                     HASVDPSSATFSVKNLREVV"
     gene            177963..178364
                     /locus_tag="PC1_RS00725"
                     /old_locus_tag="PC1_0148"
     CDS             177963..178364
                     /locus_tag="PC1_RS00725"
                     /old_locus_tag="PC1_0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010281556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter protein ExbD"
                     /protein_id="WP_012772890.1"
                     /db_xref="GI:502365447"
                     /translation="MAFTSRNDEDVMSEMNITPLVDVMLVLLVVFIVTAPMLTNAIPI
                     QLPKTSAVAPADRADPVVISIDGEQRVFINKENLAREQLVPRLQQAKASNADLVVQVQ
                     ADKDANYGAVAALLADVEQAGITRLSLLTQK"
     gene            178386..179984
                     /locus_tag="PC1_RS00730"
                     /old_locus_tag="PC1_0149"
     CDS             178386..179984
                     /locus_tag="PC1_RS00730"
                     /old_locus_tag="PC1_0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012772891.1"
                     /db_xref="GI:502365450"
                     /translation="MMPKYPLRIRPAPDASLTAAALSAGYSALVVSLVVPLLVLAGWW
                     LASRHGWMSEQILPSPLAVIDSARAFIPEELVHQLPISLLRLAIGFSGGIALGLVLGS
                     LFGLNRRLNALFMPLFTVIAQIPTLAWIPLLMLSLGIGEALKLVVLVKSVTVPVTLYT
                     CAGIQQTPQKLHEMARSLRLPPAAFLRYLILPAMLPYVMTGVRLAFSTGWVALIAVEL
                     LASSEGLGYLLVQSRQLFMLDLVFVCILIIGILGFAGERVLLKLERRWIHWPAPVLGR
                     DSLGYALPSLSLTPWLAPLVLVVLWQVSSTYEWVNVAFLPAPSRVIDALWTGLVQGGL
                     LIDLHASLLRALQGFTLGSAIGVLVGAVLGGWRIADRLFNPALSALRCVALFAWLPLI
                     TAWFGLGESAKIVFIAVAAFFPVMLATRQGIAQLPPALLEVAQVLRLTPVQTLRTLIL
                     PSVLPPLFSGLRLALMHAWTGAIGAEYFMPSGEGLGGMMIRAQQLLESDRIMAGVVLI
                     AAVAALFSRLITLSERRLTRWRFA"
     gene            180002..180760
                     /locus_tag="PC1_RS00735"
                     /old_locus_tag="PC1_0150"
     CDS             180002..180760
                     /locus_tag="PC1_RS00735"
                     /old_locus_tag="PC1_0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonate ABC transporter ATP-binding protein"
                     /protein_id="WP_012772892.1"
                     /db_xref="GI:502365453"
                     /translation="MSLHFQHITKHFIVNGTPLTVLQDIDLSLHAGELVAIIGASGCG
                     KSTLLRLAAGIDTTERGRILIGERPVRGIPDDVSLVFQEPRLFPWLTVTDNIRLGMLN
                     LNLSPAEVERRIAHYLQMMGLEGFADAWPHQLSGGMAQRVAIARGLVSTPHILLLDEP
                     FGALDALTKQQLQARLAEIRQQTDLTILLVTHDVEEAVFLADRVVVMSPRPGRISRIL
                     PINLTYPRDRTSTALLEQRQAVSQALHQADAVEA"
     gene            181270..182154
                     /locus_tag="PC1_RS00740"
                     /old_locus_tag="PC1_0152"
     CDS             181270..182154
                     /locus_tag="PC1_RS00740"
                     /old_locus_tag="PC1_0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-carbamoylputrescine amidase"
                     /protein_id="WP_012772893.1"
                     /db_xref="GI:502365456"
                     /translation="MKKVTVAATQMACSWDLPKNIENAEKLVRQAHAKGAQVILIQEL
                     FAAPYFCIDQSPEHYALAQELETSPLIKHFSALAAELNVVLPLSFFERANNAYYNSLV
                     MIDADGAVLDVYRKTHIPNGPAYQEKQFFIPGDTGFKVWQTRYAKIGVGICWDQWFPE
                     TARSLALQGAELIFYPTAIGSEPAYPDIDSQPHWTRVQQGHAAANLVPVIASNRIGTE
                     ASKYIDGLEMTFYGSSFIADQTGALVAQANKTDEAILVHEFDLEAIAAQRASWGLFRD
                     RRPDMYGTIATSDGKTWR"
     gene            182158..183261
                     /locus_tag="PC1_RS00745"
                     /old_locus_tag="PC1_0153"
     CDS             182158..183261
                     /locus_tag="PC1_RS00745"
                     /old_locus_tag="PC1_0153"
                     /EC_number="3.5.3.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772894.1"
                     /note="catalyzes the formation of carbamoylputrescine from
                     agmatine in the arginine decarboxylase pathway of
                     putrescine biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatine deiminase"
                     /protein_id="WP_012772894.1"
                     /db_xref="GI:502365461"
                     /translation="MSQPATPSLTTPHQDGFAMPAEWAPHDAVWMIWPYRTDNWREQG
                     IPAQKTFARVAEAIAQNTPVIMGVPARYMANAQQVMPVNVTLVEMESDDAWMRDTGPT
                     IVLNQAGERRGIDWQFNAWGGELGGLYEDWRQDEKVAAQVLDYHQAGRYAAPLILEGG
                     SIHVDGEGTLLTTAECLLNPNRNPHLSKAEIEQLMRDYLSISTIIWLEEGVYNDETDG
                     HIDNMCCFVRPGEVALHWTDDENDPQYARSVAAYEVLSAARDAQGRELKIWKLPAPGP
                     LYATKEEAQGVDSGDAVERLAGSRLAGSYVNFLISNQQIIFPLLDEKTDDVARDLLQQ
                     MFPGYLISGVPAREILLGGGNIHCITQQIPAVK"
     gene            complement(183401..184168)
                     /locus_tag="PC1_RS00750"
                     /old_locus_tag="PC1_0154"
     CDS             complement(183401..184168)
                     /locus_tag="PC1_RS00750"
                     /old_locus_tag="PC1_0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6CZ81.1"
                     /note="Reversibly isomerizes the ketone sugar
                     dihydroxyacetone phosphate to the aldehyde sugar
                     glyceraldehyde-3-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="WP_012772895.1"
                     /db_xref="GI:502365464"
                     /translation="MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPA
                     IYLDQANHQLAGSRIALGAQNVDVNLSGAFTGETSADMLKDIGAKYIIIGHSERRTYH
                     KESDEFIAKKFGVLKDAGLIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAKAFE
                     NTVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANA
                     AELFTQPDIDGALVGGASLKADAFAVIVKAAADAKRG"
     gene            complement(184334..184933)
                     /locus_tag="PC1_RS00755"
                     /old_locus_tag="PC1_0155"
     CDS             complement(184334..184933)
                     /locus_tag="PC1_RS00755"
                     /old_locus_tag="PC1_0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772896.1"
                     /db_xref="GI:502365467"
                     /translation="MTRKRIASLLVLSSLVLYQTHAAADPTFPPKPSANAPYLLAGAP
                     TFDQTITQFRSRYNLSNPTLPIGEFRVVDTGNITSMLTRAASRINDHLYASTALEKGT
                     GKIKTLQITWLPQPQSDQETAARRKQAIDYMAALARTFAPSLTEEQSMKKVTELLEKG
                     KGQRFYPQTEGALRYVVADDGEKGLTFAVEPIKLTLSEP"
     gene            185131..185553
                     /locus_tag="PC1_RS00760"
                     /old_locus_tag="PC1_0156"
     CDS             185131..185553
                     /locus_tag="PC1_RS00760"
                     /old_locus_tag="PC1_0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772897.1"
                     /db_xref="GI:502365470"
                     /translation="MTLQQWCFSFKGRIGRRDFWLWMAIWVALMAVLFTLSGQSWLDT
                     QSTAFGLVVLLWPTAAIMVKRLHDRNKSGWWALLLVVAWMLASGNWTMFSTIWQWGIG
                     RFLPILIVVMTLLDCGVFLGTKGENRFGAEAEPFRFRR"
     gene            complement(185571..186317)
                     /locus_tag="PC1_RS00765"
                     /old_locus_tag="PC1_0157"
     CDS             complement(185571..186317)
                     /locus_tag="PC1_RS00765"
                     /old_locus_tag="PC1_0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-NADP reductase"
                     /protein_id="WP_012772898.1"
                     /db_xref="GI:502365473"
                     /translation="MAEWVTGKVVQVENWTESLFSIRVHAPTDSFTAGQYGKLALEIE
                     GEKVQRAYSYVNAPSDPTLEFYLVTVPEGKLSPHLHALQPGSEVMVVKEPAGFFVLEE
                     VPDCETLWMLATGTGIGPYLSILQEGKDLERFKNIVLVHAARFSRDLSYLPLMQQLQQ
                     RYHGKLRIQTVVSREEETGSLTGRVPQLISNGTLEAAVGLPMNAETSHVMLCGNPQMV
                     RDTQLLLKEERQMTKHLRRRPGHMTAENYW"
     gene            complement(186435..187445)
                     /locus_tag="PC1_RS00770"
                     /old_locus_tag="PC1_0158"
     CDS             complement(186435..187445)
                     /locus_tag="PC1_RS00770"
                     /old_locus_tag="PC1_0158"
                     /EC_number="3.1.3.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010281536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose 1,6-bisphosphatase"
                     /protein_id="WP_012772899.1"
                     /db_xref="GI:502365475"
                     /translation="MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADNAAVQAMRIML
                     NQVNINGQIVIGEGEIDEAPMLFIGEQVGTGKGDAVDIAVDPIEGTRMTAMGQANALA
                     VLAVGEKGAFLHAPDMYMEKLIVGPEAKGAIDLNLPLADNLRNIALKLGKPLSQLTVT
                     TLAKPRHDACIAEMQQLGVKVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVISA
                     AVIRALDGDMQGRLLARHQVKGDSAENRRIGEDELARCRQMGIEAGSVLKLDDMARND
                     NVIFSATGITKGDLLDGIARKGNMATTETLLIRGKSRTIRRIKSTHYLDRKDRTLHEF
                     LL"
     gene            complement(187700..189211)
                     /gene="glpK"
                     /locus_tag="PC1_RS00775"
                     /old_locus_tag="PC1_0159"
     CDS             complement(187700..189211)
                     /gene="glpK"
                     /locus_tag="PC1_RS00775"
                     /old_locus_tag="PC1_0159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822006.1"
                     /note="Converts glycerol and ADP to glycerol-3-phosphate
                     and ADP; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="WP_012772900.1"
                     /db_xref="GI:502365477"
                     /translation="MNPEKKYIVALDQGTTSSRAIVLDHDANIVSVSQREFTQIYPKA
                     GWVEHDPMEIWASQSSTLVEVLAKADISSDEVAGIGITNQRETTVVWEKESGKPIYNA
                     IVWQCRRTADICEKLKKDGLEEYVRNTTGLVVDPYFSGTKVKWILDHVEGSRERAKRG
                     ELLFGTIDTWLIWKMTQGRVHVTDYTNASRTMLFNIHTLEWDTRMLEALDIPREMLPE
                     VRASSEVYGQTNIGGKGGTRIPIAGIAGDQQAALYGQLCVNPGQAKNTYGTGCFLLMN
                     TGKEAVLSKHGLLTTIACGPRGEVNYALEGSVFVGGASIQWLRDELKLIGDSMDSEYF
                     ATKVKDTNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHIIRATLESIAFQTRD
                     VLDAMQADADTRLKALRVDGGAVANNFLMQFQSDILGTRVERPEVRESTALGAAFLAG
                     LATGFWNDLDEVKSKATIEREFRPSIETVERNYRYSGWQKAVARARNWEDHDA"
     gene            complement(189265..190104)
                     /locus_tag="PC1_RS00780"
                     /old_locus_tag="PC1_0160"
     CDS             complement(189265..190104)
                     /locus_tag="PC1_RS00780"
                     /old_locus_tag="PC1_0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014917001.1"
                     /note="involved in the transport of glycerol into the
                     cell; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol uptake facilitator GlpF"
                     /protein_id="WP_012772901.1"
                     /db_xref="GI:502365479"
                     /translation="MSQAERSTLKGQCIAEFLGTGLLIFFGVGCVAALKLAGASFGQW
                     EISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFDGRKVVPYILAQIAGAFCA
                     AALVYGLYHNLFVDFEQTNNMVRGSTESLSLAGIFSTYPNPHISVMQALLVETVITAI
                     LMCLILALTDDGNGIPRGPLAPLLIGILIAVIGASMGPLTGFALNPARDFGPKLFAFL
                     AGWGNVAFTGAREIPYFLVPIFGPIIGACLGAFGYRALIGRNLPCDVCEPEAETTTRR
                     ESR"
     gene            190801..191040
                     /locus_tag="PC1_RS00785"
                     /old_locus_tag="PC1_0162"
     CDS             190801..191040
                     /locus_tag="PC1_RS00785"
                     /old_locus_tag="PC1_0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114846.1"
                     /note="interacts with FisZ and is necessary for Z-ring
                     formation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapB"
                     /protein_id="WP_010281529.1"
                     /db_xref="GI:497967373"
                     /translation="MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEQNNALSQDVQAA
                     AGSREALVRENEQLKEEQVVWQERLRALLGKMEEV"
     gene            complement(191160..191645)
                     /locus_tag="PC1_RS00790"
                     /old_locus_tag="PC1_0163"
     CDS             complement(191160..191645)
                     /locus_tag="PC1_RS00790"
                     /old_locus_tag="PC1_0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004704795.1"
                     /note="regulator of RNase E; increases half-life and
                     abundance of RNAs; interacts with RNase E possibly
                     inhibiting catalytic activity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of ribonuclease activity A"
                     /protein_id="WP_010281528.1"
                     /db_xref="GI:497967372"
                     /translation="MKYDTSELCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFED
                     NGLLFDLLEENGLGRVLLVDGGGSVRRALINAEIARLATQNEWEGIVVYGAVRQVDDL
                     AELDIGIQAMAAIPVGAGSEGIGESDIRVNFGGVTFFSGDHLYADNTGIILAEDPLDI
                     E"
     gene            complement(191771..192697)
                     /locus_tag="PC1_RS00795"
                     /old_locus_tag="PC1_0164"
     CDS             complement(191771..192697)
                     /locus_tag="PC1_RS00795"
                     /old_locus_tag="PC1_0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772903.1"
                     /note="catalyzes the formation of dimethylmenaquinone from
                     1,4-dihydroxy-2-naphthoate and octaprenyl diphosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /protein_id="WP_012772903.1"
                     /db_xref="GI:502365484"
                     /translation="MTLSTHSSKTKAWLDSLRPKTLPLAFASIVTGSAIASWHSSFKP
                     GVALLALLTAGLLQILSNLANDYGDAVKGSDTEDRIGPLRGIQTGAITLTQLRNALIV
                     TVVLTIISGVSLVILACEKPADIFGFLILGLLAIFAAITYTVGNKPYGYIGLGDISVL
                     IFFGWLSVAGSYYLQTGHFDSIVMLPATACGLLATAVLNINNLRDIDNDRISGKNTLA
                     VRLGAEKARFYHTMLLLLAPVCLGLFATFYLHSLAGWLFILTLPLLIKQARYVLRETS
                     AFSMRPMLEKTVKGALLTNILFAVGVILSSCG"
     gene            complement(192843..194174)
                     /gene="hslU"
                     /locus_tag="PC1_RS00800"
                     /old_locus_tag="PC1_0165"
     CDS             complement(192843..194174)
                     /gene="hslU"
                     /locus_tag="PC1_RS00800"
                     /old_locus_tag="PC1_0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004719530.1"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease ATPase subunit HslU"
                     /protein_id="WP_010299298.1"
                     /db_xref="GI:497985142"
                     /translation="MSEMTPREIVSELDSYIIGQHKAKRAVSIALRNRWRRMQLDEAL
                     RHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRD
                     LTDSAIKMVRLQSIEKNRFRAEEMAEDRILDVLIPPAKNNWGQAESTPEPSAARQAFR
                     KKLREGQLDDKEIEIDLAAAPVGVEIMAPPGMEEMTNQLQSMFQNLAGQKQKARKIKI
                     KDAFKLLIEEEAAKLVNPEELKQQAIEAVEQHGIVFIDEIDKICKRGESSGPDVSREG
                     VQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVASPSDLIPELQGRLPIRVELQA
                     LTTEDFERILTEPSASLTEQYKALMATEGVDISFTADGIRRIAEAAWQVNESTENIGA
                     RRLHTVMERLIEDVSYDASEMNGQSVTIDADYVRNHLDELVADEDLSRFIL"
     gene            complement(194184..194714)
                     /locus_tag="PC1_RS00805"
                     /old_locus_tag="PC1_0166"
     CDS             complement(194184..194714)
                     /locus_tag="PC1_RS00805"
                     /old_locus_tag="PC1_0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005290933.1"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease subunit HslV"
                     /protein_id="WP_005973334.1"
                     /db_xref="GI:492814118"
                     /translation="MTTIVSVRRNGQVVIGGDGQATLGNTVMKGNVRKVRRLYHDRVI
                     AGFAGGTADAFTLFELFERKLELHQGHLVKAAVELAKDWRTDRMLRKLEALLAVADEN
                     ASLIITGNGDVVQPENDLIAIGSGGPYAQAAARALLENTELGARDIVEKSLGIAGDIC
                     IYTNQFHTIEELASKA"
     gene            complement(194798..195571)
                     /locus_tag="PC1_RS00810"
                     /old_locus_tag="PC1_0167"
     CDS             complement(194798..195571)
                     /locus_tag="PC1_RS00810"
                     /old_locus_tag="PC1_0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsN"
                     /protein_id="WP_012772904.1"
                     /db_xref="GI:502365500"
                     /translation="MIALAVAVLVTFAGGLYFIAHNKPDESPVLPHQNVGKGNGLPPK
                     PEERWRYIKELENRQLGVTTPTEPSAGGEIRSPVQLTDEQRQLLEQMQSDMRRQPTQL
                     SEVPYNDQTQVPRSQVTIKPSTQPMQQPPVVTTQPATRAPAVTQTTPVVPRQETPRQE
                     TPKQEAPKQQPVKQPEAPKAEKTQRWAIQCGSFKTMDPAESVRAQLAFAGIESRITSN
                     GGWNRIMLGPYNNRAAADSMIQRLKSAGASNCIPLASGG"
     gene            complement(195887..196930)
                     /locus_tag="PC1_RS00815"
                     /old_locus_tag="PC1_0168"
     CDS             complement(195887..196930)
                     /locus_tag="PC1_RS00815"
                     /old_locus_tag="PC1_0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011095728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012772905.1"
                     /db_xref="GI:502365502"
                     /translation="MKQKKGVTTATMKDVADEAGVSTATVSRTLMNPEKVSATTRRKV
                     EQAVIAVGYSPHALNRNLKRNESRTILTIVPDICDPYFSEIFRGIEETAAEHGYLVLI
                     GDCAHQHQKEKTFVDLIITKQIDGMLLLGSNLPFDAGQEEQRNLPPMVMANEFSPDLA
                     LPTVHIDNLTAAFEAVHYLYQAGHQRIACIAGPEHMHLSQYRLQGYIQALRRNGILID
                     NQYIFRGDFTYETGINGLIALMQHPQPPSAVFCHSDLMALGVLAQARKMGLDIPRDLS
                     VIGFDDIEQAQYCWPPLTSVAQPRYQIGREAMLLLLEQLQGNTVQSGSRLLSSELVIR
                     DSVAAPNFARNRL"
     gene            complement(197207..199405)
                     /locus_tag="PC1_RS00820"
                     /old_locus_tag="PC1_0169"
     CDS             complement(197207..199405)
                     /locus_tag="PC1_RS00820"
                     /old_locus_tag="PC1_0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772906.1"
                     /note="binding of PriA to forked DNA starts the assembly
                     of the primosome, also possesses 3'-5' helicase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primosome assembly protein PriA"
                     /protein_id="WP_012772906.1"
                     /db_xref="GI:502365506"
                     /translation="MSVAQVALPVPLARTFDYLLPAGGIAPQVGARVSVSFGNRKAIG
                     IITALSDTSELPLEQLKPVHDVLDEQPLFPPSLWRILLWAVEYYHYPIGEVLFHALPI
                     LLRQGKPAHRAPLWQWFATEQGRATPLSTLKRAVKQQQALAALLQSPIYRHQVSEIGL
                     TETALQALRSKGLCELQAAEQTLHDWRQNFSLSTDRLRLNTEQATAVGAIRSEDNHFA
                     AWLLAGITGSGKTEVYLSVLENVLAQGKQALVLVPEIGLTPQTIARFRERFNAPVDVL
                     HSALNDSERLAVWLRARSGEAAIVIGTRSALFTPFARLGLIVIDEEHDSSYKQQEGWR
                     YHARDLAVFRAREEDIPIVMGTATPALETLYNVQIGKYRRLNLTKRAGNAALAKQHVI
                     DLKGLPLTAGLSQPLITRIRHHLTNDNQVILFLNRRGFSPVVMCHECGWIAECQRCDH
                     YYTYHQHQKMLRCHHCDSQRPVPQQCPSCGSTNMVPVGLGTEQLEQSLAPIFPNVPIT
                     RIDRDTTSRKGALEQQLSQVRQGGARLLIGTQMLAKGHHFPDVTLVALLDVDGSLFSA
                     DFRAAERFAQLYTQVAGRAGRAGKAGEVALQTHHPEHPLLQTLLQQGYDAFASQALTE
                     RKSVFLPPFTSHILFRADDHDNQQAALFLQQLRNLLEASPLRDESLWLLGPVPALQPK
                     RAGRFRWQLLLQHPSRALLQKLVRTSMALIGTLPQARKVKWMLDVDPTDS"
     gene            199720..199935
                     /gene="rpmE"
                     /locus_tag="PC1_RS00825"
                     /old_locus_tag="PC1_0170"
     CDS             199720..199935
                     /gene="rpmE"
                     /locus_tag="PC1_RS00825"
                     /old_locus_tag="PC1_0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772907.1"
                     /note="RpmE; there appears to be two types of ribosomal
                     proteins L31 in bacterial genomes; some contain a CxxC
                     motif while others do not; Bacillus subtilis has both
                     types; the proteins in this cluster have the CXXC motif;
                     RpmE is found in exponentially growing Bacilli while YtiA
                     was found after exponential growth; expression of ytiA is
                     controlled by a zinc-specific transcriptional repressor;
                     RpmE contains one zinc ion and a CxxC motif is responsible
                     for this binding; forms an RNP particle along with
                     proteins L5, L18, and L25 and 5S rRNA; found crosslinked
                     to L2 and L25 and EF-G; may be near the
                     peptidyltransferase site of the 50S ribosome; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="WP_012772907.1"
                     /db_xref="GI:502365509"
                     /translation="MKKGIHPNYSAVTVTCSCGNVIKTHSTVGRDLNLDVCGECHPFY
                     TGKQRDVATGGRVDRFNKRFSVPGTKK"
     gene            complement(200062..200472)
                     /locus_tag="PC1_RS00830"
                     /old_locus_tag="PC1_0171"
     CDS             complement(200062..200472)
                     /locus_tag="PC1_RS00830"
                     /old_locus_tag="PC1_0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772908.1"
                     /db_xref="GI:502365512"
                     /translation="MFYPIAIEAGDDTHAYGVTVPDLPGCFSAGDTLDDAITNAKEAI
                     TGHIELLVEMGQDIPTVSTVGQLAKRSEYAGYTWAVVDIDVTRLMGGSEKINVTLPKS
                     LIDRIDRCVASNPEFKSRSGFLAQAALERISSSR"
     gene            complement(200500..200679)
                     /locus_tag="PC1_RS00835"
                     /old_locus_tag="PC1_0172"
     CDS             complement(200500..200679)
                     /locus_tag="PC1_RS00835"
                     /old_locus_tag="PC1_0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010281507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010281507.1"
                     /db_xref="GI:497967351"
                     /translation="MDSRTLIAEIKADGWELIRVNGSHHHFMHPSKPGLVTIPHPKKD
                     LPIGTVKSIRKQAGI"
     gene            complement(200777..201787)
                     /locus_tag="PC1_RS00840"
                     /old_locus_tag="PC1_0173"
     CDS             complement(200777..201787)
                     /locus_tag="PC1_RS00840"
                     /old_locus_tag="PC1_0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012772909.1"
                     /db_xref="GI:502365515"
                     /translation="MSPTSSRYAATFVVALLILAGLMLVNIATGSTTIPLTQVASVLG
                     LSSADVSPMASRIILELRIPRSLLAALCGAGLAMVGAFLQTATRNDLADPFLFGLSAG
                     ASAGAVAVITRFGEQLGDWALPMAAFCGGILSAVAVTVLFLLQQARGAERLIICGLAI
                     SFLFGALTNYLVFSGDQRAASSILFWSLGGLGLARWDTLPFAVFSVLLLFGLTALRWR
                     ALDALLAGGQTAASMGVNLSRVRVEIFICCAFATSLLVALTGVIGFIGLMIPHLARPL
                     SGVLHKRLLPMTAVLGAILLCGGDWLSRQLLAPQELPIGIITAGLGGVFVLGMLVKRQ
                     QG"
     gene            complement(201784..202746)
                     /locus_tag="PC1_RS00845"
                     /old_locus_tag="PC1_0174"
     CDS             complement(201784..202746)
                     /locus_tag="PC1_RS00845"
                     /old_locus_tag="PC1_0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012772910.1"
                     /db_xref="GI:502365518"
                     /translation="MKITLLSGLLALTSCWAHASDFPVTVDSCGQPLTFTQPPQRAVI
                     HDLNMTEMAFALGLQKSIVGLTGITGWYKAPPDFIKQQGTIPELAAKYPTLENLLAVH
                     PDFFFAGWNYGMKVGGEVTPQALKKYGIQTLVLSESCVFTEPQQQRPRASMDLLYGDM
                     LKLGKIFGKQELAQKQIDDWKQHIATLQTRIGDRPKQTVFLYDSGDDKPFTSGKFAMP
                     TAIIEAAGGKNVMDDMATSWASTSWENVAAREPDFIILLDYQTGNGADALRRFLESHP
                     LMKFTPAVQQHRYLKLQYAELTPGPANIAAVDKLAHALYPDAFK"
     gene            complement(202756..203553)
                     /locus_tag="PC1_RS00850"
                     /old_locus_tag="PC1_0175"
     CDS             complement(202756..203553)
                     /locus_tag="PC1_RS00850"
                     /old_locus_tag="PC1_0175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010299273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter-like protein"
                     /protein_id="WP_012772911.1"
                     /db_xref="GI:502365521"
                     /translation="MTEPLSTRPVLLQLHHVSVADANRAPRLSDISLSMQAGERLALI
                     GPNGSGKSTLLRVLTSELGTTTGYIHLNGQPLNSLSRHERAKRIAILAQNDTPDLRLR
                     VAEYVALGRIPHHGFSTPAYDRQLIEEALDDTGLLPLRHRLLGTLSGGERQRAALARA
                     FAQTPQLLLLDEPTNHLDPLARAQLLSLVRKRGISTLAVLHDLPLITPFADRVAVLQQ
                     GILLRWGTPAHALSADCVKSVFGMESFTVSHPINGSPIRIFEAPELH"
     gene            complement(203769..204086)
                     /locus_tag="PC1_RS00855"
                     /old_locus_tag="PC1_0176"
     CDS             complement(203769..204086)
                     /locus_tag="PC1_RS00855"
                     /old_locus_tag="PC1_0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004096927.1"
                     /note="when combined with S-adenosylmethionine represses
                     the expression of the methionine regulon and of proteins
                     involved in S-adenosylmethionine synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="met repressor"
                     /protein_id="WP_005973355.1"
                     /db_xref="GI:492814162"
                     /translation="MAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRR
                     QVNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKIIMREMGIDPDT
                     WEY"
     gene            204274..205434
                     /locus_tag="PC1_RS00860"
                     /old_locus_tag="PC1_0177"
     CDS             204274..205434
                     /locus_tag="PC1_RS00860"
                     /old_locus_tag="PC1_0177"
                     /EC_number="2.5.1.48"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019846445.1"
                     /note="catalyzes the formation of cystathionine from
                     L-cysteine and O-succinyl-L-homoserine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="WP_012772912.1"
                     /db_xref="GI:502365528"
                     /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNQPRAH
                     DYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAIMLVCTVFLRPGDLLVAPHDCYG
                     GSYRLFDSLNKRGAFRVKFVDQSDTAALNAALAEKPKLVLVESPSNPLLRVVDIAAIC
                     QAAREAGAVSVVDNTFLSPALQKPLELGADLVVHSCTKYLNGHSDVVAGAVIAKDADT
                     ITELAWWANNIGVTGAAFDSYLLLRGLRTLAPRMAAAQRNAQQIVEFLQTQPLVKALY
                     HPSLPNNPGHDIARRQQSGFGAMLSFELDGDEDTLRRFLASLELFTLAESLGGVESLI
                     SHAATMTHAGMAPEARAAAGISETLLRISTGIEDGDDLVADLDRAFQAAAKR"
     gene            205437..207872
                     /gene="metL"
                     /locus_tag="PC1_RS00865"
                     /old_locus_tag="PC1_0178"
                     /gene_synonym="metM"
     CDS             205437..207872
                     /gene="metL"
                     /locus_tag="PC1_RS00865"
                     /old_locus_tag="PC1_0178"
                     /gene_synonym="metM"
                     /EC_number="2.7.2.4"
                     /EC_number="1.1.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011095722.1"
                     /note="multifunctional homodimeric enzyme that catalyzes
                     the phosphorylation of aspartate to form
                     aspartyl-4-phosphate as well as conversion of aspartate
                     semialdehyde to homoserine; functions in a number of amino
                     acid biosynthetic pathways; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aspartate kinase II/homoserine
                     dehydrogenase II"
                     /protein_id="WP_012772913.1"
                     /db_xref="GI:502365532"
                     /translation="MSALGVAPSVTGRQLHKFGGSSLADVKCYLRVAGIMAEYSHPGD
                     LMVVSAAGSTTNQLISWLKLSQSDRLSAHQVQQALRRYHSELIAGLLPAQTAETLTAQ
                     FIRDLERLATLLDGKITDAVYAEVVGHGEIWSARLMSAVLNQLDMNAAWLDARDFLCA
                     ERAAQPQVDEGRSWPLLQQYLTQHAGQRLVVTGFICRNNAGETVLLGRNGSDYSATQI
                     GALAGVERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQP
                     VSGSDIDLQLRCSYQPEQGSTRIERVLASGTGAKIVTSHDDVCLIEVQVPSEHDFVLL
                     QKEVEQLLNRAQLKPLAIGVHQDRNLLQLCYTSEVVESALQLLSQAALPVELNQRDGL
                     AMVAMVGAGVGKNPLHSHRFYQQLKDQPIEFVRQADDGISLVAVLRVGPTEHLIRGLH
                     HSLFRAEKRIGLVLFGKGNIGSRWLELFAREQSNLSARTGFEFVLAGVVDSTRSLLNY
                     DGLDASRALAFFESEAQERDGEDLFLWMRAHPFDDLVVLDVTASDSVADLYLDFASYG
                     FHVISANKLAGASGGNNYRQIRDAFAKTDRHWLYNATVGAGLPVNFAVRDLRESGDSI
                     LAISGIFSGTLSWLFLQFDGTVPFTELVDQACQQGLTEPDPRVDLSGQDVMRKLVILA
                     REAGYDIEPSQVRVESLVPSGCEQGSVDYFFENGDSLNDQMLRRLEAAQEMGLVLRHV
                     ARFDSNGKARVGVEAVRPDHPLASLLPGDNVFAIESRWYRDNPLVIRGPGAGRDVTAG
                     ALQSDLNRLAQLL"
     gene            208361..209527
                     /locus_tag="PC1_RS00870"
                     /old_locus_tag="PC1_0179"
     CDS             208361..209527
                     /locus_tag="PC1_RS00870"
                     /old_locus_tag="PC1_0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine/spermidine ABC transporter ATPase"
                     /protein_id="WP_012772914.1"
                     /db_xref="GI:502365535"
                     /translation="MQKTTSSAAAPHIVIDHLHVGYGTTAVLNDIHLEIAQGEFVALL
                     GSSGCGKTTLLRTVAGFSSPRSGTIRVNGQDMTQAPPEKRGMALVFQSYALWPHMTVA
                     QHIAYGLRLRRVPRAEIASRVAELETMLGLTGLSARKPAELSGGQRQRVALGRALAVR
                     PDILLLDEPLSNLDARIRLQLRDEIRALQQRLGLTAIHVTHDREEAMVMADRIVILNQ
                     GRIMQAGSPQEVYHHPASSFVAAFMGAENRLVLDARYDGDTLMISGDAESHSLVPANT
                     SLPPGPIEARFRAEAACLYDAADAPLIQPGMLMRYGTVQAQSYPGGYWLHTISSGTWR
                     IQVHATHPYAIGQRVAVQIPAEALFLFPLAHETTSLSAVPDTTSRYSPLPGLTA"
     gene            209550..210683
                     /locus_tag="PC1_RS00875"
                     /old_locus_tag="PC1_0180"
     CDS             209550..210683
                     /locus_tag="PC1_RS00875"
                     /old_locus_tag="PC1_0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012772915.1"
                     /db_xref="GI:502365537"
                     /translation="MKRIFAATLMLSTPLAAVQAQELTVLTAGDQNMVDYVNEYLGPL
                     FEKQHPGVKVRAVGTGPGDAGSQKILERFNAQQAAGAKVWDTDVAVVHEKFVGPMVQK
                     GDLLKYRDDIASGKLVSMAAADKAMGTDVKGYVMPMFSSQTALAYNPDMVANPPKSYD
                     EIQQWAAANPKMFGYNGIKGGASGVSFVMGWIYAYGGDAQKLMNGPFDEAEAKKWQPA
                     FERLKAFNKNVTLTPGNAGTLDMLSRGEIAMGPVWVDMFYSWKASGQLPDNFKLLLPA
                     PGMPGQPMHYVIPAQAPNRELAKQFVELATSAKVQAEGIVERFNWYPGIDAKYVQAEL
                     KPAVWQRLFTDVTPDELANKGKTFPIAPYHTAILNAYEQAMAK"
     gene            210756..211595
                     /locus_tag="PC1_RS00880"
                     /old_locus_tag="PC1_0181"
     CDS             210756..211595
                     /locus_tag="PC1_RS00880"
                     /old_locus_tag="PC1_0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014916987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012772916.1"
                     /db_xref="GI:502365540"
                     /translation="MLQVSQFSSRLAGIALVLPALAVVAICFITPLGLSVGGAFVSQN
                     GVGIDNFVTALTLYLPDILFTLLIVSLATLLIGLLSVMIGGYLTLGESPRMVALLRWV
                     YRWPLFIPFIVTGQILRTFLAKNGWLNGALDTLGIVDMASASNWLDWRGIVFAFVWKQ
                     TPFVALLVAGAMASLDRTMIESARNLGASRLRILCEIVVPQIGQTLLTGLILSFVTMM
                     SVLSVPMMINAQSPTMLTANIAFRINAYGDYGVANALGVISLLMTGLFAVIYLRLNMR
                     DKA"
     gene            211592..212398
                     /locus_tag="PC1_RS00885"
                     /old_locus_tag="PC1_0182"
     CDS             211592..212398
                     /locus_tag="PC1_RS00885"
                     /old_locus_tag="PC1_0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter permease"
                     /protein_id="WP_012772917.1"
                     /db_xref="GI:502365543"
                     /translation="MKNVLWWIPRMLILGTLIFLIFGPLANLLLWSVAEKWFYPHLLP
                     NDWGFAFWKRVFSPRGVAWEALGNSVLVAVFTVLASLSLAIPAGYALARLPLPARGLI
                     LLIFLIPQAFPNLTVYVNIARLFYQWGLNGTLLGVVLVHTVHGLVFAVWIASAAFSAV
                     GREMEQAARSIGAGPWRAFVDITLPLAMPGLMASAIFVFLESLDEFTGSYFVGAPDVQ
                     MMPLLLYTAGAGGNYQIASITALVLLIPSVLFMLVVERFLKADVMARIGK"
     gene            212395..213399
                     /locus_tag="PC1_RS00890"
                     /old_locus_tag="PC1_0183"
     CDS             212395..213399
                     /locus_tag="PC1_RS00890"
                     /old_locus_tag="PC1_0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010299250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012772918.1"
                     /db_xref="GI:502365546"
                     /translation="MTVGKQGYVSAQDVARRAGVSRSAVSRSFTPGASVSAATYAKVM
                     TAAQELGYQVNDLARGLLANSSRLVGLVVTQPEVGFRANLVAELSQALIQRGSIPVLI
                     NTGHVREAMAAARSILFGHRAEATIVLSGSPPKEFVELAQLNGQPLIVIGRHEPACDS
                     VHIDNDSAARMAARLFASSGRTRLALAGAASATPNIIEREQAFCDEAQALGLPVAVVR
                     GGDTDYDDGLVVGQTLFSLPEAVRPDAVFCVNDLVAFGVIDRAKQFGLAVPQDLMVIG
                     FDDIPAAGWDAYALTTFRQDPATMAAQALALLDRRQSQVQEPACRAKVAAPLIRRQSA
                     "
     gene            213447..214208
                     /locus_tag="PC1_RS00895"
                     /old_locus_tag="PC1_0184"
     CDS             213447..214208
                     /locus_tag="PC1_RS00895"
                     /old_locus_tag="PC1_0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010299247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphatase"
                     /protein_id="WP_012772919.1"
                     /db_xref="GI:502365554"
                     /translation="MKLIQLSDLHLTAQGGNLHGRDPEQQLKAAIADINAHHRDTDLV
                     VISGDLSDDGSAASYTFLASVLAELQVPWRVTMGNHDDREMFLAQFPTLVDENGFVQS
                     VTTVGDDCVILLDSLHAGEVAGTLCSERLTWFARQLQAAEGKNVFLFLHHPPMSIGLP
                     ALDSVRLAPEAAEALYQVCHRFGNVRHISAGHVHRPASGGWRGISFSTIRGTNHQSAL
                     RFAPGFEVSLEAPQYAIFLTTEEGHTVHFHDFPGG"
     gene            214712..215608
                     /gene="metF"
                     /locus_tag="PC1_RS00900"
                     /old_locus_tag="PC1_0185"
     CDS             214712..215608
                     /gene="metF"
                     /locus_tag="PC1_RS00900"
                     /old_locus_tag="PC1_0185"
                     /EC_number="1.5.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P71319.1"
                     /note="MTHFR; catalyzes NADH-linked reduction of
                     5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate
                     using FAD as a cofactor; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="WP_012772920.1"
                     /db_xref="GI:502365557"
                     /translation="MSFFHANQREALNQSLAELQGRINVSFEFFPPRTSDMEETLWNS
                     IDRLSNLKPKFVSVTYGANSGERDRTHSIIKTIKERTGLEAAPHLTCIDASREQLREI
                     AQDYWQSGIRHIVALRGDLPPEGGKPDMYAADLVSLLKEVGDFDISVAAYPEVHPEAK
                     SAQADLINLKHKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFK
                     QLQKFATMTNVRVPNWMTAMFDGLDNDPETRKMVGASIAMDMVKILSREGVKDFHFYT
                     LNRAELSYAICHTLGVRPDVAR"
     gene            216089..216997
                     /locus_tag="PC1_RS00905"
                     /old_locus_tag="PC1_0187"
     CDS             216089..216997
                     /locus_tag="PC1_RS00905"
                     /old_locus_tag="PC1_0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973368.1"
                     /note="Activates the expression of a regulon of hydrogen
                     peroxide-inducible genes such as katG, gor, ahpC, ahpF,
                     oxyS, dps, fur and grxA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012772921.1"
                     /db_xref="GI:502365560"
                     /translation="MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELG
                     VMLLERTSRKVLFTQAGLLLVEQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVG
                     PYLLPQIIPMLHRTFPKLEMYLHEAQTHQLLAQLDSGKLDCAILAMVKESEAFIEVPL
                     FDEPMKLAIYQDHPWANRERVAMSDLAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTH
                     FRATSLETLRNMVAAGSGITLLPSLSVPHERERDGVCYLPCYKPEPKRTIALVYRPGS
                     PLRGRYEQLADTIREHMQGYMENLSK"
     gene            complement(216989..218395)
                     /locus_tag="PC1_RS00910"
                     /old_locus_tag="PC1_0188"
     CDS             complement(216989..218395)
                     /locus_tag="PC1_RS00910"
                     /old_locus_tag="PC1_0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010308160.1"
                     /note="catalyzes the conversion of NADPH to NADH; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="soluble pyridine nucleotide transhydrogenase"
                     /protein_id="WP_012772922.1"
                     /db_xref="GI:502365563"
                     /translation="MTLEHQFDYDAIVIGSGPGGEGAAMGLAKHGAKIAVIERHYNVG
                     GGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNSRIIRSSFSDILRHADSVIGQQTRM
                     RQGFYERNQCELFSGEASFIDAHTIAVHYPDNTHETLTAANIIIATGSRPYHPAEVDF
                     NHPRIYDSDSILQLDHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLD
                     QEMSDALSYHFWNNGVVIRHNEEFESIEGLSDGVIVNLKSGKKMKADCLLYANGRTGN
                     TETLGLENIGLSTDSRGQLKVNSMYQTALAHIYAIGDVIGYPSLASAAYDQGRLAAQA
                     IIKGDASAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVG
                     MNVGSLKILFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYP
                     TMAEAYRVAALNGLNRLF"
     gene            218607..219236
                     /locus_tag="PC1_RS00915"
                     /old_locus_tag="PC1_0189"
     CDS             218607..219236
                     /locus_tag="PC1_RS00915"
                     /old_locus_tag="PC1_0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014916981.1"
                     /note="negatively controls the expression of fabA and
                     fabB, genes involved in the unsaturated fatty acid
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_010308157.1"
                     /db_xref="GI:497994001"
                     /translation="MGVRAQQKERTRRSLIEAAFSQLSAERSFASLSLREVAREAGIA
                     PTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKTGSVIRTSVSTFMEFIGNN
                     PNAFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLEVENHIPRSFAEAQSEAMVTI
                     VFSAGAEALDVSLEQRKQLEERLVLQLRMIAKGAYYWYRKEHDSSFTVP"
     gene            219272..219658
                     /locus_tag="PC1_RS00920"
                     /old_locus_tag="PC1_0190"
     CDS             219272..219658
                     /locus_tag="PC1_RS00920"
                     /old_locus_tag="PC1_0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010281483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012772923.1"
                     /db_xref="GI:502365574"
                     /translation="MTEKPHQEKGTLVLALIAGLSVNGAFAALFSSIVPFSIFPLIAL
                     VLSVYCLHQRYLHHSMPEGIPMLAAASFLLGLLIYSAIVRVEYPAIGSNFIPSILCVV
                     LVFWIGLKLRRRKGSDSVSAEESETL"
     gene            complement(219699..220802)
                     /locus_tag="PC1_RS00925"
                     /old_locus_tag="PC1_0191"
     CDS             complement(219699..220802)
                     /locus_tag="PC1_RS00925"
                     /old_locus_tag="PC1_0191"
                     /EC_number="2.1.1.35"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010308150.1"
                     /note="catalyzes the formation of 5-methyl-uridine at
                     position 54 in all tRNAs; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA/tmRNA (uracil-C(5))-methyltransferase"
                     /protein_id="WP_012772924.1"
                     /db_xref="GI:502365576"
                     /translation="MTPEILPIEQYDDQLAEKTERLRGMMAPFNAPEPVVFRSPVSHY
                     RMRAEFRIWHEGDELYHIMFDQQTKQRIRVDRFPAASELINRLMPELLAAIQPDSVLR
                     RKLFQIDYLSTLSGEVIVSLLYHRALDEEWQEHARALRDSLTAQGFRLQLIGRATKTK
                     ICLDRDYVDECLPVAGRDMIYRQVENSFTQPNAAINIQMLEWALDATAGSTGDLLELY
                     CGNGNFSLALARNFERVLATEIAKPSVAAAQYNIAANQIENVQIIRMAAEEFTQAMQG
                     VRQFNRLQGIDLTSYQCETIFVDPPRSGLDDETVKLVQAYPRILYISCNPETLSHNLQ
                     TLSETHDIRRLALFDQFPYTHHMECGVLLEKRQ"
     misc_binding    220932..221165
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            221231..223126
                     /gene="btuB"
                     /locus_tag="PC1_RS00930"
                     /old_locus_tag="PC1_0192"
     CDS             221231..223126
                     /gene="btuB"
                     /locus_tag="PC1_RS00930"
                     /old_locus_tag="PC1_0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822023.1"
                     /note="involved in the active translocation of vitamin B12
                     (cyanocobalamin) across the outer membrane to the
                     periplasmic space; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="vitamin B12/cobalamin outer membrane
                     transporter"
                     /protein_id="WP_012772925.1"
                     /db_xref="GI:502365593"
                     /translation="MIKKISLLTALSVTAFSGWAQENQNSSSEKNADDMVVTANRFAQ
                     PVSSVLAPIDVVTRDDINRWQAKNVLEVMRRLPGVNIAQTGGVGQSASMYIRGSEARH
                     TLVLIDGVPIAKYGITGNPDFNLIPIALVQRIEFMRGPRSAVYGADAIGGVINIITQT
                     TENKTVLSTGIGSNRYQEYSGSLHQSVGDNTRVSLAGAYQDSRGFNVYPNSSNQALDS
                     DKDGWRNKTFWAGVEHQFNDSISGFFRGYGYGTNSDYDALSDDTYGPINDEQQVYNHT
                     YSGGLRFSHENYASQLIASYQKYTSIQYLSTQGRYGAYNSQDDIDQYDMLWGNTLALS
                     HGMVSAGVDWRRQKLTSEGVSFNTLNRESNRYKQDNSGAYLTAQQQYGAVILEGSVRG
                     DDNEKFGRHGTWQLASGWEFFPDYRVTLSYATGFQAPTLGQLYGQKRFDIESNENLKP
                     EESKQWEAGLEGVTGPLSWRLSGYINKIDNLIAYEYAFATNTGTYYNVDAATMKGLEW
                     TGSFETGVLNHQVTLDYLDARNDENDKVLARRAKQQAKYQVDWNLYDVDFNLSYQYVG
                     KRFDNAANTRRLPSYSTVDLAASYPVTSHLTVRGRIANLFDKDYETAYGYRTAGREYY
                     LTGSYTF"
     gene            223071..223928
                     /locus_tag="PC1_RS00935"
                     /old_locus_tag="PC1_0193"
     CDS             223071..223928
                     /locus_tag="PC1_RS00935"
                     /old_locus_tag="PC1_0193"
                     /EC_number="5.1.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010308144.1"
                     /note="converts L-glutamate to D-glutamate, a component of
                     peptidoglycan; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="WP_012772926.1"
                     /db_xref="GI:502365596"
                     /translation="MATARQGENTISPEAIPSNLPSRPTVLVFDSGVGGLSVYDEIRQ
                     LLPDLHYIYAFDNEAFPYGEKSQQFIIERVVEIVNAVQLRHQLALVVIACNTASTISL
                     PALRERFTFPVVGVVPAVKPAAKLTRNGVVGLLATRATVQRPYTHELIARFATDCQIL
                     SLGSSELVELAEAKLQGETISISELQKILRPWLRLPEPPDTVVLGCTHFPLLAEELKA
                     ALPDGTRLVDSGAAIARRTAWLIANLDNPPLSTDKNLVYCLAITPKVATLWPILQRYG
                     FDSLEKLPL"
     gene            224306..225858
                     /locus_tag="PC1_RS00940"
                     /old_locus_tag="PC1_R0001"
     rRNA            224306..225858
                     /locus_tag="PC1_RS00940"
                     /old_locus_tag="PC1_R0001"
                     /product="16S ribosomal RNA"
     gene            225938..226013
                     /locus_tag="PC1_RS00945"
                     /old_locus_tag="PC1_R0002"
     tRNA            225938..226013
                     /locus_tag="PC1_RS00945"
                     /old_locus_tag="PC1_R0002"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:225972..225974,aa:Glu,seq:ttc)
     gene            226264..229198
                     /locus_tag="PC1_RS00950"
                     /old_locus_tag="PC1_R0003"
     rRNA            226264..229198
                     /locus_tag="PC1_RS00950"
                     /old_locus_tag="PC1_R0003"
                     /product="23S ribosomal RNA"
     gene            229307..229422
                     /locus_tag="PC1_RS00955"
                     /old_locus_tag="PC1_R0004"
     rRNA            229307..229422
                     /locus_tag="PC1_RS00955"
                     /old_locus_tag="PC1_R0004"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            229579..230616
                     /gene="murB"
                     /locus_tag="PC1_RS00960"
                     /old_locus_tag="PC1_0194"
     CDS             229579..230616
                     /gene="murB"
                     /locus_tag="PC1_RS00960"
                     /old_locus_tag="PC1_0194"
                     /EC_number="1.1.1.158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010287071.1"
                     /note="catalyzes the reduction of UDP-N-acetylglucosamine
                     enolpyruvate to form UDP-N-acetylmuramate in peptidoglycan
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="WP_012772927.1"
                     /db_xref="GI:502365599"
                     /translation="MASSIISLKSYNSFSLPVSASCIKVADTQEKLIEGWRVASASQE
                     PILLLGEGSNVLFLEDFLGTILLNRLKGIDIREEGDGWYIHVGAGENWHQLVEYTLKC
                     GIAGLENLALIPGCVGSAPIQNIGAYGIELQHVCDYVDVLDLAEGDVMRFTSEECQFD
                     YRESIFKHQYRSGFAITAVGLFLKKEWSPILNYGDLVKLDPTTVTPQQIFDSVCHMRR
                     SKLPDPAVTGNAGSFFKNPIITQQHAERVLREYPNAPQYLQTDGNVKLAAGWLIDQCE
                     LKGFQLGGAAVHEKQALVLINKNNAKSSDVVELARYVRSQVAEKFSIELEPEVRFIAA
                     HGEVNAIEVLS"
     gene            230613..231572
                     /locus_tag="PC1_RS00965"
                     /old_locus_tag="PC1_0195"
     CDS             230613..231572
                     /locus_tag="PC1_RS00965"
                     /old_locus_tag="PC1_0195"
                     /EC_number="6.3.4.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010287073.1"
                     /note="catalyzes the formation of biotinyl-5'-AMP, also
                     acts as a transcriptional repressor of the biotin operon;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional biotin--[acetyl-CoA-carboxylase]
                     synthetase/biotin operon repressor"
                     /protein_id="WP_012772928.1"
                     /db_xref="GI:502365603"
                     /translation="MKDTTVPLKLIKILSDGEFYSGELLGEMMGMSRAAINKHIQTIR
                     DWGIDVFTVTGKGYSLPAPMQLLDEEVILKHLPEGGVTVLPVVDSTNQYILDRLDILS
                     SGDACLAEYQQSGRGRRGRQWFSPFGANLYLSLYWRLEQGPAAAVGVSLVIGIVMAEV
                     LHKLGADGVRVKWPNDLYLKDRKLAGILVELTGKTGDAANLVIGAGINLQMREPAPDT
                     ISQGWINLQEAGIDINRNTLASTLISELRGALAIFELQGLEPFIPRWEKLDNYFNRPV
                     RLIIGNREIYGIDRGIDRQGALLLENDGLVTPYIGGEISLRGA"
     gene            complement(231614..232564)
                     /locus_tag="PC1_RS00970"
                     /old_locus_tag="PC1_0196"
     CDS             complement(231614..232564)
                     /locus_tag="PC1_RS00970"
                     /old_locus_tag="PC1_0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DHQ6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="WP_012772929.1"
                     /db_xref="GI:502365606"
                     /translation="MSNREQSLATPYLQFNRSQWAALRDSVPLTLTEEEIVKLKGINE
                     DLSLDEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQKIPYIIGIAGSVAVGKS
                     TTARVLQALLSRWPEHRSVELITTDGFLHPNKVLKERDLMKKKGFPQSYDMHSLVKFV
                     SDIKSGTHKVTAPTYSHLTYDIVPNNNKVLEQPDILILEGLNVLQSGMDYPHDPHRVF
                     VSDFVDFSIYVDAPETLLQTWYINRFLKFRQGAFSNPNSYFHNYAKLTEEEAVGIASQ
                     LWKEINGLNLKENILPTRERASLIMTKSANHAVECVRLRK"
     gene            complement(232775..233323)
                     /locus_tag="PC1_RS00975"
                     /old_locus_tag="PC1_0197"
     CDS             complement(232775..233323)
                     /locus_tag="PC1_RS00975"
                     /old_locus_tag="PC1_0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_012772930.1"
                     /db_xref="GI:502365609"
                     /translation="MKTVQLNAATLPVYREELANLLIDAVEKGASVGYQSPLHHKEAI
                     EYFHSLQISVANGERILWVARDEEGIIGSVQLELCQKPNGRNRAEIQKLLVHSRARRT
                     GIGRQLIHLLEKHALFQQRGLLYLDTQAGSPAEAFYRALGYRHLGELPDYACTPDGYY
                     HPTAIYYKRLFAVNGLGKAIAS"
     gene            233656..233731
                     /locus_tag="PC1_RS00980"
                     /old_locus_tag="PC1_R0005"
     tRNA            233656..233731
                     /locus_tag="PC1_RS00980"
                     /old_locus_tag="PC1_R0005"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:233689..233691,aa:Thr,seq:tgt)
     gene            233749..233833
                     /locus_tag="PC1_RS00985"
                     /old_locus_tag="PC1_R0006"
     tRNA            233749..233833
                     /locus_tag="PC1_RS00985"
                     /old_locus_tag="PC1_R0006"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:233783..233785,aa:Tyr,seq:gta)
     gene            233963..234037
                     /locus_tag="PC1_RS00990"
                     /old_locus_tag="PC1_R0007"
     tRNA            233963..234037
                     /locus_tag="PC1_RS00990"
                     /old_locus_tag="PC1_R0007"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:233996..233998,aa:Gly,seq:tcc)
     gene            234044..234119
                     /locus_tag="PC1_RS00995"
                     /old_locus_tag="PC1_R0008"
     tRNA            234044..234119
                     /locus_tag="PC1_RS00995"
                     /old_locus_tag="PC1_R0008"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:234077..234079,aa:Thr,seq:ggt)
     gene            234227..235411
                     /gene="tuf"
                     /locus_tag="PC1_RS01000"
                     /old_locus_tag="PC1_0198"
     CDS             234227..235411
                     /gene="tuf"
                     /locus_tag="PC1_RS01000"
                     /old_locus_tag="PC1_0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4W5A0.1"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_012772931.1"
                     /db_xref="GI:502365611"
                     /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNA
                     RAFDQIDNAPEEKARGITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQ
                     YDFPGDDTPVVRGSALKALEGEAEWEAKIIELAEHLDSYIPEPERAIDKPFLLPIEDV
                     FSISGRGTVVTGRVERGIVKVGEEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVG
                     VLLRGIKREEIERGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKV
                     IA"
     gene            235650..236033
                     /gene="secE"
                     /locus_tag="PC1_RS01005"
                     /old_locus_tag="PC1_0199"
     CDS             235650..236033
                     /gene="secE"
                     /locus_tag="PC1_RS01005"
                     /old_locus_tag="PC1_0199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007665874.1"
                     /note="forms a complex with SecY and SecG; SecYEG forms a
                     putative protein-conducting channel to which secA binds
                     and translocates targeted polypeptides across the
                     cytoplasmic membrane, a process driven by ATP and a
                     proton-motive force; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_010285488.1"
                     /db_xref="GI:497971332"
                     /translation="MSANTEAQDSGRGLEVIKWLVVGALLVVAIVGNYYYREFSLPLR
                     ALAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTA
                     VMSLILWGLDGILVRLVSFITGLRF"
     gene            236035..236580
                     /gene="nusG"
                     /locus_tag="PC1_RS01010"
                     /old_locus_tag="PC1_0200"
     CDS             236035..236580
                     /gene="nusG"
                     /locus_tag="PC1_RS01010"
                     /old_locus_tag="PC1_0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004953928.1"
                     /note="Modulates Rho-dependent transcription termination;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination factor
                     NusG"
                     /protein_id="WP_005970339.1"
                     /db_xref="GI:492807570"
                     /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHNMEELFGEVMV
                     PTEEVVEIRGGQRRKSERKFFPGYVLVQMVMEDASWHLVRSVPRVMGFIGGTSDRPAP
                     ISDKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKV
                     SVSIFGRATPVELDFAQVEKG"
     gene            236743..237171
                     /locus_tag="PC1_RS01015"
                     /old_locus_tag="PC1_0201"
     CDS             236743..237171
                     /locus_tag="PC1_RS01015"
                     /old_locus_tag="PC1_0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006121495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_012772932.1"
                     /db_xref="GI:502365625"
                     /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNA
                     KTESVEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVT
                     SAQVREIAETKAADMTGSDVDAMARSIAGTARSMGLVVED"
     gene            237175..237879
                     /locus_tag="PC1_RS01020"
                     /old_locus_tag="PC1_0202"
     CDS             237175..237879
                     /locus_tag="PC1_RS01020"
                     /old_locus_tag="PC1_0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_012772933.1"
                     /db_xref="GI:502365633"
                     /translation="MAKLTKRMRVIRDKVDVTKQYDINEAVALLKELATAKFVESVDV
                     AVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAEFVGMEDLAE
                     QIKKGEMGFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVNNAKAGQ
                     VRYRNDKNGIIHTTIGKVDFDSNKLKENLEALLVALKKAKPSQAKGVYIKKVSLSTTM
                     GAGVAVDQSGLNAAAN"
     gene            238196..238693
                     /gene="rplJ"
                     /locus_tag="PC1_RS01025"
                     /old_locus_tag="PC1_0203"
     CDS             238196..238693
                     /gene="rplJ"
                     /locus_tag="PC1_RS01025"
                     /old_locus_tag="PC1_0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016505810.1"
                     /note="binds the two ribosomal protein L7/L12 dimers and
                     anchors them to the large ribosomal subunit; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_012772934.1"
                     /db_xref="GI:502365636"
                     /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKA
                     GREAGVYMRVVRNTLLRRVVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKA
                     NAKFEVKAAAFEGELIPAAQIDRLATLPTYEEALARLMSTMKEAAAGKLVRTLAAVRD
                     AKEAA"
     gene            238760..239125
                     /gene="rplL"
                     /locus_tag="PC1_RS01030"
                     /old_locus_tag="PC1_0204"
     CDS             238760..239125
                     /gene="rplL"
                     /locus_tag="PC1_RS01030"
                     /old_locus_tag="PC1_0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005122872.1"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_012772935.1"
                     /db_xref="GI:502365639"
                     /translation="MSITKDQILEAVAAMSVMDVVELVSAMEEKFGVSAAAAVAVAAG
                     PAEVAEEKTEFDVVLKGIGANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVSKD
                     DAEALKKSLEEAGAEVEVK"
     gene            239453..243481
                     /gene="rpoB"
                     /locus_tag="PC1_RS01035"
                     /old_locus_tag="PC1_0205"
     CDS             239453..243481
                     /gene="rpoB"
                     /locus_tag="PC1_RS01035"
                     /old_locus_tag="PC1_0205"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005970328.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; beta subunit
                     is part of the catalytic core which binds with a sigma
                     factor to produce the holoenzyme; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_012772936.1"
                     /db_xref="GI:502365643"
                     /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPE
                     GQYGLEAAFRSVFPIKSYSGNSELQYVSYRLGEPVFDVKECQIRGVTFSAPLRVKLRL
                     VIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSD
                     KGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALGYSTE
                     QILDLFFDKIVYEINGNKLQMDLVPERLRGETASFDIEANGKVYIEKGRRITARHIRQ
                     LEKDGIERIEVPVEYIAGKVLSKDYIDESTGELIGAANMELSLDLLAKLSQSGHKRIE
                     TLFTNDLDHGAYMSETVRVDPSNDRLSALVEIYRMMRPGEPPTREAAETLFENLFFSE
                     DRYDLSAVGRMKFNRSLLRDEIEGSGILSKDDIIEVMKKLIDIRNGKGEVDDIDHLGN
                     RRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGS
                     SQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEG
                     PNIGLINSLSVYAQTNEYGFLETPYRRVRDNVVTDEIHYLSAIEEGNFVIAQANTNLD
                     EEGRFIDELVTCRNKGESSLFSRDQVEYMDVSTQQVVSVGASLIPFLEHDDANRALMG
                     ANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKRGGTVQYVDASRIVIRVNDDE
                     MYPGEAGIDIYNLTKYTRSNQNTCISQMPCVSLGEPVERGDVLADGPSTDLGELALGQ
                     NMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPN
                     VGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
                     DSSLRVPNGVSGTIIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLF
                     ARIHAVLVSGGVEADKLDKLPRERWLELGLTDEDKQNQLEQLAEQYDELKHEFEKKLE
                     AKRRKITQGDDLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYD
                     ENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGEKINAMLKQHEEVTKLREFIQ
                     RAYDLGDDVRQKVDLSTFSDEEVMRLAENLKKGMPIATPVFDGAKEKEIKELLQMGGI
                     PTSGQITLYDGRTGEKFERQVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGK
                     AQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
                     ESFNVLLKEIRSLGINIELEEE"
     gene            243588..247811
                     /locus_tag="PC1_RS01040"
                     /old_locus_tag="PC1_0206"
     CDS             243588..247811
                     /locus_tag="PC1_RS01040"
                     /old_locus_tag="PC1_0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577408.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates. Subunit beta'
                     binds to sigma factor allowing it to bind to the -10
                     region of the promoter; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_012772937.1"
                     /db_xref="GI:502365646"
                     /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERM
                     GHIELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQIL
                     TEEQYLDALEEFGDEFDAKMGAEAIQALLKNMDLEQECEQLREELTETNSETKRKKLT
                     KRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLAT
                     TIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTRDCVNAKGEGMVLTGPKEAERVYRAGLASLHARVKVRITEEIKSIEGDVTHQ
                     TSIIDTTIGRAILWMIVPKGLPYSIVNQPLGKKAISKMLNTCYRILGLKPTVIFADQT
                     MYTGFAYAARSGASVGIDDMVIPEKKAEIIEEAETEVAEIQEQFQSGLVTAGERYNKV
                     IDIWAAANERVAKAMMENLSVEDVVNRDGVVEQQVSFNSIFMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRERVLGRVTAEDVIKPGTADI
                     LVPRNTLLNEQWCDMLEENSVDAVKVRSVVSCETDFGVCANCYGRDLARGHIINKGEA
                     IGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSLKLSNAKFVVNSNGK
                     LVITSRNTELKLIDEFGRTKESYKVPYGAAMAKGDGAEVSGGETVANWDPHTMPVITE
                     VSGNIRFTDMIDGQTITRQTDELTGLSSIVVLDSAERTGSGKDLRPALKIVDDKGEDV
                     LIPGTDMPAQYFLPGKAIVQLEDGVKISSGDTLARIPQESGGTKDITGGLPRVADLFE
                     ARRPKEPAILAEISGIISFGKETKGKRRLVISPLDGSDAYEEMIPKWRQLNVFEGEVV
                     ERGDVVSDGPESPHDILRLRGVHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQMLR
                     KGTIVNAGSTEFLEGEQAEVSRIKIANRQLEADGKITATFSRDLLGITKASLATESFI
                     SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRQAGEA
                     PIVPQVSADEASANLAELLNAGFGSSDDE"
     STS             243698..244289
                     /locus_tag="PC1_RS01040"
                     /old_locus_tag="PC1_0206"
                     /standard_name="MARC_46213-46214:1107802028:1"
                     /db_xref="UniSTS:471646"
     gene            248141..249538
                     /locus_tag="PC1_RS01045"
                     /old_locus_tag="PC1_0207"
     CDS             248141..249538
                     /locus_tag="PC1_RS01045"
                     /old_locus_tag="PC1_0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate transporter"
                     /protein_id="WP_012772938.1"
                     /db_xref="GI:502365650"
                     /translation="MDTSTTPTLSQPGGSVLHQDDSISSDNALQTQSVSHSQNKAKRA
                     AWGSFVGAVVDWYDFLLYGIVAALVFNTEFFPQVSPTMGTLAAFGTFGVGFLFRPLGG
                     MVFGHFGDKLGRKRMLMITVWMMGISTALIGLLPSFDSIGWWAPVLLVMLRAIQGFAV
                     GGEWGGAALLAVESAPKKKKAFYSSGVQVGFGVGLLLATGSVSLVSNLTTNEEFITWG
                     WRLPFLFSLILVAIAWWVRNGMDESQEFEANKTLGERANKLRSFPIMEALRQHPKAFL
                     LIIALRLGELLTMYIVTAFALNYSTTHLGLSRDIFLNIGLLVGAISCVSIPFFAYLAD
                     SFGRRRIYVTGALIGAASAVPFFMALESHNTLLILFFAIMLANIAHDMIVSVQQPMFT
                     ELFGTAYRYSGAGVGYQVASVVGGGFTPFIAVLLVQFMDGSWHAVAAYLAIGCLLSAI
                     VGMQMKAKSADALPR"
     gene            complement(249634..249825)
                     /locus_tag="PC1_RS01050"
                     /old_locus_tag="PC1_0208"
     CDS             complement(249634..249825)
                     /locus_tag="PC1_RS01050"
                     /old_locus_tag="PC1_0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010301731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010285501.1"
                     /db_xref="GI:497971345"
                     /translation="MEFHENRSQKPFRESPFWLMLILPYRLWKAWRARAQTLKILRNM
                     SDDGLKDIGLKRSDLDRFR"
     gene            249999..251423
                     /locus_tag="PC1_RS01055"
                     /old_locus_tag="PC1_0209"
     CDS             249999..251423
                     /locus_tag="PC1_RS01055"
                     /old_locus_tag="PC1_0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_012772939.1"
                     /db_xref="GI:502365654"
                     /translation="MTRYQHLAGLLEQRIEQGLYQSGERLPSVRALSTEHGVSISTVQ
                     QAYHLLETRQLIMPQPRSGYFVTPRKATPPVPALTRPAQRPVEITQWESVLELVNVRL
                     ETNVLKFGSGMPDVSQPTIKPLWKEMARLCQYQDPRILQYDSVYGVPALREQIARLTV
                     DCGCQLTQDDIVVTTGCQEALFVAVRAVCQPGDIVAVESPAFPGTMQILRGLDIKAIE
                     IPTDSVTGISLEALRLALDQWPIKAVLLVPSCNNPLGFIMPDARKKSLVTLAQHFDIA
                     IIEDDAYGELAYEYPRPRAIKSFDEDGRVLLCSSFSKNLAPGLRVGWIAPGRYLERVI
                     HTKYISTGSTVVQPQLAVAEFIRQGHYQPHLRRMRAQYKANLSTFTCWVREYFPSNIC
                     VSRPQGGFLMWIELPEYFDSLKLTREVRKSGIQIAAGSLFSASGKYRNCIRLNYANRF
                     TEEMREGLRIVGNEVAKMMHTPPD"
     gene            complement(251420..251671)
                     /locus_tag="PC1_RS01060"
                     /old_locus_tag="PC1_0210"
     CDS             complement(251420..251671)
                     /locus_tag="PC1_RS01060"
                     /old_locus_tag="PC1_0210"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772940.1"
                     /db_xref="GI:502365657"
                     /translation="MRLASQSENYTEDNILRIAPRNMTFGLSPRSVTKNTVASLAGLS
                     ITALAGRSRLPLIGSAHQPADTGLILTRIGPSLTLSEAI"
     gene            complement(251815..252936)
                     /gene="thiH"
                     /locus_tag="PC1_RS01065"
                     /old_locus_tag="PC1_0211"
     CDS             complement(251815..252936)
                     /gene="thiH"
                     /locus_tag="PC1_RS01065"
                     /old_locus_tag="PC1_0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010301738.1"
                     /note="in Escherichia coli this enzyme functions in
                     thiamine biosynthesis along with thiFSGI and iscS; with
                     ThiFSG catalyzes the formation of thiazole phosphate from
                     tyrosine, cysteine and 1-deoxy-D-xylulose-5-phosphate;
                     forms a complex with ThiG; contains an iron-sulfur center;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiH"
                     /protein_id="WP_012772941.1"
                     /db_xref="GI:502365661"
                     /translation="MSVDFQTVWEQLDWDDLTLRINGKTAQDVERALTAPHLTHDDFM
                     ALISPAASAYLEPLAQRAQQLTRQRFGNTVSFYVPLYLSNLCSNDCTYCGFSMSNHIK
                     RKTLDEAEILRECAAIKELGFEHLLLVTGEHQRKVGMDYFRRVFPLIRPLFSSLMIEV
                     QPLSQDEYAELKALGLDGVMVYQETYHTATYQLHHLKGQKQDFHWRLATPDRLGRAGI
                     DKIGLGALIGLSNSWRTDCYMVAEHLLHLQQHYWQSRYSISFPRLRPCAGGIEPASLM
                     DEAQLMQVICAFRLLAPDIELSLSTRESPFFRDHAIPIAINNVSAFSKTQPGGYADDH
                     PELEQFSPHDSRRPEDVAQAIVRAGLQPVWKDWDGYLGR"
     gene            complement(252933..253718)
                     /locus_tag="PC1_RS01070"
                     /old_locus_tag="PC1_0212"
     CDS             complement(252933..253718)
                     /locus_tag="PC1_RS01070"
                     /old_locus_tag="PC1_0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DHS2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole synthase"
                     /protein_id="WP_012772942.1"
                     /db_xref="GI:502365664"
                     /translation="MLHIADTTLTSRLLTGTGKFATPELMLAALEASGSQLVTMAMKR
                     VDLNGGNDAILAPLRQLGIKLLPNTSGAKTADEAIFAARLAREALGTHWLKLEIHPDV
                     KYLLPDPIETLKAAEQLVKEGFTVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQG
                     LQTRDFLRIIIEQARVPVIVDAGIGAPSQAADALEMGADAVLVNTAIAVARDPVAMAR
                     AFRLAVEAGGLARQAGLGSKQFVASATSPLTGFLHQQAEGAVR"
     gene            complement(253720..253920)
                     /locus_tag="PC1_RS01075"
                     /old_locus_tag="PC1_0213"
     CDS             complement(253720..253920)
                     /locus_tag="PC1_RS01075"
                     /old_locus_tag="PC1_0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010285513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiS"
                     /protein_id="WP_010285513.1"
                     /db_xref="GI:497971357"
                     /translation="MRITLNDEPFEFPEAITVEALLSQINRLQPGTALAINQTIIPHA
                     TWSQHQVQDGDDILLFQAIAGG"
     gene            complement(253917..254696)
                     /locus_tag="PC1_RS01080"
                     /old_locus_tag="PC1_0214"
     CDS             complement(253917..254696)
                     /locus_tag="PC1_RS01080"
                     /old_locus_tag="PC1_0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein MoeB"
                     /protein_id="WP_012772943.1"
                     /db_xref="GI:502365668"
                     /translation="MATHHHSTPAGLSDSEFMRYSRQLMLEDIGPEGQDKLKAASVLL
                     VGLGGLGAPASLYLAAAGIGTLLLADDDALHISNLQRQILYRTSDTDKPKAVLAQRQL
                     QALNPHSEAIALTERLSGETLDNAVSRVDLVLDCSDNMATRHAVNAACFRAGKPLISG
                     SAVGFSGQLAVFTPPYHSGCYACLYPDTTEPQRNCRTAGMLGPVVGVIGTLQALEAIK
                     LLAGMPSALDGKLRMFNGKQQSWNTLQLTRAPHCSVCGGAA"
     gene            complement(254698..255339)
                     /locus_tag="PC1_RS01085"
                     /old_locus_tag="PC1_0215"
     CDS             complement(254698..255339)
                     /locus_tag="PC1_RS01085"
                     /old_locus_tag="PC1_0215"
                     /EC_number="2.5.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913805.1"
                     /note="catalyzes the formation of thiamine monophosphate
                     from 4-methyl-5-(beta-hydroxyethyl)-thiazole monophosphate
                     and 4-amino-5-hydroxymethyl pyrimidine pyrophosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="WP_012772944.1"
                     /db_xref="GI:502365670"
                     /translation="MTDSTPFAPTAQRLGLYPVVDSVEWIERLLGVGVKTIQLRIKDR
                     SDEQAEADVIQAIALGRRYQAQLFINDYWKLAVKHQAYGVHLGQEDLDTADLTAIKQA
                     GLRLGISTHDDRELARAVAINPSYIALGHIFPTQTKDMPSAPQGLAELTRHITDLQDR
                     FPTVAIGGISIDRVPAVRKTGVGSIAVVSAITQAPDWRQATATLLRMIEGREA"
     gene            complement(255336..257291)
                     /locus_tag="PC1_RS01090"
                     /old_locus_tag="PC1_0216"
     CDS             complement(255336..257291)
                     /locus_tag="PC1_RS01090"
                     /old_locus_tag="PC1_0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772945.1"
                     /note="catalyzes the formation of
                     4-amino-2-methyl-5-phosphomethylpyrimidine from
                     5-amino-1-(5-phospho-D-ribosyl)imidazole and
                     S-adenosyl-L-methionine in thiamine biosynthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine synthase ThiC"
                     /protein_id="WP_012772945.1"
                     /db_xref="GI:502365672"
                     /translation="MSTDPLSINTVSSKSGRREQRAAAQQFIETLQGTAFPNSKRIYL
                     TGSRDDIAVPMREIQLSPTLLGGSKDNPQYEPNEPIPVYDTSGPYGDPAAQPDVRIGL
                     AKLRASWIAERSDTEALSGVSSDFTQQRLADAGLDHLRFEHLPRPLRAKAGKRVTQLH
                     YARQGIITPEMEFIALRENMGRERIRTDVLRQQHPGQSFGALLPENITPEFVRQEVAA
                     GRAIIPSNINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTV
                     MDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGVAENLNWEMFRDTLLEQAEQ
                     GVDYFTIHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHKESFLYEHFREICEIC
                     AAYDVALSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQ
                     MIRRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPK
                     EHLGLPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLAL
                     DPQTARAYHDETLPQESGKVAHFCSMCGPKFCSMKISQEVRDYAAKQEAEAKPIEVGM
                     AQMSQEFRSRGSELYHSATSLQAEENQ"
     misc_binding    complement(257414..257567)
                     /note="TPP riboswitch (THI element) as predicted by
                     Rfam(RF 00059), score 66.15"
                     /bound_moiety="thiamin/thiaminpyrophosphate"
     gene            complement(257690..258151)
                     /locus_tag="PC1_RS01095"
                     /old_locus_tag="PC1_0217"
     CDS             complement(257690..258151)
                     /locus_tag="PC1_RS01095"
                     /old_locus_tag="PC1_0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005970308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of sigma D"
                     /protein_id="WP_012772946.1"
                     /db_xref="GI:502365675"
                     /translation="MLNQLQSLTEYVGGNNALIDQWLQARKQLLVAYYHLVGIKPNKE
                     ALSLLDEEALDNFCQNLVDYLSTGHFHLYEKMLHEAATHSEQLLALSTQLDFALQSNT
                     QQIMTFYDNHLATAIDHDNCLEFQQALSSVGETLEERFTLEDNMIRLVYDN"
     gene            258260..259042
                     /gene="nudC"
                     /locus_tag="PC1_RS01100"
                     /old_locus_tag="PC1_0218"
     CDS             258260..259042
                     /gene="nudC"
                     /locus_tag="PC1_RS01100"
                     /old_locus_tag="PC1_0218"
                     /EC_number="3.6.1.22"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DAL8.1"
                     /note="can catalyze hydrolysis of broad range of
                     dinucleotide pyrophosphates but prefers reduced form of
                     NADH; requires divalent metal ions such as magnesium and
                     manganese and produces two mononucleoside 5'-phosphates;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH pyrophosphatase"
                     /protein_id="WP_012772947.1"
                     /db_xref="GI:502365678"
                     /translation="MEQTLKGDETGWWVVSDAVQIWLPQGELPCGTATKWSLQGKTAR
                     QIGEWQEQPVWLVCQGRDTDMASVRQLLDQDVGLFQLAGRGVQLAEFYRSHRFCGYCG
                     HEMVRSKTELACLCHHCKERYYPQIAPCIIVAIRRGEEILLAQHNRHRGNMYTVLAGF
                     VEVGETLEQTVVREVMEESQVQIKNLRYVSSQPWPFPHSLMMAFMAEYAGGEIKHDPK
                     ELRDAGWFRYDQLPQLPPPGTVARRLIEDTVVLCRAYHENEG"
     gene            259191..260255
                     /gene="hemE"
                     /locus_tag="PC1_RS01105"
                     /old_locus_tag="PC1_0219"
     CDS             259191..260255
                     /gene="hemE"
                     /locus_tag="PC1_RS01105"
                     /old_locus_tag="PC1_0219"
                     /EC_number="4.1.1.37"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DHS9.1"
                     /note="catalyzes the formation of coproporphyrinogen from
                     uroporphyrinogen III; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="WP_012772948.1"
                     /db_xref="GI:502365683"
                     /translation="MTDLKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAG
                     DFMSLCKNAELACEVTLQPLRRYALDAAILFSDILTIPDAMGLGLYFEAGEGPRFHSP
                     ITSHADVVNLPIPDPEQELGYVMNAVRTIRKNLAGEVPLIGFSGSPWTLATYMVEGGS
                     SKAFTVIKKMMFAEPKTLHLLLDKLADSVILYLNAQIRAGAQAVMVFDTWGGALSGRD
                     YKEFSLRYMHKIVDGLQRENEGRRVPVTLFTKGGGQWLEAMAETGCDALGLDWTSDIA
                     DARRRVGDKVALQGNMDPSMLYADPARIEQEVASILAGFGQGNGHVFNLGHGIHQDVP
                     PEHAGVFVEAVHRLSRPYHA"
     gene            260271..260960
                     /locus_tag="PC1_RS01110"
                     /old_locus_tag="PC1_0220"
     CDS             260271..260960
                     /locus_tag="PC1_RS01110"
                     /old_locus_tag="PC1_0220"
                     /EC_number="3.1.21.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010301765.1"
                     /note="Selectively cleaves double-stranded DNA at the
                     second phosphodiester bond 3' to a deoxyinosine leaving
                     behind the intact lesion on the nicked DNA; cleaves DNA
                     containing urea residues, AP sites, base mismatches,
                     insertion/deletion mismatches, flaps, and pseudo-Y
                     structures; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="WP_012772949.1"
                     /db_xref="GI:502365685"
                     /translation="MIDTQQLRAEQLARASDVIRHDDLPFEQPAFIAGADVGFEQEGS
                     VTRAAIAVMRYPSLELVEYKIARISTTMPYIPGFLSFRECPGLLAAWALLEQKPDLLF
                     VDGHGISHPRRLGVASHFGLLVDVPTIGVAKSRLCGRFEPLTESVGSQQPLLDKGEQI
                     GWVWRSKARCNPLFVATGHRVSQDSALHWVQSCMRGYRLPEPTRWADAVASNRPAFVR
                     WQRQQAANVLS"
     gene            261038..261628
                     /locus_tag="PC1_RS01115"
                     /old_locus_tag="PC1_0221"
     CDS             261038..261628
                     /locus_tag="PC1_RS01115"
                     /old_locus_tag="PC1_0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011091874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772950.1"
                     /db_xref="GI:502365688"
                     /translation="MLRNPIHLRLEKLASWQHVTFMACLCERMYPNYHEFCRQTEFGD
                     AMVYRRILDLVWETLVVKDAKVNFDSQLEKLEEAIPAAEDYDLYGVYPAIDACIALGE
                     LIHSRLSGETLEHAIAISETSIRTVAMLEMTQAGKEMTDDELKVLPAIEEEWDIQWEI
                     FRLLAACEERDIELIKGLRSDLREAGSSNIGINLHQ"
     gene            261833..262105
                     /locus_tag="PC1_RS01120"
                     /old_locus_tag="PC1_0222"
     CDS             261833..262105
                     /locus_tag="PC1_RS01120"
                     /old_locus_tag="PC1_0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013200312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_005970302.1"
                     /db_xref="GI:492807482"
                     /translation="MNKTQLIDVIADKADLSKAQAKAALESTLAAITESLKEGDAVQL
                     VGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
     gene            262185..262796
                     /locus_tag="PC1_RS01125"
                     /old_locus_tag="PC1_0223"
     CDS             262185..262796
                     /locus_tag="PC1_RS01125"
                     /old_locus_tag="PC1_0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043881700.1"
                     /db_xref="GI:762766865"
                     /translation="MLTAVVACSSRTAPPEFFASGYVADRGIVRLWRKDDAQNTTALT
                     TVFNPLQGNALVVTRYTFQQDKLREIQRNQLGTQKEDMRLRFAEDGTVSFMQRQLAER
                     RESVSDDDVALYQFDAKRMLELSDVLRAGKVILKQGKWLEGQVQSCDGTAVRPDFDND
                     SREWIAEQKMHATRPLNVAWLEAPEGTQLLLVVEDDVCQWQPK"
     gene            complement(262866..264152)
                     /locus_tag="PC1_RS01130"
                     /old_locus_tag="PC1_0224"
     CDS             complement(262866..264152)
                     /locus_tag="PC1_RS01130"
                     /old_locus_tag="PC1_0224"
                     /EC_number="6.3.4.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114797.1"
                     /note="catalyzes the formation of
                     N(1)-(5-phospho-D-ribosyl)glycinamide from
                     5-phospho-D-ribosylamine and glycine in purine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="WP_012772952.1"
                     /db_xref="GI:502365693"
                     /translation="MNILVIGNGGREHALAWKAAQSPLAKRVYVAPGNAGTALEAALT
                     NVDIAATDVPALVAFAQENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPSQAAAQLE
                     GSKAFTKDFLARHNIPTAEYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMT
                     LQEAENAIEDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRV
                     GDKDTGPNTGGMGAYSPAPVVTDEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMI
                     SADGQPKVIEFNCRFGDPETQPIMLRLRSDLVELCLAACDGTLDQKDSVWDERPSLGV
                     VLAAGGYPADYNTGDVISGLPQQDAEDGKVFHAGTKLNGINVVTNGGRVLCVTALGNT
                     VAEAQQRAYEIAAGIQWQGVFCRKDIGYRAIEREQA"
     gene            complement(264170..265810)
                     /gene="purH"
                     /locus_tag="PC1_RS01135"
                     /old_locus_tag="PC1_0225"
     CDS             complement(264170..265810)
                     /gene="purH"
                     /locus_tag="PC1_RS01135"
                     /old_locus_tag="PC1_0225"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913812.1"
                     /note="involved in de novo purine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazolecarboxamide
                     formyltransferase"
                     /protein_id="WP_043881861.1"
                     /db_xref="GI:762768350"
                     /translation="MHIPFFTDYPNPGDNIIMQQRRPIRRALLSVSDKAGIVEFAQAL
                     SHRGVELLSTGGTARLLADAGLAVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRDQ
                     DDAIMAQHDIKPIDIVVVNLYPFAQTVARENCTLEDAVENIDIGGPTMVRSAAKNHKD
                     VAIVVKSSDYSAIINEIDANEGSLTYETRFDLAIKAFEHTAAYDSMIANYFGALVPPY
                     HGETDKPSGNFPRTLNLNYIKKQDMRYGENSHQQAAFYIEENIHEASVATSTQLQGKA
                     LSYNNIADTDAALECVKEFAEPACVIVKHANPSGVAIGGSILDAYERAYKTDPTSAFG
                     GIIAFNRELDEETAQAIISRQFVEVIIAPSASEAALKVTAAKQNVRVLTSGNWQQRVP
                     GLDFKRVNGGLLIQDRDLGMVDASQLRVVTERQPSEQELRDALFCWKVAKFVKSNAIV
                     YARDNMTIGIGAGQMSRVYSAKIAGIKAGDEGLEVKGSAMASDAFFPFRDGIDAAAAV
                     GITCVIQPGGSIRDDEVIAAANEHGIAMIFTDMRHFRH"
     gene            266361..267911
                     /locus_tag="PC1_RS01140"
                     /old_locus_tag="PC1_R0009"
     rRNA            266361..267911
                     /locus_tag="PC1_RS01140"
                     /old_locus_tag="PC1_R0009"
                     /product="16S ribosomal RNA"
     gene            267977..268053
                     /locus_tag="PC1_RS01145"
                     /old_locus_tag="PC1_R0010"
     tRNA            267977..268053
                     /locus_tag="PC1_RS01145"
                     /old_locus_tag="PC1_R0010"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:268011..268013,aa:Ile,seq:gat)
     gene            268096..268171
                     /locus_tag="PC1_RS01150"
                     /old_locus_tag="PC1_R0011"
     tRNA            268096..268171
                     /locus_tag="PC1_RS01150"
                     /old_locus_tag="PC1_R0011"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:268129..268131,aa:Ala,seq:tgc)
     gene            268372..271306
                     /locus_tag="PC1_RS01155"
                     /old_locus_tag="PC1_R0012"
     rRNA            268372..271306
                     /locus_tag="PC1_RS01155"
                     /old_locus_tag="PC1_R0012"
                     /product="23S ribosomal RNA"
     gene            271415..271530
                     /locus_tag="PC1_RS01160"
                     /old_locus_tag="PC1_R0013"
     rRNA            271415..271530
                     /locus_tag="PC1_RS01160"
                     /old_locus_tag="PC1_R0013"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            complement(271814..272575)
                     /locus_tag="PC1_RS01165"
                     /old_locus_tag="PC1_0226"
     CDS             complement(271814..272575)
                     /locus_tag="PC1_RS01165"
                     /old_locus_tag="PC1_0226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter ATP-binding protein"
                     /protein_id="WP_012772954.1"
                     /db_xref="GI:502365695"
                     /translation="MNQTALTQSTDHMITLENVNKWYGQFHVLKDINLQVRQGERIVL
                     CGPSGSGKSTTIRCINHLEEHQQGRIVVDGIELNNDLRNIEKIRTEVGMVFQHFNLFP
                     HLTVLQNCTLAPCWVRNMPKKEAEELAMHYLERVRIAAHAHKFPGQLSGGQQQRVAIA
                     RSLCMKPKIMLFDEPTSALDPEMVKEVLDTMLGLAQDGMTMLCVTHEMGFARTVADRV
                     IFMDQGEIVEQAPPDIFFSSPRSERTQSFLSQILH"
     gene            complement(272584..273678)
                     /locus_tag="PC1_RS01170"
                     /old_locus_tag="PC1_0227"
     CDS             complement(272584..273678)
                     /locus_tag="PC1_RS01170"
                     /old_locus_tag="PC1_0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_043881701.1"
                     /db_xref="GI:762766869"
                     /translation="MTMNHYTQGRQSSLFRAMQWARRNLFSSISNSLLTLFCLWLLWV
                     AIPPLLNWAIFQANWIGTTRNDCTRDGACWVFIHARFGHFMYGLYPAAEIWRINFALT
                     IGLLSILPMFLKSIPYRGRYIAVWAVAYPLIAWWLLYGGFGGLSRVETYQWGGLTLTL
                     IIAAVGIAGALPLGILLALGRRSTLPIVRMLSVVFIEFWRGVPLITVLFMSSVMLPLF
                     LTEGTTIDKLLRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLGLGYWRMQGLV
                     ILPQALKMVIPGLVNTIISLFKDTSLVIIIGLFDLFSSIQQATVDPTWLGMSTEGYVF
                     AAMVYWIFCFSMSRYSQHLESRFNTGHKSH"
     gene            complement(273687..274865)
                     /locus_tag="PC1_RS01175"
                     /old_locus_tag="PC1_0228"
     CDS             complement(273687..274865)
                     /locus_tag="PC1_RS01175"
                     /old_locus_tag="PC1_0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_012772956.1"
                     /db_xref="GI:502365697"
                     /translation="MLQRPTVKGDLSLTNPAVRAWLYQIVVVIAVLAVAAYLLHNTVT
                     NLAQRGITSGFDFLNKSAGFGIVQHLIDYQQGDTYARVFLVGLFNTLLVSALCIVFAS
                     ILGFTIGLARLSDNWLLRKISNIYIEIFRNIPPLLQIFFWYFAVLRNLPGPRQSISAF
                     DVAFLSNRGFYLPSPELGPGAAAFFLSLIITLVVTWGVFRRNQRYHALTGQPRRTWPL
                     ALGLLLGLCALSHLIFGAAFHWDMPELKGFNFRGGMVLIPELAALTVALSVYTSSFIA
                     EIIRSGIQSVSHGQHEAARSLGLPNPVTLRKVILPQALRVIIPPLTSQYLNIVKNSSL
                     AAAIGYPDMVSLFAGTVLNQTGQAIETIAITMSVYLIISLLISLLMNLYNRKIALVER
                     "
     gene            complement(274931..275956)
                     /locus_tag="PC1_RS01180"
                     /old_locus_tag="PC1_0229"
     CDS             complement(274931..275956)
                     /locus_tag="PC1_RS01180"
                     /old_locus_tag="PC1_0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_005975324.1"
                     /db_xref="GI:492818363"
                     /translation="MKRIVISTLVAGASLFAAINQAHAGATLDAIQKKGFVQCGISDG
                     LPGFSYADASGKYSGIDVDVCRGLAAAVFGDANKVKYTPLTAKERFTALQSGEVDVLS
                     RNTTWTSSRDGGMGMLFTGVTYYDGIGFLTHNKAGLTSAKELDGATVCIQAGTDTELN
                     VADYFKTHKMQYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSKPAEFIVL
                     PEVISKEPLGPVVRRGDEEWFSIVRWTLFAMLNAEEMGVTSKNVDQLAAKPTTPDMSH
                     LLGHEGSYGKDLKLPNDWAFKIIKQVGNYGEIFERNVGMGSELKIKRGLNELWNKGGI
                     QYAPAVR"
     gene            complement(276322..276987)
                     /locus_tag="PC1_RS01185"
                     /old_locus_tag="PC1_0230"
     CDS             complement(276322..276987)
                     /locus_tag="PC1_RS01185"
                     /old_locus_tag="PC1_0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine ABC transporter permease"
                     /protein_id="WP_010681530.1"
                     /db_xref="GI:498367374"
                     /translation="MPPWLQLMADSFWSLLSAGLKFTVPLAILSFIFGLALGIIIALV
                     RLYGPKPLKWLGDFYVWVIRGTPLLVQLFLIFYGLPSAGITLDAFPAALIGFTISVGA
                     YSSEIVRGAILSVPKGQWNAAYSLGMNGRQAIRWVIFPQSVFVSLPPLSNTFISLIKD
                     TSLAAVITVPEMFLSAQRIVSVTYEPLILYVEAALIYLMFSTVLSQLQVKLEKYYQRH
                     ITH"
     gene            complement(277030..277797)
                     /locus_tag="PC1_RS01190"
                     /old_locus_tag="PC1_0231"
     CDS             complement(277030..277797)
                     /locus_tag="PC1_RS01190"
                     /old_locus_tag="PC1_0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012772957.1"
                     /db_xref="GI:502365698"
                     /translation="MKKIRFALLTSALLATSVFAHADDLSDIKSAGVLKIGTEGTYAP
                     YTYHDKSGQLVGFDVDIGRAVAEKLGVKAQFIEGRWDGLIAGIDAKRYDAVINQVGVT
                     KERQAKYDFSKPYIDSKAVLVVRGDNTTLKDFSDLKGKKAAQSLTSNYSKQATSYGAD
                     IVPTDGFNQSLDLVLSGRADATLNDNLSFLDFKKHKPDANVKIAATSKDGEPSAILVR
                     KNQATLVEALNKALDEIKADGTYKTISVRYFGEDVSQ"
     gene            278118..279263
                     /locus_tag="PC1_RS01195"
                     /old_locus_tag="PC1_0232"
     CDS             278118..279263
                     /locus_tag="PC1_RS01195"
                     /old_locus_tag="PC1_0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_012772958.1"
                     /db_xref="GI:502365699"
                     /translation="MKIRIASYNVENLFHRTAILNLPDSRQIDALLQQVRQLQHLLEQ
                     PQYDDALKDQVFRLSIALRPYIDIRTDAGTLGRWKKEDAGTGFRINKSCRGRGDWIGE
                     IVFKAQEFSSQQRKNTGKIITLLNADILCAVEVENMDVLRDFNNQVLGDDKFSQFVMI
                     DSPNDPRGIDVACLTRYRIAQLRTHIFDAGKRFDPVFSRDCLEVTLDAGLKQPIYILC
                     NHFKSQSGQTEEERLRGAEKRRDQAERVAEIVQQTYDLKKDYVVILGDLNEDSSNPWH
                     SLAPLFSLSDLHPVIDPERPEKERYTYYFAGGKKGARLNQLDYIFLSAPLHQAVVEWG
                     VERRGIYNIDKIAAKEGAEPVTPLPEVTSWDTAASDHAALWVEVDIT"
     gene            279331..279732
                     /locus_tag="PC1_RS01200"
                     /old_locus_tag="PC1_0233"
     CDS             279331..279732
                     /locus_tag="PC1_RS01200"
                     /old_locus_tag="PC1_0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772959.1"
                     /db_xref="GI:502365700"
                     /translation="MSKQGLEQYPDALRWSFGDSPALADELLQLVLEGHKTATCSSYH
                     AFKNEETPQVGDYNIVLDGAGQPSCVIRTRSLTLVRYCDVTAEMAAKEGEGDKSLTFW
                     REGHQTFFEREGTFAPDMLLVFEEFELIEVF"
     gene            complement(279804..280868)
                     /locus_tag="PC1_RS01205"
                     /old_locus_tag="PC1_0234"
     CDS             complement(279804..280868)
                     /locus_tag="PC1_RS01205"
                     /old_locus_tag="PC1_0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_012772960.1"
                     /db_xref="GI:502365701"
                     /translation="MKVLDNDQCDVWYQALLERDSGYTGVFFVGVITTGVFCISVCRA
                     RKPKRENVEFYKDVKSALDAGFRPCKVCRPTENAHSAPLLIEQALELVRANPKTRISD
                     TELRKHDISPERVRRWFLQNHGITFQAFQRMQRVNVALQELKGGRNATEVAFDSGYES
                     LSGFGYTYKRLTGVSPTEQSQVIMIHRFTTPLGPMFVCATERGVCLLEFTDRRMLETE
                     FRDLQRLLNARIMSGENIHTRQTEKEISEYFSGTRQQFTLLLDTPGSDFQRTVWQELR
                     AVPYGHTSHYQALSGLIGKPNAVRAVAAANGANRVAIVIPCHRIIGKDGTMTGYGGGI
                     ARKKWLIEHEKTMLNHPTES"
     gene            complement(280852..281628)
                     /locus_tag="PC1_RS01210"
                     /old_locus_tag="PC1_0235"
     CDS             complement(280852..281628)
                     /locus_tag="PC1_RS01210"
                     /old_locus_tag="PC1_0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxyvinyl-carboxyphosphonate
                     phosphorylmutase"
                     /protein_id="WP_012772961.1"
                     /db_xref="GI:502365702"
                     /translation="MNFTERHHQSPPLLIANVWDASSAIAAQHAGYQALGTSSAAIAA
                     MLGYEDGEAMSFDELLYIVTRIKSVSHLPLSVDVEAGFGRTASEITVNLKRLASLGVV
                     GVNLEDSRVVNGVRQLDDAVAFSRTLKEIRHALTIENDQLFFNIRTDTFLLGHEQALQ
                     ETLLRGRLYEEAGADGLFVPCLTSENDIAIISREINLPLNVMCMPDLPAFDRLKTLGV
                     NRLSMGNFVHSAIQSTFKNIMLTIQSQQSFAGVFVDESSR"
     gene            complement(281871..282167)
                     /gene="fis"
                     /locus_tag="PC1_RS01215"
                     /old_locus_tag="PC1_0236"
     CDS             complement(281871..282167)
                     /gene="fis"
                     /locus_tag="PC1_RS01215"
                     /old_locus_tag="PC1_0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001465625.1"
                     /note="Stimulates excision of phage lambda; affects Mu
                     development; acts as an activator of rRNA and iRNA
                     transcription; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_005975342.1"
                     /db_xref="GI:492818403"
                     /translation="MFEQRVNSDVLTVSTVNSQAQVTQKPLRDSVKQALKNYFAQLNG
                     QDVSDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN"
     gene            complement(282191..283156)
                     /locus_tag="PC1_RS01220"
                     /old_locus_tag="PC1_0237"
     CDS             complement(282191..283156)
                     /locus_tag="PC1_RS01220"
                     /old_locus_tag="PC1_0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52539.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase B"
                     /protein_id="WP_012772962.1"
                     /db_xref="GI:502365703"
                     /translation="MHIGQFQLTNRLIAAPMAGISDRPFRALCHAMGAGMTVSEMLSS
                     NPEVWRSDKSRLRMVHSDEPGIRAVQIAGCDPDEMAAAARINADSGAQIIDINMGCPA
                     KKVNRKMAGSALLQYPDLVKQILSSVVKAVDVPVTLKIRTGWAPEHRNCVEIAKLAED
                     CGIQALTIHGRTRACLFNGSAEYDSIRAVKQAVSIPIIANGDITDPHKARAVLDYTGA
                     DALMIGRAAQGRPWIFREIQHYLDTGELLAPMPLAEVKRLLIEHIRELHDFYGPGKGF
                     RIARKHVSWYLQEHAPNDQFRRTFNAIEDASEQLEALKAYFENLA"
     gene            complement(283513..284247)
                     /locus_tag="PC1_RS01225"
                     /old_locus_tag="PC1_0238"
     CDS             complement(283513..284247)
                     /locus_tag="PC1_RS01225"
                     /old_locus_tag="PC1_0238"
                     /EC_number="4.2.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010300278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="WP_012772963.1"
                     /db_xref="GI:502365704"
                     /translation="MKGKLSIVLMLSACFPVLAADPVNWGYEGNGDPAHWGKLSPDFS
                     LCETGKNQSPINIRQALNAQHDPLQLAFLPGTQQIINNGHTVQVNVGPGNTLLLDNET
                     FTLQQFHFHAPSENEIDGKQFPLEGHFVYKDASGALTVIALMFQEGEANQPLATAWQQ
                     IPAQVNQAEEVRTPIAIQSLLPTSLNYYRFSGSLTTPPCSEGIRWLVLDHPVTASAEQ
                     INQFRSVMHHANNRPIQPLNGRVIIH"
     gene            complement(284423..285310)
                     /gene="prmA"
                     /locus_tag="PC1_RS01230"
                     /old_locus_tag="PC1_0239"
     CDS             complement(284423..285310)
                     /gene="prmA"
                     /locus_tag="PC1_RS01230"
                     /old_locus_tag="PC1_0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DAJ5.1"
                     /note="methylates ribosomal protein L11 at multiple amino
                     acid positions; mutations of these genes in Escherichia
                     coli or Thermus thermophilus has no apparent phenotype;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L11 methyltransferase"
                     /protein_id="WP_012772964.1"
                     /db_xref="GI:502365705"
                     /translation="MPWIQLKINTSGNVAEQLGDAMIESGAVSVTFQDTHDTPVFEPL
                     PGETRLWGDTDAIALYDAETDMNDVIAMLEQEPLLGVGFKHKIEQLEDKDWEREWMDN
                     FHPMQFGKRLWICPSWRDIPDPTAVNVMLDPGLAFGTGTHPTTALCLQWLDGLDLEGK
                     TIIDFGCGSGILAIAALKLGAARAIGIDIDPQAIQASRDNAQRNGVSERLELYLPKDQ
                     PADLSADVVVANILAGPLRELAPLISDLPKAGGHLGLSGVLATQADGVAEAYADKFTL
                     DPVAEREEWCRITGQRRAS"
     gene            complement(285328..286779)
                     /gene="panF"
                     /locus_tag="PC1_RS01235"
                     /old_locus_tag="PC1_0240"
     CDS             complement(285328..286779)
                     /gene="panF"
                     /locus_tag="PC1_RS01235"
                     /old_locus_tag="PC1_0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913828.1"
                     /note="mediates high affinitiy panthothenate transport
                     which is stimulated by the presence of sodium ions; member
                     of SSS family of sodium/solute symporters; the imported
                     panthothenate is phosphorylated by panthothenate kinase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:pantothenate symporter"
                     /protein_id="WP_012772965.1"
                     /db_xref="GI:502365706"
                     /translation="MQIEILLPLIGYLLLVFGLSVYAYRRRQAGNFLNEYFLGGRSMG
                     GFVLAMTLIGTYVSASSFIGGPGAAYKYGLGWVLLSMIQLPTMLLSLGILGKKFAILA
                     RRYNAITLNDMLYARYNSPLLVWFASISLLVAFIGAMAVQFIGGARLLETAANIPYDI
                     GLLIFGVTIALYTTFGGFRASVLNDAMQGIVMLIGTVILLVGVIYAAGGLHSAVDKLQ
                     QIDPMLVSPQGSGGILSMPFMASFWVLVCFGVIGLPNTAVRCISYRDSKALHRGIIIG
                     TIVIGILMLGMHLAGALGRAVMPNLTIPDQVLPALMVTVLPPLAAGIFLAAPMAAIMS
                     NINAHLLQASATIIKDLYLSVRPQQIHNERRIKILSSMTTLLLGLLVLLASLRPPDMI
                     IWLNLLAFGGLEAVFLWPLVLGLYWERANAAGALSAMFSGAICYTLLASFNLQLAGYH
                     PIVPSLLLSLMAFIIGNRFGHNPPAPVAASSSL"
     gene            complement(286769..287011)
                     /locus_tag="PC1_RS01240"
                     /old_locus_tag="PC1_0241"
     CDS             complement(286769..287011)
                     /locus_tag="PC1_RS01240"
                     /old_locus_tag="PC1_0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012772966.1"
                     /db_xref="GI:502365707"
                     /translation="MDTRFPQAHREARWAFGLTLVYLVAWALAAYLPDNTQGITGLPH
                     WFEMACLLLPLVFTLLCWLMVHVIFRDISLESDDAN"
     gene            287557..287985
                     /locus_tag="PC1_RS01245"
                     /old_locus_tag="PC1_0242"
     CDS             287557..287985
                     /locus_tag="PC1_RS01245"
                     /old_locus_tag="PC1_0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010681543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_012772967.1"
                     /db_xref="GI:502365708"
                     /translation="MSVSARNQLSGVVSSIVEGAVNNEVALTLESGDKLTTVITRASC
                     QSMDLAVGKPAIALVKAPWVILASAECGLNFSARNQFHGKVSSVTKGAVNSTVQLVTA
                     GGLTLTSTVTNESLEEMNIDVGNELIALVKASSIILATRK"
     gene            complement(288258..289601)
                     /locus_tag="PC1_RS01250"
                     /old_locus_tag="PC1_0243"
     CDS             complement(288258..289601)
                     /locus_tag="PC1_RS01250"
                     /old_locus_tag="PC1_0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013510730.1"
                     /note="an AccC homodimer forms the biotin carboxylase
                     subunit of the acetyl CoA carboxylase, an enzyme that
                     catalyzes the formation of malonyl-CoA, which in turn
                     controls the rate of fatty acid metabolism; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxylase"
                     /protein_id="WP_012772968.1"
                     /db_xref="GI:502365709"
                     /translation="MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLL
                     ADETVCIGPAPSTKSYLNIPAIISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIF
                     IGPRAETIRLMGDKVSAITAMKKAGVPTVPGSDGPLTDDMDANRVHAKRIGYPVIIKA
                     SGGGGGRGMRVVRSDKELEQSINMTRAEAKAAFNNDMVYMEKYLENPRHVEIQILADG
                     QGHAVYLAERDCSMQRRHQKVVEEAPAPGITDELRRNIGDRCAKACIDINYRGAGTFE
                     FLYENGEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGLPLSIKQKDVKVRGHA
                     VECRINAEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLITYG
                     ETREIAISRMKNALAELIIDGIKTNIELQMKIMSDENFQRGGTNIHYLEKKLGLQ"
     gene            complement(289613..290080)
                     /locus_tag="PC1_RS01255"
                     /old_locus_tag="PC1_0244"
     CDS             complement(289613..290080)
                     /locus_tag="PC1_RS01255"
                     /old_locus_tag="PC1_0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010300308.1"
                     /note="composes the biotin carboxyl carrier protein
                     subunit of the acetyl-CoA carboxylase complex, the enzyme
                     that catalyzes the carboxylation of acetyl-CoA to
                     malonyl-CoA, which in turn controls the rate of fatty acid
                     metabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein"
                     /protein_id="WP_012772969.1"
                     /db_xref="GI:502365710"
                     /translation="MDIRKIKKLIELVEESGIAELEISEGEESVRISRAPAAVNYPMM
                     QQAYATPMMQPQPALAAAVAPAPVEAAAAPAAISGHIVRSPMVGTFYRTPSPDAKAFV
                     EVGQQVNVGDTLCIVEAMKMMNQIEADKAGVVKAILLESGQPVEFDEPLVVIE"
     gene            complement(290105..290557)
                     /locus_tag="PC1_RS01260"
                     /old_locus_tag="PC1_0245"
     CDS             complement(290105..290557)
                     /locus_tag="PC1_RS01260"
                     /old_locus_tag="PC1_0245"
                     /EC_number="4.2.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010300311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="WP_012772970.1"
                     /db_xref="GI:502365711"
                     /translation="MAEKFHILLLNGPNLNLLGTREPDKYGKTTLADIVSELETQAQA
                     LNVKFSHLQSNAEHVLIDTIHQARGNTDFILINPAAFTHTSVALRDALLAVSIPFIEI
                     HLSNVHAREPFRHHSYLSDVAVGVICGLGADGYQYALQTAVKRLSTSN"
     gene            complement(290811..291410)
                     /locus_tag="PC1_RS01265"
                     /old_locus_tag="PC1_0246"
     CDS             complement(290811..291410)
                     /locus_tag="PC1_RS01265"
                     /old_locus_tag="PC1_0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913834.1"
                     /note="in Escherichia coli this inner membrane protein was
                     found to anchor the periplasmic catalytic oxidoreductase
                     YedY; sulfite oxidase activity not demonstrated; contains
                     heme; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfoxide reductase heme-binding subunit YedZ"
                     /protein_id="WP_012772971.1"
                     /db_xref="GI:502365712"
                     /translation="MRLTLQHITRLKVLLHLAGFLPLLWLILSVDQGWFSADPAKDIQ
                     HFTGRMALKLLLATLLVTPLARYGKQPLLIRCRRLLGLWCFFWATLHLVSYALLELGL
                     DHLALLGKELISRPYLTLGVISWLILLALAVTSPQIMMRKLGSQWQKLHNFVYLVAIL
                     APIHYLWSVKTLSPQPILYALAALILLLFRYKKFRQWWR"
     gene            complement(291490..292491)
                     /locus_tag="PC1_RS01270"
                     /old_locus_tag="PC1_0247"
     CDS             complement(291490..292491)
                     /locus_tag="PC1_RS01270"
                     /old_locus_tag="PC1_0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010681554.1"
                     /note="in Escherichia coli this periplasmic enzyme was
                     found to encode the periplasmic catalytic subunit of an
                     oxidoreductase; requires inner membrane anchor protein
                     YedZ; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfoxide reductase catalytic subunit YedY"
                     /protein_id="WP_012772972.1"
                     /db_xref="GI:502365713"
                     /translation="MHKHRKPTEADVTPESLFYQRRRILKALGISAAALSLPFSAQAD
                     LLAWFKGTDKPKAPPGKPLTFSQPADWKLDLPLTPEDKVTGYNNFYEFGLDKADPAAN
                     AGGLKTEGWTIKIDGDVAKPLTLDIDDLLKRFPLEERIYRFRCVEAWSMVIPWVGFEL
                     AKLIKFAEPTSNARYVAFQTLYDPEQMPGQKDRFMGGGLDYPYVEGLRMDEAMNPLAL
                     LAVGVYGKTLPPQNGAPIRLVTPWKYGFKNIKSIVHIRFTREKPPCTWNLAAPDEYGF
                     YANVNPHVDHPRWSQATERVIGSGGLLNVERQPTLLFNGYAEQVASLYRGLNLRDNF"
     gene            complement(292795..293772)
                     /locus_tag="PC1_RS01275"
                     /old_locus_tag="PC1_0249"
     CDS             complement(292795..293772)
                     /locus_tag="PC1_RS01275"
                     /old_locus_tag="PC1_0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_012772973.1"
                     /db_xref="GI:502365715"
                     /translation="MQALVLEQSDGLTHAQIREIDAEQLPTGDVTVDINWSGINYKDA
                     LAITGKGKIIRNFPMVPGIDFAGTVRHSDSDRFTAGQPVILTGWGVGENHWGGLAQQA
                     RVKSDWLVPLPASLDARKAMILGTAGFTAMLCVMALEDGGITPESGDIIVTGASGGVG
                     STAVALLAELGYQVTAVSGRADNTDYLKKLGAKQVLDRSEFSGSPRPLEKQRWAGAVD
                     TVGDNVLATLLAQMDYNATVAACGLAGGIALPTTVMPFILRNVRLQGVDSVMAPLARR
                     QQAWERLATILPESFYQQVTQEIGLEDVPATAAALLENKVTGRTLVKIS"
     gene            294076..296013
                     /locus_tag="PC1_RS01280"
                     /old_locus_tag="PC1_0251"
     CDS             294076..296013
                     /locus_tag="PC1_RS01280"
                     /old_locus_tag="PC1_0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772975.1"
                     /note="regulates the degradation of the small RNAs CsrB
                     and CsrC; may function to targate RNase E to specific RNA
                     molecules; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772975.1"
                     /db_xref="GI:502365717"
                     /translation="MGFTTRFSILVVLLTVLAIFLMLFSSIFSLCYYSQLRTEQQLRE
                     VTASIDQALLVQSPENIQYWLPSMMKTAGIVVLDIQDNDSTLYSIQLPEAGWERTHLY
                     HEVEFPLMHHLNMTIAIRYVDPLIGLPRFVVSMLSVLLAAGLMLLMLYFSIRWLRRQA
                     AGQEELEERAQRILKGERESVMQGSVREWPVNTSGALDQLLSDLVEAREERGRVDTLI
                     RAFAAQDAETGLSNRLFFDNQLTTQLEDGEEVGTHGVVMMIRVPDFETLQETHGYSSA
                     LQEYRFTLVNLLSTFVMRYPSALLARYFSSDFTVLLPHSTLKEANAIATQLVKSIDIL
                     PACPLIDREEVLHIGICAYRGGQSAEQVMESVEDATRNAVLQGGNSWCVFDRQVPEKG
                     RGSVKWRTLLEQTLARGGPRLYQKPAVTKEGVVHHREMMSRIYDGEQELLAAEYMPLV
                     QQLGLAASYDRQLVARIIDLSANWPGETLALPVSVDSLLQKPFLRWLKEVLLQCPKTQ
                     RQRILFELAEADVCQYIGRLRPVLTVILGLGCRLAVTQAGLTLVSTTYIKSLPVEIIK
                     LHPGLVRSLERRPENQLFVQSLTEACKGTQTRVFAAGVRTKEEWRMLLGKGVYGGQGD
                     FFAASVLVTDELKKYSSQHRV"
     gene            296330..297373
                     /locus_tag="PC1_RS01285"
                     /old_locus_tag="PC1_0252"
     CDS             296330..297373
                     /locus_tag="PC1_RS01285"
                     /old_locus_tag="PC1_0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein Mbl"
                     /protein_id="WP_010300322.1"
                     /db_xref="GI:497986166"
                     /translation="MFKKFRGMFSNDLSIDLGTANTLIYVKGQGIILNEPSVVAIRQD
                     RAGSQKSVAAVGHDAKQMLGRTPGNIVAIRPMKDGVIADFQVTEKMLQHFIKQVHSDS
                     FMRPSPRVLVCVPVGATQVERRAIRESALGAGAREVFLIEEPMAAAIGAGMPVSEATG
                     SMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERI
                     KHEIGSAYPGDEVLEIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMAALE
                     QCPPELASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALE
                     MIDMHGGDLFSEE"
     gene            297549..298532
                     /locus_tag="PC1_RS01290"
                     /old_locus_tag="PC1_0253"
     CDS             297549..298532
                     /locus_tag="PC1_RS01290"
                     /old_locus_tag="PC1_0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010681557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreC"
                     /protein_id="WP_012772976.1"
                     /db_xref="GI:502365718"
                     /translation="MKPLFSRGPSLQLRLFLAVVTAIVVIVADSRLGSFVKIRTYMDT
                     AVSPFYFLANGPRQVLDNMSASLATREQLGLENTALRQELLMKNSDLLMLGQLKQENA
                     RLRELLGSPLRQDEQKMVTQVMSAGTDPYSDQVVIDKGQTNGVYEGQPVISDKGVVGQ
                     VVAVGQFTSRVLLICDVSHALPIQVLRNDIRVIAAGNGCADDLQLEHLPNNTDIRVGD
                     VLVTSGLGGRFPEGYPVAVVSSVKADTQRAYTIIQARPTAGLQRLRYLLLLWGVENNS
                     NTSLPPAEVHRVANERLMQMMPQVLPSPDDMGPPLPPDTAAPTVEPQRGRQ"
     gene            298529..299017
                     /locus_tag="PC1_RS01295"
                     /old_locus_tag="PC1_0254"
     CDS             298529..299017
                     /locus_tag="PC1_RS01295"
                     /old_locus_tag="PC1_0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010300327.1"
                     /note="part of cell wall structural complex MreBCD;
                     transmembrane component; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreD"
                     /protein_id="WP_012772977.1"
                     /db_xref="GI:502365719"
                     /translation="MNRYRRHGNWIIWLSFLIAMVLQIMPWPDEIYMFRPSWLTLFLI
                     YWVMALPHRVNVGTGFILGLIMDLILGSTLGVRALALSIIAYLVAFKFQLFRNMALWQ
                     QALIVMLLSLLMDLTVFWAEFLVINVSFRPETFWNSVVDGVLWPWLFLLMRKIRRQFT
                     VQ"
     gene            299026..299619
                     /locus_tag="PC1_RS01300"
                     /old_locus_tag="PC1_0255"
     CDS             299026..299619
                     /locus_tag="PC1_RS01300"
                     /old_locus_tag="PC1_0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DAI3.1"
                     /note="Maf; overexpression in Bacillus subtilis inhibits
                     septation in the dividing cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation inhibitor Maf"
                     /protein_id="WP_012772978.1"
                     /db_xref="GI:502365720"
                     /translation="MTQLYLASASPRRRELLTQLDIPFAVLNVAVEEQRLPEEAAEVY
                     VRRLAHEKAAAGVAAAPLDLPVLGADTIVVLNGQVLEKPQDEAHAAEMLSQLSGKPHQ
                     VMTAVALADKDDILSCLVITDVVFRPLSQQDIERYIASGEPMDKAGAYGIQGKGGCFV
                     RSLNGSYYAVVGLPLVETHELFSNFAALRSARGKHDC"
     gene            299609..301078
                     /locus_tag="PC1_RS01305"
                     /old_locus_tag="PC1_0256"
     CDS             299609..301078
                     /locus_tag="PC1_RS01305"
                     /old_locus_tag="PC1_0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009651913.1"
                     /note="involved in the processing of the 5'end of 16S
                     rRNA; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease G"
                     /protein_id="WP_012772979.1"
                     /db_xref="GI:502365721"
                     /translation="MTAELLVNVTPSETRVAYIDGGILQEIHIERDAKRGIVGNIYKG
                     RVSRVLPGMQAAFVDIGLDKAAFLHASDIMPHTECVAGDEQKNFHVRDIAELVRQGQD
                     LMVQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESEAERERLKKTVAE
                     YCDDDGGFIIRTAAEGIGEEELSQDAAFLKRLWGKVMERKKRNQTKCKLYGEVALAQR
                     ILRDFAGAALDRIRIDSRLTYEALLEFTSEYIPEMTRKLEHYAGKQPIFDLFDVENEI
                     QRSLDRKVELKSGGYLIIDQTEAMTTIDINTGAFVGHRNLDETIFNTNTEATQAIARQ
                     LRLRNLGGIIIIDFIDMNNDDHRRRVLHSLEQALSKDRVKTSINGFSQLGLVEMTRKR
                     TRESIEHVLCHECPTCHGRGTVKTVESVCYEIMREIVRVHHAYDTDRFLVYASPAVGE
                     ALKSEESHALAEVEIFVGKQVKVQIEPLYSQEQFDVVMM"
     gene            301120..304950
                     /locus_tag="PC1_RS01310"
                     /old_locus_tag="PC1_0257"
     CDS             301120..304950
                     /locus_tag="PC1_RS01310"
                     /old_locus_tag="PC1_0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012772980.1"
                     /db_xref="GI:502365722"
                     /translation="MRRLPGIVVITGATLVVMVALLVSGLRLVLPQLDHFRPQLVAWA
                     QSAAGVPLEIGSMTGRWESFGPTLEIEKLRTSLPESDWQVDRITLALDVWQSLLHGRW
                     QFRDLTFHQLKLDINSPFTGQQQDSKLMESGKVSDLFLRQFDHFDLRDSHITFLTPSG
                     SRAELSIPQLTWLNSDKRHRAEGLISLSSFNGQHGVVQMRMDLHDEQGLLSNGTFYLQ
                     ADNIDMKPWLSRWMKNNTGLESADFSLAAWLNVRDGGIHSGDVFLNQGTANWGDGPDA
                     HRLNVDDMTLHVSRQENGWQVDVPELNLATDGTAWPKGRLSALWLPKNEHMLGPDRQE
                     ELRIRASNLALERVSTLLPLLSSTTPALKERWAELQPTGTLNTVAVDIPLQQPERSRF
                     QANWQDVSWKQWKLLPGVDHFSGSARGSAERGQVSVALKQSTLPYVDMFRAPLEIQQA
                     SGTIDWRNDAQGLALWSHGLDVQAKSLWANGDFRYEQPVKQEPKLDILAGIRLTDAAD
                     AWRYYPEQFMGTELVDYLSGALKGGRVDNATLIFAGNPQHFPYTHNEGQFEVWVPVKG
                     ATFEFQPGWPALTPLDINLDFANNGLWMFAPQTWLGKVEGKNISAVIPDYEKEMLLID
                     GELEGPGPEVGNYFNQTPLKSSLGTALDELKIGGPVKGSLHLDIPLVGDDVHASGDIA
                     LNNNSLYIKPLNTTIKNLTGKFRYENGNLRSDTLQANWMNQPMAVNFTTEEQAKAFLV
                     NVGLQGDWQPALLPGLPASASKALSGTAGWKSTVAVNLPHTGKTTYEVDVQADLNKVS
                     SHLPNPLNKPAGESLPLEVKASGDLNGFAIQGRLGKDNRFNSQWLLKGDTVTLARASW
                     QNAATASPALPDDSSLVLDLPSLDAESWLGLLPSLRASASAEGRKAQSSLRFPEAVTL
                     RTPELQLLGQQWHDLEITRKNTLAGSEVKAKGREIDGTVEIPNRGMWRSDINYLYYNP
                     QWKGNEATNPVALAEKKSPLNDPSISFEDWPSLAVNCRQCWIIGQNMGRIQGTLLPEK
                     EKLTLTDGIIDTGKARLTVNGTWQENAEGVRTALKGRLTGDSLEQNANWFGVDSPLKA
                     GSFDVDYDLYWRGTPWAPDIASLSGILHTRIGKGEIAEVGAGQAGQLLRLLSFDALMR
                     KLRFDFSDTFGRGFYFDSIRSTAWIKDGVLHTDDMLIDGLEADIAMKGDLDLAKRQVN
                     MEAVIAPEISATVGVATAFAVNPVIGAAVFAASKVLAPLWNKISLIRYQISGSLDQPK
                     IQEVLREPNKKKGE"
     gene            305007..306452
                     /gene="tldD"
                     /locus_tag="PC1_RS01315"
                     /old_locus_tag="PC1_0258"
     CDS             305007..306452
                     /gene="tldD"
                     /locus_tag="PC1_RS01315"
                     /old_locus_tag="PC1_0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114764.1"
                     /note="responsible for the proteolytic maturation of the
                     E. coli pMccB17 plasmid-encoded microcin B17, an exported
                     protein that targets the essential topoisomerase II DNA
                     gyrase; degrades the E. coli plasmid F-encoded CcdA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease TldD"
                     /protein_id="WP_012772981.1"
                     /db_xref="GI:502365723"
                     /translation="MSLSFVSEQLLTANKLNLDDLAAVLGSLNERRLDYADLYFQSSY
                     HESWVLEDRIIKDGSYNIDQGVGIRAIDGEKTGFAYADQITLNALHQSAQAARSIVRE
                     QGTGTARTLGEVSHRALYPTLNPLDSLTREDKIALLQRADTVARAADARVQEVSASLT
                     GVYELVLVAATDGTLAADVRPLVRLSISVLVEAEGKRERGSSGGGMRGGYDYFWEVAD
                     GEARVDAWAKEAVRMALVNLSAVAAPAGPMPVVLGAGWPGVLLHEAVGHGLEGDFNRR
                     GTSVFSGQMGKLVASELCTVVDDGTLSGRRGSLSMDDEGVPGQYNVLIENGILKGYMQ
                     DKLNARLMGVAPTGNGRRESYAHLPMPRMTNTYMLAGKSTPEEIISSVEYGLYAPNFG
                     GGQVDITSGKFVFSTSEAYLIEKGRITTPVKGATLIGSGIEAMQQISMVGNDLALDKG
                     VGVCGKEGQSLPVGVGQPTLKLESLTVGGTA"
     gene            complement(306537..307130)
                     /locus_tag="PC1_RS01320"
                     /old_locus_tag="PC1_0259"
     CDS             complement(306537..307130)
                     /locus_tag="PC1_RS01320"
                     /old_locus_tag="PC1_0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010681563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772982.1"
                     /db_xref="GI:502365724"
                     /translation="MKIFKVGDTQSALCNTCQSLETATFQLRDVPFSDNSGVVRQVLV
                     GVCNRCGNVAIIPHQSTPMIKKARDVQRKALESRVPAHMIDILNLASCELGGEPDFIP
                     TLMKYYLHTLAADRAAAQDIPRFLQSDLAKGKSEKRLSLKGRHVATDIDVLKTTTNIS
                     STTDLLKGIVLKIKEDVLVQRDEIHIRQLKSIIAAVS"
     gene            complement(307140..307436)
                     /locus_tag="PC1_RS01325"
                     /old_locus_tag="PC1_0260"
     CDS             complement(307140..307436)
                     /locus_tag="PC1_RS01325"
                     /old_locus_tag="PC1_0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043881862.1"
                     /db_xref="GI:762768353"
                     /translation="MGFKDAKKQLIVCLQSGTVLHEARGNISTKNLLATGQASITELI
                     DIIYQSSGTSYSSSPHHFAAHIDVHIIRCRHRGISWYIKWYFAEPNCVFISVHH"
     gene            complement(307589..308524)
                     /locus_tag="PC1_RS01330"
                     /old_locus_tag="PC1_0261"
     CDS             complement(307589..308524)
                     /locus_tag="PC1_RS01330"
                     /old_locus_tag="PC1_0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772984.1"
                     /note="for aaeXAB operon; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012772984.1"
                     /db_xref="GI:502365726"
                     /translation="MERLKSMSVFARVVEFGSFTAAARQLQMSVSAVSQTVTKLEDEL
                     QIKLLNRSTRSIGLTEAGKIYYHGCRRMLHEAHEVHEQLYAFNNTPIGTLRIGSSSTM
                     AQNVLSTMTAAMLKEYPGLSVNLVTGIPAPDLIADGLDIVIRVGALQDSSLFSKRLGS
                     MPMVICAAKSYLAQHGTPDKPADMVNFSWLEYSVRPDSEFELIAPEGISTRVTPQGRF
                     VTNDPQTLVRWLKAGAGIAYVPLMWVVDEINRGEIEILFNRYHSDPRPVYALYTRKDN
                     LPLKVQVCINYMTEYFKNVALTYQGYRQDHGEEKK"
     gene            308950..309153
                     /locus_tag="PC1_RS01335"
                     /old_locus_tag="PC1_0262"
     CDS             308950..309153
                     /locus_tag="PC1_RS01335"
                     /old_locus_tag="PC1_0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DIM1.1"
                     /note="membrane protein AaeX; the gene is a member of the
                     aaeXAB operon; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein AaeX"
                     /protein_id="WP_012772985.1"
                     /db_xref="GI:502365727"
                     /translation="MSSLPVMVLFGLSFPPVFFVLLVSLTLFFVVNCLLQPTGIYDFV
                     WHPALFNSALFCCLFYLLFRYGL"
     gene            309161..310126
                     /locus_tag="PC1_RS01340"
                     /old_locus_tag="PC1_0263"
     CDS             309161..310126
                     /locus_tag="PC1_RS01340"
                     /old_locus_tag="PC1_0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DIM2.1"
                     /note="with AaeB forms an efflux pump whose substrates are
                     p-hydroxybenzoic acid, 6-hydroxy-2-naphthoic and
                     2-hydroxycinnamate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="p-hydroxybenzoic acid efflux pump subunit AaeA"
                     /protein_id="WP_012772986.1"
                     /db_xref="GI:502365728"
                     /translation="MKAFFLTLFRQQAVLIKKMSRVAITLVIVLCAIVAIFRVWAFYT
                     ESPWTRDAKFTADVVAIAPDVSGLLSDVRVTDNQLVNKGDVLFVIDQPRYHQAVAQAE
                     ADVAYYQALVTEKRRESGRRARLGISAMSQENIDQSSNALETATHQLAKAQVVLSLAQ
                     LELERTVVRAPADGWVTNLHVQSGEFIERGNTAVALVKKDSFYLLAYMEETKLEGVRR
                     GYRAEITPLGSEKIFYGTVDSVAAGVNNSSSSANNKGLANVDSNLEWVRLAQRVPVKI
                     RLDRQMGDLYPAGTTATVVITGEQVNNDKKPSPLIRLLYRLREFG"
     gene            310138..312126
                     /locus_tag="PC1_RS01345"
                     /old_locus_tag="PC1_0264"
     CDS             310138..312126
                     /locus_tag="PC1_RS01345"
                     /old_locus_tag="PC1_0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DIM3.1"
                     /note="with AaeA forms an efflux pump whose substrates are
                     p-hydroxybenzoic acid 6-hydroxy-2-naphthoic and
                     2-hydroxycinnamate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="p-hydroxybenzoic acid efflux pump subunit AaeB"
                     /protein_id="WP_012772987.1"
                     /db_xref="GI:502365729"
                     /translation="MKTPSLTGPVFFTTPKFARLRFAFKLSFAIVLSLFLGFHLQLET
                     PRWSVLTAAIVAAGPAFAAGGEPFSGAIRHRGMLRVVGTFIGCIGALIIIIATVRAPV
                     VMLMLCCIWAGLCTWVSSLVKVENAYVFGLAGYTTLIIIVSTQGTPLLTPQFAVERCS
                     EIVLGIVCAILADLLFSPRSIKQDVDRSMGELLVDQYRLLQLSMSGAEKETIDAAWHA
                     LVRKTTALSGMRSSLMLESSRWQNSNRRLTSLHTQSLTMITQACETYLVLQDAPTPVK
                     SSLKLVLDQPVESFRDVHCRVKALRHLIAADSRDVPPTLVSWVGAATRYLLLAKGVQT
                     NGRITTIEADVLNSEVEIKAPSAETHHAMINGLRTGVATALGCLFWLSTGWTSGSVCM
                     VMIAVVTSLAMRLPNPQMMAKDFLFGTIYALPLGALMFMFIMPSTQQSMLLLCLSLGA
                     MAFFLGLEVQKRRLGSLGALASTINILVLDNPMTFHISQFLDSAIGQIIGCFLALMVI
                     LLIRDNTKAHTGRTLLNRFVYGAVSALTTNTTRRKENHLPALYQQLFLLLNRFPDDIA
                     KYRLALWLIIMHQRLRTLDIPQNAALSAFHRQIRATAEQVILARRDTTRSRYFTQLLG
                     ELERYQQMLTEQQLPASVTAPVGRLTGILRDYQHALSN"
     gene            312266..313720
                     /gene="gabD"
                     /locus_tag="PC1_RS01350"
                     /old_locus_tag="PC1_0265"
     CDS             312266..313720
                     /gene="gabD"
                     /locus_tag="PC1_RS01350"
                     /old_locus_tag="PC1_0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011091914.1"
                     /note="catalyzes the formation of succinate from succinate
                     semialdehyde; NADP dependent; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate-semialdehyde dehydrogenase"
                     /protein_id="WP_012772988.1"
                     /db_xref="GI:502365730"
                     /translation="MSGQNLQDHELFKTGYFAAGKWQQGTATFEVVNPATGETIASVA
                     KAGKKETQAAIDAAYAAFPAWKRKTAKERSEILYRWYELILENKRYLAELMTAEQGKP
                     VQEAEGEVVYAASFIQWFAEQGKRANGEIIPSAKPGSKIYATREPVGVVVAITPWNFP
                     LAMLTRKLGPALAAGCTGVIKPANNTPLSAFALLALAQQAGVPDGVLNGVAGDTQAIS
                     DTVMASDKVRKISFTGSTTVGKTLVRNAADTMKKVSMELGGNAPYIVFDDADIQAAVK
                     GAIANRFRNAGQVCVSANRFYIQDGVYDEFVSLLAEEVKRLKVGNGMDDGVVLGPLID
                     DAAVEKVEKHVNDAVEKGGKALVGGQRHKLGHSFFEPTVIVDANEAMLLAQEETFGPV
                     APCFRFKTEEEVIERANNTPFGLAAYFYSQNLQRVFRVAEALESGMVGINECAVSTEL
                     APFGGVKESGLGREGSVLGLDEFLEVKTWHLGGL"
     gene            complement(313816..314367)
                     /locus_tag="PC1_RS01355"
                     /old_locus_tag="PC1_0266"
     CDS             complement(313816..314367)
                     /locus_tag="PC1_RS01355"
                     /old_locus_tag="PC1_0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012772989.1"
                     /db_xref="GI:502365731"
                     /translation="MKQKYEDWLNDVPDNQEDDEDDEIIWVSKSEIKRDAEALKDLGA
                     ELVDLGKNALEKIPLDDDLRAAVELAQRIKKEGRRRQLQLIGKMLRARDPEPIQTALD
                     KLNNRHNQQVALFHKLEQLRDRLIEEGDDVVPDILALYPHADRQQLRSLVRNAQKEKA
                     ANKPPKSARQIFQYLRELAETTD"
     gene            314665..316005
                     /gene="pmbA"
                     /locus_tag="PC1_RS01360"
                     /old_locus_tag="PC1_0267"
                     /gene_synonym="tldE"
     CDS             314665..316005
                     /gene="pmbA"
                     /locus_tag="PC1_RS01360"
                     /old_locus_tag="PC1_0267"
                     /gene_synonym="tldE"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010681570.1"
                     /note="protease involved in proteolytic processing of the
                     antibiotic Microcin B17 and in sensitivity to the DNA
                     gyrase inhibitor LetD; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase PMbA"
                     /protein_id="WP_012772990.1"
                     /db_xref="GI:502365732"
                     /translation="MTITTQVAEQRKALELAVAQALELARAGSDAAEVAVTKTTGISV
                     STRYGDVENVEFNSDGALGITVYHQQRKGSASSTDLSPDAIARTVQAALDIARYTSVD
                     PFAGPADRDLLAFDAPDLDLFHPTELDADRGIELAARAEQAALQADKRITNTEGGSFN
                     SHYGVKVFGNSHGLLKSYCSSRHSMSSCVIAEVNGDMERDYAYTVGRALDDLLSPEWV
                     GEECARRTLSRLSPRKLPTMQAPVMFSAEVATGLFGHLVGAISGGSVYRKSTFLLDKL
                     GQQILPEWLTIEEQPHLLKGLASTPFDSEGVRTQAREIVKAGVLQTWLMTSYSARKLG
                     MKSTGHAGGIHNWRIAGQGLDFNGMLKQMGKGLLVTELMGQGVSGVTGDYSRGASGFW
                     VENGEIQYPVSEITIAGNLKDMLRNIVTVGNDIETRSNIQCGSVLLPDMKIAGE"
     gene            316445..319624
                     /locus_tag="PC1_RS01365"
                     /old_locus_tag="PC1_0268"
     CDS             316445..319624
                     /locus_tag="PC1_RS01365"
                     /old_locus_tag="PC1_0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_012772991.1"
                     /db_xref="GI:502365733"
                     /translation="MSGKTAVPQPPIKPVIGNLADVDPRNSIDSLMKLAKTYGPFFKM
                     RIFSDEFYVASSQELVNELSDESFFEKKLSAELLELRYLGGDGLFTAHTHEPNWGKAH
                     RILMPALGPLGVRSMFDKMLDISEQMFLRWERFGPDVDIDVADNMTRLTLDTIALCGF
                     DYRFNSFYRDDLLPFVKAIVGSLKEAGLRVRRPGIVNKLMIPSTRQYRTDKALMYSVV
                     EQLIAARKMDPKASEKNDLLNRMLNGVDPQTGEKLSDENIAHQMLTFLVAGHETTSGM
                     LSFTVYFLLKNPNVLNKARAIVDEVLGDEIPRIEHLAQLRYLEQILMESLRMWPTAGG
                     HVVSPTQDTILAGKYPLTPKDSIVILQPQLHRDVKAWGDDANLFKPERFGPDNAENLL
                     PNSWQPFGSGKRACIGRMFAMQEAQLVLAMMLQRFDFELSDPSYELKIVEHLTIKPDN
                     LKIRIRVRKPSKTLARGVTPKETSNKMAVMPVAKAQHHQDLIPLLVLHGGNTGSSEAF
                     ANRIAADAQRYGFASTLAALDDYAEKLPQTGALIVITASYEGMPPNNARHFVPWVEGL
                     ADDALSGLKFSVFGCGNLQWVRTYQAIPKRVDLALEHAGGERIHERGVADSGGDFFGN
                     FDDWYTKLWPALTTAFGRQGAVAEDATELELEFVHTDRVSTLQIPDMGRGVVVENREL
                     VDMTSPFARSKRHIEIRLPEGMAYRAGDYLAVLPRNSDDQIDRVLRRFGLSPDMMLVI
                     NQAPDVTGLPIGQPISCAELLGNYVELSQPATRAQVAALAAATRCPPEKMELEKLATE
                     HYENDVLAPRLSVLDLLYRFQSCPTDFRRYLTMLPSIKARQYSISSSPAWKPDHVTLT
                     VAVVDSPALSGIGRYKGVASNYLASLKPDDRIAIVVRPSSPFFHLPDDPSIPIILIGA
                     GSGIAPFRGFLQERALQQAAGVRVGPALLFFGTGHPDVDYLYRDELAAWEKSHIVTVL
                     PAFSHQPDGEVTFVQHRVWADRERIKTLFCNGGSLFVCGDGLRMVPEVRDMLLRIYRE
                     ATGSNETDAMLWADKLEREQGRYVVDMFI"
     gene            complement(319764..320174)
                     /locus_tag="PC1_RS01370"
                     /old_locus_tag="PC1_0269"
     CDS             complement(319764..320174)
                     /locus_tag="PC1_RS01370"
                     /old_locus_tag="PC1_0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913850.1"
                     /note="Regulates the synthesis of nucleoside triphosphates
                     for nucleic acid synthesis, CTP for lipid synthesis, and
                     GTP for protein elongation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase regulator"
                     /protein_id="WP_012772992.1"
                     /db_xref="GI:502365734"
                     /translation="MTKPNLTISELDAERLDMLLEQPAFADSDIAQALNEELDRAEIL
                     PSASIPSHVVTMNSRVRFRDLNTNEEHIRTLVYPAAVKDSQEPLSVMAPLGAALLGMH
                     VGNAITWQLPNGEETRIEVLELLYQPEAAGEYHR"
     gene            complement(320345..320617)
                     /locus_tag="PC1_RS01375"
                     /old_locus_tag="PC1_0270"
     CDS             complement(320345..320617)
                     /locus_tag="PC1_RS01375"
                     /old_locus_tag="PC1_0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohistidinoprotein-hexose
                     phosphotransferase"
                     /protein_id="WP_012772993.1"
                     /db_xref="GI:502365735"
                     /translation="MTVRQTVEIKNKLGMHARPAMKLFELVQSFDAEVILRNDSGTEA
                     EASSVIAMLMLDSAKGRLIEVEATGPDEAQALAAVIGLFEAGFDED"
     gene            complement(320649..321506)
                     /locus_tag="PC1_RS01380"
                     /old_locus_tag="PC1_0271"
     CDS             complement(320649..321506)
                     /locus_tag="PC1_RS01380"
                     /old_locus_tag="PC1_0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DAG8.1"
                     /note="glucosamine-6-phosphate regulated; inactivates the
                     glmS upregulator glmZ; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glmZ(sRNA)-inactivating NTPase"
                     /protein_id="WP_010296630.1"
                     /db_xref="GI:497982474"
                     /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPELANTL
                     AARNISAAVSIDVRNMPESPEIFEHAMEQLPPSFSPQLLFLDADRNTLIRRYSDTRRL
                     HPLSSKNLSLESAIDEESDLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKREREL
                     TMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVASFLDRHTEVHNF
                     IYQTRSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRGKNVQSRH
                     RTLEKRKPS"
     gene            complement(321667..322140)
                     /locus_tag="PC1_RS01385"
                     /old_locus_tag="PC1_0272"
     CDS             complement(321667..322140)
                     /locus_tag="PC1_RS01385"
                     /old_locus_tag="PC1_0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011091919.1"
                     /note="involved in nitrogen metabolism; protein IIA is
                     phosphorylated by enzyme I(Ntr); Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS nitrogen regulatory protein IIA(Ntr)"
                     /protein_id="WP_039279069.1"
                     /db_xref="GI:746230273"
                     /translation="MNHDPVLQLSTVLRPECTRSTVHCQSKKRALEIISELAARQLNI
                     PSQIIFDAILTRERMGSTGIGGGIAIPHGKLEDDNALGAIGVFIQLEQPIAFDAIDNQ
                     AVDLLFALLVPAEQCKTHLHTLSLVAKRLADKTVCRRLRAAQSDEELYQIMTEAG"
     gene            complement(322237..322524)
                     /locus_tag="PC1_RS01390"
                     /old_locus_tag="PC1_0273"
     CDS             complement(322237..322524)
                     /locus_tag="PC1_RS01390"
                     /old_locus_tag="PC1_0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975449.1"
                     /note="YhbH; resting ribosome-binding protein involved in
                     ribosome stabilization and preservation in stationary
                     phase; binds specifically 100S ribosomes (an inactive
                     ribosome product of a 70S ribosome dimerization); seems to
                     be involved in modulation of the sigma(54) (RpoN) activity
                     for quorum sensing; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome hibernation promoting factor HPF"
                     /protein_id="WP_012772995.1"
                     /db_xref="GI:502365737"
                     /translation="MQLNITGHHIEITEPLRDFVNGKFAKLEQYFDRINQVNVVLRVE
                     KVQQIAEATIHVNGGELHATSEAEDMYAAIDLLIDKLARQLNKHKDKLKQH"
     gene            complement(322548..323981)
                     /locus_tag="PC1_RS01395"
                     /old_locus_tag="PC1_0274"
     CDS             complement(322548..323981)
                     /locus_tag="PC1_RS01395"
                     /old_locus_tag="PC1_0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822090.1"
                     /note="sigma factors are initiation factors that promote
                     the attachment of RNA polymerase to specific initiation
                     sites and are then released; sigma 54 factor is
                     responsible for the expression of enzymes involved in
                     nitrogen assimilation and metabolism; the rhizobia often
                     have 2 copies of this sigma factor; in Rhizobium etli
                     RpoN1 shown to be involved in the assimilation of several
                     nitrogen and carbon sources during free-living aerobic
                     growth and RpoN2 is involved in symbiotic nitrogen
                     fixation; in Bradyrhizobium both RpoN1 and N2 are
                     functional in free-living and symbiotic conditions, rpoN1
                     gene was regulated in response to oxygen; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-54"
                     /protein_id="WP_012772996.1"
                     /db_xref="GI:502365738"
                     /translation="MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQEIQQALESN
                     PLLEQTDQHDEIESFEKADSDSLDTGEALEQRDMPEELPIDATWDEIYSAGTPSGTGT
                     DYRDEELPIYQGETTQTLQDYLMWQVELTPFSDTDAAIATSIVDAVDNTGYLTVPLED
                     ILDSIGDDDVTLEEVEAVLKRVQRFDPVGVAARDLRDCLLVQLSQFADSTPRLAEARL
                     IVSDHLDLLANHDFRSLIRVTRLKEEVLKEALALIQSLDPRPGQSINTGESEYVIPDV
                     LVRKVQGIWAVELNTDSIPRLQINQQYAALGNSARNDSDGQFIRSNLQEARWLIKSLE
                     SRNDTLLKVTRCIVEQQQDFFEQGEEFMKPMVLADIAQAVDMHESTISRVTTQKFLHS
                     PRGIFELKYFFSSHVNTDSGGEASSTAIRALVKKLIAAENPVKPLSDSKLTALLSDQG
                     IIVARRTVAKYRESLSIPPSNQRKQLI"
     gene            complement(324031..324756)
                     /locus_tag="PC1_RS01400"
                     /old_locus_tag="PC1_0275"
     CDS             complement(324031..324756)
                     /locus_tag="PC1_RS01400"
                     /old_locus_tag="PC1_0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS ABC transporter ATP-binding protein"
                     /protein_id="WP_010296638.1"
                     /db_xref="GI:497982482"
                     /translation="MATLTAENLAKAYKGRKVVENVSLTVNSGEIVGLLGPNGAGKTT
                     TFYMVVGIVPRDEGRIVIDDDDISLLPLHERALRGIGYLPQEASIFRRLSVYDNLMAV
                     LQIRKDLTTEQQEDRANELMEEFHIIHLRDSLGQSLSGGERRRVEIARALAANPKFIL
                     LDEPFAGVDPISVLDIKKIIEHLRDSGLGVLITDHNVRETLDVCERAYIVSQGNLIAH
                     GSPTDILADEQVKRVYLGEGFRL"
     gene            complement(324760..325332)
                     /locus_tag="PC1_RS01405"
                     /old_locus_tag="PC1_0276"
     CDS             complement(324760..325332)
                     /locus_tag="PC1_RS01405"
                     /old_locus_tag="PC1_0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975458.1"
                     /note="LptA; periplasmic binding protein part of a
                     putative ABC superfamily of uptake transporters; interacts
                     with LptB protein, the ATP binding component of the uptake
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_012772997.1"
                     /db_xref="GI:502365739"
                     /translation="MKSKTNNLMRNTLIASSLFAVSVSAFAVTGDSNQPIRIDSAQQS
                     LDMQGNTVTFTGNVVVKQGTIEVKADKVVVTRPQGTQGSEVVEGYGNPVTFYQMQDNG
                     KPVKGHAQKIRYELAKDLLVLTGNAYLEQQDSNVKGDRITYLVKQQQMEATSEKGKRV
                     TTVLVPSQLQDKENKSQPSRSQQPQPRVTE"
     gene            complement(325313..325879)
                     /locus_tag="PC1_RS01410"
                     /old_locus_tag="PC1_0277"
     CDS             complement(325313..325879)
                     /locus_tag="PC1_RS01410"
                     /old_locus_tag="PC1_0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_012772998.1"
                     /db_xref="GI:502365740"
                     /translation="MSKTKRWLTAFLALLVLILIGWNIADDDTVAAPDANDPAVPVYT
                     SEKTNTQVYSPAGKLSYRLISEKAEYFNDEQLSWFTAPVATLFNEQGTATWSVRADRA
                     KLTKDKMLYLYGHVEVNSLTKDAQLQRITTNNAQVNLVTQDVSSDDEVTLYGTSFTSS
                     GMKMRGNLRNKTAELIEKVKTSYEIQNQ"
     gene            complement(325876..326442)
                     /locus_tag="PC1_RS01415"
                     /old_locus_tag="PC1_0278"
     CDS             complement(325876..326442)
                     /locus_tag="PC1_RS01415"
                     /old_locus_tag="PC1_0278"
                     /EC_number="3.1.3.45"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975463.1"
                     /note="forms homotetramers; catalyzes hydrolysis of KDO
                     8-P to KDO and inorganic phosphate; functions in
                     lipopolysaccharide biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonate 8-phosphate
                     phosphatase"
                     /protein_id="WP_012772999.1"
                     /db_xref="GI:502365741"
                     /translation="MSEVRAQTDTCYGPVDQQVLDKAREVRLLICDVDGVMSDGLIYM
                     GNHGEELKAFNVRDGYGIRCLLTSGIEVAIITGRSAKLLEDRCKTLGINHLYQGQSDK
                     VLAFNDLLDKLSVTANQVAYIGDDMIDWPVMAQVGLSVAVADAHPLLLPRADYVTRIA
                     GGRGAVRELCDLILFSQDKLEHAKGLSI"
     gene            complement(326461..327432)
                     /locus_tag="PC1_RS01420"
                     /old_locus_tag="PC1_0279"
     CDS             complement(326461..327432)
                     /locus_tag="PC1_RS01420"
                     /old_locus_tag="PC1_0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-arabinose 5-phosphate isomerase"
                     /protein_id="WP_043881863.1"
                     /db_xref="GI:762768364"
                     /translation="MPADFDFQQAGKQVISIERDGLAQLDQYIDDNFTLACKKIFDCQ
                     GKVVVMGMGKSGHIGCKMAATFASTGTPAFFVHPGEASHGDLGMVTPHDIVIAISNSG
                     ESHEILSLIPVLKRQKVFLICMTSAPESTMGKAADIHLCVHVPQEACPLGLAPTSSTT
                     ATLVMGDALAVALLQARGFTAEDFALSHPGGALGRKLLLRVSDIMHSGDEIPHVPHDA
                     SLRDALVEITRKNLGMTVICEADMKIQGIFTDGDLRRIFDMNIDLNSARIADVMTAGG
                     IRVAPQTLAVDALNLMQSRHITSVLVAENDRLVGIVHMHDMLRAGVV"
     gene            complement(327593..328558)
                     /locus_tag="PC1_RS01425"
                     /old_locus_tag="PC1_0280"
     CDS             complement(327593..328558)
                     /locus_tag="PC1_RS01425"
                     /old_locus_tag="PC1_0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011091927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:calcium antiporter"
                     /protein_id="WP_012773001.1"
                     /db_xref="GI:502365743"
                     /translation="MLFATLLLFVGLLLLVYGADRLVYGAAVLARSLGLPPFVIGITI
                     VGFGTSLPELIVSVTAALNDQNDMAVGNVIGSNIANILLILGSAALIRPLTVHSAILR
                     RELPLMLSVTLLCGVLLHDSYLSRADGMMLLFAAILCLVLILRMAQQAQREGGDSLTR
                     EQLAELPQDDSNQMVAVLWLILGMIILPMAARMVVDNATVIARYFDVSELTIGLTILA
                     IGTSLPELATAIVGTLKKEDDIALGNLIGSNIFNIAIVLGVPALLSPGALNPQVFQRD
                     YWVMLAASVLLTALCLSKKRRIGQGAGALLCCAFIAYLTVLFCFS"
     gene            328860..329672
                     /locus_tag="PC1_RS01430"
                     /old_locus_tag="PC1_0281"
     CDS             328860..329672
                     /locus_tag="PC1_RS01430"
                     /old_locus_tag="PC1_0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773002.1"
                     /note="ABC transporter maintaining outer membrane lipid
                     asymmetry; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="organic solvent ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_012773002.1"
                     /db_xref="GI:502365744"
                     /translation="MHHEATNLVEIRGLSFRRGEREIFTDITLNVPKGKVTAIMGPSG
                     IGKTTLLRLIGGQLQPDSGEIWFDGENIPRLSRSELYNARKKMSMLFQSGALFTDLNV
                     FDNVAWPLREHTRLPESLLRSIVMMKLEAVGLRGAAELMPAELSGGMARRAALARAIA
                     LDPQLIMFDEPFVGQDPITLGTLVKLIDELNHALGVTCIVVSHDVPEVMSIADYAYIV
                     ADKRVVAEGTADQLRANNDPQVRQFLDGIADGPVPFRFPAGDYKTSLLGSGG"
     gene            329680..330462
                     /locus_tag="PC1_RS01435"
                     /old_locus_tag="PC1_0282"
     CDS             329680..330462
                     /locus_tag="PC1_RS01435"
                     /old_locus_tag="PC1_0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012773003.1"
                     /db_xref="GI:502365745"
                     /translation="MLLRTLASLGRQGISTSAAFGRAGLMLFNALVGKPEFRKQWPLL
                     VKQLYSVGVQSLLIIMVSGLFIGMVLGLQGYIVLTTYSAEASLGMMVALSLLRELGPV
                     VTALLFAGRAGSALTAEIGLMKATEQLSSMEMMAVDPLRRVVAPRFWAGLISMPLLAV
                     IFVAVGIWGGALVGVDWKGIDSGFFWSAMQGAVDWRQDVLNCVIKSVVFAITVTWIAL
                     FNGYDAIPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFGN"
     gene            330467..331033
                     /locus_tag="PC1_RS01440"
                     /old_locus_tag="PC1_0283"
     CDS             330467..331033
                     /locus_tag="PC1_RS01440"
                     /old_locus_tag="PC1_0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012773004.1"
                     /db_xref="GI:502365746"
                     /translation="MQTKKTEVWVGVFMLIALAAILFLCLKVADLKSIGSEPTYRLYA
                     TFDNIGGLKARSPIRIGGVVIGRVADISLDEKTYLPRVAMDIQQRYDHIPDTSSLAIR
                     TSGLLGEQYLSLNIGFEDEDMGTTILKDGGVIQDTKSAMVLEDLIGQFLYKSGGNSED
                     NAGQSGTEPGADPAATSEHHNEPVPSHP"
     gene            331046..331675
                     /locus_tag="PC1_RS01445"
                     /old_locus_tag="PC1_0284"
     CDS             331046..331675
                     /locus_tag="PC1_RS01445"
                     /old_locus_tag="PC1_0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975476.1"
                     /note="involved in maintaining outer membrane lipid
                     asymmetry; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="organic solvent ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_012773005.1"
                     /db_xref="GI:502365747"
                     /translation="MFKRLLMVALLVVAPLANAADQTNPYRLMNEAAEKTFDRLKSEQ
                     PKIKQSPDYLRTVVREELLPYVQVRYAGALVLGRYYKDATPAQRDAYFKAFEAYLEQA
                     YGQALAMYNGQTYQIAPEQPLGNADIISIRVTIIDNGGRPPVRLDFQWRKNSKTGNWQ
                     AYDMIAEGVSMITTKQNEWATILRQKGVDGLTQQLESSAKQTITLDQKK"
     gene            331689..331979
                     /locus_tag="PC1_RS01450"
                     /old_locus_tag="PC1_0285"
     CDS             331689..331979
                     /locus_tag="PC1_RS01450"
                     /old_locus_tag="PC1_0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma B factor antagonist"
                     /protein_id="WP_043881864.1"
                     /db_xref="GI:762768367"
                     /translation="MANALNWQAQDDTLALTGDLDRETLLPFWQQRESLLMGKTVLDV
                     SGLNRVDSAGLALLMHVYQQPSSGREITIVGASDRLKTLIALYNLNEIIPVS"
     gene            332114..332368
                     /locus_tag="PC1_RS01455"
                     /old_locus_tag="PC1_0286"
     CDS             332114..332368
                     /locus_tag="PC1_RS01455"
                     /old_locus_tag="PC1_0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004948511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010280170.1"
                     /db_xref="GI:497966014"
                     /translation="MENNEIKDVLMNALALEEAHVSGDGSHFQVIVVGGLFAGMSRVK
                     KQQAVYAPLMEYIADNRIHALSIKAYTPEEWQRDRKLNGF"
     gene            332451..333713
                     /locus_tag="PC1_RS01460"
                     /old_locus_tag="PC1_0287"
     CDS             332451..333713
                     /locus_tag="PC1_RS01460"
                     /old_locus_tag="PC1_0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DAF2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="WP_012773007.1"
                     /db_xref="GI:502365749"
                     /translation="MDKFRVQGPTRLAGEVTISGAKNAALPILFAALLAEEPVEIQNV
                     PKLRDIDTTMKLLGQLGARVERNGSVHVDASNVNVFCAPYDLVKTMRASIWALGPLVA
                     RFGQGQVSLPGGCAIGARPVDLHIYGLEQLGAQIVLEEGYVKATVDGRLKGAHIVMDK
                     VSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLNTLGAKISGAGSDKITIEGV
                     ARLGGGVYRVVPDRIETGTFLVAAAVSRGQIICRNTRPDTLDAVLAKLREAGAEIEIG
                     EDWISLDMHGKRPKAVTVRTSPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMH
                     VPELIRMGAQAEIESNTVICHGVDKLSGAQVMATDLRASASLVLAGCIAEGVTIVDRI
                     YHIDRGYDRIEDKLRALGANIERVKEHE"
     gene            complement(333821..334933)
                     /locus_tag="PC1_RS01465"
                     /old_locus_tag="PC1_0288"
     CDS             complement(333821..334933)
                     /locus_tag="PC1_RS01465"
                     /old_locus_tag="PC1_0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine endoprotease"
                     /protein_id="WP_012773008.1"
                     /db_xref="GI:502365750"
                     /translation="MLAKLLRSALFGALVAGIILAILPFIGSGTSFLKSSDRQTDGSP
                     ISYHQGVSRAAPAVVNIYNRVANQEKPSEVAIHPLGSGVIMNEKGYILTNKHVINNVQ
                     QIQIELSDGRLYEARVIGSDSLTDLAVLQIDGVNLPVIPINADRIPHVGDVVMAIGNP
                     YNLGQTITQGIISATGRVSLSAYGQQRSQVGRQNLLQTDASINHGNSGGALVNTLGEL
                     VGINTLSFDKSSNGETPEGISFAIPVALATKVMGKLIRDGRVVRGYIGVNGVQIENIE
                     NSTLANNRGVQGRLSGILVQTIDPGGPADKAGIRVEDVIVSVNNKPARSIIETMEQVS
                     EIHPGTVIPVTIERNNDNNDTKQITLQMTIQEFPTQ"
     gene            complement(335148..336518)
                     /locus_tag="PC1_RS01470"
                     /old_locus_tag="PC1_0289"
     CDS             complement(335148..336518)
                     /locus_tag="PC1_RS01470"
                     /old_locus_tag="PC1_0289"
                     /EC_number="3.4.21.108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010296670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine endoprotease"
                     /protein_id="WP_012773009.1"
                     /db_xref="GI:502365751"
                     /translation="MKKTSLLFSALAMSIGLTLSTLPVANAALPAVVQGQQTPSLAPM
                     LEKVLPAVVSVHVEGTQVQRQRVPEEFKFFFGPNFPTDKQSSRPFEGLGSGVIIDAAK
                     GYVLTNNHVINNADKIRVQLNDGREYEAKLIGRDEQTDIALLQLNDAKNLVAVKMADS
                     DQLRVGDFAVAVGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGNSGGA
                     LVNLNGELIGINTAILAPGGGNIGIGFAIPSNMAQNLAQQLVEFGEVKRGLLGIKGSE
                     MTSEMAKAFNVDAQRGAFVSEVLPKSAAAKAGIKAGDVLTTLDGKPISSFAELRAKVG
                     TTAPGKTVKIGLLRDGKPQEVSVVLDNSSSASTSAETLSPSLQGASLTNGQLKDGSKG
                     VQIDNVAKDTPAAQVGLQKGDIIIGVNRERIENITQLRKLLEAKPSVLALNIVRGEET
                     IYLLLR"
     gene            complement(336794..337198)
                     /locus_tag="PC1_RS01475"
                     /old_locus_tag="PC1_0290"
     CDS             complement(336794..337198)
                     /locus_tag="PC1_RS01475"
                     /old_locus_tag="PC1_0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008815206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005975485.1"
                     /db_xref="GI:492818712"
                     /translation="MTWEYALIGLVVGIIIGAVAMRFGNRKLRQQQVLQNELEKSKTE
                     LEDYRQELVGHFARSAELLDNMADDYRQLYQHMAKSSNNLLPNVPGQDNPFKYRLTES
                     EADNDQAPVNMPPRDYSDGASGLLRGERPIRK"
     gene            337414..338565
                     /locus_tag="PC1_RS01480"
                     /old_locus_tag="PC1_0291"
     CDS             337414..338565
                     /locus_tag="PC1_RS01480"
                     /old_locus_tag="PC1_0291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773010.1"
                     /db_xref="GI:502365752"
                     /translation="MATPQTTRQQTTPLALYQQALSAGEYQPDEVQRQTVVRLEAIHQ
                     ALCERAADDNAGASGRVGKWRSWLGLREKRESAPVQGLYMWGGVGRGKTWLMDMFFHS
                     LPAERKMRLHFHRFMLRVHEELNQFQGQENPLEKVADGFKAETDVLCFDEFFVSDITD
                     AMLLAELLRALFARGIALVATSNIPPDDLYRNGLQRARFLPAIELIKQHCEVRNVDAG
                     IDYRLRTLTQAHLYLSPLNEDTEATMQQMFTRLTGKRWQTPGPVLEINHRPLATLGVS
                     EGVLAVDFHTLCTEARSQNDYIALSRLYHTMLLHNVTVMETKEENTARRFLALVDECY
                     ERRIKLIISAQASMFEIYQGEHLKFEYQRCLSRLQEMQSEEYLRQPHLA"
     gene            338803..339231
                     /locus_tag="PC1_RS01485"
                     /old_locus_tag="PC1_0292"
     CDS             338803..339231
                     /locus_tag="PC1_RS01485"
                     /old_locus_tag="PC1_0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000847558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="WP_012773011.1"
                     /db_xref="GI:502365753"
                     /translation="MKTFTAKPETVKRDWYVVDANGKTLGRLATELARRLRGKHKAEY
                     TPHVDTGDYIIVLNADKVAVTGNKRNDKIYYHHTGHIGGIKQATFEEMIARRPERVIE
                     IAVKGMLPKGPLGRAMFRKLKVYAGTEHNHAAQQPQVLDI"
     gene            339247..339639
                     /locus_tag="PC1_RS01490"
                     /old_locus_tag="PC1_0293"
     CDS             339247..339639
                     /locus_tag="PC1_RS01490"
                     /old_locus_tag="PC1_0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002437466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="WP_012773012.1"
                     /db_xref="GI:502365754"
                     /translation="MAENQYYGTGRRKSSAARVFIKPGNGNIVINQRSLEQYFGRETA
                     RMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAG
                     FVTRDARQVERKKVGLRKARRRPQFSKR"
     gene            339970..340611
                     /gene="sspA"
                     /locus_tag="PC1_RS01495"
                     /old_locus_tag="PC1_0294"
     CDS             339970..340611
                     /gene="sspA"
                     /locus_tag="PC1_RS01495"
                     /old_locus_tag="PC1_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316028.1"
                     /note="transcriptional activator; required for activation
                     of bacteriophage P1 late promoter; induced by starvation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stringent starvation protein A"
                     /protein_id="WP_005975503.1"
                     /db_xref="GI:492818753"
                     /translation="MAVAANKRSVMTLFSGPSDIFSHQVRIVLAEKGVSVEIEQVDMD
                     NLPQDLIDLNPYGSVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGNSRLM
                     MHRIESDWYSLLKKITHGSAQEADAARKQLREELLAIAPVFNEAPYFMSEEFSLVDCY
                     LAPLLWRLPQLGIELSGSGAKELKGYMTRVFERDAFLASLTEVEREMRLQTRG"
     gene            340617..341120
                     /locus_tag="PC1_RS01500"
                     /old_locus_tag="PC1_0295"
     CDS             340617..341120
                     /locus_tag="PC1_RS01500"
                     /old_locus_tag="PC1_0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_012773013.1"
                     /db_xref="GI:502365755"
                     /translation="MALSQLSPRRPYLLRAFYDWLLDNQLTPHLVVDVTLPGVMVPME
                     FARDGQIVLNIAPRAVGGLELADDSVRFNARFGGVPRQVYVPMAAVMAIYARENGAGT
                     MFEPEPAYEESAGEFEDFQEGAPSGTVMSIVDSSPDSEAPDGGSGSDDEPPQPPKGGR
                     PSLRVVK"
     gene            complement(341202..341975)
                     /locus_tag="PC1_RS01505"
                     /old_locus_tag="PC1_0296"
     CDS             complement(341202..341975)
                     /locus_tag="PC1_RS01505"
                     /old_locus_tag="PC1_0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin reductase"
                     /protein_id="WP_012773014.1"
                     /db_xref="GI:502365756"
                     /translation="MAVEVALVTGAGQGIGRAIALRLAADGFAVAIVDYNQETAHSVA
                     QEIEKAGGQAIALQADVADREAVFAAVAAAKKRFGDFNVIVNNAGVAPSTLIEDITPE
                     VIDRVYNINVKGVIWGIQAALDAFKSLGHGGKIINACSQAGHVGNPELAVYSSSKFAV
                     RGLTQTAARDLAPLGITVNGYCPGIVKTPMWDEIDRKISESAGKPRGYATEEFAKRIT
                     LGRLSEPEDVAACVSYLASHDSDYMTGQSLLIDGGMVFN"
     gene            342306..342767
                     /locus_tag="PC1_RS01510"
                     /old_locus_tag="PC1_0297"
     CDS             342306..342767
                     /locus_tag="PC1_RS01510"
                     /old_locus_tag="PC1_0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde-activating protein"
                     /protein_id="WP_043881702.1"
                     /db_xref="GI:762766911"
                     /translation="MLGYCDSNTQKIRRGSMHQGRCLCGGVTISTAHSVRDVAACHCG
                     MCQTWGGGPLMAVECTDPAIEIEGEENITVWPSSEWAERGFCRVCGTHLFYRLRGGDA
                     YHIPAGFFADETDKKLISQIYIDKKPGYYSFVEKTPTLTEQDIIALYAGKD"
     gene            complement(342834..344252)
                     /locus_tag="PC1_RS01515"
                     /old_locus_tag="PC1_0298"
     CDS             complement(342834..344252)
                     /locus_tag="PC1_RS01515"
                     /old_locus_tag="PC1_0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019080037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase subunit beta"
                     /protein_id="WP_012773016.1"
                     /db_xref="GI:502365758"
                     /translation="MSQNVYQFIDLQRVDPPKKPLKIRKIEFVEIYEPFSESQSKAQA
                     DRCLACGNPYCEWKCPVHNYIPNWLKLANEGRIIEAAELSHQTNSLPEVCGRVCPQDR
                     LCEGSCTLNDEFGAVTIGNIERYINDKAIEMGWKPSVANVKPTGKRVAIIGAGPAGLA
                     CADVLARNGVQAVVFDRHPEIGGLLTFGIPSFKLEKEVMVKRREIFTEMGIEFRLNTE
                     VGKDVQMKALLDEYDAVFLGVGTYQSMRGGLDNEDAQGVYDALPFLIANTKQLMGFEA
                     AADEPYVSMQGKRVVVLGGGDTAMDCVRTSIRQGSTHVTCAYRRDEENMPGSKREVKN
                     AREEGVEFKFNLQPLSVEINGAGKVCGVKMARTALGAPDANGRRRPEIVEGSEHVLEA
                     DAVIMAFGFRPHKMAWLAEHDVKLDDQGRIVAPESCDNAFQTSNPKIFAGGDAVRGSD
                     LVVTAIAEGRKAADGIMNYLEV"
     gene            complement(344262..348722)
                     /gene="gltB"
                     /locus_tag="PC1_RS01520"
                     /old_locus_tag="PC1_0299"
     CDS             complement(344262..348722)
                     /gene="gltB"
                     /locus_tag="PC1_RS01520"
                     /old_locus_tag="PC1_0299"
                     /EC_number="1.4.7.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975510.1"
                     /note="catalyzes the formation of glutamate from glutamine
                     and alpha-ketoglutarate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase subunit alpha"
                     /protein_id="WP_012773017.1"
                     /db_xref="GI:502365759"
                     /translation="MLYDASQERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGA
                     ILADGKTGDGCGLLLQKPDRFFRLVAEEHGWRLAKNYAVGMMFLNQDEELARATRRIV
                     EEELQNETLSVLGWREVPTNPDVLGEIALSSMPRIEQIFVNAPAGWRQRDMERRLFMA
                     RRRIEKRIEDKDFYVCSFSNLVTIYKGLCMPADLPRFYLDLADLRLESSICLFHQRFS
                     TNTVPRWPLAQPFRYLAHNGEINTIAGNRQWARARAYKFKTPLIPDLQDAAPFVNETG
                     SDSSSLDNMLELFLSGGMDIIRAMRLLVPPAWQNNPDMDPELRAFFDFNSMHMEPWDG
                     PAGIVMSDGRYAACNLDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEKGRVGP
                     GELMVIDTRSGRILHSAETDNDLKSRHPYKEWMEKNVKRLVPFEELPDDQVGSREFND
                     DLLETYQKQYGYSSEELDQVIRVLGENGQEATGSMGDDTPFAVLSSRPRIIYDYFRQQ
                     FAQVTNPPIDPLREAHVMSLATSIGREMNVFCEAEGQAHRLSFKSPILLYSDFTQLTS
                     QDELHYRADTLDLTFDPSQQTLQQTIEKLCDEAESKVRDGAVLLVLSDRGISESRLPV
                     PAPMAVGAVQRRLVEKSLRCDANIIVETASARDPHHFAVLLGFGATAIYPYLAYETLA
                     RMVDNHTIDKPYRAVMLNYRNGINKGLYKIMSKMGISTIASYRCSKLFEAVGLHKDVS
                     TQCFLGVVSRIGGANYSDFEQDLLNLSKRAWLKRKTLEQGGLLKFVHGGEYHAYNPDV
                     VTTLQTAVKSGEYSDYEQYAKLVNERPAATLRDLLALKPQEGAAIAIDSVEPASEMFK
                     RFDTAAMSIGALSPEAHESLAEAMNGLGGFSNSGEGGEDPARYGTNKVSRIKQVASGR
                     FGVTPAYLVNADVIQIKVAQGAKPGEGGQLPGDKVTPYIARLRYSVPGVTLISPPPHH
                     DIYSIEDLAQLIFDLKQVNPKAMISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGT
                     GASPLSSVKYAGCPWELGLVETQQALVSNGLRHKIRLQVDGGLKTGLDIVKAAILGAE
                     SFGFGTGPMVALGCKYLRICHLNNCATGVATQDEKLRRDHYHGLPERVTNYFQFIAHE
                     TRVLMAELGVSRLVDLIGRTDLLVELDGFSAKQNKLDLSPLLHAAQPQPGKALYCTES
                     NLSFDKGLLNKELLAQAQPHIDSKQGKALYFDIRNTDRSVGATLSGAIAEKHGDQGLA
                     GDPIKAYFSGTAGQSFGVWNAGGVELKLTGDANDYVGKGMAGGSISVRPPVGSAFRSH
                     EASIIGNTCLYGATGGKLFAAGRAGERFAVRNSGCITVVEGIGDNGCEYMTGGIVCVL
                     GRTGVNFGAGMTGGFAYVLDEDGEFRKRVNPELVEVLDVEELAIHEEHLRGLITEHVQ
                     NTGSHRGEEILANWPTWAPKFALVKPKSSDVKALLGHRSRSAAELRVQAQ"
     gene            349374..350303
                     /locus_tag="PC1_RS01525"
                     /old_locus_tag="PC1_0300"
     CDS             349374..350303
                     /locus_tag="PC1_RS01525"
                     /old_locus_tag="PC1_0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_012773018.1"
                     /db_xref="GI:502365760"
                     /translation="MQLQKLINMFGGNLQRRYGEKIHKLTLHGGFNCPNRDGTLGRGG
                     CTFCNVASFADEQMQQRSIAQQLETQAGKVNRAKRYLAYFQAYTSTYAEVQVLESMYQ
                     EALKQAEMVGLCVGTRPDCVPDAVLDLLSRYHEQGYEVWLELGLQSACDKTLHRINRG
                     HDFACYQETTRRARERGLKVCSHLIVGLPGEDAQHCLSTLEQVVETGVEGIKLHPLHI
                     VEGSTMAKAWRAGRLPELALDRYVETAGEMIRHTPPEVIYHRISASARRPTLLAPLWC
                     ENRWTGMVELDRYLQTHGVQGSALGTPYRYDEV"
     gene            350423..352792
                     /locus_tag="PC1_RS01530"
                     /old_locus_tag="PC1_0301"
     CDS             350423..352792
                     /locus_tag="PC1_RS01530"
                     /old_locus_tag="PC1_0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010280197.1"
                     /note="sensor-regulator protein which regulates the
                     expression of many genes in response to respiratory growth
                     conditions including anaerobic repression of the arc
                     modulon; hybrid sensory histidine kinase in two-component
                     regulatory system with ArcA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aerobic respiration control sensor protein ArcB"
                     /protein_id="WP_012773019.1"
                     /db_xref="GI:502365761"
                     /translation="MKQIRLLAQYYVDLMVKLGLVRFSLLLASVLVLLAMVVQMAVTL
                     LLSGEVENIDVVRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSKLVAKLEEMRHRDL
                     ELNEQLQENIAQLNQEIADRIKAEDARVLVMSRLKEEMSRREQAQIELEQQSALLRSF
                     LDASPDLVYYRNEDKEFSGCNRAMELLVGKSQKQLIGLTPQDVYSPDIAEKVMETDEK
                     VFRHNVSLTYEQWLVYPDGRKACFELRKVPFYDRMGKRHGLMGFGRDITERKRYQDAL
                     ENASREKTTFISTISHELRTPLNGIVGLSRILLDTQLDPEQQKYLKTIHVSAITLGNI
                     FNDVIEMDKQERRKVQLDNQPIDFTGFLVDLENLGGLLAEPKGLKLIMDQHYPLPQKV
                     ITDGTRLRQILWNLLSNAVKFTPKGENGEKGEIVVRVWHEKGDRLSFEVEDSGMGIPA
                     DELEKIFAMYYQVKDQHGGKPATGTGIGLAVSKRLAQNMGGDIQVSSTQGKGSCFTLT
                     VIAPSVDEAGSGLDDDDDLPLPALHVLLVEDIELNVVVARSVLEKLGNSVDVAMTGQD
                     ALDMFDPDEFDLVLLDIQLPDMTGLDVARQLRARYGNRSLPPLVALTANVLKDKREYL
                     DAGMDDVLSKPLSVPALTAVIKQFWDTHTVWTEEPVIEEGTEMAKAEEDLLDIPMLEQ
                     YLDLVGPKLIHQSLEMFEQMMPGYLAILDSNMTARDQKGITEEGHKIKGAAGSVGLRH
                     LQQVAQQIQTSSLPAWWDNVQEWVDELKHDWRHDVQVLRDWVAKAEKES"
     gene            353254..353907
                     /locus_tag="PC1_RS01535"
                     /old_locus_tag="PC1_0302"
     CDS             353254..353907
                     /locus_tag="PC1_RS01535"
                     /old_locus_tag="PC1_0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010280199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenoid biosynthesis protein"
                     /protein_id="WP_012773020.1"
                     /db_xref="GI:502365762"
                     /translation="MKRVGIVLSGCGVYDGSEIHEAVLTLLALDRAGAQAVCFAPDKP
                     QLQVVNHLTGDVTGENRNVLAESARIARGKIQPLSTANAQDLDALIVPGGFGAAKNLS
                     DFATQGSACQIDETLQLLTQEIYKQNKPIGFICISPALLPTILGEPVRVTIGNDIDTA
                     EAVEEMGGIHVVCPVDDIVVDEEHKIVTTPAYMLANSISEAAQGIDKLVARVLDLTE"
     gene            353904..354638
                     /gene="mtgA"
                     /locus_tag="PC1_RS01540"
                     /old_locus_tag="PC1_0303"
     CDS             353904..354638
                     /gene="mtgA"
                     /locus_tag="PC1_RS01540"
                     /old_locus_tag="PC1_0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DIR2.1"
                     /note="glycosyltransferase; polymerizes glycan strands in
                     the peptidoglycan; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monofunctional biosynthetic peptidoglycan
                     transglycosylase"
                     /protein_id="WP_012773021.1"
                     /db_xref="GI:502365763"
                     /translation="MKWSRGRGGLLAWLKRLIVRSVLVVIGAWLAGILLFSFLPVPFS
                     AVMVDRQISAWLKGEFSYVAHSDWVSMEEIAPEMALAVMAAEDQKFPDHWGFDLDAIG
                     QALKHNERNTQRIRGASTLSQQMVKNLFLWDGRSWVRKGLEAGITTGVELVWTKRRIL
                     TVYLNIAEFGPGIFGVEAAARRYFNKPASRLTASESALLAAVLPNPIRFRANAPSSYV
                     IQRQQWILRQMRQMGGDAFLRANNLN"
     gene            354709..356004
                     /locus_tag="PC1_RS01545"
                     /old_locus_tag="PC1_0304"
     CDS             354709..356004
                     /locus_tag="PC1_RS01545"
                     /old_locus_tag="PC1_0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773022.1"
                     /db_xref="GI:502365764"
                     /translation="MRLRYWSGLLVALCCVASVARADAEPKASSPDNPYAFLQQHQLS
                     SVKQQLQQKTEKPQTRMAYEQLISEADRALKIANPSVTEKKSTPPSGSKHDYLSLSAY
                     WWPDPDKADGLPWIRRDGQVNPASKDEETDGVRLAKFTAQTQALTLAWYFSGKQAYAD
                     KAISMIRTWFIDPATRMNPNLDFAQGVPGIAPGRGSGVLDGRYFSTRIVDSLLILRHA
                     PGWTTQDEQQMQKWMSDYLHWLQTSKLGKKEATAQNNHGSWYTVQVAGIAWYLGKIDV
                     VKSMAQLQREKLDHQLQPDGSQPEELARTRSFHYSYFNLQAITDMAILASRVGENIWQ
                     YQTPKGSSVIKALDFMAPYLDENKAWPRKTMDRQSSRLIPLLLQAERGVKAPRYQTQI
                     KQAGFAELLSGAASERDKEPSHISVETRRALWLLNPVAP"
     gene            complement(356131..356703)
                     /locus_tag="PC1_RS01550"
                     /old_locus_tag="PC1_0305"
     CDS             complement(356131..356703)
                     /locus_tag="PC1_RS01550"
                     /old_locus_tag="PC1_0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773023.1"
                     /db_xref="GI:502365765"
                     /translation="MRISSAFAVLSIALLLQGCVGVVAVGSAVATKTATDPRTVGTQV
                     DDGTLEVRVTNAISKDEQLKKEARIIATAYQGKVLLTGQAPNTEMANRAKQIALGVEG
                     AAEVYNEIRQGTPVSMGTASMDTWITTKVRSQILASDTVKSSNVKVTTENGEVFLLGL
                     VTQREGTSAAEIASKVGGVKHVTTAFTYLQ"
     gene            complement(356715..357305)
                     /locus_tag="PC1_RS01555"
                     /old_locus_tag="PC1_0306"
     CDS             complement(356715..357305)
                     /locus_tag="PC1_RS01555"
                     /old_locus_tag="PC1_0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DAD4.1"
                     /note="Required for the timely initiation of chromosomal
                     replication via direct interactions with the dnaA
                     initiator protein; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DnaA initiator-associating protein DiaA"
                     /protein_id="WP_012773024.1"
                     /db_xref="GI:502365766"
                     /translation="MLDRIKVCFTESIQTQIAAAEALPDAISRGAIAMVQSLLNGNKI
                     LCCGNGTSAANAQHFAASMINRFEAERPSLPAIALNADNVVLTAIANDRLHEEVYAKQ
                     VRALGQAGDVLLAISTRGNSRDIVKAVESAVTRDMTIVALTGYDGGELAGLLGPQDVE
                     IRIPSHRSARIQEMHMLTVNCLCDLIDNTLFPHQND"
     gene            complement(357369..357725)
                     /locus_tag="PC1_RS01560"
                     /old_locus_tag="PC1_0307"
     CDS             complement(357369..357725)
                     /locus_tag="PC1_RS01560"
                     /old_locus_tag="PC1_0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DIR6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773025.1"
                     /db_xref="GI:502365767"
                     /translation="MNQRAAGAVYEQQARRYLERAGLTFTAANVTLRGGELDLIMRDR
                     HIWVFVEVRYRRNAHFGDAAASVTRHKQQRLLHAAAVWLAQRGASFDTVDCRFDVLAI
                     TGDRFDWIPNAFATQG"
     gene            complement(357722..359740)
                     /locus_tag="PC1_RS01565"
                     /old_locus_tag="PC1_0308"
     CDS             complement(357722..359740)
                     /locus_tag="PC1_RS01565"
                     /old_locus_tag="PC1_0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011091954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein activator LpoA"
                     /protein_id="WP_012773026.1"
                     /db_xref="GI:502365768"
                     /translation="MLPFHFVRTQAGRAIPVLLAALFLAGCPSQAPQSPPPEVQGKAD
                     ASSDYYLQQMQQSSDNNKADWQLLAIRSLLQEGKAPQASQQFNALPEKLSAAQKQEQQ
                     LLSAELSVAQNNMDAAKAALSQLDVSALSDQQKQRYYQTQIKTAQGRTSIELLRAYIA
                     QEPLLKGDEHQMNLDQTWLALTQMSPQESGALLINANENVLQGWVDLLNNYQNNRESP
                     DQLQSAIQDWQTRYPHHPAAKKLPTQLNQVINYQPSSVSSIALLLPLNGQAQVFANAI
                     QQGFNAAKNGQIATAPVSAPAAPVTDTTQDGQVTPSSDGQSAQSPAPYSDQAVASTTQ
                     APEAQPTSAGLSNSLPVKVYDTSSQPLANILTQAQQDGASLVIGPLLKNEVDQLANSQ
                     SPLNILALNQPEHVENSPNICYFALSPEDEARDAAKFIHQQGKQQPLVLAPRGALGDR
                     IVNAFAQAWNQQSGTSPLQQRFGNTAELKQAINSGAGLSLSGQPVSVSQQQAQPGTTI
                     GGLTIPSQVQPTVSSSVSGNIDAVYIIATPDELALIKPMIDMRTTSRARPALYASSRS
                     FQAGLGPDFRLEMEGLQFSDIPLLAGANPALMQQVSSQFKNDYSLVRLYAMGMDAWTL
                     ASHFGEMRQIPGHQIPGATGMLSSGPDCTINRQLTWQQYRQGQLVPVL"
     gene            359802..360689
                     /locus_tag="PC1_RS01570"
                     /old_locus_tag="PC1_0309"
     CDS             359802..360689
                     /locus_tag="PC1_RS01570"
                     /old_locus_tag="PC1_0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_012773027.1"
                     /db_xref="GI:502365770"
                     /translation="MNQDQQADISASTLYIVPTPIGNLGDITQRALAVLASVDLIAAE
                     DTRHTGLLLQHFAINARLFALHDHNEQQKADVLLAKLQSGQSIALVSDAGTPLINDPG
                     YHLVRRCREAGVRVVPLPGACAAITALSASGLASDRFCYEGFLPAKTKARKDTLRDLG
                     EEPRTLIFYESTHRLLDSLQDISEVLGAERYVVLAREITKTWESIHGAPVGELLAWVK
                     EDENRRKGEMVLIVEGHQADDSALSAEALRTLMLLRAELPLKKAAALAAEIHGVKKNA
                     LYRYGLEQEGDSGESGDDK"
     gene            360715..361093
                     /locus_tag="PC1_RS21475"
     ncRNA           360715..361093
                     /locus_tag="PC1_RS21475"
                     /ncRNA_class="RNase_P_RNA"
                     /product="bacterial RNase P"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            362525..363310
                     /locus_tag="PC1_RS01575"
                     /old_locus_tag="PC1_0310"
     CDS             362525..363310
                     /locus_tag="PC1_RS01575"
                     /old_locus_tag="PC1_0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773028.1"
                     /note="seems to be involved in biofilm formation; in
                     asymptomatic bacteriuria E. coli strains 83972 and VR50,
                     the ygiD gene is upregulated during biofilm formation in
                     urine; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LigB family dioxygenase"
                     /protein_id="WP_012773028.1"
                     /db_xref="GI:502365771"
                     /translation="MSNTSRMPALFLGHGSPMNVLENNVYTQAWQTLGETLPRPKAII
                     AVSAHWYTRGTAVTAMENPRTIHDFGGFPQALFDTQYPAPGSPELAARIQQVLAPYPV
                     TADQSQWGLDHGSWGVLIKMYPDADIPVVQLSVDGTQPAAYHYELGRKLAALRDEGFM
                     IVASGNVVHNLRMVKWDGDAEPYPWAISFNQFVRDNLTYQGDDHPLVNFMQHEGAALS
                     NPTPDHYFPLLYVLGSWDGKEAISIPVDGLEMGSLSMLSVQVG"
     gene            complement(363380..364540)
                     /locus_tag="PC1_RS01580"
                     /old_locus_tag="PC1_0311"
     CDS             complement(363380..364540)
                     /locus_tag="PC1_RS01580"
                     /old_locus_tag="PC1_0311"
                     /EC_number="6.3.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773029.1"
                     /db_xref="GI:502365772"
                     /translation="MKRIDITARPDWQEKATEFGFRFHTMYGEPYWSEEAYYQFTLAQ
                     IEELEETTAELHQMCLQVVEKVINSDALLAKFRIPKHTWEFVRHSWRTNQPSLYSRLD
                     LAYDGKSPAKLLENNADTPTSLYEAAFFQWLWLEDQINAGNLPQNSDQYNSIQEKLIE
                     RFEELKLNHGFGLLHFACCQDTEEDRGTVQYLQDCALEAGLPSEFLYIEEIGLGEKGQ
                     FTDPENQVISNLFKLYPWEFMLREMFSTKLEDAGVRWLEPAWKSIISNKALLPMLWEM
                     FPDHPNLLPAYFAEDEHPKLDSYVTKPLFSREGANIQIIENGKEIASADGPYGEEGMI
                     VQQYHPLPKFGDSYTLIGSWLVNDQPCGIGVREDRALITQDLSRFYPHTILD"
     gene            complement(364552..365226)
                     /locus_tag="PC1_RS01585"
                     /old_locus_tag="PC1_0312"
     CDS             complement(364552..365226)
                     /locus_tag="PC1_RS01585"
                     /old_locus_tag="PC1_0312"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DIS1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773030.1"
                     /db_xref="GI:502365773"
                     /translation="MKRTKNINQEMFRKEWRTHRLAPVALAVSAVFFLAGCEQTDETV
                     SLYQNADDCSSANPSMAAQCTTAYNNALKEAEKTAPKYATKEDCVAEFGEAQCTQTPA
                     PAQAGMAAESQQGGGMSWMPLMAGYMMGRMMGGGAGFAQQPLFSPKTPASPANGQFVD
                     ASGKNYGNATTGRTMTVPKTALAPKPATTSTITRGGFGETVAKQNSMQRSSASSSSSS
                     SRSMGG"
     gene            complement(365493..366884)
                     /locus_tag="PC1_RS01590"
                     /old_locus_tag="PC1_0313"
     CDS             complement(365493..366884)
                     /locus_tag="PC1_RS01590"
                     /old_locus_tag="PC1_0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane channel protein"
                     /protein_id="WP_012773031.1"
                     /db_xref="GI:502365774"
                     /translation="MKKLLPLLIGLSLGGFSAMSQAENLLQVYQQAKSTNPDLRSSAA
                     TRDAAFEKINESRSPLLPQLGINAGYTYNKGYRDSNGVNNNEKSATLQLTQTLFDMSK
                     WRALTLQEKQAGIEDVTYQTAQQNLMLNTATAYFNVLRAIDSLSYINAQKQAIYRQLD
                     QTTQRFNVGLVAITDVQNARAQYDSVLANEVLTRNTLDNALESLRQITGNFYPQLAGL
                     NIERFSTQKPEAVNNLLKEAENRNLNLLSARLSQDLAREQIRSAETGYMPTLDLTAST
                     GVSDTRYSGSRTNSGNFNDTDAGQHRVGINFTLPLYSGGATNSQVKQAQHSYVSASEL
                     LESAHRSVIQTVRSSFNNISASISSINAYKQAEVSAQSSLDAMEAGYQVGTRTIVDVL
                     DATTTLYNAKQQLSSARYDYLINQLNIKSAQGTLNEADLQALNAALGQPVSTTPTVTD
                     NSAPLATTASAQR"
     gene            367217..367849
                     /gene="nudF"
                     /locus_tag="PC1_RS01595"
                     /old_locus_tag="PC1_0315"
     CDS             367217..367849
                     /gene="nudF"
                     /locus_tag="PC1_RS01595"
                     /old_locus_tag="PC1_0315"
                     /EC_number="3.6.1.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773033.1"
                     /note="ADP-sugar pyrophosphatase; catalyzes the formation
                     of D-ribose 5-phosphate from ADP-ribose; can also act on
                     ADP-mannose and ADP-glucose; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="WP_012773033.1"
                     /db_xref="GI:502365776"
                     /translation="MASSVSGPVTFTKDDVEIIARETLYDGFFSLELYRFRHRLFNGG
                     MSGEVSREILERGHAVVLLPYDPVRDEVVLIEQIRIAAYDTSASPWLFELVAGMIEPG
                     ESHEEVARREAQEEAGLRVGRCRPIINYLASPGGTSERLAVMVGEVDTRTAKGIHGLS
                     EENEDIRVHVVSREQSYQWVEEGIVDNAASVIALQWLTLHHEELKRAWVD"
     gene            367853..368284
                     /locus_tag="PC1_RS01600"
                     /old_locus_tag="PC1_0316"
     CDS             367853..368284
                     /locus_tag="PC1_RS01600"
                     /old_locus_tag="PC1_0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_012773034.1"
                     /db_xref="GI:502365777"
                     /translation="MKRYTPDFPAMMRLCETNFMQLRRLLPKIDEVGEIAVYHVNNAI
                     YQLTILESTRYTSLVEIKQTAPAVSYWSLPMMSVRLYHDALVAEVCASQQIFRFKARY
                     DYPNKKLHQRDEKHQINQFLADWLKYCLAYGSMSIPVFDTQ"
     gene            368392..369219
                     /locus_tag="PC1_RS01605"
                     /old_locus_tag="PC1_0317"
     CDS             368392..369219
                     /locus_tag="PC1_RS01605"
                     /old_locus_tag="PC1_0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3',5'-cyclic-nucleotide phosphodiesterase"
                     /protein_id="WP_012773035.1"
                     /db_xref="GI:502365778"
                     /translation="MESLLTLPVASGARVRILQITDTHLFAGEHETLLGINTYRSYHA
                     VLNAIKARQDAFDLIVATGDLAQDHTLEAYHHFSRGIAQIPAPCVWLPGNHDFQPAMV
                     DALAEAGIAPSKHVLLGDKWQIILLDSQVFGVPHGELSEYQLEWLERSLKSQPDRFTL
                     LLLHHHPHPSGCTWLDQHSLRNAHSLSAVLDRYPQVNTVLCGHIHQEMDFDWHGRRLL
                     ATPSTCVQFKPHCTNFTIDDVAPGWRYLDLFPDGRLETEVYRLSGSEFLPDMDSDGY"
     gene            369219..369800
                     /locus_tag="PC1_RS01610"
                     /old_locus_tag="PC1_0318"
     CDS             369219..369800
                     /locus_tag="PC1_RS01610"
                     /old_locus_tag="PC1_0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822130.1"
                     /note="Displays esterase activity toward palmitoyl-CoA and
                     pNP-butyrate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_012773036.1"
                     /db_xref="GI:502365779"
                     /translation="MPTLLYLHGFNSTPQSAKATALKTWLAEQHPEIDMIIPQLPPYP
                     AEAAEMMESLIMERAGRPVGIVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLLDH
                     LGEYQNPYTGEQYVLESRHVYDLKVMQVDRLESPDLLWLLLQTGDEVLDYRQAVAYYT
                     ACRQTVESGGNHAFVGFEHFFTPIVNFLGLTTD"
     gene            369893..371788
                     /locus_tag="PC1_RS01615"
                     /old_locus_tag="PC1_0319"
     CDS             369893..371788
                     /locus_tag="PC1_RS01615"
                     /old_locus_tag="PC1_0319"
                     /EC_number="5.99.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913888.1"
                     /note="decatenates newly replicated chromosomal DNA and
                     relaxes positive and negative DNA supercoiling; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit B"
                     /protein_id="WP_012773037.1"
                     /db_xref="GI:502365780"
                     /translation="MAQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNS
                     VDEALAGHARRIDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFS
                     GKNYQFSGGLHGVGISVVNALSTRVEVTVKRDGQVYDIAFANGDKVQDLTVTGTCGRR
                     NTGTRVHFWPDEKFFDSARFSVSRLTHLLKAKAVLCPGVEIIFKDKVNNTEQRWCYQD
                     GLNDYLCEAVNGLITLPEKPFLGSITGDTEAVDWALLWLPEGGELLMESYVNLIPTPM
                     GGTHVNGLRQGLLDAMREFCEFRNILPRGVKLSADDIWERCAYVLSVKMQEPQFAGQT
                     KERLSSRQCAAFVSGVVKDAFSLWLNQNVQAAEQLAELAISSAQRRMRAAKKVVRKKL
                     TSGPALPGKLADCTSQDLSRTELFLVEGDSAGGSAKQAREREFQAIMPLKGKILNTWE
                     VSSDEVLASQEVHDISVAIGIDPDSDDLSQLRYGKICILADADSDGLHIATLLCALFV
                     RHFRALVQGGHVYVAMPPLYRIDLGKEVYYALDEEEKAGVLEQLKRKKGKPNVQRFKG
                     LGEMNPLQLRETTLDPNTRRLVQLTIKEDDIDQTMAMMDMLLAKKRSEDRRNWLQEKG
                     DKAEIEV"
     gene            371982..372995
                     /locus_tag="PC1_RS01620"
                     /old_locus_tag="PC1_0320"
     CDS             371982..372995
                     /locus_tag="PC1_RS01620"
                     /old_locus_tag="PC1_0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="WP_012773038.1"
                     /db_xref="GI:502365781"
                     /translation="MQYTKLGNSDLTVSRICMGCMGFGDASTGQHSWTLGEAESREII
                     RYGLENGINFYDTAIAYQRGSSERYVGKALRDMAKRDDVVVATKFLPRTQQQISDGLS
                     GQHAIAQSLDQSLHNLGMDYIDLYICHIWDYNTPILDVLDALHRAVKAGKVRAIGISN
                     CHAWQLAKANAIAERENLTPFVSVQSHYNLIMREDERELFGLCAEDNIALTPYSALAS
                     GRLSRLEGVESLRLKEDTYAKGKYDTTAEQDRIIIDRVAELAARHRASMTEISLAWLL
                     TKVTAPVVGATKKHHIDGAVKAVNLTLSDDEIRYLEESYQPHRLVGVMAQNAPQTQAK
                     KQA"
     gene            373173..374069
                     /locus_tag="PC1_RS01625"
                     /old_locus_tag="PC1_0321"
     CDS             373173..374069
                     /locus_tag="PC1_RS01625"
                     /old_locus_tag="PC1_0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012773039.1"
                     /db_xref="GI:502365782"
                     /translation="MKVTLEELQAFVVVIDTGSITAAAEQLGQTTSGISRALRRLEDK
                     LGTTLLHRTTRRLSLSEEGTMFLEHARGVLHAVEHAEEQVLLRHEQPSGRLRVNSASA
                     FMQHVIVPLVPEFRRRYPKIILELNTDDFVIDLLEQHTDIAIRIGTLKDSTIHARPLG
                     ASKLHIVASPEYLQQHGTPRTVESLADHICLGFTQVESLNHWPLRHGLQNFYPITPAL
                     LASNGEILRQLALRGEGIVRMSTFLIRDDLAAGRLVPILTEETVEASLPVYAVYYRNS
                     QLAARITCFLDFMSETLTENPL"
     gene            complement(374110..374691)
                     /locus_tag="PC1_RS01630"
                     /old_locus_tag="PC1_0322"
     CDS             complement(374110..374691)
                     /locus_tag="PC1_RS01630"
                     /old_locus_tag="PC1_0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773040.1"
                     /note="involved in drug resistance; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH quinone reductase MdaB"
                     /protein_id="WP_012773040.1"
                     /db_xref="GI:502365783"
                     /translation="MQNILLIDAGKSFAHSKGELNHTLTEVAASFLRDKGHDVRVTVV
                     DSGYDIEQEIQNYLWADTIIYQMPGWWMDTPWILKKYIDDVFTAGHGSLYASDGRSRS
                     DASKKYGSGGLLQGRKYMLSLTWNAPLEAFDDPEQFFHGVGVDGVYLPFHKANQFIGL
                     SPLPTFICNDVIKAPDVPAYLVNYRQHLDELFA"
     gene            complement(374894..375757)
                     /locus_tag="PC1_RS01635"
                     /old_locus_tag="PC1_0323"
     CDS             complement(374894..375757)
                     /locus_tag="PC1_RS01635"
                     /old_locus_tag="PC1_0323"
                     /EC_number="4.1.2.40"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773041.1"
                     /db_xref="GI:502365784"
                     /translation="MLISMTDILKPTREHRFAIGAFNVADSCFIRAVVEEAEATNTPA
                     IISIHPSELEFVTDEFFAYVRERTLRSPVPFVIHLDHGASIAHVLRAIQCGFTSVMID
                     GSLLPYEENVALTREVVKLAHAVGVSVEGELGTIGDTGTTIEGGVSKVIYTDPEQAED
                     FVNRTGVDTLAVAIGTAHGIYPKDLKPELQMHILRDISQRVSIPLVLHGGSANPDAEI
                     AEAVTLGVGKINISSDMKFAYFQKAREILSRETWWDPNAIYPEPIKAAKEVIRYKMAL
                     FGSTGKASLYR"
     gene            complement(375847..376698)
                     /locus_tag="PC1_RS01640"
                     /old_locus_tag="PC1_0324"
     CDS             complement(375847..376698)
                     /locus_tag="PC1_RS01640"
                     /old_locus_tag="PC1_0324"
                     /EC_number="4.1.2.40"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="WP_012773042.1"
                     /db_xref="GI:502365785"
                     /translation="MYAAMKALIDDAYQQQYAVLAINCFNLETARAAIAAAEQQRAPL
                     ILNVYQGHSAHFPPHLAVPLAKALAEQATVPVALSLDHGTAFSLIGQAFRAGFTGLMI
                     DASSHPLAENILRTQQVVTIAATAGVCVEGELGHIADAPVYDQEDAAVKMTQVEDVVP
                     FIRQTGIDLLAVSVGTAHGMYPPGVTPRIDFERLEALHRESTVPLALHGGSGTKADDI
                     RRVSRHGVAKINVGAAVFEAGKTALQQALHQHPTTELSDLLATMESACRDVVVDYLGW
                     SGSANKA"
     gene            complement(376710..377801)
                     /locus_tag="PC1_RS01645"
                     /old_locus_tag="PC1_0325"
     CDS             complement(376710..377801)
                     /locus_tag="PC1_RS01645"
                     /old_locus_tag="PC1_0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose subfamily transporter subunit IIC"
                     /protein_id="WP_012773043.1"
                     /db_xref="GI:502365786"
                     /translation="MNTRKITVGQEIKRHLLTGISWMIPLIVAAGICIALGQVIGGPD
                     VGKQTGSIAWMLNQIGGWGMGLIVPLISAAIAYSIADRPGFAPGLIVGFICGQIQTGF
                     IGGILGGFLVGYTVLLLRRYIKLPTSMQGLMPVMILPLLSTIIAGLLMMTFIGQPIVW
                     LQKSLIHLLESMQGGSKFLMGAILGAMATFDFGGPVNKTMSLFADGMLVDGIYGPEAV
                     KFVGSMIPPFGITLSFLLTRYKYTRAEKEALKAAFPMGICMITEGVIPIAARDLFRVV
                     ASCVVASAIAGGLIMVWGVEAPVPHGGMFVVPLFTKPLMFCLALGIGTAICGVMLSLI
                     KKRVTQADEEFDDVDDSSVRDEDIKFTLE"
     gene            complement(377827..378141)
                     /locus_tag="PC1_RS01650"
                     /old_locus_tag="PC1_0326"
     CDS             complement(377827..378141)
                     /locus_tag="PC1_RS01650"
                     /old_locus_tag="PC1_0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010297459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIB"
                     /protein_id="WP_010297459.1"
                     /db_xref="GI:497983303"
                     /translation="MNIVCVAACTAGIAHTYIAREKLIKGANALNYAIKVETQGTIGT
                     ENELTPDEIAAADVVILAIDIKITGEERFKGKPIVRVKTEVVIKSPIKFLEKVASSLA
                     GA"
     gene            complement(378155..378634)
                     /locus_tag="PC1_RS01655"
                     /old_locus_tag="PC1_0327"
     CDS             complement(378155..378634)
                     /locus_tag="PC1_RS01655"
                     /old_locus_tag="PC1_0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011091972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS IIA-like nitrogen-regulatory protein PtsN"
                     /protein_id="WP_012773044.1"
                     /db_xref="GI:502365787"
                     /translation="MDINKILNVNRVKLTMSATNKDEAINELTDLLYADGAITNKQDF
                     IHDVWLREAEGSTGFENHIAIPHGKSSAVKQTTLAIGRTRHDIPWETLDGSQVRCIIL
                     FAVRLEDQNTTHIRLLSQVASALADDEVIAQLLDESDPHKIIRLFSQYAETAPVTPT"
     gene            complement(378682..380229)
                     /locus_tag="PC1_RS01660"
                     /old_locus_tag="PC1_0328"
     CDS             complement(378682..380229)
                     /locus_tag="PC1_RS01660"
                     /old_locus_tag="PC1_0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010280232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_043881865.1"
                     /db_xref="GI:762768371"
                     /translation="MQPLTSRQNRLLKYLLQHQGYVTVKDIAHYLDVSEKTVYRDMQF
                     VEAFLSVWNIYPDKKVGAGIMLTTDDDRHLTLLEQQIVVDDGETDALINNARRVKIAS
                     QLLSDTPHETSISKLSERYFISSASIVNDLKIIESWLHPLGLALVRSQSGTHIEGSEN
                     QVRHAMASLINDVMHHKEPGPLNHSRLDPGSYKALINYFGEEDVSFVESLLQDMERQL
                     SYPLGEPYYINIFTHTLIMMHRIAQGKALMMAEESVHQQVDNRIFSIAQNMVSQIEQR
                     VESTLPSDEVWFIYQYIISSGIVMEERADNQLLRYQFSNGESRRITHALTQIFSDLIN
                     IDLRTDKLLHEGLLIHIKPLLNRLKYQIHIRNPLLDDIKSEFIDIYDMTQQAMDEVCQ
                     RFQLKPVAEDEIGYLTIHFQAALERQIAHKRILVVCSSGVGTSHLLKNRILRAFPDWI
                     IVGVVSASNMQRFCQQEEIELIISTIHLEEQHIPVVYVSAFFNDDDIKRVTEKVIANQ
                     LHQAVPH"
     gene            complement(380668..383070)
                     /locus_tag="PC1_RS01665"
                     /old_locus_tag="PC1_0329"
     CDS             complement(380668..383070)
                     /locus_tag="PC1_RS01665"
                     /old_locus_tag="PC1_0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_012773046.1"
                     /db_xref="GI:502365789"
                     /translation="MLINKNLNKILLTGILTGVALNSMAADSTTGNNALNGKSQDNSA
                     AKAEQTDDVMTVKSPKIEKKAGSSTTLTAADMQKEGGNNFGTIMRYQPLVSATGASGG
                     SNTGKSGFDRGGYTGYNIRGIESNRVAIDTDGIALPNATGRSYASRAGFNTFGMGRDY
                     IDPYVYSSVDIESGVTSAENTINALGGSVSFRPKSADDYLKAGKQDYFGLQSDFDSAN
                     HGWHNGITAAGGDDELRGVVVLSRRDGQQTRNNSDEIAAYPANWHSNAILASGIWQAN
                     DEHQLTGTLDYYHKTNHTHYDYWGNLPSGNNTIYGTAQQSSETRRWTASLKDRWTPVN
                     NTLVDLVDSRIYFQNSESHDNTWLPATTGMAAADSHRVYSDYNVTTYGFDTHMVKSWD
                     RHEFSWGLNASQSKTERPFRQSPNQTGANNIMQPEADSNSYTVGGFVQDTVTWDLAGH
                     AFSVVPAVRAIHQRTKPTNTVRLSGDGSVISESDVNRLYGKANSDTQVLPALSFLYDI
                     TPTLTTYLQYRRGAQFPDASQLYGSTNLDANYAGPFQYAFIGNSDLKTETSNNVEWGL
                     KGEATEGITFRTALFYNTYKNFIANTRYRRSANPDKFTNVPSNISTIYQAENRDKAYI
                     YGGEVSSKIQLGTWFPAVDGLSTTLAFGYTKGQSQSRYLGDRYVDLDSVAPMKAVIGI
                     AYDDPSQRYGAAVTSTFQKGKQAKDTSRESYTNAGSAITTSSTEYMRIPGYGMVDLTA
                     YYRVTKNVKINGGVYNLTDRKYWDYLSSRQIETNDRQGQYDRALSVQPGRTFQLGVNV
                     DF"
     gene            383321..383656
                     /locus_tag="PC1_RS01670"
                     /old_locus_tag="PC1_0330"
     CDS             383321..383656
                     /locus_tag="PC1_RS01670"
                     /old_locus_tag="PC1_0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773047.1"
                     /db_xref="GI:502365790"
                     /translation="MKLPTYETDHYELDDGEALNREYPDSFWIPDKEVRESLVPDDFV
                     KLIFRMEKTAGADELSVERMWVRVTTKYRALYQGVLDNTPTGSDCVRCGQIVTFHACH
                     VIGIYEKDE"
     gene            383757..384260
                     /locus_tag="PC1_RS01675"
                     /old_locus_tag="PC1_0331"
     CDS             383757..384260
                     /locus_tag="PC1_RS01675"
                     /old_locus_tag="PC1_0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773048.1"
                     /db_xref="GI:502365791"
                     /translation="MSIEIPESVLPLFQAAGWPCATTQSVPPFVPENHPAFIILHTFG
                     GLTVGQCGAGEACASGDIIFGSSEDLQEDETLLEWQGILNTTLILIGETHHSHGALLM
                     DSAGICYGMSFIHEAFWFEGADFGTAVERILLGRKGKPMLRPDQSSISVYGETITADH
                     PNVYRYR"
     gene            384435..386705
                     /locus_tag="PC1_RS01680"
                     /old_locus_tag="PC1_0332"
     CDS             384435..386705
                     /locus_tag="PC1_RS01680"
                     /old_locus_tag="PC1_0332"
                     /EC_number="5.99.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975574.1"
                     /note="decatenates newly replicated chromosomal DNA and
                     relaxes positive and negative DNA supercoiling; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="WP_012773049.1"
                     /db_xref="GI:502365792"
                     /translation="MSEMTHDGAESLALRTFTENAYLNYSMYVIMDRALPFIGDGLKP
                     VQRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYP
                     LVDGQGNWGAPDDPKSFAAMRYTESRLSKYAEILLSELGQGTVDYTPNFDGTMQEPKM
                     LPARLPNILLNGTTGIAVGMATDIPPHNVREVAAAAVMLLENPKASLDDLLQHVQGPD
                     FPTEAEIITPRDEVRKLYQNGRGSVRMRAVWKKEDGDVVITALPHQVSGAKVLEQIAS
                     QMRAKKLPMVEDLRDESDHENPTRLVLVPRSNRIDMDQVMNHLFATTDLEKSYRVNMN
                     MIGLDGRPSVKGLVEILSEWLVFRRDTVCRRLNYRLEKVLKRLHILEGLLIAFLNIDE
                     VIHIIRTEDEPKPVLMRQFSLSETQAEAILELKLRHLAKLEEMKIRGEQDDLAKERDQ
                     LQALLASDRKLSNLIKKEIQADAQTYGDDRRSPLYERSEAKAMSEHDFVPSEPVTIVL
                     SEMGWVRSAKGHDIDPAGLSYKAGDSFRAAAKGKSNQPVVFIDSTGRSYALDPITLPS
                     ARGQGEPLTGKLTPPPGATIEQVLMAADDQPLLMASDAGYGFVCTFNDLVARNRAGKA
                     IITLPDNAKALAPMEIHGDDNLLMAITAAGRMLLFPVSDLPQLSKGKGNKIVSISSAD
                     FAEGKDRLTWLYLLPPQASVTLYFGKRKLVLRPNELQKYQGERGRKGTLLRGLQRIDR
                     IEVDAPQQISTGSSEE"
     gene            386857..387594
                     /locus_tag="PC1_RS01685"
                     /old_locus_tag="PC1_0333"
     CDS             386857..387594
                     /locus_tag="PC1_RS01685"
                     /old_locus_tag="PC1_0333"
                     /EC_number="2.3.1.51"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913902.1"
                     /note="catalyzes the formation of 1,2-diacyl-sn-glycerol
                     3-phosphate from 1-acyl-sn-glycerol 3-phosphate using
                     either acyl-CoA or acyl-ACP; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_012773050.1"
                     /db_xref="GI:502365793"
                     /translation="MLSILRFLVVVIFSILVCIFGLFYCLFSPRNPRHVATFGHLFGR
                     LSTVFGLKVEMRIPEEAAHYGNCIYIANHQNNYDMVTVSKAVQPRTVTVGKKSLLWIP
                     FFGPLYWLTGNLLIDRENRAKAHGTIAQVVKHIKERNTSIWMFPEGTRSRGRGLLPFK
                     TGAFHAAISAEVPIVPICVSTTSNKVKLNRWNNGLVIVEMLPPIDTRAYTKDQVRELA
                     THCHDVMAAKIAELDAEVAAREAADKK"
     gene            387696..389111
                     /locus_tag="PC1_RS01690"
                     /old_locus_tag="PC1_0334"
     CDS             387696..389111
                     /locus_tag="PC1_RS01690"
                     /old_locus_tag="PC1_0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010280242.1"
                     /note="septal ring component that protects the divisome
                     from stress; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsI"
                     /protein_id="WP_012773051.1"
                     /db_xref="GI:502365794"
                     /translation="MSLSRRQFIQASGLALCAGMTPLAAKASGNSAALPIPPLLESRR
                     GQPLFLTMQRAHWAFSGDRKTAIWGINGRYLGPTVRVYDGDDVKLIYSNRLNEPVAMT
                     IGGLQVPGPLMGGAARIISPGTDWSPVVPIRQPSATCWYHANTPNRMAPHIYNGLAGL
                     WLVEDRASKALPLPNHYGVDDFPLIIQDKRLDNFGVPIYSPPSNGGFVGDSLLVNGIQ
                     NPFVEVSRGWVRLRLLNASNSRRYVMRLSDGRAMHVIASDQGLLPAPMAVNQLSLAPG
                     ERREILIDMSQGEDVTLTAGESAGIMDRLRGLFEPSSILISTQILTLKPTGLLPLVTD
                     NLPMRLLADNIIEGSISRTREFRLGDSLPGINGAMWDMTRADVQTQLGRCERWIIHAD
                     TPQAFHIQGVKFLVRSANGGPPAVEDSGWKDTVWVDNDVELLVYFMQPSSMAFPFLYY
                     SQTLELADRGSTGQLIVQSAM"
     gene            389479..390216
                     /locus_tag="PC1_RS01695"
                     /old_locus_tag="PC1_0335"
     CDS             389479..390216
                     /locus_tag="PC1_RS01695"
                     /old_locus_tag="PC1_0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_012773052.1"
                     /db_xref="GI:502365795"
                     /translation="MRELLLWVRDQLAGASSAPRYMQLASLLESEIGRRKALAGQFLP
                     AERLIAQQLGLSRVTVSRSLSLLEEKGLIVRQQGVGTRVTQRLNYALSAEDEGFTALV
                     LKQGGIAGSLWLDKVIQVPPAAIAAKMSLPEGEVVTYLRRVRLSNGEPVSLETTWIPQ
                     KFLPDPEALEQSLYQYWVSRGIAPDKKRYRFKAIACAAEIAARLGTAVGTPLLYCQLH
                     VYNEQGELLEYSEAHCRSDVYEIQFAD"
     gene            complement(390259..391086)
                     /gene="dkgA"
                     /locus_tag="PC1_RS01700"
                     /old_locus_tag="PC1_0336"
     CDS             complement(390259..391086)
                     /gene="dkgA"
                     /locus_tag="PC1_RS01700"
                     /old_locus_tag="PC1_0336"
                     /EC_number="1.1.1.274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822144.1"
                     /note="methylglyoxal reductase/beta-keto ester reductase;
                     catalyzes the reduction of 2,5-diketo-D-gluconic acid to
                     2-keto-L-gulonic acid; also catalyzes the reduction of
                     methylglyoxal, ethyl-2-methylacetoacetate and
                     ethyl-acetoacetate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-diketo-D-gluconic acid reductase"
                     /protein_id="WP_012773053.1"
                     /db_xref="GI:502365796"
                     /translation="MTQPKVKLADGNIMPQLGLGVWRASSEDTVIAVTEALSIGYRAI
                     DTAAIYKNEEAVGQALSSANLPREEVFITTKLWNGDHTDPQKALEESLRKLRLDYIDL
                     YLIHWPLPQQNTFVDAWRGLIKLQEQGLAKSIGVSNFHIHHLQRLKEETGVLPVIDQV
                     ELHPLLQQRQLHAWNATHHIQTESWSPLAQGGEGIFDHPVIRKLATKYGKTPAQIVIR
                     WHLDSGLVVIPKSVTPSRIKENFEVFDFRLDKDELGEIAKLDSGKRLGSDPDEPRND"
     gene            complement(391361..392524)
                     /locus_tag="PC1_RS01705"
                     /old_locus_tag="PC1_0337"
     CDS             complement(391361..392524)
                     /locus_tag="PC1_RS01705"
                     /old_locus_tag="PC1_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010297502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde oxidoreductase"
                     /protein_id="WP_012773054.1"
                     /db_xref="GI:502365797"
                     /translation="MLNFTLHTPTKILFGEGQIAELGKEIPADARILITYGGGSVKHN
                     GVLDQVYRALEGRNVREFSGIEPNPTYETLMKAVEVVRAEKIDFLLAVGGGSVVDGTK
                     FIAAAADYQAAQDPWHILQTGGAEIDRGVAMAAVLTLPATGSESNNGAVITRKSTNDK
                     LAFRSRYTQPLFAVLDPVVTYTLPARQIANGVVDAFVHTVEQYLTYSVDAKVQDRFAE
                     GLLLTLVEEGPRALAEPENYKVRANVMWSATMALNGLIGAGVPQDWSTHMLGHELTAL
                     HGLDHAQTLAVVLPAMLAARKAQKRDKLLQYAERVWNLRDGSEDQRIDGAIAATRDFF
                     EKMGVPTRMSDYQLDGSSIPTLVAKLNEHGLTALGEHRDITLEESQKIYEAAR"
     gene            complement(392528..393268)
                     /locus_tag="PC1_RS01710"
                     /old_locus_tag="PC1_0338"
     CDS             complement(392528..393268)
                     /locus_tag="PC1_RS01710"
                     /old_locus_tag="PC1_0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="WP_012773055.1"
                     /db_xref="GI:502365798"
                     /translation="MNKTIELFTSHRSERSYLDKAIPDDVLDAIIQSAHLAPTSVNSQ
                     QVSLIVTRDPERKARIAELAGGQPWIAKAPVFITVVLDMHKTQVGIAMSGKQQHAHES
                     LESLIAGTTDVGIALGTLMAAARSFGLGIVPIGGIRREPQAMIDFLELPELTFPVAGV
                     AIGYVDTPAHQKPRLPLNSFRHDETYHQDVLPAAIEQYNQTLVTHWQQTGRADGDNWG
                     DNTASYYQHIYFPKVLPAILQQGFKLDK"
     gene            393500..394489
                     /locus_tag="PC1_RS01715"
                     /old_locus_tag="PC1_0339"
     CDS             393500..394489
                     /locus_tag="PC1_RS01715"
                     /old_locus_tag="PC1_0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_012773056.1"
                     /db_xref="GI:502365799"
                     /translation="MLTEGQCEGLVQNPADQKPIVQELTESQQTVRQRIVRQAIRCST
                     KNWATPSLVPQVKILYTEQHHPRVPVMYEPTIVIIFQGQKIGYVGGKTFQYDPENYLL
                     MTVPLPFECETIASAEHPLVGMAIRIDIQMLQDLLIDIGDDDSAVRPCSCTCGVNSAP
                     LTDEILCAVERLLDAMDNPRDARVLGPTIVREIIYHMLCGERGAALQALVNRHTHFSQ
                     IAKSLRRIENHYADNLNVEQLAAEVNMSISAFHHNFKAVTNTSPLQYLKSYRLHKARV
                     MMINEGLRAGVAAARVGYESVSQFSREFKRYFGATPSDEAARLKASNMVVEES"
     gene            complement(394519..395178)
                     /locus_tag="PC1_RS01720"
                     /old_locus_tag="PC1_0340"
     CDS             complement(394519..395178)
                     /locus_tag="PC1_RS01720"
                     /old_locus_tag="PC1_0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773057.1"
                     /db_xref="GI:502365800"
                     /translation="MSVVHDIIQALWQQDFSALADPHVIWVVYGILFTTLFLENGLLP
                     ASFLPGDSLLLLTGAMIAKGVMSFFPTMILLTIAASLGCWLSYLQGRWLSDTRLVKGW
                     LLQLPAHYHQRAHHLFHRHGLMALLVGRFLAFIRTLLPTMAGISGLNNTRFQIFNWLS
                     GLLWVGGIVTLGYALSHIPLVKRYEDQVMTALILLPIILLISGLIGMAVVVWRKKRAV
                     A"
     gene            complement(395500..396690)
                     /locus_tag="PC1_RS01725"
                     /old_locus_tag="PC1_0341"
     CDS             complement(395500..396690)
                     /locus_tag="PC1_RS01725"
                     /old_locus_tag="PC1_0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973775.1"
                     /note="catalyzes the formation of L-homocysteine from
                     cystathionine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase"
                     /protein_id="WP_012773058.1"
                     /db_xref="GI:502365801"
                     /translation="MTSKKTATALVAAGRSKKFTHGSVNPVIQRASSLVFDTVQDKKH
                     ATINRAKGALFYGRRGTLTHFAFQEAMVELEGGVGCALYPCGAAAISNAILSFVAAGD
                     HILVTESAYEPTQDFCTKVLNKLNVSTTYFNPLIGADIAELIQPNTKVVFLESPGSIT
                     MEVHDVPAIVQAVRRINPEIVIMIDNTWAAGILFKAFDFDIDISIQAGTKYIVGHSDA
                     MLGTAVANERCWAQLREHSYLMGQMVDADTAYVASRGLRTLGVRLKQHQESSIRIAKW
                     LAERPEVAVVNHPALPECKGHEFYVRDFNGCNGLFSFVLKEKLSKETLAHYLDHFEHF
                     SMAYSWGGFESLILANQPEELAAIRPASGVDFTGTLIRLHIGLEDSDDLIDDLAAGFS
                     RLSA"
     gene            complement(396934..398226)
                     /locus_tag="PC1_RS01730"
                     /old_locus_tag="PC1_0342"
     CDS             complement(396934..398226)
                     /locus_tag="PC1_RS01730"
                     /old_locus_tag="PC1_0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011091985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773059.1"
                     /db_xref="GI:502365802"
                     /translation="MDAFILIASLAVLLAVGVPVAYAVGLSAIVGALWIDLPLEAVMI
                     QVTNGVNKFSLLAIPFFILAGAIMAEGGIARRLVSFAYIFVGFIRGGLSLVNIVASTF
                     FGAISGSSVADTASIGSVMIPEMEKKGYPRDFSAAVTASGSVQAILTPPSHNSVIYSL
                     ATGGTVSIASLFIAGILPGLLLSLTMMVMCVGFAHRRGYPKGERVPFRQALKIFVDTL
                     WGLMTVVIIMGGILSGIFTATESAAIACLWSFFVTMFIYKDYKWSELPKLMYRTVKTV
                     TIVMILIGFAAAFGAIMTYMQLPARITEFFTSISDNKYVILMCINIMLLLLGTLMDMA
                     PLILILTPVLLPVALSLGIDPVHFGMIMLVNLGIGLITPPVGSVLFVASAVSKQKIEQ
                     VVKAMLPFYCGLFLVLMLVTYIPAISLWLPKLFGVHTG"
     gene            complement(398242..398748)
                     /locus_tag="PC1_RS01735"
                     /old_locus_tag="PC1_0343"
     CDS             complement(398242..398748)
                     /locus_tag="PC1_RS01735"
                     /old_locus_tag="PC1_0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010280256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_012773060.1"
                     /db_xref="GI:502365803"
                     /translation="MAQSYLSSMDVLYRIAMWVSGLALLIMTIVIPVGIFARYVLNAA
                     LSWPEPISIICMVTFTFVGAAVSYRSNSHIAVSMLTDRLPESGKKICVHLSNLLMLLI
                     SLFILYYSTLLCLELWEQPVAEFPLLTAGESYLPLPIGSLITVLFIIEKMFFGPQDKR
                     PVVMLGSS"
     gene            complement(398863..399840)
                     /locus_tag="PC1_RS01740"
                     /old_locus_tag="PC1_0344"
     CDS             complement(398863..399840)
                     /locus_tag="PC1_RS01740"
                     /old_locus_tag="PC1_0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_012773061.1"
                     /db_xref="GI:502365804"
                     /translation="MKLSKTLIGVCLGSTALLMSHAIQAQQIKASDVHPEGYPNVVAV
                     QKMGEKLKAATGGRLEIKTFPGGVLGDEKQMIEQAQIGAIDIIRVSMTPVAAILPEIE
                     VFTLPYIFRDEDHMHKVLDGKIGQEIGDKITQSSKSKLVFLGWMDAGTRNLITKEPVV
                     KPEDLKGMKIRVQGSPVALATLKAMGANSIAMGVSEVFSGMQTGVIDGTENNPPTFVA
                     HNYLPVVKNYTWSRHFIIPELFLYSKTKWDKLSKEDQDLILKLAKEAQQEQRVLWNEY
                     TQQSLDKMKAGGVQFHDIDTEYYFKATQPVRDQFGAKYQDLIKAVADVK"
     gene            400832..401551
                     /locus_tag="PC1_RS01745"
     CDS             400832..401551
                     /locus_tag="PC1_RS01745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010280258.1"
                     /note="membrane spanning protein in TonB-ExbB-ExbD
                     complex; involved in the tonB-independent energy-dependent
                     transport iron-siderophore complexes and vitamin B12 into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbB"
                     /protein_id="WP_043881866.1"
                     /db_xref="GI:762768374"
                     /translation="MKTDLSVWGMYQHADAVVKTVMIGLLLASVITWAIFFSKSVEMS
                     GAKRRLRREYLALEQAKTLDDALETADAFKTGSVAQQLLVDAQNELELSARSDDNNGI
                     KERTAFRLERRVAATGRHMGRGNGYLATVGAVAPFVGLFGTVWGIMNSFIGIAQTQTT
                     NLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARSIASYKAMVGDVAAQVLLLQSRD
                     LDVAASNDNRASSAAHKLRVG"
     gene            401555..401980
                     /locus_tag="PC1_RS01750"
                     /old_locus_tag="PC1_0346"
     CDS             401555..401980
                     /locus_tag="PC1_RS01750"
                     /old_locus_tag="PC1_0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973764.1"
                     /note="membrane spanning protein in TonB-ExbB-ExbD
                     complex; involved in the tonB-independent energy-dependent
                     transport iron-siderophore complexes and vitamin B12 into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_010280259.1"
                     /db_xref="GI:497966103"
                     /translation="MAMHLKEDVSDDGEMHDINVTPFIDVMLVLLIIFMVAAPLATVD
                     IRVDLPASSAAPQPRPEKPLYLTVKADKQMFLGEEVVSEQSLAQVLDAKTSANKETTI
                     FFQADKSVDYETIMSVMDSLRKAGYLKVGLVGAETAAAK"
     gene            complement(402090..403109)
                     /locus_tag="PC1_RS01755"
                     /old_locus_tag="PC1_0347"
     CDS             complement(402090..403109)
                     /locus_tag="PC1_RS01755"
                     /old_locus_tag="PC1_0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011091990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose operon repressor"
                     /protein_id="WP_012773063.1"
                     /db_xref="GI:502365806"
                     /translation="MKPTKRITISDIAALAGVSKSTASLVLNGRSKEFRVSDETRDRI
                     LAVAHEQRYQPSIHARSLRSSRSNTLGLVVPEMTNYGFAVISRELEMLCREAGLQLLI
                     ACTDENASQEMMAVNSLVQRQVDGLIVASSLLSDIEYQKINQQLPVIQFDRVIGDSTL
                     PMVISEAVESTAEMVERIARQHRDEFYFLGGQPRISPTRHRLEGFQLGLARTGIDCKP
                     EWIIHGSYHPSAGYEMFAQLCATLGRPPKALFVAACGLMEGVLRYMNQHNLMESGIRL
                     CCFDDHYLFDCLPLKIDTVAQDCENLARNSFEMVTSLIAQQPLEEDRRYIPTRIHWRH
                     PDSRA"
     gene            complement(403140..404549)
                     /locus_tag="PC1_RS01760"
                     /old_locus_tag="PC1_0348"
     CDS             complement(403140..404549)
                     /locus_tag="PC1_RS01760"
                     /old_locus_tag="PC1_0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010297541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family 32"
                     /protein_id="WP_012773064.1"
                     /db_xref="GI:502365807"
                     /translation="MKEVHLLKRMAHALMSGHSRKQEDPYRPEWHLSPCVGLLNDPNG
                     FIHHKGRYHLFYQWNPLSCAHGAKFWGHWSSADLVNWTHEPVALVPSESYESHGCYSG
                     SAVVDQGAIMLMYTGNVKYDDGSRTAFQCLARENPNGEYDKLGAVLTLPDGYTGHVRD
                     PKVWRHDDHWYMVLGAQDLDLQGKVLLYRSDDLLAWEKVGEIAGSRLGGLGDFGYMWE
                     CPDLFPLDGKDVLICCPQGVPAEEERYLNTFQAGYVIGSLNYNNGAYPHQDFHELDLG
                     FEFYAPQTTLSEDGRRLLFGWMSIPDENEFFEPTIEYGWIHTMTCPRELTLRGDRVYQ
                     RPARELQQLRRQHYTWHGAADYASPLHTSSAEILIAVQGEFQLSLASQLVLCWDGERV
                     TLSRRNRRTGEPEHRYWRGELSQLQILCDRSSVEIFINDGEAVMSARYFPESEATMTF
                     SGSGRLTLQHWLLAPCVIE"
     gene            complement(404549..405919)
                     /locus_tag="PC1_RS01765"
                     /old_locus_tag="PC1_0349"
     CDS             complement(404549..405919)
                     /locus_tag="PC1_RS01765"
                     /old_locus_tag="PC1_0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010280264.1"
                     /note="phosphoenolpyruvate-dependent sugar
                     phosphotransferase system; catalyzes the phosphorylation
                     of incoming sugar substrates concomitant with their
                     translocation across the cell membrane; IIB is
                     phosphorylated by IIA and then transfers the phosphoryl
                     group to the sugar; IIC forms the translocation channel;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter"
                     /protein_id="WP_012773065.1"
                     /db_xref="GI:502365808"
                     /translation="MDINKTAAALIPLLGGKENIASAAHCATRLRLVLNDDNLADKKA
                     IENVDGVKGCFQNAGQMQIIFGTGLVNKVYAEFIKAAGISESSKSEAASIAAKKLNPL
                     QRLARLLSNIFVPIMPAIIASGLLMGLLGMIKTYGWVDASSAIFVMLDMFSSAAFIIL
                     PILIGFTAAREFGGNPYLGATLGGILTHPALTNAWGVAGGFQTMHFFGMDIAMIGYQG
                     TVFPVLLAVWFMSIVEKRLRKIVPDALDIIVTPFLTVIISGFVAMLIIGPAGRALGDG
                     ISFLLSTLITHAGWLAGLLFGGLYSAIVITGVHHSFHAIEAGLLGNPNIGVNFLLPIW
                     AMANVAQGGACLAVYFKTRDAKTRAIAVPAGLSCLLGITEAAIFGINLRFIKPFLAAL
                     AGGALGGAWVVFNHVNMTAVGLTGFPGLAIVQGGSMLNYLIGMFIAFGAAFTLSLLLK
                     YKTDSE"
     gene            complement(405999..407534)
                     /locus_tag="PC1_RS01770"
                     /old_locus_tag="PC1_0350"
     CDS             complement(405999..407534)
                     /locus_tag="PC1_RS01770"
                     /old_locus_tag="PC1_0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010297545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose porin"
                     /protein_id="WP_012773066.1"
                     /db_xref="GI:502365809"
                     /translation="MKPSHLAVTIGLLLSSPFYVSAANTDSIEARLNAMEQRLQQAEA
                     RAQAAEARADAAEKQTQQLATRTTQTEQKTQQVEQRTTALAKQKSFADGFEFHGYARS
                     GLSINDSATSSKTDIGPGMSPAGQTGGHIGRLGNEDDTYVEIKLEHKQKLDNGATTRF
                     KVMMADGQRSYNDWTATTSDLNIREAFVELGSLPTFTGAFKDTTLWAGKRFDRDNFDI
                     HWLDSDVVFLAGTGGGIYDVKWADSAKSNFSLYGRSLGEITSLDNDIKNYVFTANNYV
                     GPFQFMLSGLTAKNNDVKQNTGTSRDNTFVTNTNAGDKGYHAMVAYHGDSFYGLRDGT
                     SKTAILYGHGLGGEVKNIGADGNLTNDANTWRFATYGTTALNKTWSFAPSILAQTSKD
                     RYVNGDSYEWVTFNARLIQEITENFALAYEGSYQYMDLDPRGYRSLNQVSGGFYKLTF
                     APTFKVGDIGNFFSRPELRVFASYMDWDKRLDNYSSEDTFGSTGFKAGGEWNFGIQME
                     TWF"
     gene            complement(407733..408656)
                     /locus_tag="PC1_RS01775"
                     /old_locus_tag="PC1_0351"
     CDS             complement(407733..408656)
                     /locus_tag="PC1_RS01775"
                     /old_locus_tag="PC1_0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoimidazole riboside kinase"
                     /protein_id="WP_012773067.1"
                     /db_xref="GI:502365810"
                     /translation="MANRIWVMGDAVVDLIPEDAERYLKCPGGAPANVAVGIARLGGN
                     SAFIGRVGDDVFGHFLKTVLEQENVDTHHMAHDRFHRTSTVVVSLDEAGERAFTFMVR
                     PSADLFLQPEDLPIFNRGEWLHLCSIALSQEPSRSTAFEAMRQIKAAQGRVSFDPNIR
                     DDLWQSEQELRDCLTQALMLADVVKLSREELAFLCSTPDVEAGIQQFMQRYPTQLLLV
                     TLGSEGVWLHDRHQLRHFAAPSVTPVDTTGAGDAFVAGLLHGLAQYDDLSQPLSWDPI
                     IAQAQRCGALATTAKGAMTALPYAQQLHALP"
     gene            409126..409677
                     /locus_tag="PC1_RS01780"
                     /old_locus_tag="PC1_0352"
     CDS             409126..409677
                     /locus_tag="PC1_RS01780"
                     /old_locus_tag="PC1_0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773068.1"
                     /db_xref="GI:502365811"
                     /translation="MFSFDKNKKDAKEPQERSEINSSPAISPSNELINSVNPVRVKKD
                     TFISQGARMTGSLAVDGNITVEGRVEGDVQCDNTIKVEHTGQVNGEMKSQQIIINGRV
                     EGRIAASVVAILAQGKVFGDIFTDELSIEKGGVFTGQSHPLTPPTQNQEKLTYVDKEK
                     EKAAKAPAEQENVVALAGNVPTE"
     gene            409860..410318
                     /locus_tag="PC1_RS01785"
                     /old_locus_tag="PC1_0353"
     CDS             409860..410318
                     /locus_tag="PC1_RS01785"
                     /old_locus_tag="PC1_0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010286715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773069.1"
                     /db_xref="GI:502365812"
                     /translation="MKVEAAESSVFASQQVMAKRSTEHAEKAALSEQLQSYQAGSGAV
                     PVGQTTRYDFTRISPAELYETVEGLVSSGRLGREEGSALLGFISSPRENVGSVPPSNV
                     FQPINVFDTIQQGVAGASSRSEVQNTESLQRAAEALNRFQGQVSSISVYV"
     gene            complement(410394..411746)
                     /locus_tag="PC1_RS01790"
                     /old_locus_tag="PC1_0354"
     CDS             complement(410394..411746)
                     /locus_tag="PC1_RS01790"
                     /old_locus_tag="PC1_0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal-dependent decarboxylase"
                     /protein_id="WP_012773070.1"
                     /db_xref="GI:502365813"
                     /translation="MSELTLLADADERGRRYLAENAQRRVFPDAAALAALARFDEALP
                     QQGFSPESTLTLLDEVGSPATTASNGPNYFGFVIGASLPVAAASERLMIAWDQCASTF
                     DNSPVSATLERLASRWVLDALNLPKDSAVGFGTSATACTLSCLAAARRALLAKQGWDF
                     DNDGLNGAPEITVVISELTHITVKKALRVLGFGLRHLRIAPVNAYGQIDVAQLPPLDD
                     RTILCLQAGEVNTGEFDDFAQIIPIAKAAGAWVHVDGAFGLWARASSHATLTEGIELA
                     DSWTTDAHKWLNTPYDCAMAICRDADALAEAMNADAVYSSAARDAQKNLTLEFSRRPR
                     GIPVWAVLRTLGRDGVAEMVERHCRQAAFIADGLRHAGFEVLNRVVLNQVLLRGETDG
                     QTTAIRDALQASGKAWFGGTVWQGRPALRISVSSWRTQDDNVQALITLLTEIKARTPR
                     "
     gene            complement(411804..413057)
                     /locus_tag="PC1_RS01795"
                     /old_locus_tag="PC1_0355"
     CDS             complement(411804..413057)
                     /locus_tag="PC1_RS01795"
                     /old_locus_tag="PC1_0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_043881867.1"
                     /db_xref="GI:762768378"
                     /translation="MKTSPIHTTSSVTECDLYSTQTTLPRALVLLFACASALSVANVY
                     YAQPLLDALSVDFHISIAAVGGVMSATQLGCALALILLVPLGDILNRRYLMLSQLGAL
                     IVALIAVGLSTTSLALLIGMLAVGMLGTAMTQGLIAYAATAAAPQERGRVVGAAQGGV
                     VIGLLLARVLSGFIADVAGWRSVYFFSALLMLLLAVLLWRTLPHQLLARQRPHYSALL
                     LSMLTLLRQERVLQIRGTIALLMFAALSIFWSALVLPLSREPYFFSHTVIGAFGLVGI
                     LGALAAVKAGSLADKGREQWVSGIALLLLLTSWLPLWLAPYSLLALVVGIIVLDLGGQ
                     AIHVTNQSMIFKTHPDAHSRLVGCYMLFYSIGSGLGAMATTAAYDAAGWSGVCLLGAA
                     VSLTALLFWKVTLHASAPSPAASTP"
     gene            413208..413654
                     /locus_tag="PC1_RS01800"
                     /old_locus_tag="PC1_0356"
     CDS             413208..413654
                     /locus_tag="PC1_RS01800"
                     /old_locus_tag="PC1_0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010298232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="WP_012773072.1"
                     /db_xref="GI:502365815"
                     /translation="MVKRKSLKEDACPVARALDVVGDRWALLIIRDAFDNRRRFSDFQ
                     RSLGVAKNILTDRLRTLVDEGILSVQPVSDSSAYQEYVLTPKGEQLFPLVVALRQWGE
                     QQLFAEGEPHSLLLDRHTGQPLQAMLPHSAQGQPVVGQDTFVQKVD"
     gene            413664..414125
                     /locus_tag="PC1_RS01805"
                     /old_locus_tag="PC1_0357"
     CDS             413664..414125
                     /locus_tag="PC1_RS01805"
                     /old_locus_tag="PC1_0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773073.1"
                     /db_xref="GI:502365816"
                     /translation="MQKEPKETGSDLEAISRYLKKLHVLTLCVGENSELWCASCFYTY
                     DDQLIAFYLMTELQTRHGEMMVRLPQVAGTVSGQPKSVMLIKGVQFRGQAVLLEGDEA
                     HQARARYNTRFPIARASQAPIWRLDLTEIKMTDNALGFGKKRYWQRDEQVQ"
     gene            414220..414873
                     /locus_tag="PC1_RS01810"
                     /old_locus_tag="PC1_0358"
     CDS             414220..414873
                     /locus_tag="PC1_RS01810"
                     /old_locus_tag="PC1_0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773074.1"
                     /db_xref="GI:502365817"
                     /translation="MSRVLLLGATGLVGHELLQLLKANNRVETIYAPTRKPLASSEKV
                     VNPHGPDLSAALAQLTDPVDIAFCCLGSTLKTAGSKQAFRYVDYTLVVEGSKVALALG
                     ATHLLVVSSLSANATSPFFYSRVKGETERSLRQQGWQHLTLAQPSMLLGEREDSRPLE
                     SLAAPLFRLFPAKWRAIEGKTVAQALLNQAFSPEPKARVTVLESDQLRSLGKLPALQ"
     gene            complement(414885..415349)
                     /locus_tag="PC1_RS01815"
                     /old_locus_tag="PC1_0359"
     CDS             complement(414885..415349)
                     /locus_tag="PC1_RS01815"
                     /old_locus_tag="PC1_0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010286739.1"
                     /note="activates anaerobic ribonucleoside-triphosphate
                     reductase under anaerobic conditions; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleotide reductase-activating
                     protein"
                     /protein_id="WP_012773075.1"
                     /db_xref="GI:502365818"
                     /translation="MNYHQYYPVDVVNGPGTRCTLFVAGCVHECVGCYNKSTWRLNSG
                     QPFTQEQEDRIIADLQDTVIPRQGISLSGGDPLHPRNVPDILRLVERIRAECPGKDIW
                     VWTGYVLAELTPEQQRVVDLINVLVDGKFVQDLKDPALIWRGSSNQVVHRLR"
     gene            complement(415431..417569)
                     /locus_tag="PC1_RS01820"
                     /old_locus_tag="PC1_0360"
     CDS             complement(415431..417569)
                     /locus_tag="PC1_RS01820"
                     /old_locus_tag="PC1_0360"
                     /EC_number="1.17.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004093802.1"
                     /note="Catalyzes the reduction of nucleoside
                     5'-triphosphates to 2'-deoxynucleoside 5'-triphosphates;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside triphosphate reductase"
                     /protein_id="WP_012773076.1"
                     /db_xref="GI:502365819"
                     /translation="MKPVVIKRDGCQVPFDEVRIKEAVERAAHAAGVNDADYCATVAC
                     AVAQQMQDKSRVDIREIQDAVENLLMSGNYKKLARTYIEYRHDRDIARERHGRLNQEI
                     RGLVEQSNMALLNENANKDSKVIPTQRDLLAGIVAKHYAKQYILPRDVVLAHERGEIH
                     YHDLDYSPFFPMFNCMLIDLNGMLTNGFKMGNAEIEPPKSISTATAVTAQIIAQVASH
                     IYGGTTINRIDEILAPFVTASHAKHKAVAEEWQIPDADNYALTRTEKECYDAFQSLEY
                     EVNTLHTANGQTPFVTFGFGLGVSWESRLIQESILRNRIAGLGKNHKTAVFPKLVFAI
                     RDGLNHKAGDPNYDIKQLALECASKRMYPDILNYDQVVNVTGSFKTPMGCRSFLGVYE
                     ENGQQIHDGRNNLGVISLNLPRIALEAEGNEDRFWTLLDQRLALAKKALMTRIARLES
                     VKARVAPILYMEGACGVRLKADDSIADIFKNGRASISLGYIGLHETINALFGNQTHVF
                     DDETLRAKAIAIIACLKDATEQWKDETGYGFSLYSTPSENLCDRFCRLDTAEFGVVQG
                     VTDKGYYTNSFHLDVEKKVNPYQKIDFELPYPPLANGGFICYGEYPNLQHNLKALEDV
                     WDYSYSRVPYYGTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDSARVSVTRRVCGY
                     LGSPDARPFNAGKQEEVKRRIKHLGNGQLG"
     gene            complement(417973..418710)
                     /locus_tag="PC1_RS01825"
                     /old_locus_tag="PC1_0361"
     CDS             complement(417973..418710)
                     /locus_tag="PC1_RS01825"
                     /old_locus_tag="PC1_0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010286744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_012773077.1"
                     /db_xref="GI:502365820"
                     /translation="MTYCVAMCLSDGLVFASDSRTNAGVDHIATFKKLYVFQHENERV
                     LVIQCAGNLATTQSIISLLNARIDAQHTPNLMQVNSMYDAAMLLGETVREVIHRDSSV
                     QQNGSNTNFGCNLLLGGQIGGETHRLFHIYPEGNFIEATPDTPYFQIGESKYGKPIID
                     RVLTMDTPLEQAMCCALISIDSTLRSNLSVGLPLDVMIYRTGSFASTEQQRITENNAY
                     FTTIRKAWSEGLLNTFRQLPPFPDIQP"
     gene            complement(418734..419555)
                     /locus_tag="PC1_RS01830"
                     /old_locus_tag="PC1_0362"
     CDS             complement(418734..419555)
                     /locus_tag="PC1_RS01830"
                     /old_locus_tag="PC1_0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase"
                     /protein_id="WP_012773078.1"
                     /db_xref="GI:502365822"
                     /translation="MKLTINHLTHYRYDEEVKFSTQYLRLTPQNSAHQKIREWKLTLP
                     TSAVQTTDAYGNVLHVLTLDHPHQDITIHAEGVVDILDSGAAENPEIQDGLSPLVFLR
                     PTPLTEADGEIRAFAQRYYRPDAAEESLNTLMAELRLKMPYTPGATQVQDTAAAAFAM
                     QKGVCQDHTHVFLACCRSLSIPARYVSGYVYSQDTHHVAMHAWAEVWLNGYWQGFDIT
                     NSTRQLHQHLWLAVGMDYMDACPVRGTRLGGGCEEMFSEAEVRLFERQQQVQQQQ"
     gene            complement(419552..420481)
                     /locus_tag="PC1_RS01835"
                     /old_locus_tag="PC1_0363"
     CDS             complement(419552..420481)
                     /locus_tag="PC1_RS01835"
                     /old_locus_tag="PC1_0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773079.1"
                     /db_xref="GI:502365823"
                     /translation="MLSRTASELYWMARYLERAESLARVLDVTYKLSMMPRHSQQQRD
                     LALPLNLTATHELFQQRYTRFSMNNLLNFFALDSQNPSSIYNCIEMAWNNAHAVRGSL
                     SSEVWECINATRIDIRNLRHQGVDNVGIDAFFDWVKERSHLFRGAMFGTLLRNDAQCF
                     IRVGTLIERAYATAQLLKVKHQQLNNDPDPVREYYRLDTLLRAVSAREAYHSIYRQPI
                     SPETVTELLVLREDVPRSLHACIGDLVLQLEAIGSQRAKVPHRLAHLLHVELRFSTLD
                     DILAQDLSTYLNNFMIKINELADSIRHTYLEAL"
     gene            complement(420475..421914)
                     /locus_tag="PC1_RS01840"
                     /old_locus_tag="PC1_0364"
     CDS             complement(420475..421914)
                     /locus_tag="PC1_RS01840"
                     /old_locus_tag="PC1_0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010284550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773080.1"
                     /db_xref="GI:502365824"
                     /translation="MIKMKLPSAPYYDEMLSSQGQQRQHYNSYWQWLQQTDQQAIKQK
                     KEQAELLFHRVGITFNVYGEEGGTERLIPFDSVPRIIPAHEWQLLDRGIRQRVQALNA
                     FLYDIYHHQHILKAGIIPSEQVLANEQYQPCMQGVNLHNNIYAHITGIDMVRNSDGHY
                     YVLEDNLRTPSGVSYMLENRKMMMRLYPDLFASQHIAPVERYPSYLLQTLRESTLVDD
                     PTVVVMTPGRFNSAYFEHSFLAQQMGVELVESADLFVKEGAVYMRTTEGPCQVDVIYR
                     RVDDAFLDPLAFRADSMLGVPGLLSVYRAGGVVLANAIGTGVADDKSIYPYVPEMIRF
                     YLSEEPILHNIPTWQCRNPSDLSYVLDHLDSMVVKEVHGAGGYGMLVGPRATRGEIET
                     FRQRLLAHPNNYIGQETLALSTCPTFIDDGLAPRHIDLRPFALSGEEIRLVPGGLTRV
                     ALTEGSLVVNSSQGGGTKDTWVMEEDESC"
     gene            complement(422136..422522)
                     /locus_tag="PC1_RS01845"
                     /old_locus_tag="PC1_0365"
     CDS             complement(422136..422522)
                     /locus_tag="PC1_RS01845"
                     /old_locus_tag="PC1_0365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004874062.1"
                     /note="has endoribonuclease activity on mRNA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="WP_012773081.1"
                     /db_xref="GI:502365825"
                     /translation="MSRTISTEHAPAAIGPYVQGVDLGSMIITSGQIPVNPKSGLVAD
                     NITAQTRQSLENVQAIVEAAGLKVSDIVKTTVFVKDLHDFTLVNTAYEAFFNEHDAPF
                     PARSCVEVARLPKDVKIEIEAIAVRR"
     gene            complement(422621..423085)
                     /locus_tag="PC1_RS01850"
                     /old_locus_tag="PC1_0366"
     CDS             complement(422621..423085)
                     /locus_tag="PC1_RS01850"
                     /old_locus_tag="PC1_0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973701.1"
                     /note="involved in the allosteric regulation of aspartate
                     carbamoyltransferase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase regulatory chain"
                     /protein_id="WP_012773082.1"
                     /db_xref="GI:502365826"
                     /translation="MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTATDQRITI
                     GLNLPSNHLGRKDLIKIENIFLTEEQANQLAIYAPQATVNQIDDYDVVRKLVPTLPEH
                     ITGVLTCPNSNCISRSEPVSSSFSVKQRDGDVHLKCKYCEKEFERQAVLQDR"
     gene            complement(423101..424036)
                     /locus_tag="PC1_RS01855"
                     /old_locus_tag="PC1_0367"
     CDS             complement(423101..424036)
                     /locus_tag="PC1_RS01855"
                     /old_locus_tag="PC1_0367"
                     /EC_number="2.1.3.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DA73.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="WP_012773083.1"
                     /db_xref="GI:502365827"
                     /translation="MVNPLYQKHIISINDLSREDLELTLRVAASLKAKPQPELLKHKV
                     IASCFFEASTRTRLSFETAMHRLGASVVGFADSNNTSLGKKGETLADTISVISQYVDA
                     IVMRHPQEGASRLATEFSGGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLNNINIAM
                     VGDLKYGRTVHSLTQALAKFEGNRFYFIAPDALAMPDYILSMLKEKNIAYSLHNSIDE
                     VVGELDILYMTRVQKERLDPSEYINIKSQFVLRAADLHSARPNLKVLHPLPRVDEITI
                     DVDATPYAYYFQQAGNGIYARQALLALVLNRELVL"
     gene            424559..425023
                     /locus_tag="PC1_RS01860"
                     /old_locus_tag="PC1_0370"
     CDS             424559..425023
                     /locus_tag="PC1_RS01860"
                     /old_locus_tag="PC1_0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010298260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773086.1"
                     /db_xref="GI:502365830"
                     /translation="MITGNVHHLELVPYLPAKLREAIEYVKKNITADTPLGKHDIEGN
                     SVFVLISNDSTDLLEKRRAEYHAKYLDIQIVLSGVEGMTFSNLPAGKPDTDWLADKDI
                     AFLPSGEQEKQFVMQEGDFVVFFPGEVHKPLCAVGEPAHVRKAVVKIDASLV"
     gene            425373..426056
                     /locus_tag="PC1_RS01865"
                     /old_locus_tag="PC1_0371"
     CDS             425373..426056
                     /locus_tag="PC1_RS01865"
                     /old_locus_tag="PC1_0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_012773087.1"
                     /db_xref="GI:502365831"
                     /translation="MTQITLPDRLIAMFESDPLVGWAIKDTNSRFVYVNNTFKTWQTI
                     STRYDYEGLNIRDIPVPVAEFSDIFNQQEREIERTGKAVRAITTHIQGTEKIMQPAYN
                     IQEPIYDEHRNCIGTVISVRHVRIITPTSLLNGTIIQHSTFEPPSTIFTEKEWEVIYL
                     LVCGMMLKDISSILSITVDAVNSRLRSCYRKTGLNSVSGLKEYCRDNRFDNYIPLFFL
                     KKGHIIIRG"
     gene            426061..426726
                     /locus_tag="PC1_RS01870"
                     /old_locus_tag="PC1_0372"
     CDS             426061..426726
                     /locus_tag="PC1_RS01870"
                     /old_locus_tag="PC1_0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_012773088.1"
                     /db_xref="GI:502365832"
                     /translation="MDPDLTPVEYYFDNSLFGWAIKDCNSQYVYGNKMACQYFGVTEN
                     KLVGCLDTDLTPDISEHYGHILYDDQKILTTNEMSIVLKTFDYGRRNRLRSFLVEKRP
                     WRLNDGSDGIVCTYIEITNVYFSTFLMPCERKPIVFTRPANIFTDKEWEAVLLLQSGV
                     KQNRIPDILGISSSTLRNRITRCCDKAGVANSTALIQHCNQKGWDNYIPPFFLIKGHV
                     SIT"
     gene            complement(427088..428095)
                     /locus_tag="PC1_RS01875"
                     /old_locus_tag="PC1_0374"
     CDS             complement(427088..428095)
                     /locus_tag="PC1_RS01875"
                     /old_locus_tag="PC1_0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010298266.1"
                     /note="catalyzes the formation of ornithine and
                     carbamylphosphate from citrulline in the arginine
                     catabolic pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="WP_012773089.1"
                     /db_xref="GI:502365833"
                     /translation="MQPFYKRHFLRLMDFTPAEIANLLALSTKLKADKKNGTEVRRLQ
                     GKNIALIFEKDSTRTRCSFEVAAYDQGAQVTYLGPSGSQIGHKESIKDTARVLGRMYD
                     GIQYRGYGQQIVETLAQYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKPLSEMALV
                     YVGDARNNMGNTMLEAAALTGLDLRLVAPKACWPDAGLVAECQAAAEQTGGSITLTED
                     IATGVAGADFIYTDVWVSMGEPKETWQERIALLKPYQVNAAMIAATGNPQVKFLHCLP
                     AFHDDQTTMGQQMAEQYGLHGGMEVTDEVFESAHSIVFDQAENRMHTIKAVMVATLAQ
                     D"
     gene            428257..428682
                     /locus_tag="PC1_RS01880"
                     /old_locus_tag="PC1_0375"
     CDS             428257..428682
                     /locus_tag="PC1_RS01880"
                     /old_locus_tag="PC1_0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNase E inhibitor protein"
                     /protein_id="WP_012773090.1"
                     /db_xref="GI:502365834"
                     /translation="MANRELLEEQREETRLIIEELLDDGSDPDALYTIEHHFSAEKFE
                     VLEKVAVEAFKLGYEVTDAEELEVEDGVLLMCCDAISEVALNAELIDAQVEQLLALAE
                     RHGVNYDGWGTYFEDPDGEGEEDGDDEDFYDEDDDGKRH"
     gene            complement(428751..429254)
                     /locus_tag="PC1_RS01885"
                     /old_locus_tag="PC1_0376"
     CDS             complement(428751..429254)
                     /locus_tag="PC1_RS01885"
                     /old_locus_tag="PC1_0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010284587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_012773091.1"
                     /db_xref="GI:502365835"
                     /translation="MTTATSAKLQVRPITAHDDAAIARVIRQVSAEFGLTADKGYTVS
                     DPNLDALFALYSQPQSAYWVIEYEGCVVGGGGIAPLVAGDEDVCELQKMYFLPIARGK
                     GLARQLAIQALDFARQHGFRRCYLETTGHLTSAIRLYESLGFEPIPHSMGNTGHTDCE
                     VTMLKVL"
     gene            429549..430730
                     /locus_tag="PC1_RS01890"
                     /old_locus_tag="PC1_0377"
     CDS             429549..430730
                     /locus_tag="PC1_RS01890"
                     /old_locus_tag="PC1_0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010284589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773092.1"
                     /db_xref="GI:502365836"
                     /translation="MTINTSENNTQHRVKFHGKAGEYFAIWLVNALLTVITLGIYSAW
                     ATVRRRRYFYGNTEINGDRFDYHADPIQILKGRLLVIAGIILFYIILAMSPTLGTIIA
                     LAFAALIPIIVIRNWRYNAIMSSYRGVRFNYDCQTGRAYWVLLFCPILLMLAFYIALV
                     VVVMIGMQSNSPILIGFIALAIAIPGFAAVNGIMKMMQLDFYVNNLSFGKTAFKAELT
                     KAAFIKFALVSLLIFVPFLIAALSFMSSFIFTLFQTIMMGGGNEDLILMMLLSNAFNF
                     IMMFIVALLGVLVSSSYLVVAQRNYLFNQTSLNGDVKLHSSMQTLSYMGLLITNSLIT
                     IFSLGWAAPVAEIRHARYIANATAVEGDLALLHVQAHQDTANSALAEEAVQALDLGVG
                     L"
     gene            430747..431784
                     /locus_tag="PC1_RS01895"
                     /old_locus_tag="PC1_0378"
     CDS             430747..431784
                     /locus_tag="PC1_RS01895"
                     /old_locus_tag="PC1_0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M48"
                     /protein_id="WP_012773093.1"
                     /db_xref="GI:502365837"
                     /translation="MNIEGHYQYPGLAARVAASLHLADNGSMMVLNTGSSNTTFSLEQ
                     VTVSDALGSIPLTLTFPDGGRFVPADDPTFRAWYSARRRPGLVHRLERHKRGVILTLF
                     ATILVIINYVYVVLPWASSALALRIPTAIEQQLGQHTLTLLRHSDFTPSKLPIERQQA
                     MQALFQQVMPADMREDKTPLRLEIMSAPIGPNAFMLADGTLIISDDLVTLAKSDNELA
                     AVMLHEMGHHAYRHPMRMVVRSSLVSLTFMWMTGDVSGVGDTVLQSAAFINEMQFSRD
                     MEREADAWAIAEMQQQGRSLQSMQAMYQALVANDRSHDEVESLDLPDWLSTHPDMDER
                     LKVIEREMNKH"
     gene            432150..433229
                     /locus_tag="PC1_RS01900"
                     /old_locus_tag="PC1_0379"
     CDS             432150..433229
                     /locus_tag="PC1_RS01900"
                     /old_locus_tag="PC1_0379"
                     /EC_number="2.3.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773094.1"
                     /db_xref="GI:502365838"
                     /translation="MINRILSGVVGAFLLMLSPLTHAQANFPEPKEGDWIAPEFTFNS
                     GEKLKDLRIHYYTIGDKTKPAVLLLHGTNQPIKALLANGFGGELFGPGQALDSSKYFI
                     IMPESIGSGKSSKPSDGLRMKFPQYDYNDMVQAQYRLVKEGMGINHLRLVMGYSMGGM
                     QTWLWGEKYPDMMDALVPMASLPNELSGRNWMMRRILIESIKNDPVWNNGDYTQQPPT
                     LKTASIMFSIATTGGTLAYQSKAPTRAQADKLVEDRLAAPSNSDANDFIYIWGSSANY
                     NAAPELNKIKASVLVINSADDERNPVETGILDNELKKIKQATLFLIPASKDTSGHGTM
                     MSAKFYKDELQRFLEKNQSQKNNKK"
     gene            433449..435068
                     /locus_tag="PC1_RS01905"
                     /old_locus_tag="PC1_0380"
     CDS             433449..435068
                     /locus_tag="PC1_RS01905"
                     /old_locus_tag="PC1_0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_012773095.1"
                     /db_xref="GI:502365839"
                     /translation="MFRKIKIRTALSMMVFSLAALLLFVGVLGLVAVQSGNKSFARVD
                     MEVLPGLVALNDSSELLLRGRLDLRLYESLMGKGDVEAAKVALGRARTKVDGASEKWQ
                     EYLKYPQSDEEKVISADMAEKRNTLMQDFIDPAFAALNAGNLDEYRQRAGKSTVLYAA
                     FDKSSKALVAFKLKSIDEAYADSNGRVNLMETILYTAIACALLLAALAWSVMTNMIVK
                     PLNQAISVFDRIAEGDLRAQIDSSGKNEIAHLFAAVQRMRDGLENMVRVVRNGTDAIS
                     VGVEEIASGNIDLSSRTEQQAASLDETASSMEQIMSTVKNNEDNTRKANDLALKASNS
                     ASRGGNVVSEVVDTMRSIKQSSAKISDIVGVIDGIAFQTNLLALNAAVESARAGQYGK
                     GFAVVASEVRMLAARSATAAKEIGTMIDDSLSRIEKGAGLVEVAGNTMDEVLMDVKKV
                     VDIMDEITLASSEQSRGISQINIAINQMDGVTQQNASLVSEVATSANALQEQVVNLQQ
                     SVSRFQIARENMEMDNVLPGLRQNIALADAR"
     gene            complement(435146..435706)
                     /locus_tag="PC1_RS01910"
                     /old_locus_tag="PC1_0381"
     CDS             complement(435146..435706)
                     /locus_tag="PC1_RS01910"
                     /old_locus_tag="PC1_0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DJM6.1"
                     /note="in yeast cells this enzyme removes the 2'-phosphate
                     from RNA via an intermediate in which the phosphate is
                     ADP-ribosylated by NAD followed by a presumed
                     transesterification to release the RNA and generate
                     ADP-ribose 1''-2''-cyclic phosphate; functions in tRNA
                     splicing; the function and substrate of bacterial enzymes
                     in organisms that do not perform splicing is unknown;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA 2'-phosphotransferase"
                     /protein_id="WP_012773096.1"
                     /db_xref="GI:502365840"
                     /translation="MSNTKHADVSKFLSYVLRHKPEAIGLTLNSGGWANIAELISCAA
                     KDGRLLTREVIQSVVDNSDKKRFSISADGLSIRAAQGHSSAQVDMRYEPKVPPEFLYH
                     GTATRFIDSINQQGLRPGSRQYVHLSADEATAITVGQRHGKPTVLKIKTLEMHQQGFI
                     FYQADNGVWLTLTVPVPFIDSTPFID"
     gene            436273..437457
                     /locus_tag="PC1_RS01915"
                     /old_locus_tag="PC1_0383"
     CDS             436273..437457
                     /locus_tag="PC1_RS01915"
                     /old_locus_tag="PC1_0383"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773097.1"
                     /db_xref="GI:502365841"
                     /translation="MSSDTFADLQKVFFAAFIQGLGYNLNQPAQVVQPSPPIIGDDED
                     DNDKILWSYFNTLPTSSLTRNTTLASGTQFLSTYSAIMSSLQSPPNKFKEEIGEYCFD
                     AFSNAVENGNAEATPRGYRDWAFLTNKCSSHANSGASAYAAMLLDPIFAGQNNVLPYK
                     PVGRKSVDFFPDYNTMMKQLKKAPSREFTTDLSIKDTSYTKTWNGGAQSAVFGLWSNS
                     YSNTEISQKFASSSVHLEASFKNLLPFSANPGDWYNSATLGIAYSEAGTPPWSPNGLK
                     TWKNTFSASGDMQRFTTLLLIANQMKLVYSTAATFSTTEQKEIIKNSRSGLWPFYHKS
                     SENVSETSVNFDTSGRLMVTVTTEKNVPTIVGAIIEPVDKYLGHLRDASQLELRRLIP
                     RG"
     gene            437532..438431
                     /locus_tag="PC1_RS01920"
                     /old_locus_tag="PC1_0384"
     CDS             437532..438431
                     /locus_tag="PC1_RS01920"
                     /old_locus_tag="PC1_0384"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773098.1"
                     /db_xref="GI:502365842"
                     /translation="MRNFDDVQQYFIARQIEAIGLPSNTVKIYQGAISPAPDDNALWE
                     LLDQLPSSGVIQYNNQGSFFEHYSILVNALVASPNILDPIAAAQRNLTNWGEQPPAWE
                     KGYRSMEKQLSSAPKISFEFELPVSASSSFWGIWHNSDPMAGLSSAIALSALSVKVSF
                     GHLLHFTPQPDDWYTGIALKTAYQNPNKTPPWQPDDLISWDSMFGITGSLHQIVTGLI
                     CVSDIKVEYTISAHFTDQHLNEIKEYNGGGVWPYYLSNKNAVTKFQINTDGDLHVSIM
                     STKGMPIIIGVIANPMASWIGGQ"
     gene            complement(438687..441542)
                     /locus_tag="PC1_RS01925"
                     /old_locus_tag="PC1_0386"
     CDS             complement(438687..441542)
                     /locus_tag="PC1_RS01925"
                     /old_locus_tag="PC1_0386"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DA54.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valyl-tRNA synthetase"
                     /protein_id="WP_012773100.1"
                     /db_xref="GI:502365844"
                     /translation="METKYNPQDIEQPLYEHWEKQGYFKPHGDTSKESFSIMIPPPNV
                     TGSLHMGHAFQQTIMDTLIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAEEGKTR
                     HDYGREAFIDKIWQWKGESGGNITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRL
                     YKEDLIYRGKRLVNWDPKLRTAISDLEVENREVKGSMWHLRYPLADGVKTAEGKDYLV
                     VATTRPETMLGDTGIAVNPEDPRYKDLIGKEVILPLIGRRIPIVGDEHADMEKGTGCV
                     KITPAHDFNDYEVGKRHQLPMVNILTFDGDIRQSAEVFDTNGEASTVYSSDIPEAFQG
                     LERFAARKALVAAFDELGLLEEIKAHDLTVPYGDRGGVVIEPMLTDQWYVRAAVLAKP
                     AVEAVEDGRIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDANGNVYVGRT
                     ESEVRSENNLADDVVLNQDEDVLDTWFSSGLWTFSTLGWPEQTPDLKAFHPSSVMVSG
                     FDIIFFWIARMIMLTMHFIKDEDGKPQVPFHTVYMTGLIRDEEGQKMSKSKGNVIDPL
                     DMVDGISLEALLEKRTGNMMQPQLAEKIRKRTEKQFPNGIEPHGTDALRFTLAALAST
                     GRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEDQDCGFGAGEKVLSLADRWILAEFN
                     RTVKAYREALDGYRFDIAAGILYEFTWNQFCDWYLELTKPVMNGGSEAELRGTRHTLV
                     TVLEALLRLAHPIIPFITETIWLRVKALKGISADTIMLQPFPEFDASQEDTLALNDLE
                     WIKQAIIAVRNIRAEMNIAPGKPLEVLLRDATAEAQRRVEENRSFIQTLARLENITVL
                     PAGDKGPVSVTKLIDGAELLIPMAGLIDKAAELDRLAKEVAKIEAEIGRIESKLSNEG
                     FVARAPEAVVAKEREKMDGYAVAKAKLLEQQAVIAAL"
     gene            complement(441555..442004)
                     /locus_tag="PC1_RS01930"
                     /old_locus_tag="PC1_0387"
     CDS             complement(441555..442004)
                     /locus_tag="PC1_RS01930"
                     /old_locus_tag="PC1_0387"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114650.1"
                     /note="binds to single-strand binding (SSB) protein and
                     acts as a bridge between the DnaX clamp loader complex and
                     the SSB; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit chi"
                     /protein_id="WP_012773101.1"
                     /db_xref="GI:502365845"
                     /translation="MKNATFYLLEHDSKSGELSAHEALACDLAAERWRAGKRVLIACE
                     DEQQAIRLDEALWQRDPTAFVPHNLAGEGPRHGAPVELAWPQRRGNAPRDLLISLLPQ
                     FADFATAFHEVIDFVPYEESLKQLARDRYKTYRSVGFQLTTATPPTH"
     gene            complement(442109..443620)
                     /locus_tag="PC1_RS01935"
                     /old_locus_tag="PC1_0388"
     CDS             complement(442109..443620)
                     /locus_tag="PC1_RS01935"
                     /old_locus_tag="PC1_0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114651.1"
                     /note="catalyzes the removal of N-terminal amino acids
                     preferably from various peptides; a cyteinylglycinase,
                     transcription regulator and site-specific recombination
                     factor; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosol aminopeptidase"
                     /protein_id="WP_010284628.1"
                     /db_xref="GI:497970472"
                     /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYIS
                     ALLRRGELEGKVGQSLLLHHVPNILSERILLIGCGKERELDERQYKQVIQKTINALNE
                     TGSMEAVCFLTELHVKGRNTYWKVRQAVETAKETLYTFDQLKSNKVELRRPLRKMVFN
                     VPTRRELTSGERAIQHGLAIAAGIKAAKDLGNMPPNICNAAYLASQARQLADTYSQNI
                     ITRVIGEQQMKELGMNAYLAVGQGSQNESLMSVIEYKGDPNPETRPIVLVGKGLTFDS
                     GGISIKPADSMDEMKYDMCGAATVYGVMRMAAELALPLNIIGVLAGCENMVDGRAYRP
                     GDVLTTMSGQTVEVLNTDAEGRLVLCDTLTYVERYEPDVVIDVATLTGACVIALGHHI
                     TGLMANHNPLAHELLSASEQSGDRAWRLPLTDEFQEQLESNFADMANIGGRPGGAITA
                     GCFLSRFTRKYSWAHLDIAGTAWRSGKAKGATGRPVALLSQFLLNRAGQNDVE"
     gene            443904..445019
                     /locus_tag="PC1_RS01940"
                     /old_locus_tag="PC1_0389"
     CDS             443904..445019
                     /locus_tag="PC1_RS01940"
                     /old_locus_tag="PC1_0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010284631.1"
                     /note="with LptBGC is involved in lipopolysaccharide
                     export; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS ABC transporter permease LptF"
                     /protein_id="WP_012773102.1"
                     /db_xref="GI:502365846"
                     /translation="MIIIRYLVRETFKSQLAILFILLLIFFCQKLVRILGAAVDGEIP
                     TNLVISLLGLGVPEMVQLILPLSLFLGVLMTFGRLYAESEITVMHACGLGKRVLLKAA
                     LALAVFTAVIATINVMWLSPWSSRHQEEVLAEAKANPGMATLVEGQFQSAQGGNAVLF
                     VGNVKGSEFQHVFLAQLRPSGNARPSVVVADRGHIKQNEDGAQVVTLDNGSRYEGTAL
                     LRDFRITDFTNYQAVIGHQSVTLNNSDVQQMDMQTLWHSDAHDARAEFHWRLTLILSV
                     LIMALMVVPLSVVNPRQGRVLSMLPAMLLYLIFFLLQSSLRSNASKGKIDPMVWVWLT
                     NLMYFGIAVMLNLWDTVPMRKVRARFKPRTLKTQGAA"
     gene            445019..446095
                     /locus_tag="PC1_RS01945"
                     /old_locus_tag="PC1_0390"
     CDS             445019..446095
                     /locus_tag="PC1_RS01945"
                     /old_locus_tag="PC1_0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973656.1"
                     /note="with LptABCF is involved in the transport of
                     lipopolysaccharides; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS ABC transporter permease"
                     /protein_id="WP_012773103.1"
                     /db_xref="GI:502365847"
                     /translation="MFGVLDRYIGKTIFTTIMTTLFMLVSLSGIIKFVDQLRKVGQGE
                     YSALGAGLYTLLSVPKDIEIFFPMAALLGALLGLGQLATRSELVVMQASGFTRLQIAT
                     AVMKTAIPLVLLTMAIGEWVSPQGEQMARNYRSQMISGGSMISTQGGLWAKDGNDFIY
                     IERVAGDKELSGVNIYHFDDSNKLLSVRYAASAEFEDDRNVWRLSQVDESDLSDGKQI
                     GGSQTLSGEWKTNLTPDKLGVVALEPDALSIRGLHNYAKYLKQSGQESSRYQLNMWSK
                     IFAPVSVAVMMLMAVSFIFGPLRSVSAGSRIVIGISFGFLFYLLNEIFRPLSLVYGIP
                     PILGAILPSSVFLCISVALLLKRR"
     gene            446324..446408
                     /locus_tag="PC1_RS01950"
                     /old_locus_tag="PC1_R0015"
     tRNA            446324..446408
                     /locus_tag="PC1_RS01950"
                     /old_locus_tag="PC1_R0015"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:446358..446360,aa:Leu,seq:caa)
     gene            446660..447088
                     /locus_tag="PC1_RS01955"
                     /old_locus_tag="PC1_0391"
     CDS             446660..447088
                     /locus_tag="PC1_RS01955"
                     /old_locus_tag="PC1_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="blasticidin S-acetyltransferase"
                     /protein_id="WP_012773104.1"
                     /db_xref="GI:502365848"
                     /translation="MELIVTHDIADNDREALFAGLRSYNHRFINPASFGQLGIFHRNS
                     VGVMTGGLIATRKGLWLCIDYLWVSEESRGLKLGSALVKEAEQEAMRLGCRHALVDTF
                     SFQALPFYEKQGYQLHMSLPDFPEEGMFRHYLIKQNIQSA"
     gene            447179..448300
                     /locus_tag="PC1_RS01960"
                     /old_locus_tag="PC1_0392"
     CDS             447179..448300
                     /locus_tag="PC1_RS01960"
                     /old_locus_tag="PC1_0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773105.1"
                     /db_xref="GI:502365849"
                     /translation="MAYQLNLNWPEFLEKYWQKQPVVLKNAFPNFVDPITPDELAGLA
                     MEAEVDSRLVSHKNGQWQASNGPFEHFDNLGETGWSLLAQAVNHWHAPSAELVRPFRV
                     LPDWRLDDLMISFSVPGGGVGPHIDQYDVFIIQGMGSRRWRVGDKLPMRQFCPHPALL
                     HVDPFPPIIDEDLEPGDILYIPPGFPHDGFTHETALNYSVGFRGPNGRDLISSFADYV
                     LENDLGGEHYSDPDLTCREHPGRVEDYEFDRLREMMIEVINQPEALKQWFGRFVTTPR
                     HELDIAPAEPPYEQDEIVGALMDGDVLTRLSGLRVLEVGGSYFINSERLDTVDPKAAD
                     ALCRYTVLGKKELGDALENPAFVAELTGLVNQGYWFFDE"
     gene            448477..449637
                     /locus_tag="PC1_RS01965"
                     /old_locus_tag="PC1_0393"
     CDS             448477..449637
                     /locus_tag="PC1_RS01965"
                     /old_locus_tag="PC1_0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase"
                     /protein_id="WP_012773106.1"
                     /db_xref="GI:502365850"
                     /translation="MFHSPQIQRSVLTLFFVISVGMLPLRSSAEADTPGSLTEKTTLD
                     AKNGLQEAAEQYLIRYRSLSGVDGKSPREDTGAVFIPKGEAPKGGWPVVVWAHGTVGV
                     QTSCAPSLNPRSARDAQYLNTWLSLGFAVVAPDYAGLGSPGLHHYLNARGEAWSVLDG
                     VKAALGAFPLRNQLTIVGQSQGAHAAFASVGYQPDYAPDLHIVSTVLTGVPYFDDKTS
                     AAALFAGGGGVKEGGDPKIPYAMYIYLSAADTEKGLNIDDYFTPKAAADVSAAREMCI
                     DALTKKVMDDGLNAGNSLKPATQGLLESQTASLRYNTLKIAHPVFIGTGTQDIDVPAI
                     MQRAFARDIAKAGTSVDVHEYKGMNHDETVNVSLRDSVPFVLKNLHADTKKH"
     gene            complement(449715..450908)
                     /locus_tag="PC1_RS01970"
                     /old_locus_tag="PC1_0394"
     CDS             complement(449715..450908)
                     /locus_tag="PC1_RS01970"
                     /old_locus_tag="PC1_0394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010284642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012773107.1"
                     /db_xref="GI:502365851"
                     /translation="MLTLATLIRFELRSLLRDPTLLLTLFGGILLYSFLYPRPYLAQT
                     PRELPVVLVDEDGTQLSRRLAFMADSTPEVRLVAQRNTLDEAKALLLHGEAKGILYIP
                     RHFYRDIMQGKSVTVSYSADASYFLIYGAIAQSLATVGGTAGAQVKVARLLAQGEGIP
                     AASSQWQATTLNTVPVFNPTMGYVDYVVPGVFMLILHQILLMGCGLLGAGQNQRTQSG
                     GVHYWQYATPWRLLLARTAVVGGAYLLSLLYMLGFCLDAYGIAREASMSQLLLFTLPF
                     LLSTLWLGVVLGATFTRKDLPSQAVLLSSIPIVFLSGFIWPVEMIPAPLNWLAQWIPA
                     VFTIQGILRLNQMGADFSQIDAFWWHLWMLAALYGLLAWGMLGYRQRQYRRENQAARR
                     WLARD"
     gene            complement(450902..452017)
                     /locus_tag="PC1_RS01975"
                     /old_locus_tag="PC1_0395"
     CDS             complement(450902..452017)
                     /locus_tag="PC1_RS01975"
                     /old_locus_tag="PC1_0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter permease"
                     /protein_id="WP_012773108.1"
                     /db_xref="GI:502365852"
                     /translation="MMREWSALWRDRWGMALALWLPLVTMLMTWWTLSGAIVRELPIG
                     LVDLDNSTMSRQFARALHASPSFNLNHQFPAVAEGSSSLRGGEIYALVVIPRHFERDI
                     RQGTLPTVTAWNNGQFVLVAKVINSSLALVAGTFNGQIAVVQALAQGAAVPEAKGLAV
                     PIGGQITALFNQNSNYAQFLLNAIIPSIWSILLALYGMNTLAREDRHGTLWVPENRAA
                     IGSKFLTHWLIGWAWGGLWSYGLYSLLDYPLNGSALLLVVSIGVTAGACVALGMAFYA
                     LIRDPARTVSIVGALMAPGLAFMGITFPAAAMETFATFWRQLLPVAHYGDIAIAITSY
                     GAGIMQIAPALAALALFWLLLPFTLWRYRSSGKEIAC"
     gene            complement(452017..453009)
                     /locus_tag="PC1_RS01980"
                     /old_locus_tag="PC1_0396"
     CDS             complement(452017..453009)
                     /locus_tag="PC1_RS01980"
                     /old_locus_tag="PC1_0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773109.1"
                     /db_xref="GI:502365853"
                     /translation="MTQSLSRSKRKWFLQAILLIVVVWIAYRFWLAYQPEPIRLQGQI
                     EAQQYSVSSKVAGRIAEVPVQKGQQLDVGDLVFTLLTPELDAKLEQAKAGEAAAGAVA
                     LEAQKGAREQQIAAAKDQWQKAKAGSELSHKTYLRVQNLYQEGVLPLQKRDEAKASWD
                     AARYTEGMAWQEYQMAQEGTRKETQVAAEEKARMAAGSVAEVEAYLAEARVVSPHTGE
                     VSNVLLRSGEIAPQGFPVVTLLDMSDIWIQLAVREDLLERFAMGTEFEARIPALNNQT
                     FRFKVSYVSVMGDFATWRATDTRQGFDMRTFEVEARPIEPINGLRVGMSALVEM"
     gene            complement(453006..454427)
                     /locus_tag="PC1_RS01985"
                     /old_locus_tag="PC1_0397"
     CDS             complement(453006..454427)
                     /locus_tag="PC1_RS01985"
                     /old_locus_tag="PC1_0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773110.1"
                     /db_xref="GI:502365854"
                     /translation="MPRITHKKIRPLTYFPIALLLLQCWSPTTWGQTISFNQAWARLL
                     QSDDSIAAEHAGVDRAQSLKESAKGLYWPQVNVGASYTRLDKPVELDARDLNPLSNHR
                     DIFAALNQLINISGNPFVTRFTEQNVVTSSVQVVWPLFTGGRIDAAQSIRAAQVNEAE
                     QMLIVRTLAQFEALAQTYYGVVMAHQVMKTRQDIEKGMAQHYDHARKLEAQGQIARVE
                     VLSAQSAYDMARIETQKARRSMETTEMVFAKLIKTEGATPSSPLFVNKALPELPALVK
                     QTLNTHPGLKVLSAKRDQAKDLIRIERAKYAPDVFLFGNYQLYEQDTLAARTTPDWMV
                     GVGVSVPLISREGRSDNIAAAKSAEMQVNYLEADMRQNLEIMVESTWREARLALEEFN
                     SLSSTQKLAEENVRLRNKAFMQGMSTSLDVVDALNQLAGAKTQRASAAYRYVVSIARL
                     MAISGQITRFSDYQTQHAIQVMP"
     gene            complement(454792..456231)
                     /gene="aspA"
                     /locus_tag="PC1_RS01990"
                     /old_locus_tag="PC1_0398"
     CDS             complement(454792..456231)
                     /gene="aspA"
                     /locus_tag="PC1_RS01990"
                     /old_locus_tag="PC1_0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010298348.1"
                     /note="catalyzes the formation of fumarate from aspartate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="WP_012773111.1"
                     /db_xref="GI:502365855"
                     /translation="MSTNIRIEEDLLGTREVPADAYYGIHTLRAIENFYISNSTISDI
                     PEFVRAMVMVKKAAALANKELQTIPRKIADTILQACDEVLNNGKCLDQFPVDVYQGGA
                     GTSVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYTSI
                     LKLVEAITQLSDGFERKAKEFENILKMGRTQLQDAVPMTLGQEFHAFNVLLKEENRNL
                     LRTAELLLEVNLGATAIGTRLNTPDEYQKLAVQHLAKVSGLPCVPAEDLIEATSDCGA
                     YVMMHSALKRVAVKLSKICNDLRLLSSGPRTGLNEINLPELQAGSSIMPAKVNPVVPE
                     VVNQVCFKVIGNDTCVTMAAEAGQLQLNVMEPVIGQAMFESIQILSSACYNLLEKCVD
                     GITANKDVCEAYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTE
                     EQLDDIFSIQNLMHPAYKAKRYTDENEAV"
     gene            complement(456484..457479)
                     /locus_tag="PC1_RS01995"
                     /old_locus_tag="PC1_0399"
     CDS             complement(456484..457479)
                     /locus_tag="PC1_RS01995"
                     /old_locus_tag="PC1_0399"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012773112.1"
                     /db_xref="GI:502365856"
                     /translation="MVKRTVSANKSIDMYAVYVFVTMAEAGSMTAAAARLGLTPSAIS
                     QTIRLLEEDFGVKLVNRARRPFVLTPYGIALKNRGEILTEEIANLKAQVLEAGKGIKP
                     DLRIGLVDSFAITCGSVFTKSLMKSSSQLLIRTGLSPQQGEALMRRELDLIVTSDPLI
                     DSDSVVRHQLFSEGYFIITPPDYRKRIKTVEDIRELSAALPLVRFNRNSQIGMQIERY
                     LRRIDVRVPNMLEFDNADTLTSMVAAGIGWAVTTPLSFLQSVAHSREVLTHMPEQLNI
                     KRSLYIVGHRDEYSAFFEEACDVTHDIIKTVFIPKLKTLNRGIEKLVEINPDNTE"
     gene            complement(458071..458406)
                     /locus_tag="PC1_RS02000"
                     /old_locus_tag="PC1_0400"
     CDS             complement(458071..458406)
                     /locus_tag="PC1_RS02000"
                     /old_locus_tag="PC1_0400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773113.1"
                     /db_xref="GI:502365857"
                     /translation="MTDTHATPADSTITIFRDLIASLPFAQLDDIQLCDLGAIAAESV
                     EGLCHGLHYLGDTLQNDVELPQESLSQLGACLNATAHLIPALLEMCEQAERHVRTVTT
                     VSDAPFTTQ"
     gene            458850..459269
                     /locus_tag="PC1_RS02005"
                     /old_locus_tag="PC1_0402"
     CDS             458850..459269
                     /locus_tag="PC1_RS02005"
                     /old_locus_tag="PC1_0402"
                     /EC_number="2.5.1.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione transferase"
                     /protein_id="WP_012773114.1"
                     /db_xref="GI:502365858"
                     /translation="MLKGLNHLTFAVTDLAASLDFYQNLLQMTLHARWESGAYLTCGD
                     LWLCLSLDPVRQCLSKEDSDYTHYAFSIEQANFLPFCTRLMAENIPVWKTNRSEGDSF
                     YFLDPDGHKLEVHVGDLQQRLAACRKNPYQGMVFELP"
     gene            complement(459277..460860)
                     /locus_tag="PC1_RS02010"
                     /old_locus_tag="PC1_0403"
     CDS             complement(459277..460860)
                     /locus_tag="PC1_RS02010"
                     /old_locus_tag="PC1_0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773115.1"
                     /note="sigma 54-dependent; regulates genes involved in
                     forming a 2',3'-cyclic phosphodiester on RNA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_012773115.1"
                     /db_xref="GI:502365859"
                     /translation="MKRRVIIGVLGTTLDKRGKRENRWTKWRPTVGLCQQPDFPVDRL
                     ELLHQSRNEGMAQQVAEDIAVVSPATQVTLQTVELRDPWNLEEVYSAFLDFASRYPFD
                     TENEEYFVHITTGTHVVQICWFLLTEARYLPAKLLQTAPGEKADRPAPQGIYAVIDLD
                     LSRYATLTSRFQHEQERSVSFLKSGIETRNSTFNALIDQIERVALRSTAPMLLTGPTG
                     AGKSFLAQRIYQLRQSRHLVSGRFVAVNCATLRGDNAMSTLFGHVKGAFTGALQARTG
                     LLREADGGMLFLDEIAELGLDEQAMLLKAIEEKHFLPFGSDKEVSSDFQLIAGTHRNL
                     HEWIAQGKFREDLYARINMWTFPLPGLAERREDIEPNIDYELQRFTRDHQTQIRFDKD
                     ARQRYLTFACSPQAAWRGNFRELGSSIARMATLAEQGRITVALVEEEVARLQASWRRD
                     APATALPPELANIDLFEQRQLETVLDVCRTANSLSEAGRQLFAVSRQQKQKPNDADRL
                     RKYLARFGLSWEELKRGEG"
     gene            461061..462287
                     /locus_tag="PC1_RS02015"
                     /old_locus_tag="PC1_0404"
     CDS             461061..462287
                     /locus_tag="PC1_RS02015"
                     /old_locus_tag="PC1_0404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010296155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA ligase"
                     /protein_id="WP_043881868.1"
                     /db_xref="GI:762768382"
                     /translation="MKMQDYDMMSPVNSAPVKMWTQGVPVEPEARDQLLNTAKMPFIF
                     KHLAVMPDVHLGKGSTIGSVIPTRGAIIPAAVGVDIGCGMIAVRTSLVASDLPDNLMG
                     LRSAIEQAVPHGRSVTRSKRDVGSWQNPPQTVDAHWSLLEPRFKRLTDKYPQLLKTNN
                     YQHLGTLGTGNHFIEICLDEVDRVWVMLHSGSRGVGNAIGSLFIKLAQEDMQQHIANL
                     PDRNLAYFEEGSLHFDDYIEAVEWAQDFARHNREVMMSHTLAALSRIVTKPFTTQQEG
                     VNCHHNYVQRETHFGESVLITRKGAVSAQKGQMGIIPGSMGAKSFIVRGLGNEESFCS
                     CSHGAGRTMSRTAAKKRFTVEDQIRATAHVECRKDSDVIDEIPMAYKDIDKVMAAQSS
                     LVEIVHTLRQVVCVKG"
     gene            462292..463083
                     /locus_tag="PC1_RS02020"
                     /old_locus_tag="PC1_0405"
     CDS             462292..463083
                     /locus_tag="PC1_RS02020"
                     /old_locus_tag="PC1_0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="WP_012773117.1"
                     /db_xref="GI:502365861"
                     /translation="MMEKDYRVDAAMRTRIKLVLQDVEERYQVKVLYACESGSRGWGF
                     ASPDSDYDVRFLYVHRPEWYLRVEAQRDVIELPIDDELDVCGWEWRKALGLLKRANPT
                     LIEWLDSPVVYQEDRDATSALRATVPTWFSPSKARWHYLSMARKNFRGYLQDETVRLK
                     KYFYVLRPLLAVRWIEAGKGMPPMRFSQLLAGTVDDPRLLAEIHQLLEIKQRSGEAEY
                     GPRREVIHAFITQMLSDADSLAELPDSKSDDDTMLDALLYRTVMA"
     gene            463124..464467
                     /locus_tag="PC1_RS02025"
                     /old_locus_tag="PC1_0406"
     CDS             463124..464467
                     /locus_tag="PC1_RS02025"
                     /old_locus_tag="PC1_0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773118.1"
                     /db_xref="GI:502365862"
                     /translation="MASYDLLLQQLEKLVASPDNYYRPAQADALGSASHLITLTRHYN
                     GHIRQRAVLCLGFMDEVSALPALIERVNDWAEPVRRAAKQSVRLLLTPNNTASFVANL
                     PAIFWLLQCQREDHQPLVDEIVSFLSEEAHAPSLFAGLCSEDKTVARLSLDILAEREC
                     FPLKQIFGQAMLHHDPLVRANAVRYLLSADKDVDHDVLTILLKDSFAPIKQVALQYVI
                     DNAFPVSESQLIALLFDKNALVRQRASALLRERNDDPVAHYLAVLDRASTVTVRKTTL
                     WGLDEHRYDGIVALAERNLDERYPSLYYSALRILILRTGDDARERLLDSLRNPSIAIT
                     KVARKLFYQQKIYLSLSELQCCLDSASSREHVEVYYFLAHKLNKWDWLVFLLDNAKSE
                     NTALTQTGVAYWVQRFNRSGMLPDTRQQARLRTLLDENPHVISRDSPYIALFLYS"
     gene            464547..464831
                     /locus_tag="PC1_RS02030"
                     /old_locus_tag="PC1_0407"
     CDS             464547..464831
                     /locus_tag="PC1_RS02030"
                     /old_locus_tag="PC1_0407"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010296161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-damage-inducible protein J"
                     /protein_id="WP_012773119.1"
                     /db_xref="GI:502365863"
                     /translation="MSTIHFRIDEETKQLAMQAADRHQVSLTELMRQRAEELAEEERQ
                     YQRNAGDEWLEAQIQDAFSRYDAGEGEFVSNEDVSQRMDALKAWAARGEL"
     gene            464828..465133
                     /locus_tag="PC1_RS02035"
                     /old_locus_tag="PC1_0408"
     CDS             464828..465133
                     /locus_tag="PC1_RS02035"
                     /old_locus_tag="PC1_0408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_012773120.1"
                     /db_xref="GI:502365864"
                     /translation="MIFKVRWEKQALADREGIYRYLYKEAGLDVANAADEKFISSVSL
                     LEATPEAGLDIGKSGERRKLVLTRFPFIIIYALKRKINEVHILRILHTSRKLSASYR"
     gene            complement(465139..465930)
                     /locus_tag="PC1_RS02040"
                     /old_locus_tag="PC1_0409"
     CDS             complement(465139..465930)
                     /locus_tag="PC1_RS02040"
                     /old_locus_tag="PC1_0409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_012773121.1"
                     /db_xref="GI:502365865"
                     /translation="MAATNHWTRDQLLIAFTLYSQLPFGRLHSRNPDIIRYAKLINRT
                     PSALAMKLVNLASLDPFIIDSGRTGLRGASNADRALWQEMDSNPELFEQQCQQAMVSL
                     EAGAAKATTAPSPFKANDSEIPDYHGGERLTQVKTRIGQQLFRKRVLSNYGERCCVTG
                     LEEPALLVASHIQPWKTAAEYRLDPSNGLCLSNLHDKAFDMGLISFNDSLEMLLSPRI
                     KKLKSAISDVNFAQYEGKQIHVPDTYPPNLSQMAFHREHIFLARG"
     gene            466085..467182
                     /locus_tag="PC1_RS02045"
                     /old_locus_tag="PC1_0410"
     CDS             466085..467182
                     /locus_tag="PC1_RS02045"
                     /old_locus_tag="PC1_0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773122.1"
                     /db_xref="GI:502365866"
                     /translation="MPRSSIPLFRPLCALALLVLAGCASKTATTPESRPADVRAQVLK
                     LLPDNVKDRQGWATDIATAFTAQGLDPSNENLCSVLAVTEQESTFSADPQVPNLSKIA
                     WQEIDRRAEKVHVPAFLVRTALLIKSPNGKSYSERLDKVRTEKELSAIFDDFIDMVPM
                     GQTLFGRLNPVHTGGPMQVSIAFAEANAKGYPYTVDGSLRREVFSRRGGMYFGIKHLL
                     DYPANYPQSIYRFADFNAGRYASRNAAFQRAVSRLTGVKLALDGDLINYSSDKASATE
                     LAVRALGKHLDMSDSAIRRALEKGNSLDFEDTSLYERVFALADKSGTKAPRAILPGIT
                     LESPKITRKLTTAWFAQRVDERRQRCLARAK"
     gene            complement(467232..468701)
                     /locus_tag="PC1_RS02050"
                     /old_locus_tag="PC1_0411"
     CDS             complement(467232..468701)
                     /locus_tag="PC1_RS02050"
                     /old_locus_tag="PC1_0411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter"
                     /protein_id="WP_012773123.1"
                     /db_xref="GI:502365867"
                     /translation="MNLSTLRHDIPAGLVVFLVALPLSLGIAQASGLPPFVGLLTGVV
                     GGIVVTLFSPSRYAVSGPAAGLVTIVSGSIASLGSFSALLLAIMLAGVLQCILGLLRA
                     GRFITLIPGTVIKGMLSAIGILLIIQQIPLAFGSDGEDDLTSLFDTSEPGFSASALTV
                     CLIGLAILWLWTTKPVQKISALSWLPGPLVAVLFGGLFTVYGERLSSDMVDNLPRIVL
                     PEFGNLEQFMGEMIRPDWQAWKNPAVYVVAVTLALVASLETLLSQEALKKIRPQHPVP
                     SPDKEMRAQGIGNMVSGFLGGLPITAVIVRSSVNVNAGARTKFSILLHGVLLLLCGLF
                     MTDLLNVIPLASLAAVLLYTGYKLASPQQFLLLWRQGLQQFVPFAATVIGIIVFGMLA
                     GIGLGIVTQLAFSIYKSHRNAMQLTRYGDHFVLSFQQNLTFVHNPRLQGLLNKIPANS
                     VVIVEHDNADYIDPDVRTMLEDFRENAQERGIKLNQWPV"
     gene            complement(468698..469360)
                     /locus_tag="PC1_RS02055"
                     /old_locus_tag="PC1_0412"
     CDS             complement(468698..469360)
                     /locus_tag="PC1_RS02055"
                     /old_locus_tag="PC1_0412"
                     /EC_number="4.2.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium-transporting ATPase"
                     /protein_id="WP_012773124.1"
                     /db_xref="GI:502365868"
                     /translation="MFSKKRVFNLTTLKPLLAKNRSWATLRRQRHPHYFRKHTQGQTP
                     HSLWIGCSDSRVPAEVLTGSAPGELFVHRNIANMVVTDDDNFMSVLQYALEYLHVSRI
                     VLCGHYGCGGVQAAVNLPDMGLAQENSALSRRITALRQALSPHIAASQEGDADDSTRQ
                     NQLVEANVLAQFAHLIACEPVQKAWRHGVELDVFGCVYDLHSGHLKELIHRHAKEQEA
                     SP"
     gene            complement(469913..471874)
                     /locus_tag="PC1_RS02060"
                     /old_locus_tag="PC1_0413"
     CDS             complement(469913..471874)
                     /locus_tag="PC1_RS02060"
                     /old_locus_tag="PC1_0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_012773125.1"
                     /db_xref="GI:502365869"
                     /translation="MKSLHHISIRSKFILALLPPILALLWFSFSGVMERRGTENEMIR
                     MAKLITLARDAGEFAHQLQRERGMSAGYFGSQGKKFGSELTTQRQDTDRAQQQFQQTA
                     ANLSDSELGNDVSGEIGKIAQRMQQIGEYRRNIDSLSISVTQALGYYSDSVNYLLNIV
                     GDMTHLVSDGSIAQRLAAYYNLLNVKEQAGLERAVLSNTFSANSFAAGMFERLNQMVG
                     KGEAYTTAYNMFANTDLRKAFEQALNNPSAQNALQMRNKAIASPGGNFGIDASQWFNQ
                     QTAKIDELKKVEQLAANDLATQVNTLAAEARQSWISYLAGALISLLMALGLASMIMRS
                     INEQLQQTLTTIREMGGDLTRRLRVPGTDELSQLNQAYNASLENIADMVVSIKHSSQT
                     IGRASSEIANGNQDLAQRTEEQSASLVQTASSMEEITVTVKQTADFAGQARQLTTEVD
                     DQAQRVGTITESASGAMERIQDASQRVNAVVTAIDAIAFQTNLLALNAAVEAARAGQH
                     GRGFSVVAAEVRQLSQRSADEAGKIRALIADSIASVSEGTKLVNQSNRGISDIVSGTR
                     KVRDLVNEIAVAADEQSLGIAQINEALSQLEMVTQQNATLVSQASVASQLLDEQAIEM
                     ESLVSRFKVDDSAPQQTLQQSLPQARLPR"
     gene            complement(472235..474607)
                     /locus_tag="PC1_RS02065"
                     /old_locus_tag="PC1_0414"
     CDS             complement(472235..474607)
                     /locus_tag="PC1_RS02065"
                     /old_locus_tag="PC1_0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose 1,4-beta-cellobiosidase"
                     /protein_id="WP_043881869.1"
                     /db_xref="GI:762768385"
                     /translation="MQIDPLRRNYVSVKLWGEDDGNINTGRLYLYMIKDGVEYQIGYR
                     HEGDYSPLSVAHWNKPLPGRFFYSTTLLPYSMTKGSTSITLKIVSTGRLYPFGSGGPE
                     STKPYQYAMNQPSRGIYRAYTHIDPFLNVAGEKQGSEPAATTRPSPGDEILGTNGRFR
                     TAMNNHIQTLISKPSTTDALSGGDLRYLARAWSVPELVSYQNSGLVDKVVATLDAYAA
                     QYYADTNIATKNWGGNFGSQGQAIYYLRNALTASRLDESVNYGNAGVKKRRVAWADML
                     FASREFGRQKNRLVLSNQSLIANTNIYFTNKGLLVLSDSRAFPETTAQRYIKEAVGLL
                     PWTGDDRNGPGDGGWAPFGDRYYQVTDKGQTREWGYLGAGYGEVQSYLAEYYRVTGNE
                     DFRKQMIKMAKARAPFRRPAIEISNGANYRAMEAIGLLAWRGAHESDGNFAGFLTYVD
                     AVNTNERAKGLRVAAASKDATLIGYAKQMLEDNQFFANLDGAESAFEALDVFADYQTI
                     KTASDSGARLPMSADQPDFAWADEENAIVAVKKGNERLWLSTYWQAKAGTGINGLARF
                     HFSTPSYDQYGVLETTPIFRSTTSYTRPNRIDMPEKTPYTPPNPPTNAYAGEVLPLGI
                     KPEDASNDEPFRGKADFYATRFGHYLIGINANASNRYVLKTPVGFKNAEDLVSQRTLS
                     GNITVDPRSTAVLYLNDTRDTKAVPNAPLHLGSQNSNGINTLFWTQSSGSEHYKVMRS
                     TSENGTYQAIATVTENSYSDRTGTASGRYYYRIVATNGNGESYPSMASQP"
     gene            complement(475093..477804)
                     /locus_tag="PC1_RS02070"
                     /old_locus_tag="PC1_0415"
     CDS             complement(475093..477804)
                     /locus_tag="PC1_RS02070"
                     /old_locus_tag="PC1_0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010285278.1"
                     /note="P-type; involved in magnesium transport into the
                     cytoplasm; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-transporting ATPase"
                     /protein_id="WP_012773127.1"
                     /db_xref="GI:502365871"
                     /translation="MTDMITQTGYRRARKTPTATFAIAREAQNSLDQTLANLNTHLHG
                     LSHDDVIERQQTYGENRVAHEKAPHALVQLAAAFNNPFIYVLTALAAISFFTDYWLPL
                     RHNEETSLTGVIIILVMVSLSGLLRFWQEFRTNKAAEALKSMVRTTATVLRRPHASAT
                     AVMQEIPLQQLVPGDMLFLSAGDMVPADVRLVESRDLFVSQAVLTGESLPIEKYDVFS
                     DISAKGSQPTGCVGESDLLALSNICLMGTNISSGTATAIVVATGSHTYFGSLAKSIVG
                     TRSQTAFDRGVNSVSWLLIRFMIVMVPIVLLINGFTKGDWMEASLFALAIAVGLTPEM
                     LPMIVSSNLAKGAIAMARRKVVVKRLNAIQNFGAMDVLCTDKTGTLTQDRIILEHHLN
                     TQGQVDESVLQLAWLNSAHQSGMKNLMDQAIMQFGRHNPAIAALGRYRKIDELPFDFI
                     RRRLSIIVADEHDQQRLICKGAVEEMLSVATHVNENGQRYELDDERRNTLKMLAENYN
                     QQGFRVLMIGTRELSPVGSTLPLSAEDERDLTICGLLTFLDPPKESASAAIRALHENG
                     VTVKVLTGDNAIITSKICRDVGLEPGEVLEGNAIDALSDEQLSVLVEQRTIFARLTPL
                     QKSRVLKALQGNDHTVGFLGDGINDAPALRDADIGISVDTGTDIAKESADIILLEKNL
                     MVLEEGVIKGRETFGNIIKYLNMTASSNFGNVFSVLVASAFIPFLPMLAIHLLIQNLM
                     YDISQLSLPWDKMDKEFLRKPRKWDAKNIGRFMLCIGPTSSIFDITTYALMWFVFAAN
                     SVEHQALFQSGWFVEGLLSQTLVVHMLRTQKIPFIQSTAALPVMLMTGLVMAMGIYLP
                     FSPLGPLVGLQPLPWEYFPWLAATLIGYCTVAQLVKRAYIRRFGQWF"
     gene            complement(478322..479899)
                     /locus_tag="PC1_RS02075"
                     /old_locus_tag="PC1_0416"
     CDS             complement(478322..479899)
                     /locus_tag="PC1_RS02075"
                     /old_locus_tag="PC1_0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_012773128.1"
                     /db_xref="GI:502365872"
                     /translation="MKFSQLTVFSKLLLGFSVLIAMMLLLGVVSLLQLSVNNSRIDEL
                     SSSSLPGVRYSLEMRGVLSETRLQQIQYIDSKTPEEREGHRKELLQNADAFLAAFKNY
                     QTVANSEDKKALIKVIGENFSGFNSVNATLIDTVNRGDLAEASRISGANSSKYRSQLM
                     KDLAKLVEMEVATAKNIVDGANSTYRTSQYYVWGLLLLALLTTAVIATIISRNISRQL
                     GGDPHYAQEIMTEIASGNLTTEIKLRQGDNSSLLASINHMNRQLVNTVHTIMNGSESI
                     TLASSEIAQGNSDLSQRTEEQAASLIQASANMQQLTHTVRQNADNAKEASQLAQQTSE
                     TASQGGLIVDDMLKRMHEISDSSQKIVDIIAVIEGIAFQTNILALNAAVEAARAGSEG
                     KGFAVVAGEVRTLAQKSANAAKEIKTLIEGTVEKITDGSARADKASQAMSEIVQSVKK
                     VTDIVAEISQASNEQHIGIKEISVAVEQMDRVTQQNAALVEESATAAHAMTEQGEQLR
                     DAVRFFKVNQDHLLRIH"
     gene            complement(480455..480769)
                     /locus_tag="PC1_RS02080"
                     /old_locus_tag="PC1_0417"
     CDS             complement(480455..480769)
                     /locus_tag="PC1_RS02080"
                     /old_locus_tag="PC1_0417"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DA26.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-rhamnose mutarotase"
                     /protein_id="WP_012773129.1"
                     /db_xref="GI:502365873"
                     /translation="MLRKAFVMSVFPDCHDDYQRRHNPIWPELAEVLKNHGAHHYSIF
                     LDKQRNLLFGYVEVESEARWEAIAQTEVCQRWWKYMSDVMPSNPDNSPVSEALEPVFY
                     LD"
     gene            complement(480858..481682)
                     /locus_tag="PC1_RS02085"
                     /old_locus_tag="PC1_0418"
     CDS             complement(480858..481682)
                     /locus_tag="PC1_RS02085"
                     /old_locus_tag="PC1_0418"
                     /EC_number="4.1.2.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnulose-1-phosphate aldolase"
                     /protein_id="WP_012773130.1"
                     /db_xref="GI:502365874"
                     /translation="MQAILSSWFVQGMIKATSDMWLKGWDERNGGNVSLRLTAEDVTP
                     YESDFYPQPRHEALSQPMPALADCWFIVTGSGKFFRNVQLDPADSLVVLQVDSDGKGY
                     RIFWGLTNGGLPTSELASHFQSHIVRMGVTHGHDRVIMHCHATNLIALSYVLELDTAK
                     FTRELWEGSTECLVVFPDGVGIVPWMVPGTDAIGDATSEQMQRHSLVLWPFHGIFGTG
                     PTLDDAFGLIDTAEKSAEVMVKVRSMGGKKQTISTEELIALGKRFGVTPMEVALRV"
     gene            complement(481687..482949)
                     /locus_tag="PC1_RS02090"
                     /old_locus_tag="PC1_0419"
     CDS             complement(481687..482949)
                     /locus_tag="PC1_RS02090"
                     /old_locus_tag="PC1_0419"
                     /EC_number="5.3.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971149.1"
                     /note="catalyzes the formation of L-rhamnulose from
                     L-rhamnose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="l-rhamnose isomerase"
                     /protein_id="WP_012773131.1"
                     /db_xref="GI:502365875"
                     /translation="MSTPIETAWQLAKARYASLNIDVEAALEQLDQIPVSMHCWQGDD
                     VAGFENTGGPLTGGIQATGNYPGKASTPDELRADLEQAFALIPGPKRLNLHAIYLESA
                     QPVARNEIAPEHFRTWVEWAKRHQLGLDFNPTCFSHPLSADGFTLSHPDEKVRRFWIE
                     HCQASRRISAYFGRELGTPSVMNIWVPDGMKDLTIDRLAFRQRLLSALDEIIAEPLDQ
                     AHHIDAVESKLFGIGAESFTVGSNEFYLGYAASRGTALCLDAGHFHPTEVISDKISSA
                     ILYVPRLLLHVSRPVRWDSDHVVLLDDETQAIAHEIVRHKLLNRVHIGLDFFDASINR
                     IAAWVIGTRNMKKALLRALLEPTETLRKLEQNGDYTARLALLEEQKSLPWQAVWEHYC
                     QCHDVIPGSEWLQQVRQYEETILTQRQG"
     gene            complement(482946..484436)
                     /locus_tag="PC1_RS02095"
                     /old_locus_tag="PC1_0420"
     CDS             complement(482946..484436)
                     /locus_tag="PC1_RS02095"
                     /old_locus_tag="PC1_0420"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DA23.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnulokinase"
                     /protein_id="WP_012773132.1"
                     /db_xref="GI:502365876"
                     /translation="MAVKNIVAVDLGASSGRVMLATLHTATQHLTLKEIHRFSNTLVF
                     QDNHHQWDLAALERDILTGLHQIDAMGIVPDSIGIDSWGVDYVLLDQDGQRVGLPYSY
                     RDHRTDGVMATVTAELGREAIYQRTGIQFLPFNTLYQLKALCDAPSDDLHQVAHLLMI
                     PDYFHYRLTGSLVCEYTNASTTQLLSLEKKTWDSELLDYLGVPRRWLSDPVQPGHAVG
                     KWAAPSGRQISVTAVATHDTASAVVGAPLQSRDSAYLSSGTWSLMGIESDTPFNSPQA
                     LAANITNEGGVDGTYRVLKNIMGLWLLQRVCQERDIKDLGALIEAAAALPAFASLINP
                     NDDRFINPPSMHQAIRDYCREHGQPVPHSDAELARCIFDSLALLYRQVVLELGELRHA
                     PIRQLHIVGGGSQNAFLNQLCADVCQIPVLAGPVEASTLGNIGCQLMALGAVADLAAF
                     RHMLTHNFPLHRYTPRAESDFAGHWRRFQALSQPETAPKGKKETTQ"
     gene            484772..485611
                     /locus_tag="PC1_RS02100"
                     /old_locus_tag="PC1_0421"
     CDS             484772..485611
                     /locus_tag="PC1_RS02100"
                     /old_locus_tag="PC1_0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional activator RhaS"
                     /protein_id="WP_012773133.1"
                     /db_xref="GI:502365877"
                     /translation="MTLLRGDDFFTSRAVTVAVEPRTPQTAFPEHYHDFWEIVLVEQG
                     AGVHVFNDQPYALCSGSVFFVRDNDRHLFEDVEGLCLTNMLYRSPRGFRFLSDIAAFL
                     PYGPNGEWQGQWQVNAAGMQQLKQSLNSLAELAQSDAPEAIAASESLFLHILVQLRQQ
                     CFQTQSSGSERQGVQALLGWLQNNYSEEVNWGSLADRFSLPLRTLHRQLKQHTGMTPQ
                     RYLNRLRLLEARRRLQQSDDSITTIAHACGFSDSNHFSTQFRKAFSQAPKSLRHQAFS
                     REE"
     gene            485636..486490
                     /locus_tag="PC1_RS02105"
                     /old_locus_tag="PC1_0422"
     CDS             485636..486490
                     /locus_tag="PC1_RS02105"
                     /old_locus_tag="PC1_0422"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DJR5.1"
                     /note="activates the expression of rhaRS in response to
                     L-rhamnose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional activator RhaR"
                     /protein_id="WP_012773134.1"
                     /db_xref="GI:502365878"
                     /translation="MATAVRGLKLQTEDYFLTDKNVVMVAERHPQPVFPLHHHDFDEL
                     VIVWRGNGLHLWNDVPYRITRGDMFYVSANDRHSYESVHGLELDNILYIRNRLTLSAD
                     WQRLLPGGEHPQSQRHWCLGSEGMDTLREKVDALRQECMKSDALSLQLSEALLLQIAL
                     LAARYRHTPDNPQLADAHQLDMLMNALRASIAAPFRFEAFCEQHHFSARSLRSRFKEQ
                     TGMSVPHYLRQLRLCKAMELLRYDLQTIGDIAALCGFEDSNYFSVVFHQAFGVSPSAY
                     RQRFLNVE"
     gene            486552..486842
                     /locus_tag="PC1_RS02110"
                     /old_locus_tag="PC1_0423"
     CDS             486552..486842
                     /locus_tag="PC1_RS02110"
                     /old_locus_tag="PC1_0423"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010296210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CopG family transcriptional regulator"
                     /protein_id="WP_012773135.1"
                     /db_xref="GI:502365879"
                     /translation="MADTTRQTTTLRIDQDIKERLKTLADDRHSSAHALMLEAIAEYV
                     EREEKRSQYRKETLVAWEEYQNTGEHITADETVTCLESWGSGHEQDAPACHK"
     gene            486830..487135
                     /locus_tag="PC1_RS02115"
                     /note="plasmid stabilization protein; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(487195..488904)
                     /locus_tag="PC1_RS02120"
                     /old_locus_tag="PC1_0425"
     CDS             complement(487195..488904)
                     /locus_tag="PC1_RS02120"
                     /old_locus_tag="PC1_0425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012773137.1"
                     /db_xref="GI:502365881"
                     /translation="MSLNPLPHPSHTASDASAKTPLLHVDGLSVTFPSPFGPIRSVKN
                     LSFQVNAGEILALVGESGSGKSVTARTLVGLAGENVDVQANAIELTRHDGSLCDLRYL
                     TDRDWRTIRGREIGFVLQDALVSLDPLRKIGQEVAEPILTHHLLPRQQVPARVAELLT
                     KAGIPDPEHRAVQYPHELSGGLRQRALIASALAAGPQLLIADEPTTALDATVQKQVLK
                     VFTALAQAGHGVLLITHDLAVVAEVADRVIVMQQGSLVEGGEARQILSAPTHPYTRKL
                     LAAIPTASTRGKWLAGTDPLQNGMAPSSASLAADHASTDDTIALTADRIAVSFKRPDG
                     SRMQAVNQVSLQIKRGETLGIVGESGSGKTTLGKVILALQKPDSGEVRLADNAWSTLT
                     ERERRPLRARIQTITQDPLSSFDPQFTVAQILNQPLRLRRDLSDDEKQRRILTLLEYV
                     GLTPDLLSRRPRALSGGQRQRVSIAQALASEPEILICDEPVSALDVTTQAQVLDLLVA
                     LQRQLGLTMLFISHDLGVVQHMSHRIAVMKDGDIVETGPVEQIFNQPQHPYTRLLLST
                     VAE"
     gene            complement(488901..489767)
                     /locus_tag="PC1_RS02125"
                     /old_locus_tag="PC1_0426"
     CDS             complement(488901..489767)
                     /locus_tag="PC1_RS02125"
                     /old_locus_tag="PC1_0426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010285293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_010285293.1"
                     /db_xref="GI:497971137"
                     /translation="MSSEPMPFTQTPSRKTYRSPWLSTATLLPAAIVFLLALAVFFPS
                     LFTSRTADEMDMGAVFQSPNSTYWFGTDQLGRDIFSRIVHGTSLSLGIGVGAMLIACF
                     GGVLFGTLSVLAPLRIRQVLVRLLDIMLAFPDLLLALLVIAVLGRGPENTMLAVGLAG
                     IAGYARLIRSQVLQVRLSGYVEHAIALGEHPLYIVFRHIIPNTLRPLLIVATIGVGHA
                     VLSASALSFLGLGVVPPTAEWGALLADGRNFLDIAPWVSLLPASVVALSVISITLLGR
                     RLQAILAKGEAR"
     gene            complement(489760..490719)
                     /locus_tag="PC1_RS02130"
                     /old_locus_tag="PC1_0427"
     CDS             complement(489760..490719)
                     /locus_tag="PC1_RS02130"
                     /old_locus_tag="PC1_0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012773138.1"
                     /db_xref="GI:502365882"
                     /translation="MMSGLNVNLYALGKRLFTILAVLWGAATLTFIAVKLIPGDPVAI
                     LSGGDNVVDEAYRAVLIKQFGLDQPLWVQYLRYCGQALQGDFGVSYLYRLPVGSVISD
                     AMHETLPLALGGLILALFLAITSALLTAGRYGALRTTVSWLELTLLSTPVYWIGIVLL
                     SLFSFRLQWFPVTGNDGVMSLVLPVITLSLPIAAILSQVLRDGLEEALSQPFSLTVRT
                     RGVSEIRLRFRHGLRHAALAASTLTGTLLASVLGGSVLTETVFGRAGIGQVTLSAIEN
                     RDMPLVLGVVMLSAFLFVVINLLVDALYLIIDPRLRKKASAHE"
     gene            complement(490697..492310)
                     /locus_tag="PC1_RS02135"
                     /old_locus_tag="PC1_0428"
     CDS             complement(490697..492310)
                     /locus_tag="PC1_RS02135"
                     /old_locus_tag="PC1_0428"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012773139.1"
                     /db_xref="GI:502365883"
                     /translation="MEKTHPQVTTLAAGLLSLLFALNPGAYAAQSNEKPVAGGILNVG
                     LGSDTPIIDPHITAYGVTALIARNVVDSLVGQAEDNRFTPWLAESWKINDDNTEYTFH
                     LRKDVTFSDGTKLDAEAVKYNIERILDPKTTSSYAKSLLGPIDKISTPDDYTIVLHYS
                     SPFAALLQGLSLPYLGIQSPTYLKNTPNTSNTVVGSGPFILDSFVKGSGSKLTKRPDY
                     NWGPGYAKHTGPAYLDGLVFKYLPEASVRLGALSSGQIQAIDAVPPANFPTVKRNPKL
                     EVITYENPGVNRVLYLNTTKGPFQDVAVRKAFQSAVDTNAAVKVAFFGTLKAADNVLG
                     PATLYYDPSVASRWGFDVKKANELLDNAGWKQKDSEGFRTKDGNRLSVKFVYASTNVE
                     AADVALFQAVQYQVKQAGFDVQLTPVDAGEFTTRTNANEYDIASNFFVRAEPDILRTV
                     FDSAYAPPNGNNFTRISVLNDKLRKAIGAGEAERKQLYSEIQREVIDQAYVVPLYIPA
                     YQLGLSKQVQGISWATNAKPNFYDVWIKR"
     gene            493046..493660
                     /locus_tag="PC1_RS02140"
                     /old_locus_tag="PC1_0429"
     CDS             493046..493660
                     /locus_tag="PC1_RS02140"
                     /old_locus_tag="PC1_0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773140.1"
                     /db_xref="GI:502365884"
                     /translation="MNFFEQTSPSRRRYGLAAFIGLIAGIVSSFVKWGAENPLPPRSP
                     TDMFTGACAPESLIRAAENIDCSRNFLNPPYIFLRDWLGVVDPNAAVYTFAGHVFNWV
                     GVTHIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPSLFVL
                     PWYEHVSEIVGHLIWFWSIEIIRRDLRNRMTHEPDPEIPLSASR"
     gene            complement(493909..494943)
                     /locus_tag="PC1_RS02145"
                     /old_locus_tag="PC1_0430"
     CDS             complement(493909..494943)
                     /locus_tag="PC1_RS02145"
                     /old_locus_tag="PC1_0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DJS3.1"
                     /note="transports L-rhamnose and L-lyxose into the cell;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="l-rhamnose-proton symporter"
                     /protein_id="WP_012773141.1"
                     /db_xref="GI:502365885"
                     /translation="MSNPILLGIFWHFIGAASAACFYAPFKQVKNWSWETMWSLGGFF
                     SWIILPWCISWWLLPDFWRYYGSFDMATLLPIFLFGAMWGIGNINYGLTMRYLSMSMG
                     IGIAIGVTLIIGTLMTPVLQGKFSVLFGSAGGRMTLLGVLVAVIGVAIVSYAGLLKER
                     VLGIRAEEFNLKKGLILAVMCGIFSAGMSFAMDAAKPMHAAAQAQGINALYVALPSYV
                     VIMGGGAVVNLGFCFMRLATCKGISLKADLAQAKPLLIANALFAILGGVMWYLQFFFY
                     AWGHANIPADYTYISWMLHMSFYVLCGGIVGLLFKEWKSVGQKPVRTLVLGCMVIILA
                     ANVVGLGMAA"
     gene            495271..495777
                     /locus_tag="PC1_RS02150"
                     /old_locus_tag="PC1_0431"
     CDS             495271..495777
                     /locus_tag="PC1_RS02150"
                     /old_locus_tag="PC1_0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DJS4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773142.1"
                     /db_xref="GI:502365903"
                     /translation="MERFIENLMYTSRWLLAPVYLGLSLGLLALAIKFFQEVFHVLPN
                     IFDIAEADLVLVLLSLIDMTLVGGLLVMVMLSGYENFVSALDITDGREKLNWLGKMDS
                     GSLKNKVAASIVAISSIHLLRVFMDARNIPDNKLMWYVIIHLTFVLSALVMGYLDRMS
                     RYEKSKAA"
     gene            495872..496909
                     /locus_tag="PC1_RS02155"
                     /old_locus_tag="PC1_0432"
     CDS             495872..496909
                     /locus_tag="PC1_RS02155"
                     /old_locus_tag="PC1_0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent oxidoreductase"
                     /protein_id="WP_012773143.1"
                     /db_xref="GI:502365907"
                     /translation="MPQTDRINRRVVLAQRPHGAPTQENFRLEQQAVPSVDAGQVLLR
                     SVFLSLDPYMRGRMSDAPSYAKPVELNDVMVGGTISRVVESKHPDYQTGDWVLSYSGW
                     QDYAVSDGKGLTNLGQSPTNPSYALGVLGMPGFTAYMGLTDIGQPKAGETLVVAAATG
                     PVGATVGQIGKLKGCRVVGVAGGAEKCRYAVEVLGFDVCLDHRADDFAEQLKQACPQG
                     IDIYFENVGGKVFDAVLPLLNTSARIPVCGLVSGYNATGLPDGPDRLPLLAGTILKKR
                     IRMQGFIIFDDYGHRFEEFWKDVSPWVAEGKIKYREEIVDGLENAPDAFIGLLHGRNF
                     GKLVVRIGPDA"
     gene            496997..497821
                     /locus_tag="PC1_RS02160"
                     /old_locus_tag="PC1_0433"
     CDS             496997..497821
                     /locus_tag="PC1_RS02160"
                     /old_locus_tag="PC1_0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_012773144.1"
                     /db_xref="GI:502365910"
                     /translation="MHPDSASFRVRPLQPWFVINAAEDYLKKSVSQSPIAHFYSFTVD
                     RAEPMTLAVPDGSVDLLLHCCPEAPSGRVCGSTASAQITRLMPGERYFGVRFMPGIMP
                     AFLDLSPGELAGQEIPFDEVAPDTPRLLRRLVNTHDFNEQVSLFLHYFSYWTTRSAPP
                     LLLQIIDLIMAHDGKIRVDELERKTLYSARYIHRLFHDNCGMSPKTFCRTIRFQRALA
                     LLNQGNIDSLTMLAQHLEYADQSHFFREFKAFASCSPQHYLARLQAARYQYRIRQC"
     gene            498020..499399
                     /locus_tag="PC1_RS02165"
                     /old_locus_tag="PC1_0434"
     CDS             498020..499399
                     /locus_tag="PC1_RS02165"
                     /old_locus_tag="PC1_0434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_012773145.1"
                     /db_xref="GI:502365914"
                     /translation="MAQAKDIVPGFYTIDDAIALDGETTRALQLTHLNRMRSLDGHAK
                     YFVRAEGSTFIDDKGEKHLDMIGAVGVVTVGNNNEFVWSCLQKCFDNRLFMMGAISYH
                     NVAAALAHNMALLSPQGKLTKMGTATGGAEAIEGMIKLVKLGTRHKTHKTHLLATLGA
                     FHGKTSGAVSLGGKDKWRAGQQPTLGNIDHVAYGSVTELENALATGKYKAFVVEPIQG
                     EGGIIVPPAGYLKAARELCDRYDTLLVLDEIQCGAARTGKFWCCEHDDVVPDCIVFAK
                     GLSGGLVPFGGYLCTESLYEAAYGTIETCYHHTATYQENTLSAAAALGSLQFIIEHDL
                     CGMAERKGALMMQRLYDIQARHPQVIKEVRGKGLMIGIEFGRLPETLHASMGEYYSAA
                     IAGLLVEKWRIQVNFTINNLAVFRFLPPLTISEEELDYALNAFESALNSVVEQVEQVE
                     QANTSVMTA"
     gene            499410..500564
                     /locus_tag="PC1_RS02170"
                     /old_locus_tag="PC1_0435"
     CDS             499410..500564
                     /locus_tag="PC1_RS02170"
                     /old_locus_tag="PC1_0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_012773146.1"
                     /db_xref="GI:502365917"
                     /translation="MTFIYSQPVKLCIGRGEVARVGEEVAMLGSRVLLVTGKTSCRQT
                     GLLTRLTDLLTQSGVRWVLFDSIEANPLTTTVDDGAALAREQQCDVVLGVGGGSVMDA
                     AKGIAFMACHSGKLLDYLSQPPAPAATLPLVLVTTTAGTGSEGNCVAVFTNPETHDKP
                     AFFSPALYARTAIVDPTLMVTQSSRMVAATGFDALSHNIEARVGKFCNPMTEIMAERA
                     IRLLTTYLPRVCRDVTDLDAWDQVCWANTLGGIAIGMSACGLPHAMEHPLSGLYNITH
                     GEGLAALYPTLMRFSCVENIAGFAAVTCAMSDSVTHLDESERASHSVYLVQRFLENIG
                     LTFTLRDLGVSEQDIPWLADNCVQTMGVSLEQNPRWASRQDIEALYRTCL"
     gene            500649..502052
                     /locus_tag="PC1_RS02175"
                     /old_locus_tag="PC1_0436"
     CDS             500649..502052
                     /locus_tag="PC1_RS02175"
                     /old_locus_tag="PC1_0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_012773147.1"
                     /db_xref="GI:502365920"
                     /translation="MNTHQLKKNSLGLWSLVFFVVAAASPLTGVVGGLPVAISAGNGA
                     GIPAVYLMAGGILLIFSFGYIAMSRYVTNAGAFYSYITLGLGRRAGFSALSVALLAYF
                     AIQIAVVAMFGFFSSMYLQEHLGIELPWWGYSVAMLLLMCLLGIESVEVGGRVLGVLM
                     LMEVGIMLVVDIAVLLSHDTPPLTLEAFSPSVINQGSIGIALIFSIAAFIGFESTAIY
                     GEECRNPEKTIPRATLAAVILIMLFFAFTSWMMVQAYGVGQVQQQAINDPGRFILNVS
                     TALVGKWSEQMISLLLITSLFAAAQAFHNNISRYLFSIGRDGVLSTKLAQVSENKGTP
                     YVASIVQTIVVLTVLCAMVVADLDPMMQIFALGSAIATMAILLLQVGVSLAVIRFFQR
                     ETQHPVSAWSRLWAPIISTVAMLSALIMVVRNVDVLSGSSSQIVSLLPWGVFGIAIMG
                     YLSASRVRIPSPQENMP"
     gene            complement(502119..502418)
                     /locus_tag="PC1_RS02180"
     CDS             complement(502119..502418)
                     /locus_tag="PC1_RS02180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_043881703.1"
                     /db_xref="GI:762766957"
                     /translation="MRNVNKLPFNFFFYIYSILCTLIILITSIRDYEGMVDGVEIRNR
                     CEIPEGDSDGFFAFIIIPLSIPFFFVKKSMDRIITYIIMLFYYLWSFYIRFNFCQ"
     gene            complement(502425..502727)
                     /locus_tag="PC1_RS02185"
                     /old_locus_tag="PC1_0438"
     CDS             complement(502425..502727)
                     /locus_tag="PC1_RS02185"
                     /old_locus_tag="PC1_0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773149.1"
                     /db_xref="GI:502365927"
                     /translation="MFQKNYIYNVYFYAYSALCLFLINAFSTIEYEWMLDDGSLDSFC
                     EVPRADADGFLIFIIVPLSIPFLLVKRTPPRIVTYLAILIYHSYRFYTRVSLCPHR"
     gene            complement(503125..503871)
                     /locus_tag="PC1_RS02190"
                     /old_locus_tag="PC1_0440"
     CDS             complement(503125..503871)
                     /locus_tag="PC1_RS02190"
                     /old_locus_tag="PC1_0440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773151.1"
                     /db_xref="GI:502365934"
                     /translation="MSKFNAIAAECDLSFSDWGKNYPRWSPIDFIWWKTFGGNDYLNK
                     YKDSYIVFHKEKIKEIASKHKIPATLLALIAYSEAGGMIDYLKYPVLFYRQSKHTYSD
                     WANQETPTTPPEKTSIGIVAMQIRVVAEIFNKNPSELKNAEATYISICLNKDNFNLTM
                     VARHLYELITYDYPGTDTLNLTDEQFILAGSRYNRGIERSHSDFIRSINAEKTAKTER
                     DWTSYGRSMLNHREKVTKLLYNSTTVIQRP"
     gene            complement(503878..504357)
                     /locus_tag="PC1_RS02195"
                     /old_locus_tag="PC1_0441"
     CDS             complement(503878..504357)
                     /locus_tag="PC1_RS02195"
                     /old_locus_tag="PC1_0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010285305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773152.1"
                     /db_xref="GI:502365937"
                     /translation="MANSIFMKITGKIQGLISEGCLSIDSVGNKHISGHEDEIFVYAT
                     NYDLSRDRHVNHHPFSVTKVVDKSTPLLLTSIANNELLECELRYYRTSASGTQENYMT
                     ITLRDASIVNLSNQNPNSLTHNDMQPFETLSLRYESITCQHNIAGTSGYSILTENMY"
     gene            complement(504694..505905)
                     /locus_tag="PC1_RS02200"
                     /old_locus_tag="PC1_0442"
     CDS             complement(504694..505905)
                     /locus_tag="PC1_RS02200"
                     /old_locus_tag="PC1_0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
                     /protein_id="WP_012773153.1"
                     /db_xref="GI:502365939"
                     /translation="MQSFDVVIAGGGMVGLALACGLQGSGLRIAVLEKQAAEPQPLGK
                     NHALRVSAINAASECLLRHIGVWENLVAQRVSPYNDMQVWDKDSFGKISFSGEEFGFS
                     HLGHIIENPVIQQVLWQRASQLSDITLLSPTSLKQVAWGENEAFITLQDDSMLTARLV
                     VGADGAHSWLRQHADIPLTFWDYGHHALVANIRTEQPHQSVARQAFHGDGILAFLPLD
                     DPHLCSIVWSLSPEQAQAMQKLPVEEFNRQVAMAFDMRLGLCELESERQTFPLTGRYA
                     RSFAAHRLVLVGDAAHTIHPLAGQGVNLGFMDVAELIAELKRLQTQGKDIGQHLYLRR
                     YERRRKHSAAVMLASMQGFRELFDGDNPAKKLLRDVGLVLADKLPGIKPTLVRQAMGL
                     HDLPDWLSQEQ"
     gene            complement(505934..507112)
                     /locus_tag="PC1_RS02205"
                     /old_locus_tag="PC1_0443"
     CDS             complement(505934..507112)
                     /locus_tag="PC1_RS02205"
                     /old_locus_tag="PC1_0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914016.1"
                     /note="Oxygenase that introduces the hydroxyl group at
                     carbon four of 2-octaprenyl-6-methoxyphenol resulting in
                     the formation of 2-octaprenyl-6-methoxy-1,4-benzoquinone;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
                     /protein_id="WP_012773154.1"
                     /db_xref="GI:502365940"
                     /translation="MAVMIVGGGMAGATLALAISRLSQGTIPVDLIEAHSPLDKEHPG
                     FDARALALSDGTRQQLATLGIWQALSGNATAITDIHVSERGHASVVNLKASDYHVKAL
                     GHVVELHDVGQRLFSLLQQAPGVRLHCPAKVVAVTRTQDNATLTLDDGTELTGQLLVA
                     ADGSRSVLSQSCGIQWQQHDYDQVAVIANVTTAEPHRGRAFERFTPHGPLALLPMSNG
                     RCSLVWCHDKHRQHEVDGWSEAEFCRQLQQAFGWRLGRFTHIGERHSYPLRLLTASQH
                     ISHRLALVGNAAQTLHPIAGQGFNLGIRDVMSLAETLVEAAKNQQDIGQYRVLSRYQQ
                     RREPDQHTTVAITDGLVRLFANRYAALAVSRNLGLIAMNNLPLMRDAFARRTLGWVER
                     "
     gene            complement(507158..508483)
                     /locus_tag="PC1_RS02210"
                     /old_locus_tag="PC1_0444"
     CDS             complement(507158..508483)
                     /locus_tag="PC1_RS02210"
                     /old_locus_tag="PC1_0444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822307.1"
                     /note="exopeptidase able to cleave the peptide bond of the
                     last amino acid if linked to a proline residue; substrate
                     can be as short as a dipeptide; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline aminopeptidase P II"
                     /protein_id="WP_012773155.1"
                     /db_xref="GI:502365941"
                     /translation="MNPQEFLRRRQGLLEKMAPGSAAIIFAAPEAQRNADSDYPYRQN
                     SDFWYFTGFNEPEAVLLLVKSDAKHHHSVIFNRVRDLTAEIWFGRRLGQEAAPAKLGV
                     DRALPFDEISTQLHLLLNGLDVVYHAQGQYDYADKLVFAALDTLRNGTRQGFAAPATL
                     TDWRPWVHEMRLFKSPEEISVMRRACEITALAHTRAMQKCRPGMYEYQLEGEIHHEFT
                     RHGARYPSYNTIVGSGENACILHYTENETQMRDGDLVLIDAGCEYKSYAGDITRTFPV
                     NGKFTAPQRAIYDIVLRSQLRALELFGPSRSIREVNEEVVRMMVSGLIKLGVMKGDVE
                     ELIAEQAHRQFFMHGLSHWLGLDVHDVGDYGTTERGRPLEPGMVLTIEPGLYIAPDAK
                     VPQQYRGIGVRIEDNIVITENGNENLTAGVVKDADDIEALMAQWHDKQH"
     gene            complement(508574..509161)
                     /locus_tag="PC1_RS02215"
                     /old_locus_tag="PC1_0445"
     CDS             complement(508574..509161)
                     /locus_tag="PC1_RS02215"
                     /old_locus_tag="PC1_0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971094.1"
                     /note="the crystal structure of Haemophilus influenzae
                     HI0817 showed that this protein forms dimers; function
                     unknown; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773156.1"
                     /db_xref="GI:502365942"
                     /translation="MSIENTFPAYEGLDQLLHQQQVALTAAEMHGLISGMLCGGNHDD
                     SWRTLVFELTNEGMAFTQTLSQPLQDLYQATREALEDDGFLFQLFLPDDSQDEVSVFD
                     RADALAGWVNHFLLGLGVVQPQLNKAKGELKEAIEDLRNIAQLGYDEDEDQEELEQSL
                     EEVIEYVRVSAILCHNEFTSQRVATAPEQQKPTLH"
     gene            509354..509683
                     /locus_tag="PC1_RS02220"
                     /old_locus_tag="PC1_0446"
     CDS             509354..509683
                     /locus_tag="PC1_RS02220"
                     /old_locus_tag="PC1_0446"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010284667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapA"
                     /protein_id="WP_012773157.1"
                     /db_xref="GI:502365944"
                     /translation="MSAQPVDIQIFGRSLRVNCPPEQQDALNQAAEDLNQRLQDLKVR
                     TRVTNTEQLVFIAALNVCHELAQERGKTRDYASNMEQRIRMLQQTIEQALLEQGRITE
                     RQGAQFE"
     gene            509981..510622
                     /locus_tag="PC1_RS02225"
                     /old_locus_tag="PC1_0447"
     CDS             509981..510622
                     /locus_tag="PC1_RS02225"
                     /old_locus_tag="PC1_0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="WP_012773158.1"
                     /db_xref="GI:502365947"
                     /translation="MSSSDSSTSPDTSLSPTTASRQQIRQAVRQHRRLLTPEQQALFA
                     QQACERVMAHPKIIRAESVAVFLSFDGELDTSPLIQQLWQQGKRVYLPVLHPFRAGHL
                     LFLRYAPDTELVRNRLKIMEPRLDVRQVLPLPQLDILLTPLVAFDHQGQRLGMGGGFY
                     DRTLQYRNQMSRGPYPIGLAHDCQQVDALPVESWDIPLPEIITPSRHWQWSTR"
     gene            complement(510619..511872)
                     /locus_tag="PC1_RS02230"
                     /old_locus_tag="PC1_0448"
     CDS             complement(510619..511872)
                     /locus_tag="PC1_RS02230"
                     /old_locus_tag="PC1_0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773159.1"
                     /note="catalyzes the formation of NAD(+) from nicotinamide
                     ribonucleotide; catalyzes the formation of nicotinamide
                     mononucleotide from nicotinamide riboside; also has a
                     regulatory function; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012773159.1"
                     /db_xref="GI:502365950"
                     /translation="MSSFDYLKSAIRQKGCTLQQVADATDMTKGYLSQLLNAKIKSPS
                     AQKLEALHRFLELEFPRYEKSIGVVFGKFYPLHTGHIYLIQRACSQVDELHVILGYDE
                     PRDRLLFENSSMSQQPTVSDRLRWLLQTFKYQKNIHIHAFNEQGMEPYPHGWDVWSKG
                     IQAFMQEKSITPNFVYTSEEQDAPQYREHLGIEAVLIDPQRSFMNISGSQIRHDPFRY
                     WDYIPTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDE
                     MALQYSDYDKIALGQAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALI
                     DEYRFDLVILLENNTPWVADGLRSLGSTTARSEFQNLLKTMLADNNIQYVYIKESDYD
                     SRFLHCVELVQQMLGHDRSPEQSKS"
     gene            complement(512004..513386)
                     /locus_tag="PC1_RS02235"
                     /old_locus_tag="PC1_0449"
     CDS             complement(512004..513386)
                     /locus_tag="PC1_RS02235"
                     /old_locus_tag="PC1_0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114591.1"
                     /note="Sms; stabilizes the strand-invasion intermediate
                     during the DNA repair; involved in recombination of donor
                     DNA and plays an important role in DNA damage repair after
                     exposure to mutagenic agents; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="WP_012773160.1"
                     /db_xref="GI:502365956"
                     /translation="MAKAVKRAFVCNECGADYPRWQGQCSACHAWNTITEVRLASASV
                     SRSDRLTGYAGESAGVSRVQKLSEISLEALPRFSTGFQEFDRVLGGGVVPGSAILIGG
                     NPGAGKSTLLLQTLCKLSENMKTLYVTGEESLQQVAMRAHRLNLPTQNLNMLSETSIE
                     QICLIAEQEQPKLMVIDSIQVMHLADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMV
                     GHVTKDGSLAGPKVLEHCIDCSVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQG
                     LREVSNPSAIFLSRGDEVTSGSSVMVVWEGTRPLLVEIQALVDQSMMSNPRRVAVGLE
                     QNRLAILLAVLHRHGGLQMSDQDVFVNVVGGVKVTETSADLALLLSLVSSFRDRPLPQ
                     DLVIFGEVGLAGEIRPVPSGQERITEAAKHGFKRAIVPHANMPKKTPASMQVFGVKKL
                     ADALAILDDL"
     gene            complement(513404..514381)
                     /gene="serB"
                     /locus_tag="PC1_RS02240"
                     /old_locus_tag="PC1_0450"
     CDS             complement(513404..514381)
                     /gene="serB"
                     /locus_tag="PC1_RS02240"
                     /old_locus_tag="PC1_0450"
                     /EC_number="3.1.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010296284.1"
                     /note="catalyzes the formation of serine from
                     O-phosphoserine; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoserine phosphatase"
                     /protein_id="WP_012773161.1"
                     /db_xref="GI:502365959"
                     /translation="MSNSLTYRDLPDEINCWPGLPLSLSGDEVMPLDYRAGDTGWLIY
                     SDVLDKNLISRYQRKLGSAMVIVSAWNVGDYQVVRLAGTLTPRATKLAHELGIDVAPM
                     RNAPTLRSPGLLVMDMDSTAIQIECIDEIAKLAGTGELVAEVTERAMRGELDFAASLR
                     QRVGTLKGADATILKTVRKTLPLMPGLRNMVSQLQEAGWHVAIASGGFTYFADYLRDE
                     LGLVAAVANELGMQDGKLTGEVIGQIVDAKYKATTLQQLAEKLEIPMHQTVAIGDGAN
                     DLPMIKAASLGIAYHAKPKVNEQSAVTIRHADLTGVLCILSGSMRHEKR"
     gene            514538..515236
                     /locus_tag="PC1_RS02245"
                     /old_locus_tag="PC1_0451"
     CDS             514538..515236
                     /locus_tag="PC1_RS02245"
                     /old_locus_tag="PC1_0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconolaconase"
                     /protein_id="WP_012773162.1"
                     /db_xref="GI:502365962"
                     /translation="MVRARVKFRLHRTAIVLICLALLVVLMQGASYFSLSHQMARSEQ
                     VEDLARTLSRQVAYSLSPLMGSVDDNSQKINTILKQLTDHSRILDAGVYQQDGSLVAH
                     VGEQVQLRDRLALDGNRVGSYFNHQLVQPIEGKEGPIGFLRITLDTHVLATEARQVDN
                     TTNILRLMILLSLAIGIILTRTLLQNRRTRWQQSPYLLTASTPVKEEEDEAGSDTRTS
                     DSATVKKDEEEKNL"
     gene            complement(515291..516208)
                     /locus_tag="PC1_RS02250"
                     /old_locus_tag="PC1_0452"
     CDS             complement(515291..516208)
                     /locus_tag="PC1_RS02250"
                     /old_locus_tag="PC1_0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773163.1"
                     /db_xref="GI:502365966"
                     /translation="MSLSVNNTGYSNSQAQSTATSSTTAQSTTTTSSDSIQITDPITG
                     KTVTFPNNIKISAEALARWKETVAKAPPSDPKKDEPSKIPRDIYADRDLLRQTDTSKP
                     YVSNEFMTVYIDEIGTNEMAIENWSGHLKADSGISKEAFLGLVKKALSSPPEVSLWSY
                     TTDSMEIAITANKLETLKNRYVDSDYQKRADLDIQDFIEYKSNALSNLEKNILQDEYQ
                     RSVDAGDTDKANATFLELQKNAEGTSTTQLQRQQIFSRAASTDVSAWFGSFRDYIAAS
                     DFDRYTKSEYNSIVSEFYNHWLGFQLALK"
     gene            516514..518103
                     /gene="prfC"
                     /locus_tag="PC1_RS02255"
                     /old_locus_tag="PC1_0453"
     CDS             516514..518103
                     /gene="prfC"
                     /locus_tag="PC1_RS02255"
                     /old_locus_tag="PC1_0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010296292.1"
                     /note="stimulates the release of release factors 1 and 2
                     from the ribosome after hydrolysis of the ester bond in
                     peptidyl-tRNA has occurred; GDP/GTP-binding protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="WP_012773164.1"
                     /db_xref="GI:502365969"
                     /translation="MSPSEYAREVSKRRTFAIISHPDAGKTTITEKVLLFGQAIQTAG
                     TVKGRGSNQHAKSDWMEMEKQRGISITTSVMQFPYRECLVNLLDTPGHEDFSEDTYRT
                     LTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMEVLDEVES
                     ELKIACAPITWPIGCGKLFKGVYHLYKDETYLYQTGKGHTIQEVRIVKGLDNPELDTA
                     VGEELAAQLREELELVKGASHEFELDAFLAGELTPVFFGTALGNFGVDHMLDGLVAWA
                     PAPMPRKTDTREVTAAEEKFTGFVFKIQANMDPKHRDRVAFMRVVSGRYEKSMKLRQV
                     RTGKDVVISDALTFMAGDRSHIEEAYPGDIIGLHNHGTIQIGDTFTQGEDMKFTGIPN
                     FAPELFRRIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPLTNNDLIVGAVGVLQFDVVV
                     ARLKTEYNVEAIYESVNVSTARWVECSDVKKFEEFKRKNELHLALDGGDNLAYVAPTM
                     VNLNLTRERYPEVTFHQTREH"
     gene            518608..519216
                     /locus_tag="PC1_RS02260"
                     /old_locus_tag="PC1_0454"
     CDS             518608..519216
                     /locus_tag="PC1_RS02260"
                     /old_locus_tag="PC1_0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773165.1"
                     /db_xref="GI:502365972"
                     /translation="MKKTTLTKSLIVVALSSILAGGAMAEETLGQKVERIADTTGAKI
                     DSSANKASGYMSDSAITAKVKSALLEDKSITSSDISVETSKGVVTLSGFVGSQALSTR
                     AVEIATQVEGVQSVSDKLQVKDNQSQSVGAYADDAVVTSTIKAKLLADDIVPSRKVKV
                     ETQEGVVLLSGEVDNKAQSDRAESIAKAVDGVKSVKNDLTVK"
     gene            519652..519840
                     /locus_tag="PC1_RS02265"
                     /old_locus_tag="PC1_0456"
     CDS             519652..519840
                     /locus_tag="PC1_RS02265"
                     /old_locus_tag="PC1_0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010284712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stress-response protein"
                     /protein_id="WP_010284712.1"
                     /db_xref="GI:497970556"
                     /translation="MNSDIVVGKWKQWKGNFLALWADWFDSDCAWLEGSNDYLSGVLQ
                     EGYGKAHEEVSSEKTTLH"
     gene            519955..520752
                     /locus_tag="PC1_RS02270"
                     /old_locus_tag="PC1_0457"
     CDS             519955..520752
                     /locus_tag="PC1_RS02270"
                     /old_locus_tag="PC1_0457"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNAse"
                     /protein_id="WP_012773167.1"
                     /db_xref="GI:502365993"
                     /translation="MPSERYRFIDTHCHFDFPLFYDDAPESLRLAQDAGVERIIIPAV
                     ASQHFERVLMLARTYPSLYAALGLHPLYIAEHQEDDLIRLEDELRQQPARLVAVGEIG
                     LDLYMPEPQFERQLTFLEAQLRLAKKYDLPTILHSRRSHDRLAQLLRRIDVPRTGVVH
                     GFAGSLAQAQAFIRLGYYIGVGGTITYDRANKTRQAIAQLPLDRLLLETDAPDMPMSG
                     YQGQPNRPERISCAFQTLCELRAESPEEIAEALWQNSFRLFGRLIPT"
     gene            521057..522334
                     /locus_tag="PC1_RS02275"
                     /old_locus_tag="PC1_0458"
     CDS             521057..522334
                     /locus_tag="PC1_RS02275"
                     /old_locus_tag="PC1_0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside transporter NupC"
                     /protein_id="WP_012773168.1"
                     /db_xref="GI:502365997"
                     /translation="MQLVMSLIGMLVLIFFAVILSSNRKAIRLRTVVGAFVIQIGIGA
                     LVLYVPVGRKILEGLTGGVANVIAYGNQGVSFIFGGLVSDKMFEIFGGGGFVFAFRVL
                     PIIVFFSSLVAVLYYMGVMQWVIRLLGGGLQKLLGTSRTESLSATANIFVGQTEAPLV
                     VRPYIANMTRSELFAVMCGGLASIAGSVMAGYAQMGVPLDYLIAASFMAAPGGLLFAK
                     LMVPETEKTHDHDEMVGFVDEDDRPANVIDAAASGAASGMQLALNVGAMLLAFVALIA
                     LLNGILGGIGGWFDYPQLSMELMLGWIFSPVAFLIGVPWHEATVAGSFIGQKLIVNEF
                     VAYMNFSEYLKADDVVAAAGLQVLSDHTKAVISFALCGFANLSSIAILIGGLGSMAPS
                     RRQDIARLGLKAVAAGTLSNLMSACIAGFFLSL"
     gene            522517..523233
                     /locus_tag="PC1_RS02280"
                     /old_locus_tag="PC1_0459"
     CDS             522517..523233
                     /locus_tag="PC1_RS02280"
                     /old_locus_tag="PC1_0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="WP_012773169.1"
                     /db_xref="GI:502366012"
                     /translation="MLSAFIDDVEWITFPRATDGATYPGITARCHFHVSAYDDALFAA
                     LNIPFPDALARAVPKRRAEFLAGRYLARHVLNKLDHPDFVLCSAEDRSPQWPENVAGS
                     LSHNKDSVLCAAHLRIEALSCVGVDIEGFISDERAQSLWPGIIGDEEFQWFQEREESF
                     CCLLTVSFSAKESLFKALYPQVRHYFDFLDARLVALDITKREFELELLTDLTPTFYAG
                     RRFKGAYLLREYDVTTFICC"
     gene            complement(523283..525229)
                     /locus_tag="PC1_RS02285"
                     /old_locus_tag="PC1_0460"
     CDS             complement(523283..525229)
                     /locus_tag="PC1_RS02285"
                     /old_locus_tag="PC1_0460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_012773170.1"
                     /db_xref="GI:502366022"
                     /translation="MQLKSENRFSHHHFPHSKMYRALLVTGLLALPALAQAENAADEK
                     IVVTATQTKHTTLSAPASVSVITRAELEKMSVNNVSDAVKKLPGININPSTTYGRNEI
                     KIRGMRADYTLLLVNGRRINTQESLATDMGNDFDLSSIPMSAIERIEVIRGPMSSLYG
                     ADALGGVVNVILRQPGENVAGEVGYNFQAPTEGSGGDHNRLNGYVSGPLIENTLLGSL
                     IVDGGKRDAWRTEQSKNRNSDALEKRDNYSVLGNLTWLIDSQQSLDFDATYTKDDRFV
                     DWNNSGATAHNTQKLDRLGLGLTHNGSWDNFDTRLRYYYENIDLMDNSELNKGIADIT
                     QNNQTVDGQISGYLGDHLLTGGGEYRITSLEHSMNLKGGKVDVNQSALFLQDEFKIAD
                     LALTFGGRVDHHEVYGTEFSPRAYATYSLTDNWVIKGGVNKAFKAPTLAQFTKGYTKA
                     ACRGQCYIVGNPDLKAETSISYELGTAYEAEHFGTGITLFNNDIKDMIQTNSLTRTYE
                     NVSKARVQGIETSFWVDLTDDLNWTTNWTVVDAEDRATRMRLKQTPKNTVNTQLNWQA
                     LDNLSTYVSYQYTSNQYLRDKETYRTRGFNTVDIGATYTPVKNVDLKLGVTNLTNEKR
                     DYVATDIDYFVSGRTVYGGVSYKF"
     gene            complement(525327..526577)
                     /locus_tag="PC1_RS02290"
                     /old_locus_tag="PC1_0461"
     CDS             complement(525327..526577)
                     /locus_tag="PC1_RS02290"
                     /old_locus_tag="PC1_0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_043881704.1"
                     /db_xref="GI:762766968"
                     /translation="MYSQHTRPVVHLALLINMLSLGSLMMVMPLGPDFISALSMDAKN
                     IGYISGGATFASAIVGFLAAPYLDRFNRKHALLVLLTLRFGLTAACMFATSQTHLLVL
                     FILAGCVAGPASGVLMAAVVDIVPANERGKQLAYVGMSFSLAAIIIMPLSLELAHRIN
                     WQAPFYIFGLGGLLLALLVLWLFPSMPPTHRAQQSASPSTSPTSVLHDLLASPLFLLG
                     LTVVSLQMFGHFLLIPHFSNYFQFNLAFPRDDISLLYLCGGLGSMVTMQLCGNLLDRG
                     YASRTIVVTTLLLAVVILCGFVLPFSLSLYLVFTLFMALSAARSSSTLAITAGIPLPH
                     QRAAFMSYQGTAANVASGLASVASAAYLSTSVEGRIDGFSQLAVASTIFALAAMLLTL
                     RLIPLLAERSRKMAARQPVQATGQ"
     gene            526921..528117
                     /locus_tag="PC1_RS02295"
                     /old_locus_tag="PC1_0462"
     CDS             526921..528117
                     /locus_tag="PC1_RS02295"
                     /old_locus_tag="PC1_0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase EntC"
                     /protein_id="WP_012773172.1"
                     /db_xref="GI:502366037"
                     /translation="MDTLITEAETFSGLTYSEQTAFLYASEHRSLSTSGLFERISSPV
                     CASDSHDDRLSSAIAQAFQRARQAGQSLPIVVGAIPFDTTQPSCLYIPDSYTVTTKSE
                     LVSRARKHTAAAPAALTLNSVPDECQFKSIVAEAVERFRRGELSKAVLSRILDIELAW
                     PVKAQTILNNLMVQNAGGYHFSLPLPDGSILLGASPELMLRKQGNVIVSNPLAGSARR
                     MNDEHLDYLNSQRLLNSSKDKHEHKLVVDDIRQRLMPLCSSLTIPSAPSLMSTASMWH
                     LSTAISGELVHPEMTALQVACQLHPTPALCGFPTQEARQLIAELEPHDRGVFSGIVGW
                     CDANGDGEWAIAIRCGTIKNNNVRLFAGAGIVEASVPEDEWAETAAKLNTMLNAFGLK
                     SGVDGL"
     gene            528114..529757
                     /gene="entE"
                     /locus_tag="PC1_RS02300"
                     /old_locus_tag="PC1_0463"
     CDS             528114..529757
                     /gene="entE"
                     /locus_tag="PC1_RS02300"
                     /old_locus_tag="PC1_0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773173.1"
                     /note="bifunctional 2,3-dihydroxybenzoate-AMP
                     ligase/S-dihydroxybenzoyltransferase; activates the
                     carboxylate group of 2,3-dihydroxy-benzoate forming
                     (2,3-dihydroxybenzoyl)adenylate then catalyzes the
                     acylation of holo-entB with 2,3-dihydroxy-benzoate
                     adenylate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enterobactin synthase subunit E"
                     /protein_id="WP_012773173.1"
                     /db_xref="GI:502366041"
                     /translation="MSIEFTPWPEELAQRYRDKGYWVGLPLTDAWERHLTTQPDAVAV
                     VCGERQWSYRELDRQSSALASRLTESGLRCGDTALVQLPNVAEFYLTFFALLKMGVAP
                     VNALFSHNKLELLSYATQIEPRLLIASAEHPLFGDGAFLDRLQTQVPRLQTVVMLGDS
                     SLGHSLSDWLQPRASTSQYQPSASGQVAFFQLSGGSTGTPKLIPRTHDDYYYSVRRSV
                     EICELTPQTRYLCALPAPHNFPLSSPGSLGVFYAGGRVVLAPDPGAMTCFPLIERHQI
                     DITSLVPPAAALWIQAAEQFGGALRSLKILQVGGAKLSETVARRIPAVLGCQLQQVLG
                     MAEGLVNYTRLDDSDEHIFTTQGCPMSPDDEVKVLDIDGNPLPRGEAGLLATRGPYTF
                     RGYYRSPEHNARAFDSEGFYHSGDVVQMTEDGYLCVVGREKDQINRGGEKIAAEEIEN
                     LLLKHDGILHAALVSMPDPVMGEKSCAFLVVSDPALKAITLRKYLRNQGIAEFKLPDR
                     FEMIDTLPVTPVGKIDKKSLRQRIQTQLSTQNPTELQNK"
     gene            529768..530643
                     /locus_tag="PC1_RS02305"
                     /old_locus_tag="PC1_0464"
     CDS             529768..530643
                     /locus_tag="PC1_RS02305"
                     /old_locus_tag="PC1_0464"
                     /EC_number="3.3.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773174.1"
                     /note="2,3 dihydro-2,3 dihydroxybenzoate synthase;
                     catalyzes the formation of 2,3 dihydro-2,3
                     dihydroxybenzoate and pyruvate from isochorismate; with
                     Ent DEF is involved in enterobactin synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase"
                     /protein_id="WP_012773174.1"
                     /db_xref="GI:502366044"
                     /translation="MAIPSIASYPLPRAQDFPENKVSWAFEPERAVLLIHDMQDYFVN
                     FYGADSPLAQQLIENIAALRTYCKARGIPVVYTAQPNAQSAADRALLNDMWGAGLNNH
                     PDKQRVVSALAPDEHDTVLVKWRYSAFHRSPLEPMMKEMGKDQLIICGVYGHIGCMIT
                     ATDAFMRDIKPFMVGDAVADFSLQEHQMALKYVATRAGRVVSTAELTGAKMAQTLTKQ
                     GLRAHLLTLIDEEEDQFDEDENLIDYGLDSVRMMALLTEWRNQGVTLSFVDLARNPSL
                     NAWWALIEKQQGAAS"
     gene            530640..533783
                     /locus_tag="PC1_RS02310"
                     /old_locus_tag="PC1_0465"
     CDS             530640..533783
                     /locus_tag="PC1_RS02310"
                     /old_locus_tag="PC1_0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010284725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="WP_012773175.1"
                     /db_xref="GI:502366047"
                     /translation="MKPLSVAQRGLWLGHALNDDKATFNTAECIAFDGKVDIEAMLSA
                     IRQAVMECECLYCQFVEVAAEQADQPEIGFVASQLPVPIGVLPIVELLPAPRTDEAQT
                     IRQWAREEISQPLDLLNGLPCRFALLCGEKRDFLYSCVHHIALDGFGTTMLFQRIAQI
                     YTALTAGQSVPMAEFGPFSDVLEEEQQRDASGQTAQARDFWLETLNAMPEPASFSEKK
                     APIAARFLRQSCDMPEDLWQPLTALCEGNKISWPDLFLAMLATHLKLVSGSDRLTFGM
                     MVMNRIGSASLTVPSMQMNIVPLCIQVDEQADFVALAQQVARTKRTLRRHQHYRYEHL
                     RRDLNRVGGEQRLFGPLINIMPFDHPLSYGSLSSSTLNLSAGPVEDLTIEIHFKPDGT
                     PVLDFDANPACYSAEALANLQETLFTLLQRWLAQPRQTSGELLGRWLREERELALITS
                     REPEPFVEPVLTAIAKQARKNPNHTALTQRDRQYSYQQLLDLSDQAAAALHERGVQPG
                     ERIGIMLNRSPETIICLLAVMQCGAVYVPLDPEQPHERQQHIIQIAGLRTIVTQADYQ
                     HRLASVFSGEIVLAGHLLSPNAQHAALPPAEVRDGQIAYVMFTSGSTGLPKGVEIGVS
                     ALDHFIAAARQRYGLRAADRVLQFAPFNFDASIEEIFATLTSGATLVLRTDEMLESIP
                     TFVEQVEELAITLLDLPTAFWNEWVVGLKTGALTMPSALRAIIIGGEAVYPEQLVQWQ
                     RHAPDTLRLINTYGPTETTVVATSCDLQTQPADVAQLPIGLPLAGVNALILAAGDRPA
                     AEGELVLLGPTLASGYIGTEHTAFTQLAVGDRELPAYRTGDRVRLEKGQLLYLGRMDN
                     EFKISGYRIQPGEVEAHLLAQPDVDEACVQGIVYPNGVRRLVAFVATKAGEIDARALK
                     QRLGSVLPPAMIPTDYRAFRQLPKTGSNKVDRKRLLAEYHDEAPAQALASETENRVSA
                     IWQQILGVSGIQSRDNFFELGGQSLQTIQIVNRLAAEFSVSIKVSDVFDHPQLSDFCR
                     YLDDRLSQDENSVEMVW"
     gene            533789..534559
                     /locus_tag="PC1_RS02315"
                     /old_locus_tag="PC1_0466"
     CDS             533789..534559
                     /locus_tag="PC1_RS02315"
                     /old_locus_tag="PC1_0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-dihydroxybenzoate-2,3-dehydrogenase"
                     /protein_id="WP_043881705.1"
                     /db_xref="GI:762766972"
                     /translation="MMNKAQPLQFDFSGQTVWVTGAASGIGESIARQFVGLGANVIGF
                     DRAFRHQDRPFTCVTLDISEPDSVAAVCRQQLAETGLDVLVNAAGILRLGDIDALSVD
                     DWHQCINVNASGAFYLLNALVPHFKQQRRGAIVCVGSNAAHVPRLQMAAYCASKAALT
                     SLSHCAGLELAPYGVRCNLVSPGSTDTPMQRGMWHSADAEQRTIAGFPDQYKLGIPLG
                     KIAQPEEIANTVVFLASDLASHITMQDVVVDGGATLTA"
     gene            534582..540899
                     /locus_tag="PC1_RS02320"
                     /old_locus_tag="PC1_0467"
     CDS             534582..540899
                     /locus_tag="PC1_RS02320"
                     /old_locus_tag="PC1_0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="WP_012773177.1"
                     /db_xref="GI:502366053"
                     /translation="MKDIVTLLKQLERQGVRLALNAQGQLISQSSKDAITADIGRTIK
                     ENKDAIVRCLTAQQAFERPITPQNATSGPLSSSQSGLWFIEQYEEQSHLYNMPVYFRL
                     TGTLDVAALEFAFDALAQRHASLRTRFVVNEQGKGEQRIDAYQPFVIQHDDFSSLPEA
                     EREACLQQQVKAEISRPFDLTAGDLTRVRLVKMSERVHILMITQHHIISDGWSVKNMF
                     ADFKPAFLACQNRQPYPVEPTQLNYIDYAHWFNSNAFLDYHNEFKPFWVERLTGIPEV
                     HSLPLDKSRPAHQNSGGEVIFSAINNELWDKFKRLCQRYNTSNFIGLHAVFSLMLARI
                     SGEKDIVIGSPLAYRERPDIEDVVGFFVNTIVLRTQLQDQQSFVDYLQYCREQDLSAF
                     DHQLYRFEALSEAIGSDRTTAINPIFQVMLVYQAKVDFNDLIPGCDAEEETSPVLPAK
                     TDISVKVTELMGEVRLDWLFATALFERQTIQYYADRFIRLIEAVVEAPETDVWHLPLM
                     EADRFAAVLAESQQLPRSYPQPLLTVTDVIEAVAQRDPQQLAIAFDGEQRTDTLTYGE
                     LNRQANQLAHWLHRQGLGEQSLVGVLAKRDRYFVIALLAVWKAGAAYVPLDPDYPPER
                     LRHIITDANLAVILGGDGEQLAQWSAEQRIDLADPAVVAQWHDLPGDESPAIPRHAQQ
                     LAQVIYTSGSTGLPKGVMIEHGSLINLLGDHRDRIDFTPQSTMFNCMSLSFDAGNMTT
                     LLPLSCGGTLAFGEPNDRAIVQAEQACATHLILPTALMSILDPKQVNGIQAIGMGGEA
                     CPNAVVENWADKVALYNMYGPTECTVTALSTRLRKGQPVTIGKPIAHIQALILDAAGQ
                     LCPAGVPGELCLAGLGLARGYLNQPQMTASRFEHITLNDVNRVGQGTATLRIYRTGDK
                     ARLLNNGDYEYCGRIDEQIKLRGYRIEPGEIEAQLAAVCPSLKQVKVIVAQVGSRPAL
                     VAYATVKAGGGTPEPAAVLIDVAKHLPEYMVPFRLILLEDMPLTPNGKLNTKQLPPVL
                     EASDGDGEADNPLEADVLAIWRSVLNTPLGVEDDFFRLGGDSILSIQLTTRLRSAGYA
                     CTVKDVFEAKSVRRLCRVLAQNNRDTGIVAEQGTLEGEFALLPIQRWFMEQPLARPEH
                     WNQAAMIQLPEVDAGRLTTMLQALMAQHDALRLACDAEGQRYLTDVPCPAVSTLDYRQ
                     LGDDGLQQAFTALQSEFAPAQGRTMACALVRHHPQADTAVFLAFHHLVIDAVSWRILV
                     DDLERLYLGEPLPPKTSSYRQWGTALHHYATQHAEQLTYWQAQENGVDQTALLAAKDP
                     QGQASAAMLTLDAETTSQLVSEANRAFNTDVSDLLLAALTRTLNDLGWGDKARIMLEG
                     HGREAIDPTLDVSRTVGWFTSTYPVCLQDRSDWASLIQSCKEQLRQVPDKGVGFNPLR
                     YHHPQGNSLTLSPIVFNYLGLSVHTAGTWRPVDVAPGVCVALENKPAEIISLHGGIAG
                     GQLTLRQVGCLNQRDSERLMVRLTENLRALTAACLAQLHHGTVFTPSDFPAVTLSQTQ
                     LDSLSQRYDIDTLLPLSSLQQSMLYHRLRCPQDDAYHLQTPVRYAQALDVEGYRQAWQ
                     RQIQRFPALRAALESEQTSVQVIVKQADLPFYYQDVTQEADPQAVIERYRQQDLRTGF
                     DLSQPPLLRIACFRLGEQDYRVLLSCHHSVIDGWSGPQLLGAVHRDYLLLMRGETPTI
                     QVDSAYVDYALHAVAQQPAVEAFWQQRQPLLVQTNDVAVLFAAAGKRADLSQHLTQIE
                     PQVTSVSLNEQDQATLTAFAREVGVTHSIIAQYAWHRLLARSTGDAVSIVGNVLSGRE
                     SPVDDVASSVGLYINSLPLALSWQQPMSLQQHLVQLQNELMAMNQHATQSLIALTAGR
                     PRLFNSLFIYENYPGAKAEPGQRADDPHRLSPEFSAAYEKVEMPLNLVVREQAGCMLL
                     RFEFDADVLDSTQARRVLMRWHDEVVALINSAPQQPAEIIGHEKATGSVVAQKTAADS
                     GISQPDTPSAQLLLRVWAQVLHLAESGLWSQTLCECGIDSLRRIALAQALSRALAQPV
                     SVALLQRYPSPQALNGYLAQSRVTANEETLS"
     gene            540896..543010
                     /locus_tag="PC1_RS02325"
                     /old_locus_tag="PC1_0468"
     CDS             540896..543010
                     /locus_tag="PC1_RS02325"
                     /old_locus_tag="PC1_0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010284729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="WP_012773178.1"
                     /db_xref="GI:502366056"
                     /translation="MTGSNEAVVNPLAEIQQPTAFGQRVGAAYGEQRHSSELSQEYPT
                     PLVSAAWSWLLYKYSGEEQVCAAFVTSDLPDHVRPLIAHFHQRDRLISDWIAAVGSAC
                     DPLPVSEVSVAAPLHALFSSLLIVGDMASLSVVVQKVAQTVALIVQVQKDLLILTAPD
                     GQFDNRQLQGISRHLTQLLDGLLAQRWERLTQIRLSPLVAPLPHRAATPALHDELLAR
                     LAQDARQDRVAIRFQEREISYRELLQRVALIQQMFAAQGITAGQRVGLHLSRQPDTVA
                     ALLACVFSQVAFVPLEPDFPGERLQAIQQEAMLAAVLQDSYTGGSLAFDCPILNLCDL
                     PYSASDSTASVQLAQAGGPETAAYMMFTSGSTGKPKGVVIGQRALQTFIHASVERLVL
                     TDKANWLLITTLAFDISMLEVFGPLWAGGVLHLTTHEEYKDPQAVAAYLQARPEINVL
                     QATPAFWRMMFKAGWQGKPDLVALCGGEALDLRLAQRLVSRCRTLWNCYGPTEATIWS
                     QMAQIDGATLENQHTVALGNTLVGYQHLVIDDDRHPLAEGMVGELCILGEALSSGYWQ
                     RDDLTQDRFIQQVESGQRMYRTGDKVRLLADDRYQYLGRFDDQVKLRGFRIELGEIEA
                     QMKRIEQVQDAAVKLQGEGDEAVLVGYVEYKPGSEMTKLALRKQLHQFLPAYMVPGRI
                     VVLDKLPKTGSGKVDRKRLTDV"
     gene            complement(543096..544604)
                     /locus_tag="PC1_RS02330"
                     /old_locus_tag="PC1_0469"
     CDS             complement(543096..544604)
                     /locus_tag="PC1_RS02330"
                     /old_locus_tag="PC1_0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_012773179.1"
                     /db_xref="GI:502366059"
                     /translation="MLKGRKLFSLSAIVLAASGCAVTTQPISKVESGQRSQQDRVAMF
                     SQQEPVTAPITLYDAMARALKYNLESRLKVMEYALSQQQLELARYDMLPKIAASAGYV
                     GRNNMSASSSRSVETGRTSLEPSTSQDRDRDVADLTMVWNVLDFGVSYVTAQQKSDQR
                     WIAEERKRKVVHTILQDVRSAYWRAVAAERLLGQIDGLIARVNTARDASEHMSSQQIG
                     DPIEALSYQRALIDATRQLEEQRRALSLAKTELATLMNLPLDTAYKLALPQSGDETVP
                     QLNVDVKVLEEAALVSRPELREQDYQVRIHAAETRKALLRMLPGVEISAGGHYDSNSF
                     LVNNSWADVGVKATWNLFNLLSGPAARKAAQANESVSEMQRQAMSLAIMAQLYIARAN
                     FNEAQRQYKTSSELRNLDTKIVEQLRNRYKANSIGELQLIQGELNALNASLRQDLAYA
                     ELRNSYGQIFSTIGLDLLPKSLPSNSLADISQSLRQSDINWQQGKISTLQSF"
     gene            complement(544713..553274)
                     /locus_tag="PC1_RS02335"
                     /old_locus_tag="PC1_0470"
     CDS             complement(544713..553274)
                     /locus_tag="PC1_RS02335"
                     /old_locus_tag="PC1_0470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773180.1"
                     /db_xref="GI:502366064"
                     /translation="MLWRQLFSKKSDHPTDHIEQAYSAPLGFVLESRVLFDGAIAATA
                     TQAETSNSSDATASSNPAQTANHSAEATSENNTSSDQNSATHDITTDVVVQAVAGETI
                     RKEAVFIDTALTDYQTLVNSVPAGVDVFLLDSSKDGLTQMAVWAETHTGYDAIHILSH
                     GNEGQVRLGNLTLDSATAEARSADLAKLGTALTQDGDLLLYGCDIAQDTGKSFVSLLS
                     QLTQADIAASDDLTGAIAKGGNWQLETTVGSIETNNAALGEITTNYNNLLASPTLGTN
                     TFSQFSGTNTFVSSQSGVQSYDDINNGFTYVAYSTDRVTLQTVAISGNQVLNTIVAPG
                     GNLNYFAIKSTDGSEFNLSNIDLRGLGNYASTFTITGYKDGSAVAGATQTITLTTAFQ
                     TATLSNAFQNIDEVRLTTATLGNGTVQWDNIVTAPVVASTDNVPSIAGSATNPTYTEN
                     GTDVGLFTNVIANTNDSGQTFTSATFTVTNVADSTEYLNINGVKVSLINGNSVTLGSG
                     YGSASVFLSAGTATISLSGETLSNADMGTLLSGMTYGNSSENPHTTARVVTLTQVTDS
                     GASNNSYSPGNIASTVTVVAVNDAPTDLALSNTTFGQSLGSNGIVGTLSATDVDSTTF
                     TYSLVSGAGSTDNALFILSGSTLRAVNAATMAAGTYSVRLQVSDGQATYDKVITLTVA
                     DDIAPTFDATPTITAPTPDGFTLNTDLNERGTIYYVVLPDGASAPSVSQVINGQNASG
                     SLPLNFGSQLAGSAPYSQSLTLTGLAAATAYDVYVVARDSAGNATLSVVKLDVTTAAS
                     STAPTLSATGSNPVFIGGMAGAVDLFSGVSADTRDSGQTFNSLTLTVSNVSDSGEFIS
                     VAGNTISLASNGSGTLTGIGSYTVTRVGNTVTLQLSGMSASNTQFAGLVDGLRYGNSN
                     SSVTAATRDVSLTAVRDSGTSNNTTSLSLTSSVNVLASNSALYVTSGDDTGDDASFGN
                     SLQDDLNDGGGLSLREALHWANLTPGIDRIVFQTNVTLAEGLLVPTSSMLIDGQSFTL
                     NGGGYSGFQINTSSITLAIQNLTLTNFTTSTNQVTGGVLGIHYGATDINFRLYNVDIS
                     GNTDDTWGTGMIDLFNIAPGRYIVDLDRVNIHNNVLFGGLNEEGVVRLFVAGTQHTVS
                     LSITNSAIYNNGSFNPASGNIGVAGIYVTASLSNATSTHISLMNTTITGQDAGMVFGF
                     TGGSTNWVANIRNSIISGNTVDVTTFYSGGTGGTYTLLGNNNLIGGTVNLISTADPRL
                     AATATNAINQGDRFSVTGDADARGLDRVRQGAVDIGAYESQFASGVSPQVDLNGASSG
                     NDYSATVSSGLSTGVPITDMLATLSQTDGDTRLWTLTLSLAGNANGSSEYLTLSQQAL
                     LAAHAAGINVSGDGSQTVTLTGGASLDAFQTALRAIVYVNVATTPTAGNRTISVTAND
                     DASSSATSTLTVVVGNPPVVATPIPAQSVAQDGSLSFTVPAGTFTDPDVGDTLTLSAT
                     LANGSSLPSWLTFNPATGTFTGTPGNADVGILSIKVTATDTTNASVSTTFSLTVTNVN
                     DAPIVATPIPAQSVAQDGSLSFTVPAGTFTDPDGDTLSLSATLANGSALPGWLTFNSV
                     TGTFSGTPGNADVGTLSIKVIANDGNASVSTTFSLTITNVNDAPMVSATIPAQSVAQD
                     GSLNFTVPAGTFTDPDGDTLTLSATLANGSTLPSWLTFNPATGTFSGTPGNADVGTLS
                     IKVTAHDGSASVSTTFNLTITNVNDAPVVATPIPAQSVAQNGSLSFTVPAGTFTDPDV
                     GDTLTLSATLADGSPLPGWITFNSATGTFSGTPGNADVGSLSIRVTATDGSNASVHTD
                     FSLTITNVNDAPVVATPIPAQSVAQGDSLNFTVPAGTFTDPDAGDTLTLSATLANGSP
                     LPGWITFNSATGTFSGTPGNADIGSLSIRVTATDGSNASVHTDFSLTITNVNDAPVVA
                     TPIPAQSVAQDGSLNFTVPAGTFTDPDGDTLTLSATLANGSPLPGWLTFNPATGTFSG
                     TPGNADVGSLSIRVTATDGSNASVHTDFSLTVTNVNDAPVVATPIPAQSVVQDGSLNF
                     TIPAGTFTDPDGDTLTLSATLANGSPLPSWITFNPATGTFSGTPGNGDIGNLSIKVTA
                     NDGDASISTTFSLTVTPSNQAPVVSTPIPPQSVAQDGGFNFTVPAGTFSDPDGDTLTL
                     SATLTDGSPLPSWLHFDPTIGTFSGTPGNGDVGTLVIRVTATDGSNTSISTSFGLTVT
                     NVNDAPVVATPIPPQSVAQDGGFNFTVPAGTFSDPDGDALTLSATLADGSPLPSWLHF
                     DPTIGTFSGTPGNGDVGTVVIRVTATDGSNTSVSTSFGLTVTNVNDAPVVATPIPPQS
                     VAQDGGFNFTVPAGTFSDPDGDTLTLSATLSDGSPLPGWLRFDPAIGTFSGTPGNGDV
                     GTVVIRVTATDGSNTSISTSFGLTVTNVNDAPVVATPIPPQTVAQDGGFNFTVPAGTF
                     SDPDGDTLTLSATLADGSPLPGWLRFDPAIGTFSGTPGNGDVGTVVIRVTATDGSNTS
                     VSTSFGLTVTNVNDAPVVATPIPAQSVAQDGSFNFTVPAGTFVDPDGDTLTLSATLAD
                     GSPLPGWLRFDPAIGTFSGTPSNGDVGTVVIRVTATDGSNTSISTSFGLTVTRSIVGG
                     DPQFKANDGLGRTPSFSDTRQQSTQDIAAAEQTLGGLIANPSLGSLTLGNDGAPRSVM
                     SAIFATGRQNTETGTLPVSQVAGAFGHGVASGIGVNFDSTLGSFPSFSKDSALGGTSS
                     LASTFSGIYLPSLTPMEVFSGGSWKDIPLDGASNAMNSTDDNTGRSVAFTPSLHRQLQ
                     QIGDSELQRLAAIEQALQESGQQQG"
     gene            complement(554719..556827)
                     /locus_tag="PC1_RS02340"
                     /old_locus_tag="PC1_0472"
     CDS             complement(554719..556827)
                     /locus_tag="PC1_RS02340"
                     /old_locus_tag="PC1_0472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M50"
                     /protein_id="WP_012773182.1"
                     /db_xref="GI:502366071"
                     /translation="MNPHLPPLRADLQLVESAPGINGAPQWVLSDPITGRYFTLTPSA
                     IRLLRHWPLRQPQQILAAANSEPGLPLRVKELEQLLQFLRQHDLIAASDVEQRQRYLG
                     KAQAMRTSLWKSVLHQYLFFRIPLWRPDPVLNRCWPWLQHYGAPFLMWVFPCILLLGL
                     FLVSRDWVRYTHSFPHLFSLSGMAVFGISLVFAKFIHELGHAFMAKRAGCRVQSMGVA
                     FIVLFPLFYTDTTDAWKLKDRQARLLIGAGGILAELMLAVIALLAWALLPDGAARTAA
                     FMLSSATWLTTLVVNLNPLMRFDGYFLLSDFWRVENLQERAYALCRWRLRESLFGHGH
                     PAPENLSPSLQRKLLVWGYASWIWRFFLFFGIALVVYHFFIKVIGIGLMLVEIVWFIA
                     LPIAKEAYAWWSMRKSIHPIAFLRSALLCSALLFILLYPWGGSIHIPAVLEAEKVSTL
                     YSPVPAQVNQLHVTDGQRVDAGDILLELTSVDLDYRLDIERQRITQLQQQRQRGAARQ
                     ETASEIQVMDRQLAEALARYRGLAAQRQRLTIRAPQAGVVRDLARDMTAGRWLTADTP
                     LLRVVEPTQGRVVGYIPEESLMRTQEGMQGVFLADDPAFPRLDVTLHDIAPTGSAYLQ
                     QEMLASDRHGPIAVRRDRDHNPQPVQAQYRVHFMVQEEPFLPLQQPLRGSVILEGEKE
                     SILGTVWRRVAALGIRESGF"
     gene            complement(556824..558152)
                     /locus_tag="PC1_RS02345"
                     /old_locus_tag="PC1_0473"
     CDS             complement(556824..558152)
                     /locus_tag="PC1_RS02345"
                     /old_locus_tag="PC1_0473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_012773183.1"
                     /db_xref="GI:502366073"
                     /translation="MSTTPTSASTAAFARFLDVERQARAAKSTEELAYCIVNDSQPLF
                     GFRHAALIINGRVRAVTGVTQPAPHAPFVAFIERACTQLSSIDEKALAKCAVIEASQL
                     DEQSRKDWQALSAPEVLWSPLNDRQGKPFGAIWYAREQLWQSTDQVLAEQLSGAFSHA
                     WLALEPQTTRWRRRQTRWKIAVPALLLLACLFIPVRQSVLAPAEVIPHQGRVVAAPLD
                     GVIQSFTVLPNQSVRKGEVLVRFDSTTLKAQADVAERALNVAEAEHRASSQRAFQDAD
                     SKARLDFLAAQVAQKRAERDYANALLSRAEIRAERDGIAVFADATRWMGKPVRTGERL
                     MELADPALTALRIELDVGDAIRLPQEAPITLFLDSDPLTPHAALLERIAYESEQTPAG
                     NLAYRLDARFTDTPPRIGLRGTAKISGDYVPLAVYLFRRPLAVIRQAIGI"
     gene            complement(558149..558952)
                     /locus_tag="PC1_RS02350"
                     /old_locus_tag="PC1_0474"
     CDS             complement(558149..558952)
                     /locus_tag="PC1_RS02350"
                     /old_locus_tag="PC1_0474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_012773184.1"
                     /db_xref="GI:502366074"
                     /translation="MDSFSNVISRRTFQLLALCLFAFTAHAQTSDPLLAIPSHDTPSL
                     TPTDNQARGILIAVEQATLSSELAGRIVEIPFREGESFKKGDLLVRFDCSIYQAQLAA
                     ASAATRAAEAELSQNQQLAQMKSVGRHAVSLSAAHFAQAQAESQVYQIQVNRCRITAP
                     FDGQVVKRRAQAFESVAQGAPLLDVVNNRNLEINLLVPSRLLSVLKPGLAFTFTPDET
                     GKPLQAKVTRLGARIDESSQTLGLTGTLAHADNTLMAGMSGTAQFSEAQ"
     gene            complement(559251..561332)
                     /locus_tag="PC1_RS02355"
                     /old_locus_tag="PC1_0475"
     CDS             complement(559251..561332)
                     /locus_tag="PC1_RS02355"
                     /old_locus_tag="PC1_0475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773185.1"
                     /db_xref="GI:502366077"
                     /translation="MTSISESLTALVKRRAQLREMFTTHQFDALDTLLEQEHQIWLDG
                     PNLPYTYIWLINSLFDPALSDADILSRLQAWVAARPESYHAHHLTGQYWENAAARIRT
                     ANGGQYVEDDRWMGAELARDLGVAAYLRASALHQRPALTFSRLFRLTCYLGEPQWLGV
                     LLQGGEPLTYAQRQAQVDPSLWEAGLERLRNEGAQTLVELPVALPASLPAREDHEWEE
                     PMNYWLRITLAVRPQDLAIRKECVYFLYPRWGGSHEAITQFIDGPLCEVLTEPERNSL
                     RVTQCWDYVGYAALIPDANDAESITYCRETFDWLLGLELFPDTRALVLRQYAWFLGNY
                     ARLEDENGIRWNKSDMRLAYNLMVEAWQVDLPESDPESDAFATLISCLDFVRIEDSFD
                     LMPKWLERCQYWRDAHYETTIAALASKFGFYGIAKGQFDSDALLARCRVLKSETNFGQ
                     AGTNLFEYVSEEAGVFLLHEAANWGEASSMAALSDLYSGHLSRRNERDPSPYEDQEKS
                     DYWQERAADAGNEICQYNIAYCLIRDNETLSPVQYQRARELMFGVMHRPNVGRTVWTR
                     AARELSTLLLFSNIPEDQARCVDVVLPELWSDEDDDNRDYAAGYYAYAFRNGAGVTQN
                     SYLAKVWIDRALEISPDSQYNHDRANEIYQRGGMLSGVRAKMGFNRDKAKIDARGRAI
                     TFGDDAHQEHQ"
     gene            562021..562953
                     /locus_tag="PC1_RS02360"
                     /old_locus_tag="PC1_0476"
     CDS             562021..562953
                     /locus_tag="PC1_RS02360"
                     /old_locus_tag="PC1_0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate phosphomutase"
                     /protein_id="WP_012773186.1"
                     /db_xref="GI:502366080"
                     /translation="MSVILSNHTPTDSYKGCTPGSRRSALRELLRQQKGIRVMEAHSP
                     LSALLIEQAAYEDGDIHYQFDAFWSSSLTDSTLRGKPDTELVDISHRFHAITEIFDVT
                     TRPLIFDGDTGGQTEHLAHRIRAAENLGISAMIIEDKTGLKKNSLFGNDVKQTQASVE
                     DFCEKITTAKKAQLTPEFMLIARIESLILDVGMEDAINRALRYADAGADGIMIHSRHK
                     NPSEILAFARQFREHYPHLPLVCVPTSFNDITFDQLIDGGFNIVIYANHMLRAAYPAM
                     KSILPEILKHGRTLEVEDKCMSIKDILDLIPGTR"
     gene            563186..564340
                     /locus_tag="PC1_RS02365"
                     /old_locus_tag="PC1_0477"
     CDS             563186..564340
                     /locus_tag="PC1_RS02365"
                     /old_locus_tag="PC1_0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonopyruvate decarboxylase"
                     /protein_id="WP_012773187.1"
                     /db_xref="GI:502366088"
                     /translation="MIDPNKLIEFLAQRGVHFFSGVPDSLLKAFCLAVESNHSGLAHR
                     IASNEGCAIGMAIGHYLSTRTLPVVYMQNSGLGNAINPLCSLATPDVYGIPLLLIIGW
                     RGEVDDGGKQQHDEPQHVMQGRVTLAQLDVLDIPHIVLDSHSAPRWDDIQALLQRSHD
                     EHRPVALVVRKNTFSSSAAPANSTVEPVLMQREAIVAACLNVLPSHLPIVSTTGMLSR
                     ELYELREQRSEGHQRDFLTVGGMGLASQIALGLCDAQPQRKVVCLDGDGALLMHMGGL
                     TNTAQANNLIHIVINNGAHDSVGGQPTAASRLPLAPIAAASGYGDTYYVETEDALQAA
                     LQQALRAHSSQFIEVKCRVGHRSDLGRPATSPAQNRDAFMQFLNTPPQAS"
     gene            564395..565288
                     /locus_tag="PC1_RS02370"
                     /old_locus_tag="PC1_0478"
     CDS             564395..565288
                     /locus_tag="PC1_RS02370"
                     /old_locus_tag="PC1_0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxy-3-oxopropionate reductase"
                     /protein_id="WP_012773188.1"
                     /db_xref="GI:502366090"
                     /translation="MTHSVSLVGVGVLGKAISLRLLQRQFSLSVFNRTHSKASEIAAE
                     GAQSVPELHQLFTQEKQVVLICLKDAEAIRDVFQSKEVTQKLTRYRPLFLNISTIGPE
                     ESRWMASFFHQHGAHYVECPVSGGPEGARQGKLAAWVGPCVDDFARTVNDIVTSLSDR
                     YVLMANNHSAQTMKVINNYCEAVHLLVAAEALLVAEGHGIAPDMLANALTLGRGRSTY
                     MEVMLDRYLNPRETVSVPLSIRLKDLDLAHTLFQRAEIQSEFFDTARQCYQNTADLSA
                     VPQDQTACFAYLSRTLPAGRE"
     gene            565289..565732
                     /locus_tag="PC1_RS02375"
                     /old_locus_tag="PC1_0479"
     CDS             565289..565732
                     /locus_tag="PC1_RS02375"
                     /old_locus_tag="PC1_0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase system protein PhnG"
                     /protein_id="WP_012773189.1"
                     /db_xref="GI:502366093"
                     /translation="MSELTQRQRWMSILAHSDPVELEEHWGTLNFPTGYQLLRPTQIG
                     LIQLQGRMEVDGPRFIVGDMTVTRAAVQLEDGTCGYSYIAGRNKPHAELCAWIDALLQ
                     TRSYFHEIWERIITPLADQQRAYREQQQHEVAASRVNFFTLVRGE"
     gene            565739..566320
                     /locus_tag="PC1_RS02380"
                     /old_locus_tag="PC1_0480"
     CDS             565739..566320
                     /locus_tag="PC1_RS02380"
                     /old_locus_tag="PC1_0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase"
                     /protein_id="WP_012773190.1"
                     /db_xref="GI:502366095"
                     /translation="MTTMTGFAHPVFGTQLCFRKIVKAMSEPGSLVTVPNVSGLESIS
                     SATAATLLTLTSHTTPLFIDPRIGNPLLLRTLCLHTNVPIATTLEEAYFVLLSGNPFS
                     YDLMALSCGSEAEPEKSTTVIVEVDGMHDGPCLKLTGPGIKTHRIISPRLPGSVRNYL
                     CNRPHAFPTGLDFLFTSGKKLFAIPRSTHVEEC"
     gene            566320..567423
                     /locus_tag="PC1_RS02385"
                     /old_locus_tag="PC1_0481"
     CDS             566320..567423
                     /locus_tag="PC1_RS02385"
                     /old_locus_tag="PC1_0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914045.1"
                     /note="required for the use of phosphonate and phosphite;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase complex subunit PhnI"
                     /protein_id="WP_012773191.1"
                     /db_xref="GI:502366097"
                     /translation="MYVAVKGGEKAIEAAHQLQSCRRRGCTDIPELDCSQIEQQLNLA
                     VDRVMTEGNIYDRQLAALAIKQASGDLVESIFLLRAYRSTLPRWGISQPLNTSDMRLE
                     RRVSAIFKDLPGGQLLGPTYDYTHRLLDFSLLAAGEDPVAPQPDAADANEEADEHVAH
                     AFQFLAQQHFVPERDIRDDSDPPDITMVPPSYPGTRAARLQQLFRGDEGFLLSLGYST
                     QRGYGRNHPFVGEIRTGYITVSIVAEEVGFAIDIGEILLTECETVNGFVKPTNDAPHF
                     TRGYGLAFGRSERKAITVALADRALQAADYQEEIRGPAQDEEFVLSHADNVEAAGFVS
                     HLKLPHYVDFQSELELLKRLREEYLASVPRSNA"
     gene            567423..568328
                     /locus_tag="PC1_RS02390"
                     /old_locus_tag="PC1_0482"
     CDS             567423..568328
                     /locus_tag="PC1_RS02390"
                     /old_locus_tag="PC1_0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase complex subunit PhnJ"
                     /protein_id="WP_012773192.1"
                     /db_xref="GI:502366100"
                     /translation="MGQTTISRQTGSRPETAYDDSDTEYNYAYLDESTKGMIRRAILK
                     AIAIPGHQVPFGSREMPMPYGWGTGGIQITASIIGPDDTLKVIDQGSDDTTNAVSIRT
                     FFRKVANVPTTEKTSDATLIQTRHRIPETPLKEDQILVFQVPIPEPLRFIEPRETETC
                     KMHALEEYGVMQVKLYEDIARFGHIATTYAYPVKVNHRYVMDPSPIPKFDNPKMDMMP
                     ALQLFGAGREKRVYAVPPYTVVESLDFDDHPFTIQQWDKPCELCGARDSFLDEVVMDD
                     DGTRMFVCSDTDYCQQRQSQGGETS"
     gene            568325..569113
                     /gene="phnK"
                     /locus_tag="PC1_RS02395"
                     /old_locus_tag="PC1_0483"
     CDS             568325..569113
                     /gene="phnK"
                     /locus_tag="PC1_RS02395"
                     /old_locus_tag="PC1_0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase"
                     /protein_id="WP_012773193.1"
                     /db_xref="GI:502366103"
                     /translation="MTTEHHVPDTPLLDVRHLTHLYAPEKGFRDVSFQLWPGEVLGIV
                     GESGSGKTTLLNAISARLAPQDGEVIYRNAEQQVLSIYDISERQRRALVRTEWGIVWQ
                     HPLAGLRPTVSAGGNIGERLMAIGNRHYGDIRSKAAQWMANVELPENRLDDLPTTFSG
                     GMQQRLQIARNLVTAPRLIFMDEPTGGLDVSVQARLLDLLRTLVVEMQLSVVIVTHDL
                     GVARLLSHRLLVMQRGRVVEQGLTDRVLDDPSHPYTQLLVSSIL"
     gene            569135..569866
                     /locus_tag="PC1_RS02400"
                     /old_locus_tag="PC1_0484"
     CDS             569135..569866
                     /locus_tag="PC1_RS02400"
                     /old_locus_tag="PC1_0484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter ATP-binding protein"
                     /protein_id="WP_012773194.1"
                     /db_xref="GI:502366106"
                     /translation="MDTQLRIENVDKTFVLYNQQGARLPVFHDVSLSVKGGECVALHG
                     HSGSGKSTLLRSLYGNYQPDGGHIWVRHRERWVDIVNADARHVLEIRRETVGWVSQFL
                     RVIPRISTLNVVIQPLLERGMSRQESEILAGELLTHLNVPERLWSLAPATFSGGEQQR
                     INIARGFIGDYPILLLDEPTASLDAKNRLAVTQLINNAKDKGCAIVGIFHDDEVRQEV
                     ADRLYTMSLHTMPVISNAQETANDH"
     gene            569856..570992
                     /locus_tag="PC1_RS02405"
                     /old_locus_tag="PC1_0485"
     CDS             569856..570992
                     /locus_tag="PC1_RS02405"
                     /old_locus_tag="PC1_0485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein PhnM"
                     /protein_id="WP_012773195.1"
                     /db_xref="GI:502366109"
                     /translation="MIINNVNMVLAQEIIHGSLEVRNGVIHHISDRPSRHPGALDGEQ
                     AWLLPGLVELHTDNLDKCFTPRPGVNWPSEAAMRNHDALIISCGITTVLDAVAVGDVR
                     DGGHRLENLRRMTDAILYSQQHGANRADHHLHLRCELPHQNTFPLFEQLADIPLVALA
                     SLMDHSPGQRQFSSQEKYHQYYKGKYHLNDEQMAAFEEEQLAGSRRWSQPNREAIVRL
                     CHDRGITLASHDDATPEHISEAHQHRVSIAEFPTTTIAAQQAHGVGMNVLMGAPNVIC
                     GGSHSGNVSAHHLATLGVLHILSSDYYPASLLEAAFMIAEDERNDYDLPRAIALVSNN
                     PAQALQFDDRGCIEEGRRADLLLVKRQAPQMKLMRVWRQGVRVF"
     gene            570995..571564
                     /locus_tag="PC1_RS02410"
                     /old_locus_tag="PC1_0486"
     CDS             570995..571564
                     /locus_tag="PC1_RS02410"
                     /old_locus_tag="PC1_0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 1,5-bisphosphokinase"
                     /protein_id="WP_012773196.1"
                     /db_xref="GI:502366112"
                     /translation="MPKLIYLIGPSGAGKDSLLRAIRQLALPRLLVAHRYITRPAEIQ
                     GENHIALTPEEFAIRQRLGLFALNWQAHQCDYGVGIEIDGWLQRGSYVIVNGSRAYLS
                     QARERYGNTLFPICLTVSTSTLRERLCARGRESEQQIATRLQRAEEEQSRLQSDCVLL
                     NNDGDLQRTLSTFQSLLPFDSVSAARSER"
     gene            571603..572400
                     /gene="phnP"
                     /locus_tag="PC1_RS02415"
                     /old_locus_tag="PC1_0487"
     CDS             571603..572400
                     /gene="phnP"
                     /locus_tag="PC1_RS02415"
                     /old_locus_tag="PC1_0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773197.1"
                     /note="required for the use of phosphonates and phosphite
                     as phosphorus sources; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein PhnP"
                     /protein_id="WP_012773197.1"
                     /db_xref="GI:502366115"
                     /translation="MAANRAANSDQIVFHFLGTGSAQQVPAFGCECEVCQQAQQDERK
                     RRRACCAAITTQDRVILIDAGLPELAPYLLPYSRRHILLTHYHMDHVQGLFPLRWGYG
                     DPIPVFGPPDDAGCDDLFKHPGILHFQPPLTPFQSFELDGISITPVPLIHSKLTYGYL
                     IQTPTHTLAYLTDTIGLPPETAQFLSAHTLDYAVVDCSHPPQTTPPRNHNDVPRALEI
                     FTQLNPKQLYLTHIGHELDRWLQTQTLLPENVQAAYDGLELELGLGL"
     gene            <572739..575033
                     /locus_tag="PC1_RS02420"
                     /old_locus_tag="PC1_0488"
     CDS             <572739..575033
                     /locus_tag="PC1_RS02420"
                     /old_locus_tag="PC1_0488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773198.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter protein"
                     /protein_id="WP_043881870.1"
                     /db_xref="GI:762768388"
                     /translation="LALAVGAVVGLMASYPALSASNDIVVSTSTTGLTLTTGSHTSLD
                     SVEVTSTGALSGSFYGINNSTTIGSIINAGTISGSEGLFSTGTIGSIINSGLIESSWD
                     AALWAEGAASTINAIDNRGTINGAVAVVVQGGAHLGTLTNSGTISGSYGIANFGSGGT
                     IDSIINTGLISSNSAIYNASATLGSIANSGVIAGDIYSASGLIFNGGEGVTFGTLTGY
                     DQATQGSININNGDLVFASGNLLLNDNVTVSSGVMSNQAAALQINNTVTLNGNYVQGS
                     DATLLIGVADDAVATGDITTDSGYGRLVVSGTANIASGSTVSLVSLNNYAFANGQRYV
                     VAQAAAEGTEYNASSLNYLASGYNGVITGSAQADSVNSGLSDLVVTLGTSGPSRNATT
                     GNAISSFNGLFNYGGTDTSLLNVFNASATLGSSEEANRAGARLSPAAVASASAQASSA
                     PTNAILNVVSQRADAIRVSGGNSGVATGEGDSDVVMWGQGFGGKANQGQRSDVSGYDA
                     RFGGLLIGADRAVSDSWRLGGLGSYAATNVDSTGDNDGSTVRIKSYGLFGYANYEGRP
                     WFLNLSTGVVRHQYDTQRLIDFSGFSGNATGSFNGMQYVVSGQTGYPFKLGATETTLT
                     PIAGLTYSILKQQGYTESGGNGAGLTVGDATSTSLKSDVALKLDRRIALSGGEVQPFI
                     QLGWRHEFHDDAMQSAANFAADSTGATDFVTTGSRPVADSGVLSVGTTIVSQRNLSLT
                     LKYTGEAARSYESHSGNLQVRWQF"
     gene            575169..575996
                     /locus_tag="PC1_RS02425"
                     /old_locus_tag="PC1_0489"
     CDS             575169..575996
                     /locus_tag="PC1_RS02425"
                     /old_locus_tag="PC1_0489"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_012773199.1"
                     /db_xref="GI:502366122"
                     /translation="MKITRLLVLFSTLAIGCTSDPQRHADEIAQVAGLQRETLPVSPF
                     VLTTYTRITRTDRPLNIYIEGDGRAWRTRNLPADDPTPRRALGLSLAAADRAANVVYI
                     ARPCQFTPSSVNPACQPDYWTGKRFAPEVITAMDRAITHYAAKVPTQSIVLTGYSGGG
                     AVAVLVAAQRHDIALLRTVAGNLDHDAVNRFHGVSLMLGSLNPRDVAKQVAAIPQWHF
                     SGEDDRIVPPFVAEHFARAVGECAQVRRIPGVGHEGDWVSLWPSLINLRAPCRHSNP"
     gene            complement(576167..>576310)
                     /locus_tag="PC1_RS02430"
     CDS             complement(576167..>576310)
                     /locus_tag="PC1_RS02430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316247.1"
                     /exception="unextendable partial coding region"
                     /note="controlled cell death protein; post-segregation
                     toxin; toxin addiction system; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid maintenance protein CcdB"
                     /protein_id="WP_043881871.1"
                     /db_xref="GI:762768392"
                     /translation="RINNEDYRLMTTELSNVPVEVIGEEIADLGECANEIKDATNLMF
                     WGT"
     gene            complement(576506..576769)
                     /locus_tag="PC1_RS02435"
                     /old_locus_tag="PC1_0491"
     CDS             complement(576506..576769)
                     /locus_tag="PC1_RS02435"
                     /old_locus_tag="PC1_0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773200.1"
                     /db_xref="GI:502366125"
                     /translation="MTNAVAKNTPRFRLPKHTLPYVFALYMATIMAFLMCLVIILAEF
                     GMGPHYMENVMNAYQVAMPAAFVCILIVRPIVTRLVGLTVHGH"
     gene            576898..577800
                     /locus_tag="PC1_RS02440"
                     /old_locus_tag="PC1_0492"
     CDS             576898..577800
                     /locus_tag="PC1_RS02440"
                     /old_locus_tag="PC1_0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010286387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012773201.1"
                     /db_xref="GI:502366128"
                     /translation="MDVLGLISNFIRVVENGSIAAAARAKGMSPAAVSQSLSRLETHL
                     GVRLLSRTTRSMTLTENGKRYFEKVRHIPHDIELASQAAASETKLQGPLCIATTAAFG
                     RYVIAPLMPAFKESFPDIDIELISTDRNVNHRLEGVDVSIRIEAQLNDQLIARKIASL
                     PFIFCAAQAYLDRAGTPQTPEELSQHACLVFRYPTDGRFLPWTFMVNGQPVNVKLNPK
                     FISDDIDIIAKIAANGGGVTRLASFVAQPLIDSGQLTPLFCSDRSSGNHVESLPMNIY
                     ACVNERSALNSKVRAFIAFLEAEI"
     gene            578523..579746
                     /locus_tag="PC1_RS02445"
                     /old_locus_tag="PC1_0493"
     CDS             578523..579746
                     /locus_tag="PC1_RS02445"
                     /old_locus_tag="PC1_0493"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="abortive infection protein"
                     /protein_id="WP_012773202.1"
                     /db_xref="GI:502366131"
                     /translation="MIKWYRFKNFYSFKDEQLVDLTLKANSSTSSLDEPWLDTRITKV
                     LAVMGANGSGKSNMLKPLAFLSWFCSESFKSMDNSDYLPIYPHICNKKDPSEIEIYFV
                     DSRTVEDEIHNFEFKYLLKFNKKRVLHEELKYKTSRLFSSIFYRKYDELTNSYKVKSA
                     GDDFNISELKTVPQNASAISYFRRKGDNIIADAMHHIFYSIENNLNAFGKANFDYGKV
                     LKATEYYSEEPDIFEKAKKYLTRMDFGLDDIIIKSEDIIDKKTGESEKKFLPYGIHTH
                     EGERFEIPFIMESTGTQACYYFIYKLISALHYGGVAVIDELDSDLHPYMIRELIDMFA
                     NNGINKLSSQLIFSCHTAEILKSLNKHNVYLVEKSNSVSEAWRLDDIQGLRSQDNLYS
                     KYITGALGGVPDINI"
     gene            579758..580282
                     /locus_tag="PC1_RS02450"
                     /old_locus_tag="PC1_0494"
     CDS             579758..580282
                     /locus_tag="PC1_RS02450"
                     /old_locus_tag="PC1_0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773203.1"
                     /db_xref="GI:502366134"
                     /translation="MTKKKIVRRSVRKTLLLVGEGHAEKAFLSHLKSLFSNGTFKVST
                     VTAGGKGPEHVITHAISCKKCDGYDFVIVLLDTDLPWPKSHIRSALSAGINLIGSEPC
                     LEGLLLDILGLRKVNSNKGCKDLLHPLLSGICTERDSYAELFTLETLNKSKNEKIQFI
                     IEALRGKERKSLKI"
     gene            complement(580457..580762)
                     /locus_tag="PC1_RS02455"
                     /old_locus_tag="PC1_0495"
     CDS             complement(580457..580762)
                     /locus_tag="PC1_RS02455"
                     /old_locus_tag="PC1_0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316247.1"
                     /note="controlled cell death protein; post-segregation
                     toxin; toxin addiction system; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_012773204.1"
                     /db_xref="GI:502366137"
                     /translation="MQFIVYQYKRASHYTMFIDVQSDIVDTPKRRMVIPLIESHHLSE
                     KVNKTLFPLIRIDGEDYRLMTTELSSVPVEVIGKVIADLGDCADEIKDALNLMFWGI"
     gene            complement(580765..580983)
                     /locus_tag="PC1_RS02460"
                     /old_locus_tag="PC1_0496"
     CDS             complement(580765..580983)
                     /locus_tag="PC1_RS02460"
                     /old_locus_tag="PC1_0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_012773205.1"
                     /db_xref="GI:502366141"
                     /translation="MKHRVSVTVDKDNYQVLSAAGVNISGLVNDAIGKEARRIKAEEW
                     KKENREGMEEVARFIAQHGSFADENRNW"
     gene            complement(581042..581785)
                     /locus_tag="PC1_RS02465"
                     /old_locus_tag="PC1_0497"
     CDS             complement(581042..581785)
                     /locus_tag="PC1_RS02465"
                     /old_locus_tag="PC1_0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobC"
                     /protein_id="WP_012773206.1"
                     /db_xref="GI:502366145"
                     /translation="MLISDYRERRAHSHEKMRRLLTFLKEETYSDFKTLMLLFDYKNH
                     KPLYLLLAKAIDMGFIQKQTFCTRMEKISLWGITNDGLSVVVTPHEDGFPARFEPSKV
                     TGWTLMQRLDRQLARLLLEKKGAYGWISGADSTFRSRYKVYHRPAGVITLLDGTVIAV
                     ETERHLKTKARYQAIITQHLITRTQKLWMYVFYIVPDPQIKRAIERMFNSVKYAIVDH
                     QQIPLETKHRNVFRVYTVEELKGLDLNLG"
     gene            complement(581837..582520)
                     /locus_tag="PC1_RS02470"
                     /old_locus_tag="PC1_0498"
     CDS             complement(581837..582520)
                     /locus_tag="PC1_RS02470"
                     /old_locus_tag="PC1_0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773207.1"
                     /db_xref="GI:502366148"
                     /translation="MSERFIFATFTALNMPFRHDAGRDGFRRMNACASRAFIRGVRQV
                     NSISQKLLICVARTHPRAFPPRETEQAGGSRINFAAPASKKTRPRVGLFGGLKPRTPS
                     WLSLRPQAGSEARLPTLKAFSHFFADRNGQKKKWAKNGVSKGVVARSGRRCAAVDVGS
                     FGVASSRDITPMRQAIRASSPHELAHAVLCRERYFPAHDRIAVTSLSPQDRLMTSTHA
                     SGRRYSPML"
     gene            complement(582689..583030)
                     /locus_tag="PC1_RS02475"
                     /old_locus_tag="PC1_0499"
     CDS             complement(582689..583030)
                     /locus_tag="PC1_RS02475"
                     /old_locus_tag="PC1_0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015854711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773208.1"
                     /db_xref="GI:502366151"
                     /translation="MADTDSNTGASYQSLPDYENRYSAMSAALARLDFSHMDTDELSQ
                     VTEYCAETQAGLCHCLNFIGDALITFADNDVCESTPESLCQLGHGLTAISLLIPALTT
                     MHKRAHSLTAR"
     gene            complement(583483..584742)
                     /locus_tag="PC1_RS02480"
                     /old_locus_tag="PC1_0501"
     CDS             complement(583483..584742)
                     /locus_tag="PC1_RS02480"
                     /old_locus_tag="PC1_0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019845670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_012773210.1"
                     /db_xref="GI:502366158"
                     /translation="MLTDSKVRSAKHLAKSYKLTDSQGLYLTVSPSGAKLWYFRYRFG
                     GKENRLAFGPYPQITLAEAREKRDAARKLLASGLSPSQLRKSNNPAVEESRTFQYVAM
                     TWHTSSLKLWSEAHADKILTCLKRYVFPAIGSMDIAQVETRHLAQLVKAIDDKGVHDV
                     AGRVRQHLTKIMRHAVQQGVIKYNPAYDLDGVVTPVVTQHHPALPLKRLPELLEKIEN
                     YKGRMLTRLALELNLHVFLRSSELRFARWDEFNLKAHIWSVPAQREAVNGVRFSERGA
                     KMKDEHLVPLSRQAVALLKQIQAYSGESVFVFPGAHTLNKPMSENTINKALRVIGYDT
                     KTEICGHGFRTMACSALNESGRWSKDAIERQMSHKERNGVRAAYVHKAEHLEARIEMM
                     QWWSDYLDVNREGYVAPYIYARNYTVG"
     gene            complement(584904..584979)
                     /locus_tag="PC1_RS02485"
                     /old_locus_tag="PC1_R0017"
     tRNA            complement(584904..584979)
                     /locus_tag="PC1_RS02485"
                     /old_locus_tag="PC1_R0017"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(584944..584946),aa:Phe,seq:gaa)
     gene            complement(585106..585681)
                     /locus_tag="PC1_RS02490"
                     /old_locus_tag="PC1_0502"
     CDS             complement(585106..585681)
                     /locus_tag="PC1_RS02490"
                     /old_locus_tag="PC1_0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012773211.1"
                     /db_xref="GI:502366162"
                     /translation="MQREDVLEHALTLLEQHGFAMTTLDMLAERLGVPVEELTPFWPD
                     REALLYDGLRHHSQQVDTWRRQLLLDDEKTIEQKLLARYQVLHESVNKQRYPGCLFIA
                     ACSFFPDINHPIHQIAEQQKLASYQYTRDLLEELETDDPEMVAQQMELILEGCLSNLL
                     VKHQASSIATAQRLAEDVLRFALCRKNGALT"
     gene            complement(585725..587476)
                     /gene="dipZ"
                     /locus_tag="PC1_RS02495"
                     /old_locus_tag="PC1_0503"
     CDS             complement(585725..587476)
                     /gene="dipZ"
                     /locus_tag="PC1_RS02495"
                     /old_locus_tag="PC1_0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773212.1"
                     /note="two electrons are transferred from cytoplasmic
                     NADPH to thioredoxin and then to the inner membrane
                     protein DsbD which keeps the disulfide isomerase DsbC in a
                     reduced state in the oxidizing periplasm; DsbC in turns
                     rearranges incorrectly made disulfide bonds in the
                     periplasm; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="WP_012773212.1"
                     /db_xref="GI:502366165"
                     /translation="MAQRIFTLIFLLWTAFGTPNVAASSFGQKLFGNSTTSRFLPVDS
                     AFAFEFQQQNNQLNLRWDIHPDYYLYRAQIKIEGNGATLGKIELPPGESHNDEFFGQV
                     FILRDRLALAVPIEQAESGATVKVTYQGCADAGFCYPPETRVVPLSQVLASTGTDAAP
                     NTPSGKATPSDQTAPPQTTPMPFSPWWALLIGIGVAFTPCVLPMYPLIASLVLGRKEQ
                     LTPRRTLLLSMTYVQGMALTYTLLGLVVAAAGLRFQAALQHPYILIGLSVMFVALALS
                     MFGLYTLQLPSSVQTRLTEWSNRQQGGSVTGVFCMGALAGLICSPCTTAPLSAILLYI
                     AQSGNMLAGGGTLYLYALGMGLPLILVTLFGNKLLPRSGPWMQYVKEAFGFIILALPV
                     FLLERILGEVWGMRLWSALGIAFFGWALMLTLRSGKGWMRGVQLLLLAGVVISAKPLQ
                     DWVFPPAGVAQSHTSALNFAPVANIADLNSALAKSAQPVMLDLYADWCVACKEFEKYT
                     FSDPAVQDHLSRITLLQADVTANREEQNALLKKLQVLGLPTIVFFDAQGKEIPGSRVT
                     GFMNAEQFQAHLQKFSP"
     gene            complement(587452..587784)
                     /locus_tag="PC1_RS02500"
                     /old_locus_tag="PC1_0504"
     CDS             complement(587452..587784)
                     /locus_tag="PC1_RS02500"
                     /old_locus_tag="PC1_0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010286405.1"
                     /note="copper binding protein required for copper
                     tolerance; involved in resistance toward heavy metals;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="divalent ion tolerance protein CutA"
                     /protein_id="WP_012773213.1"
                     /db_xref="GI:502366169"
                     /translation="MSDRPLCDAVVILCTAPDEVCAQQLAHSLLETRLAACVTLLPGA
                     RSLYYWEGKLEQQSEVQMLIKSDTSHQQALLTHLKQQHPYDTPELLVLPVSGGDSDYL
                     TWLNASLR"
     gene            complement(587916..589217)
                     /locus_tag="PC1_RS02505"
                     /old_locus_tag="PC1_0505"
     CDS             complement(587916..589217)
                     /locus_tag="PC1_RS02505"
                     /old_locus_tag="PC1_0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_012773214.1"
                     /db_xref="GI:502366172"
                     /translation="MLGLELFIVLLAIYLGARLGGIGIGFAGGLGVLVLTLGFQIKPG
                     VIPFDVIEIIMAVIAAIAAMQVAGGMDYLVSLAEKLLRKHPKYVTFLAPLVTYFMTIL
                     AGTGHTAFSTLPVIAEVAKEQGIRPSRPLSIAVVASQIAITASPISAAVVFVAGILEP
                     HGVSYLLLLGICIPTTLAAILLTAIVTNFLGKELKDDPIYQERLKKGETTLRGNSQHE
                     IKPGAKLSVVLFLIGIVAVVLYATAISGTVGLIQNPVLPRNEAIVVFMLTIATLICIT
                     CKIDTARILSASTFKSGMSACICVMGVAWLGDTFVKAHISDIQDTAGALLQSYPWMLA
                     VVLFFAATLLYSQAATAKALMPAALLLGVSPVTAVASFAAVSALFVLPTYPTLLAAVE
                     MDDTGSTRIGKFVFNHSFLIPGVIAITLSVIFGFILGSILI"
     gene            complement(589339..590778)
                     /gene="aspA"
                     /locus_tag="PC1_RS02510"
                     /old_locus_tag="PC1_0506"
     CDS             complement(589339..590778)
                     /gene="aspA"
                     /locus_tag="PC1_RS02510"
                     /old_locus_tag="PC1_0506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010308186.1"
                     /note="catalyzes the formation of fumarate from aspartate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="WP_012773215.1"
                     /db_xref="GI:502366175"
                     /translation="MSENIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNNKISDI
                     PEFVRGMVMVKKAAALANRELQTIPKKIADVIIRACDEVLNNGKCMDQFPVDVYQGGA
                     GTSVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRISVYASV
                     LKLTEAIAKLSDGFERKAKEFEDVLKMGRTQLQDAVPMTLGQEFHAFNVLLQEEIKNL
                     LRTAELLLEVNLGATAIGTRLNTPDGYQQLAVQRLAEVSGLACVPAEDLIEATSDCGA
                     YVMVHSSLKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPE
                     VVNQVCFKVIGNDTCVTMASEAGQLQLNVMEPVIGQAMFESTHILTNACYNLLEKCVN
                     GITANKSVCEAYVFNSIGIVTYLNPFIGHHNGDIVGRICAETGKSVREVVLERGLLTE
                     AELDDIFSIQNLMHPAYKAKRYTDENELP"
     gene            591303..591776
                     /gene="fxsA"
                     /locus_tag="PC1_RS02515"
                     /old_locus_tag="PC1_0507"
     CDS             591303..591776
                     /gene="fxsA"
                     /locus_tag="PC1_RS02515"
                     /old_locus_tag="PC1_0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773216.1"
                     /note="F exclusion of bacteriophage T7; overproduction of
                     this protein in Escherichia coli inhibits the F
                     plasmid-mediated exclusion of bacteriophage T7; interacts
                     with the F plasmid-encoded PifA protein; inner membrane
                     protein; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exclusion suppressor FxsA"
                     /protein_id="WP_012773216.1"
                     /db_xref="GI:502366178"
                     /translation="MRWLPLLLIFLLAYIEISLFIQVAEVLGVAMTLLLVVFTSCVGV
                     SLVRNQGMKTLVQMQQKMAAGESPAAEMVKSVSLVLAGFLLLIPGFLTDFLGLLLLLP
                     PVQKSLTLKLMPHLHIWRSGSGASSSSGGNTFEGEYQRKDGGSANIEHRDDRDDR"
     gene            592008..592301
                     /gene="groES"
                     /locus_tag="PC1_RS02520"
                     /old_locus_tag="PC1_0508"
     CDS             592008..592301
                     /gene="groES"
                     /locus_tag="PC1_RS02520"
                     /old_locus_tag="PC1_0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008814807.1"
                     /note="10 kDa chaperonin; Cpn10; GroES; forms
                     homoheptameric ring; binds to one or both ends of the
                     GroEL double barrel in the presence of adenine nucleotides
                     capping it; folding of unfolded substrates initiates in a
                     GroEL-substrate bound and capped by GroES; release of the
                     folded substrate is dependent on ATP binding and
                     hydrolysis in the trans ring; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="WP_005971295.1"
                     /db_xref="GI:492809681"
                     /translation="MNIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEVLAVG
                     HGRILENGEVKPLDVKVGDIVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
     gene            592347..593993
                     /gene="groEL"
                     /locus_tag="PC1_RS02525"
                     /old_locus_tag="PC1_0509"
     CDS             592347..593993
                     /gene="groEL"
                     /locus_tag="PC1_RS02525"
                     /old_locus_tag="PC1_0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010427772.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_012773217.1"
                     /db_xref="GI:502366184"
                     /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSF
                     GAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITE
                     GLKAVAAGMNPMDLKRGIDKAVIAAVEELKALSVPCSDSKAIAQVGTISANSDETVGK
                     MIAEAMDKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESP
                     FILLADKKISNIREMLPVLEAVAKAGKPLVIVAEDVEGEALATLVVNTMRGIVKVAAV
                     KAPGFGDRRKAMLQDIATLTGGTVISEEIGLELEKATLEDLGQAKRVVINKDTTTIID
                     GTGEEAAIQGRVAQIRQQVEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEK
                     KARVEDALAATRAAVEEGVVAGGGVALVRVAAKLASLTAQNEDQNVGIKVALRAMEAP
                     LRQIVSNAGEEPSVVANTVKAGEGNYGYNAATEEYGNMIDFGILDPTKVTRSALQYAA
                     SVAGLMITTECMVTDLPKSDAPDLGAAGGMGGMGGMGGMM"
     gene            594273..594806
                     /locus_tag="PC1_RS02530"
                     /old_locus_tag="PC1_0510"
     CDS             594273..594806
                     /locus_tag="PC1_RS02530"
                     /old_locus_tag="PC1_0510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Chorismate pyruvate-lyase"
                     /protein_id="WP_012773218.1"
                     /db_xref="GI:502366186"
                     /translation="MSDDVSTLLRTISWFAEPPSVLPEHIGDWLMETSSMTQRLEKYC
                     AQLTVTLCREGFVSPQSLGEESEQLPPDERYWLREVVLYGDERPWLFGRTIVPQQTLD
                     GTDSALTKIGNQPLGRYLFEQKSLTRDYIHTGCCEGLWARRSRLCLSGFPLLLTELFL
                     PESPVYYTPSDEGWQVI"
     gene            594819..595682
                     /gene="ubiA"
                     /locus_tag="PC1_RS02535"
                     /old_locus_tag="PC1_0511"
     CDS             594819..595682
                     /gene="ubiA"
                     /locus_tag="PC1_RS02535"
                     /old_locus_tag="PC1_0511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010282904.1"
                     /note="catalyzes the conversion of 4-Hydroxybenzoate into
                     3-octaprenyl-4-hydroxybenzoate, as part of the ubiquinone
                     biosynthesis pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="WP_012773219.1"
                     /db_xref="GI:502366188"
                     /translation="MERSVTAGKWLAYCRLMRIDKPIGSLLLLWPTLWALWLAGGGAP
                     APWTLFVFVAGVFLMRAAGCVINDYADRHFDGHVKRTASRPLPSGEVSEQSAKVLFVV
                     LVLLAFGLVLTLNTMTIWLSVAGLGLAWVYPFMKRVSHLPQFVLGAAFGWSIPMAYAA
                     VSESLPATCWMMFLAYICWTVAYDTQYAMVDRDDDLKIGVKSTAILFGRFDNLIIGLL
                     QFSMLALLLILGTMTGLGMPYYISLLVAGGMFIYQQILTAGRERDACFKAFHNNKYAG
                     MAIFIGVLFGL"
     gene            complement(595815..598283)
                     /locus_tag="PC1_RS02540"
                     /old_locus_tag="PC1_0512"
     CDS             complement(595815..598283)
                     /locus_tag="PC1_RS02540"
                     /old_locus_tag="PC1_0512"
                     /EC_number="2.3.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DKD0.1"
                     /note="PlsB; catalyzes the formation of 1-acyl-sn-glycerol
                     3-phosphate by transfering the acyl moiety from acyl-CoA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_012773220.1"
                     /db_xref="GI:502366190"
                     /translation="MSGWRKIYYKLLNLPLKLLVKSKVIPADPVVELGLDPSRPILYV
                     LPYNSQADLLTLRAKCLALGLPDPSQSFEFNGVELPSHVFINDGPRVFRYYVPKQKSV
                     KLFHDYLDLHRANPDLDVQMVPVSVMFGRSPGREGHSQATPHLRLLNGIEKFFAVLWL
                     GRDSFVRFSSPVSLRYMATEHGTDKTIAHKLARVARMHFSRQRLAAVGPRLPVRQELF
                     NKLLDSKAIKKAVDDEARSKKISHEKAQQNAIALMEEIAADFSYEAVRLSDRVLSWTW
                     NRLYQGINVHNAERVRQLAQDGHGIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGI
                     NLNFWPAGPIFRRLGAFFIRRTFKGNKLYSTIFREYLGELFARGYSVEYFMEGGRSRT
                     GRLLEPKTGTLAMTIQAMLRGGTRPITLVPIYVGYEHVMEVGTYAKELRGAVKEKEGF
                     MQMVRGLRKLRNLGQGYVNFGEPLPLTTYLNQHVPQWRDAIDPIEAQRPSWLTPTVQD
                     ISMDIMVRINNSAAANAMNLCSTALLASRQRSLTREQMQEQLDCYLQLLRQVPYHKDI
                     TVPKKTADELLEHALSMNKFEVEKDSIGDIIILPREQAVLMTYYRNNIQHLLVLPSLI
                     ASIVIHHRRITLAEVVRQIALIYPLLQSELFLHYSKEQLPGVLETLANELVQQQLLCS
                     RDGELAINPPRIRTLQLLSAGVRETLQRYAITLSLLCANPEINRGTLEKESRNMAQRL
                     SVLHGINAPEFFDKAVFSTLVATLRTEGYITDSAEAAQGDIVAIYNILGDLITPEVRL
                     TIESASSSAEMEAESQAVEETTQE"
     gene            598536..598901
                     /locus_tag="PC1_RS02545"
                     /old_locus_tag="PC1_0513"
     CDS             598536..598901
                     /locus_tag="PC1_RS02545"
                     /old_locus_tag="PC1_0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914067.1"
                     /note="catalyzes the phosphorylation of diacylglycerol to
                     form diacylglycerol phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_012773221.1"
                     /db_xref="GI:502366193"
                     /translation="MNKATGMTRIIKATGYSLKGLKQAWQHEAAFRQETILTIVGVII
                     ACLLPVTLVEKLLLIGSVVLIMLFELANSAIEAVVDRIGLEHHELSGRAKDIGSAAVF
                     VAIVLAAVVWGSILWQHFA"
     gene            599012..599620
                     /locus_tag="PC1_RS02550"
                     /old_locus_tag="PC1_0514"
     CDS             599012..599620
                     /locus_tag="PC1_RS02550"
                     /old_locus_tag="PC1_0514"
                     /EC_number="3.4.21.88"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DKD2.1"
                     /note="Represses a number of genes involved in the
                     response to DNA damage; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LexA repressor"
                     /protein_id="WP_012773222.1"
                     /db_xref="GI:502366196"
                     /translation="MKVLTARQQQVYDLIRDHIAQTGMPPTRAEIAQQLGFRSPNAAE
                     EHLKALARKGVIEIVSGASRGIRLLMEEETGIPLVGRVAAGEPLLAQEHIECHYQVDP
                     AMFKPSADFLLRVSGMSMKDIGIMDGDLLAVHKTEDVRNGQIVVARIDDEVTVKRLKK
                     QGNMVHLLAENEEFAPIVVDLRQQSFSIEGLAVGVIRNSDWS"
     gene            600117..600326
                     /locus_tag="PC1_RS02555"
                     /old_locus_tag="PC1_0515"
     CDS             600117..600326
                     /locus_tag="PC1_RS02555"
                     /old_locus_tag="PC1_0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010298839.1"
                     /db_xref="GI:497984683"
                     /translation="MNKDQASGNWKQFKGKAKEQWGKLTDDDLTVIEGKRDQLVGRIQ
                     ERYGYAKEAAEKEVKHWEEHHKYHW"
     gene            complement(600423..600932)
                     /locus_tag="PC1_RS02560"
                     /old_locus_tag="PC1_0516"
     CDS             complement(600423..600932)
                     /locus_tag="PC1_RS02560"
                     /old_locus_tag="PC1_0516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010282915.1"
                     /note="Acts as a negative controlling element, employing
                     Zn(2+) as a cofactor to bind the operator of the repressed
                     genes znuACB; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_043881706.1"
                     /db_xref="GI:762766988"
                     /translation="MDSTKQDKLLAQAEQICQQRAVRLTPQRLEVLRLMAQQSGAISA
                     YDLLDLLRVSEPQAKPPTVYRALDFLLEQGFIHRVESNNSYVLCHHIEDHSHTSALFI
                     CDRCGQVTERQTEGVEETLRSLAQQSGFTLRHSVVEAHGLCGVCQEVASCKQPDHCDH
                     DHTVPIKKR"
     gene            complement(601039..601737)
                     /locus_tag="PC1_RS02565"
                     /old_locus_tag="PC1_0517"
     CDS             complement(601039..601737)
                     /locus_tag="PC1_RS02565"
                     /old_locus_tag="PC1_0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_012773224.1"
                     /db_xref="GI:502366208"
                     /translation="MITRRAAGQCGQADYGWLQARYTFSFGHYFDPQLLGYASLRVLN
                     QEVLAPGASFQPRTYPRVDILNIILQGEAEYRDSNGCHIQAKAGDVLLLATQPNVSYS
                     EHNTSASKPLTRLQLWLNACQTRENSPLQRMELDSSSHTLLASPEGEHTSLQLRQQVW
                     IHHVDLQQNEQSTIALQGNQAYLQLIHGSMVVKGNQNSEALHCGDGAFIKEETTLTLR
                     AESPLRALLIDLVV"
     gene            601850..602746
                     /locus_tag="PC1_RS02570"
                     /old_locus_tag="PC1_0518"
     CDS             601850..602746
                     /locus_tag="PC1_RS02570"
                     /old_locus_tag="PC1_0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012773225.1"
                     /db_xref="GI:502366211"
                     /translation="MAKERALTLEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQK
                     LEEELDVVLFDRSGHRTKFTNVGRMLLERGRILLEAADKLTTDAEALARGWETHLTIV
                     TEALIPTQRLFPLIDKLALKANTQVSILTEVLAGAWERLEQGRADIVIAPDMHFRASS
                     EMNTRKLYTMNNVYVASPEHPIHQEPEPLSDATRVKYRGIAVADTARERPVLTVQLLD
                     KQQRLTVSSLDDKRRALLAGLGVATMPYPMVAQDIAEGRLLVVGPEHQMESQIIMAWR
                     RDSMGEAKSWFLREIPKLLNQP"
     gene            complement(602817..603812)
                     /locus_tag="PC1_RS02575"
                     /old_locus_tag="PC1_0519"
     CDS             complement(602817..603812)
                     /locus_tag="PC1_RS02575"
                     /old_locus_tag="PC1_0519"
                     /EC_number="2.5.1.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773226.1"
                     /db_xref="GI:502366214"
                     /translation="MGQLVDGVWHDTWYETKSTGGHFKRSESVFRNWVTPDGTPGLTG
                     KGGFPAQSGRYHLYVSLACPWAHRTLLMRQLKGLEDHIAVSVVHPLMLDHGWTFGTDF
                     EGATGDSLYQHEFLYQLYLHAKPDYSGRVTVPVLWDTEQHTIVSNESADIIRMLNSAF
                     DGVGATAGDYYPEALRAQIDELNGWIYDKVNNGVYKAGFATSQSAYDESAMTVFAALS
                     DLEAILAKQRYLTGEQLTEADLRLWTTLIRFDPVYHTHFKCDKYRLSDYPNLFGFLRD
                     IYQMPGIADTVDMAHIRHHYYRSHGTINPHGVISLGPEQDLNQPHQRDKTVISLY"
     gene            complement(603921..604316)
                     /locus_tag="PC1_RS02580"
                     /old_locus_tag="PC1_0520"
     CDS             complement(603921..604316)
                     /locus_tag="PC1_RS02580"
                     /old_locus_tag="PC1_0520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773227.1"
                     /db_xref="GI:502366218"
                     /translation="MKNLESTALLIARILMPILFIVAGYGKLGDAYAGTQQYMQAMGV
                     PTFLLPLTILLELGGGLAVLFGLLTRTVALFTAGFTLLTALIFHSNFAEGMNQLMFMK
                     NLTIAGGYLLLAVTGPGAFSIDRLLGKKW"
     gene            complement(604590..604880)
                     /locus_tag="PC1_RS02585"
                     /old_locus_tag="PC1_0521"
     CDS             complement(604590..604880)
                     /locus_tag="PC1_RS02585"
                     /old_locus_tag="PC1_0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_012773228.1"
                     /db_xref="GI:502366221"
                     /translation="MSQRQQRDREKAQLLRRIQQQRLDLSAGKKHWLNTTARYDRGWQ
                     SLMQWRKYWIVGSSLVALYGVRHPSRMIRWGRRLVGLWGTFRLVRKTFDSRS"
     gene            complement(604877..605272)
                     /locus_tag="PC1_RS02590"
                     /old_locus_tag="PC1_0522"
     CDS             complement(604877..605272)
                     /locus_tag="PC1_RS02590"
                     /old_locus_tag="PC1_0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010298856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773229.1"
                     /db_xref="GI:502366225"
                     /translation="MTDKSQQGPASGVMASAQRIISIIVSMVESRVRLAVIELEEEKT
                     NLIQLLMMVGLTLIFATFGIMSLIALIIWGIDPQYRLFALGCITATLLGLALIGGVWT
                     LLKVRRSTLLKATRKELATDRSLLEEDPK"
     gene            complement(605286..605591)
                     /locus_tag="PC1_RS02595"
                     /old_locus_tag="PC1_0523"
     CDS             complement(605286..605591)
                     /locus_tag="PC1_RS02595"
                     /old_locus_tag="PC1_0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773230.1"
                     /db_xref="GI:502366228"
                     /translation="MAKDQNSEYLRAELKSLADTLEEVLSTSSDKSKAELDKLRNKAE
                     SALKETRNRLSDTGERIASHTKEAVESADDYVRQNPWTGVGIGAAVGVVLGVLLSRR"
     gene            complement(605768..606157)
                     /locus_tag="PC1_RS02600"
                     /old_locus_tag="PC1_0524"
     CDS             complement(605768..606157)
                     /locus_tag="PC1_RS02600"
                     /old_locus_tag="PC1_0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773231.1"
                     /db_xref="GI:502366231"
                     /translation="MKLSSSVLALSVLLSGHVLANTANQVETCQQKAQDIQRQIDEAR
                     KHGNQNRINGLEKALDGVKTHCTDAGLAEKRQEAIAEKRKDVAERQQELNESRQKGDD
                     AEKILKRERKLAEAEQELRAAERAASQ"
     gene            complement(606163..606558)
                     /locus_tag="PC1_RS02605"
                     /old_locus_tag="PC1_0525"
     CDS             complement(606163..606558)
                     /locus_tag="PC1_RS02605"
                     /old_locus_tag="PC1_0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="modulator protein MzrA"
                     /protein_id="WP_012773232.1"
                     /db_xref="GI:502366235"
                     /translation="MSIRWLFPKLTPRKVARILILLALPIIALTQSQSLRHSQDDAML
                     HIKPYDGAALPDGFYVYQRLNEKGIAIKSITPEQDSLIVRLASPEQSIAARDVLRLSL
                     PKVTITAQQATTPTPFWQQKLTQKQSKLG"
     gene            complement(606561..607244)
                     /locus_tag="PC1_RS02610"
                     /old_locus_tag="PC1_0526"
     CDS             complement(606561..607244)
                     /locus_tag="PC1_RS02610"
                     /old_locus_tag="PC1_0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773233.1"
                     /db_xref="GI:502366238"
                     /translation="MELIKELLNALWHQDFDILADPKLVWTIYILLFLIIFLENGLLP
                     AAFLPGDSLLILVGVLVAKGTMNYPFTLFLLTTAASLGCWASYIQGRWLGNTSVVQGW
                     LSHLPAHYHQRAHQLFHRHGLSALLVGRFLAFVRTLLPTIAGLSGLNNARFQFFNWMS
                     GFLWVFILVTLGFALGKTTVFLKYEDELMLCLMLLPLALLFIGLFGSLFVLWRKKRDT
                     KASNAEKGS"
     gene            complement(607698..608474)
                     /locus_tag="PC1_RS02615"
                     /old_locus_tag="PC1_0527"
     CDS             complement(607698..608474)
                     /locus_tag="PC1_RS02615"
                     /old_locus_tag="PC1_0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773234.1"
                     /note="regulates the expression of uxuBA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_012773234.1"
                     /db_xref="GI:502366241"
                     /translation="MALTEPRRLYQQLAAELKQRIESGMYQVGEKLPAERYISEEMNV
                     SRTVVREAIIMLEVEGYVEVRKGSGIHVISNQQKNPFINSGDIEFVAAGPFELLQARQ
                     LIESNIAEFAATQVTRQDIIQLMEIQEYARQEDRFRDSQWDLKFHVQVALATQNSAMA
                     TIVEKMWSQRIHNPYWRKLHEHIDDKSIESWCEEHDRILKALIRKDPYAAKLAMWQHL
                     ENTKQMLFRATTDDFEFNVDRYMFAENPVVHLDQIHAGKS"
     gene            complement(608682..609983)
                     /locus_tag="PC1_RS02620"
                     /old_locus_tag="PC1_0528"
     CDS             complement(608682..609983)
                     /locus_tag="PC1_RS02620"
                     /old_locus_tag="PC1_0528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010298866.1"
                     /note="involved in the transport of aldohexuronates;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hexuronate transporter ExuT"
                     /protein_id="WP_012773235.1"
                     /db_xref="GI:502366244"
                     /translation="MRKIKGLRWYMIGLVTIGTVLGYLTRNAISVAAPTLQDQLHITT
                     QQYSYIVAAYSACYTIMQPIAGYVLDLLGTKIGYAMFAILWAVFCMGTALAHSWGGLA
                     IARGAVGMAEAAMIPAGLKASSEWFPAKERSVAVGYFNVGSSIGAMVAPPLVVWAIVA
                     HSWEMAFIITGVLSLIWAICWLVFYKHPKDQKKLSDEERDYILSGQEAQHQTNNAKKM
                     SAWQILRNRQFWGIALPRFLAEPAWGTFNAWIPLFMFKAYGFNLKEIAMFAWMPMLFA
                     DIGCILGGYLPMLFQKYFKVNLIVSRKMVVTMGAVLMIGPGMIGLFTSPYVAIALLCV
                     GGFAHQSLSGALITLSSDVFGRNEVATANGLTGMAAWMASTMFALVVGALADTMGFSP
                     LFAALAVFDLLGAVVIWTVLKNQPASEVAAAAETLKEANQH"
     gene            610400..611809
                     /locus_tag="PC1_RS02625"
                     /old_locus_tag="PC1_0529"
     CDS             610400..611809
                     /locus_tag="PC1_RS02625"
                     /old_locus_tag="PC1_0529"
                     /EC_number="5.3.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DKE7.1"
                     /note="catalyzes the interconversion of D-glucuronate to
                     D-fructuronate or D-galacturonate to D-tagaturonate;
                     functions in glucuronic and galacturonic metabolism;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uronate isomerase"
                     /protein_id="WP_012773236.1"
                     /db_xref="GI:502366247"
                     /translation="MPQFLSEDFLLDSEFARRLYHEYAVDQPIFDYHCHLPPEQIAEN
                     YRFKNLYDIWLKGDHYKWRAMRTNGVPERLCTGDASDWEKFEAWAATVPHTIGNPLYH
                     WTHLELRRPFGVTGTLLSPSTAKDIWDRCNAMLERDDFTARGIMQQMNVKMVGTTDDP
                     IDDLRHHKTVAQDSSFSIKVLPSWRPDKAFNIELATFNDYMAKLGEVSDTDIRRFSDL
                     QAALTKRLDHFAAHGCKVSDHALDVVMFAEADDATLDSILARRLSGETLSEHEVAQFK
                     TGVLVWLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDRPLAQELSRLL
                     SKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQGEGMPGKMQFGSGWWFNDQKDGMQR
                     QMTQLAQLGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVEDGEAPADLPLLG
                     EMVKNISFDNAKNYFAIEL"
     gene            612016..613482
                     /locus_tag="PC1_RS02630"
                     /old_locus_tag="PC1_0530"
     CDS             612016..613482
                     /locus_tag="PC1_RS02630"
                     /old_locus_tag="PC1_0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971340.1"
                     /note="catalyzes the formation of D-tagaturonate from
                     D-altronate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="altronate oxidoreductase"
                     /protein_id="WP_012773237.1"
                     /db_xref="GI:502366250"
                     /translation="MQTLNRRNFPGRQHPDRVIQFGEGNFLRAFVDWQLDLLNEHTDL
                     DAGIVIVRPIDSDFPPALDTQDGLYTTIIRGLNEQGEAVREPRLIRSVNREINVYRQF
                     DEYLALAHDPNIRFVFSNTTEAGISYHADDSLSDAPPVSFPAKLTRLLYERFCHFDGA
                     ADKGWVLLPCELIDYNGVALKELVLRYAAQWKLTPTFTAWLNDHNTFCSTLVDRIVTG
                     YPRAEVEALQQEMGYQDTFWDTAEHFYLFVIQGPQWLAEELRLNKLDLNVRIVDDIKP
                     YKERKVAILNGAHTALVPVAFLAGLDTVGESMDDALIGKFVEKTIAEEIVPVLDLPHD
                     ELTSFAQAVLSRFRNPFIQHQLLSISLNGMTKFRTRILPQLLTYRERHGELPARLTFA
                     LAALIAFYRGERSGEGDTLQTYPLQDDAHWLERYSTLWAGVKENTVSLAELVNVVLRD
                     ADHWEQDLTQVPGLAAQVTEQLQTIVERGMRAAVEGYC"
     gene            613502..614992
                     /locus_tag="PC1_RS02635"
                     /old_locus_tag="PC1_0531"
     CDS             613502..614992
                     /locus_tag="PC1_RS02635"
                     /old_locus_tag="PC1_0531"
                     /EC_number="4.2.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="altronate hydrolase"
                     /protein_id="WP_012773238.1"
                     /db_xref="GI:502366253"
                     /translation="MQSIIKIHSLDNVAVALRDVEQGETVSVDSHTVTLQQPVVRGHK
                     FALETIAPGEMITKYGLPIGHALVSIAPGEHIHSQNAKTNLSDLDEYQYQPEFIDLPP
                     QMGDRDVQLYRRKNGDVGIRNELWILPTVGCVNGIARQIQQRFLKETNDAEGIDGVYL
                     FSHTFGCSQLGQDHENTRTMLQNMVRHPNAGAVLVIGLGCENNQVDAFRTTLGGFDSD
                     RVTFMVCQQQDDEVEAGLERLHTLYEAMRHDKREPGKLSELKFGLECGGSDGLSGITA
                     NPLLGRFSDYLIANGGTTVLTEVPEMFGAERILMSRCRDEATFEKTVHMVNDFKQYFI
                     AHDQPIYENPSPGNKAGGITTLEEKSLGCTQKAGQSKVVDVLKYGERLHTPGLNLLSA
                     PGNDAVATSALAGAGCHMVLFSTGRGTPYGGFVPTVKLATNSELAKKKPHWIDFDAGR
                     LIHDMPMDELLSQFVELIVEIADGKRTKNEVNDFRELAIFKSGVTL"
     gene            615081..615611
                     /locus_tag="PC1_RS02640"
                     /old_locus_tag="PC1_0532"
     CDS             615081..615611
                     /locus_tag="PC1_RS02640"
                     /old_locus_tag="PC1_0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773239.1"
                     /db_xref="GI:502366256"
                     /translation="MTQYWIAQSVGVLAFLVGITMFFNRNDQKFKIQLSAYSAVIGLH
                     FFLMGANAAGASALLNSARTLISLKTHNILVMFVFISLTLLFGLSGMHHAMELLPIAG
                     TVASTWALFRTSGLTTRCVMWCSTACWVVHNIWLGSIGGSLIEGSFLVMNGFNIIRFW
                     RMQQRGIDPFSVEKKA"
     gene            complement(615696..616943)
                     /locus_tag="PC1_RS02645"
                     /old_locus_tag="PC1_0533"
     CDS             complement(615696..616943)
                     /locus_tag="PC1_RS02645"
                     /old_locus_tag="PC1_0533"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DKF1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine transporter SstT"
                     /protein_id="WP_012773240.1"
                     /db_xref="GI:502366259"
                     /translation="METQHSRFLQYITHGSLVKQILLGLAAGIILASLSTQAALAAGL
                     LGTLFVGALKAVAPILVLMLVMASVANHQQGQKTNIRPILFLYLIGTFSAALIAVVLS
                     VLFPSTLALNAQAADITPPSGIVEVLKGLLMSVVANPIHALLNANYIGILVWAVGLGL
                     AFRHGSASTKNLISDASHAVTAIVRVVIRFAPLGIFGLVASTLAETGFGALWGYAHLL
                     MVLIGGMLLVALVINPLIVYWKIRSNPYPLVLRCLRESGVTAFFTRSSAANIPVNMEL
                     CRKLNLNEDSYSVAIPLGATINMAGAAITITVLALAAVHTLGIEVDIATALLLSVVAS
                     ICACGASGVAGGSLLLIPLACSMFGISNDIAMQVVAVGFIIGVLQDSAETALNSSTDV
                     IFTAAVCQAEDAKLAEKERLNLL"
     gene            complement(617230..618183)
                     /locus_tag="PC1_RS02650"
                     /old_locus_tag="PC1_0534"
     CDS             complement(617230..618183)
                     /locus_tag="PC1_RS02650"
                     /old_locus_tag="PC1_0534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773241.1"
                     /db_xref="GI:502366266"
                     /translation="MHSIGTPWLWGSFAAIVIVMLAIDLLYQGRKGSTVMTFKQAAVW
                     SIIWVTLSLLFNAGFWWYLDGTMGREVANAQSLAFLTGYLIEKALAVDNVFVWLMLFG
                     YFAVPPQYQRRVLIYGVLGAIVLRTLMVFGGSWLVTQFQWLLYVFGAFLLFTGLKMAL
                     AKEDDGAIGDKPLVRWLRSRLRMTDTIENEKFFVRRNGILYATPLFLVLIMVEISDVI
                     FAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAMYFLLAGVAERFSLLKYGLAVILIFI
                     GTKMMLIDIFHIPVAISLGVVASILIITMLINVWVNKRAER"
     gene            complement(618456..619454)
                     /locus_tag="PC1_RS02655"
                     /old_locus_tag="PC1_0535"
     CDS             complement(618456..619454)
                     /locus_tag="PC1_RS02655"
                     /old_locus_tag="PC1_0535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_012773242.1"
                     /db_xref="GI:502366268"
                     /translation="MIRFAIVGTSWITRQFVDAAHETGKLKLTAIYSRTAEKAQPFQA
                     DYMVDTRFDSLDAMAKSDLIDAVYLASPNSLHCEQALLFLSHGKHVICEKPLASNRYE
                     VEQMIACARENQVVLFEAFKTASLPNFSVIQQALPKVGRLRKVVLNYCQYSSRYPRYL
                     AGENPNTFNPAFSNGSIMDIGYYCLAFAVALWGEPCTTQASATLLESGVDAHGSVILN
                     YGDFDVTINHSKVSHSTIPSEIQGEDGSLVIEKVSECHNVKFIPREGKQLDLSQPQHI
                     NSMLYEAEVFAALVSDGAINHAELARSRTVAGLLTEIRRQTGVVFPADAATPGNAE"
     gene            619616..620755
                     /locus_tag="PC1_RS02660"
                     /old_locus_tag="PC1_0536"
     CDS             619616..620755
                     /locus_tag="PC1_RS02660"
                     /old_locus_tag="PC1_0536"
                     /EC_number="2.1.1.52"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="WP_012773243.1"
                     /db_xref="GI:502366270"
                     /translation="MSQLELETCNLTLVRYPQVAENSALQAWDAADEYLLRELSTMEI
                     APGPRLIFNDTFGALACGLQAQSPVSISDSYLSQLATRHNLELNGYDANAVTLLDSMA
                     DLPEAPALVVIKIPKTIALLEHQLRMLRKVVTPQTRIIAGAKARDIHTSTLQLFERVM
                     GPTKTSLAWKKARLVHCEWAELKVSEQSLTTEWELDGYGYRIQNHANVYSRNGLDIGA
                     RFFMQHLPEQIDGKIIDLGCGNGVIGLAALKANPEATVGFFDESYMAVASSQVNVEVN
                     CPQDVERCSFVVNHGLARVKRDTLQAVLCNPPFHQQQAVTDEIAWQMFMDARRCLQVG
                     GELRIVGNRHLDYFHKLKRLFGNCETVASNTKFVILRAVKTGSSR"
     gene            complement(620772..622826)
                     /gene="fadH"
                     /locus_tag="PC1_RS02665"
                     /old_locus_tag="PC1_0537"
     CDS             complement(620772..622826)
                     /gene="fadH"
                     /locus_tag="PC1_RS02665"
                     /old_locus_tag="PC1_0537"
                     /EC_number="1.3.1.34"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773244.1"
                     /note="catalyzes the formation of trans-2- enoyl-CoA from
                     2,4-dienoyl-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-dienoyl-CoA reductase"
                     /protein_id="WP_012773244.1"
                     /db_xref="GI:502366273"
                     /translation="MTAYPTLLSPLDLGFTTLKNRVVMGSMHTGLEEHPNGTERLAAF
                     YRERAQGGVGLIVTGGIAPNAKGAVAKGGATLHDEAQLAHHQVLTQAVHDAGGKIALQ
                     ILHAGRYSYQPDPVAPSAIQAPINRFAPREMSTQDIVQTIDDFARCAALAQQAGYDGV
                     EIMGSEGYLINQFLVTHTNHRDDEWGGDFQRRCRFALEIVRAVRKRTGSDFILIYRLS
                     MLDLIEEGSSWQEIVQLAQAIEQAGATLINTGIGWHEARIPTIATLVPRGAFGWVTQK
                     LMGKVRIPLITTNRINDPDVAEKLLAEGCADMVSMARPFLADAELVAKAQSGRSDEIN
                     TCIGCNQACLDQIFAGKVTSCLVNPRACHETELPIHPARVGKRFAVVGAGPAGMAFAV
                     NAAARGHQVTLFESSSYIGGQFNIAKQIPGKAEFYETLRYYRRQLELLGVTLRLSTQA
                     TPTDLLGFDDVILACGIVPRTPEIAGIDHPSVLSYLDVLRDKKPVGKRVAIIGAGGIG
                     FDTAHYLLNKKSVPDGNHRLNPHPSQAGYGDFYAEWGIDTQLQHRGGLLPHQSDELPH
                     PRDITLLQRKTGKPGENLGKTTGWIHRTTLLRHGVTLLGGVEYHHIDDEGLHIIHDQQ
                     MRCLPVDNIIICAGQEPNRTLYDPLLAAGCHVHLIGGADVAQELDARRAIDQATRLAL
                     TL"
     gene            623042..623338
                     /locus_tag="PC1_RS02670"
                     /old_locus_tag="PC1_0538"
     CDS             623042..623338
                     /locus_tag="PC1_RS02670"
                     /old_locus_tag="PC1_0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773245.1"
                     /db_xref="GI:502366275"
                     /translation="MRVEELEYRLDSALRALEQSVQRQQQTWRQEHQSLQQQLLQAKE
                     RDAYLCTQIERLSAQLSSMDSSPERNPLIQKMKVIHAHLDALAQEASAFRRSLR"
     gene            623590..624078
                     /locus_tag="PC1_RS02675"
                     /old_locus_tag="PC1_0539"
     CDS             623590..624078
                     /locus_tag="PC1_RS02675"
                     /old_locus_tag="PC1_0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773246.1"
                     /db_xref="GI:502366278"
                     /translation="MRKLTAMLVASSLALGAAGIAHANEASKGPGPEHKMMMKEGREH
                     RGMMGPDAMFKELNLTEAQKQQVKDIMKESREKMHKAMQDDRREMHSLIASDTFDTAK
                     AQAQLDKADAEHKARMLNGLETKNKIYNVLTPEQKKQYNDNFEKRLTQPPRPDGKPVP
                     AE"
     gene            624281..625750
                     /locus_tag="PC1_RS02680"
                     /old_locus_tag="PC1_0540"
     CDS             624281..625750
                     /locus_tag="PC1_RS02680"
                     /old_locus_tag="PC1_0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_012773247.1"
                     /db_xref="GI:502366281"
                     /translation="MNNDLTLKTIKFMPFLFLTTFIVSCLGFRFRVLDELSLFWPANI
                     LVFCLMISFRARNGTIKGKTLSIGIGFLVSYVAMLSAALWMDNNSPLKTKVLLCLCNM
                     VFVVTAWCAFCLMCRFAGKWSTFEKFSKYYVYIIFASTFVGAFSSGVAYGVYAYVYDT
                     GNRYAEFMDWFSEQLGTGIILAFFFLRGKDILRALRNIPLCPKHIRENIFPFLVFIIF
                     LLVSLFFQDASLITLSVIPLTLCAFNYSFPIMSLLCAITGVILNYLYINQVGILINSN
                     SEAYINSFLTTARLNIAMLIMAMLSVSHFVSMNRRLIKIIESNSLKDALTNTFNRRAF
                     LSMLNGRQGLLMNKRKRQLTLLFLDIDYFKQVNDTYGHASGDELIASFARMLSANIRP
                     SDILCRWGGEEFVIAAYDLTAEQSAAMAETLRHLTESTPLVLSDGREIRFTISIGVVT
                     FPQYEGGNTYDLIGLADEQLYKAKAQGRNRVCLRLVEDI"
     gene            625822..626184
                     /locus_tag="PC1_RS02685"
                     /old_locus_tag="PC1_0541"
     CDS             625822..626184
                     /locus_tag="PC1_RS02685"
                     /old_locus_tag="PC1_0541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773248.1"
                     /db_xref="GI:502366284"
                     /translation="MKKVHLLLTAALLVPFLSFAADSAHSGHGSASESSSSQQAYMKG
                     MDAMHTEMMEGLKSSDPDIAFAKGMIAHHRGAIDMAKTELQYGKDPELRKLAEEIIKA
                     QQPEIDQMEAWLKKQGKQ"
     gene            626503..628431
                     /locus_tag="PC1_RS02690"
                     /old_locus_tag="PC1_0542"
     CDS             626503..628431
                     /locus_tag="PC1_RS02690"
                     /old_locus_tag="PC1_0542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773249.1"
                     /note="phosphoenolpyruvate-dependent sugar
                     phosphotransferase system; catalyzes the phosphorylation
                     of incoming sugar substrates concomitant with their
                     translocation across the cell membrane; IIB is
                     phosphorylated by IIA and then transfers the phosphoryl
                     group to the sugar; IIC forms the translocation channel;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS beta-glucoside transporter subunit IIABC"
                     /protein_id="WP_012773249.1"
                     /db_xref="GI:502366287"
                     /translation="MNSKVLAENILRLVGGETNVSTLVHCATRLRFKIVDHGKVDVAA
                     LEALEGVITVINASGQLQVVIGNRVPEVYRAFGSISKLLEDGDGKRQTAESEQSTSAM
                     GRLIDLVAGIFTPLLGAMAAAGVLKGALAIVLALGWLNTKESTYVILHAASDSLFYFL
                     PMLLAITAARKFETNIFVAVSIAGALVYPTIQGLFDAGQPVTFFGLPVVMMKYTASVI
                     PIIFSVWLMSYIERFLNRHIHESVRNILTPFFLLLLMVPLTLMTIGPIGISASKLIAS
                     VFVSIYEFNPIIAGALMAASWQVLVIFGVHWGFVTVFINDLSVMGHSYLKAASSPSVF
                     AQSGALLGVMVRTKDKKLKALAGSTFIASLFGITEPGVYGVTLKLKKPFICAVIAAAI
                     GGAIVGYAKSSAVSMGMPGLLTLPIFYGEGFVGFLIGCAIAFAASFVLTVIVGFDDPT
                     PPIENTSAPTRSSSTSATPAAPVSRQPANAVPPAQPLKDAPATAEQLGSPVKGELILL
                     EDVDDKVFSSGVVGQGVAILPEEGRIYSPVDGVIASTFSSGHAVGILAQNGAEILIHV
                     GINTVQLEGQHYQMHVAEGDKVQKGQLLLEFDLEAIKQAGYDTVTPMVVTNADEYHLF
                     SPGSARQLRVGDTIIALA"
     gene            complement(628501..629889)
                     /locus_tag="PC1_RS02695"
                     /old_locus_tag="PC1_0543"
     CDS             complement(628501..629889)
                     /locus_tag="PC1_RS02695"
                     /old_locus_tag="PC1_0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="WP_012773250.1"
                     /db_xref="GI:502366290"
                     /translation="MKAFPDGFLWGGSVAANQVEGAWNEDGKGVSTSDLQLKGVHGPV
                     TERDENISCIKDRAIDFYHQYPQDIQLFAEMGFKVLRTSIAWTRIYPEGDEAEPCEAG
                     LAFYDRLFDEMAKHQIQPLITLSHYEMPYGLVKKLGGWGNRAVIDHFEKYARTVFSRY
                     KDKVKYWLTFNEINMALHSPFTGIGLSGEPSKQEIYQAIHHQLVASARAVKACHDLIP
                     DAKIGNMLLGAVRYPMTCHPKDVLEAQNKNREWLFFGDVQVRGTYPAWIQRYFRENGV
                     ELTITAQDKDDLSHTVDFVSFSYYMSGCATFEPEKYQSSRGNIIRLIPNPHLEASEWG
                     WQIDPEGLRFLLNELYDRYQKPLFIVENGLGARDVVEEDGSIHDSYRIDYLRRHLLQV
                     REAIDDGVELLGYTSWGPIDLVSAGTAQMSKRYGFIHVDRDDDGKGTLERRRKDSFYW
                     YQDVINSNGKSL"
     gene            629961..630218
                     /locus_tag="PC1_RS02700"
                     /old_locus_tag="PC1_0544"
     CDS             629961..630218
                     /locus_tag="PC1_RS02700"
                     /old_locus_tag="PC1_0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010298896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773251.1"
                     /db_xref="GI:502366293"
                     /translation="MTGKKKLGQKRVSLLTSAQVSPAIGGNVLSDHYTILNFCGNAPV
                     WLCDSGHDISVGATSALHGRMGGPQGKARALSGFIAMYKKI"
     gene            630271..630774
                     /locus_tag="PC1_RS02705"
                     /old_locus_tag="PC1_0545"
     CDS             630271..630774
                     /locus_tag="PC1_RS02705"
                     /old_locus_tag="PC1_0545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773252.1"
                     /db_xref="GI:502366298"
                     /translation="MHLYMFYLGGNAGKSNIEVHDIQFVAAEKPEDAWPALRDAWFGD
                     PDKVHIDGYARVVWADGYTVTLSDTRPADDNRLFFVNAGAYHPSTLAELHAFDLFVAK
                     SAPEAKSKGLASLLNGALHQHKDNLKDVDDCLLLEKIGDLYIHLTPCATGTPFTPEWQ
                     GYQPIGR"
     gene            631189..635418
                     /locus_tag="PC1_RS02710"
                     /old_locus_tag="PC1_0546"
     CDS             631189..635418
                     /locus_tag="PC1_RS02710"
                     /old_locus_tag="PC1_0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_012773253.1"
                     /db_xref="GI:502366300"
                     /translation="MNAKSSTCVKSVCPYCGVGCGVVMEVKDNRVIKVSGDKTHPTNF
                     GRLCTKGNTSGQALAESGRLEHAYLRADRQHESVRVDVNKAIKETARRLRTIIDTHGP
                     DAVSLYVSGQMSLESQYLANKLAKGFIGTNNIESNSRLCMASAGSGYKLSLGSDGPPG
                     SYQDFDHADVFFVIGANMADCHPILFLRMMDRVKAGAKLIVVDPRRNATADKANLFLH
                     IKPGTDLALLNSLLYLLVQNGHTDPAFIAEFTEGWEAMPAFLDDYHPETVAEITGLPE
                     ADIRKAAEWIGTASAWMSCWTMGLNQSTHGTWNTNAICNLHLATGAICRPGSGPFSLT
                     GQPNAMGGREMGYMGMGLPGQRSVLVEKDRAAIEALWNVPAGTLRTKLGGGTVAMFED
                     MMAGKIKACWIICTNPVATVPNRKNVIAGLQAAELVITQDAFLDTETNRYADILLPGA
                     LWAEAEGVMINSERNLTLMQKAVDPPGEAMADWQIIAKVACEMGYAQGFSYGSAAEVF
                     EEIKQAWNPKTGYDIRGASYERLRQAPLQWPCPPDDDNHRHPVRYLNDGVSQTLKALP
                     DGTRPRLVFATESGKGIFLPRPHMSPAEMPDNDFQFVLNTGRLQHQWHTMTKTGKIPT
                     LNKLNPGPFIEVHPEDASALGIQDKDRVEVRSRRGHAALPAVVTDRVRPGNCFAPFHW
                     NDVFGDDLAINAVTSDAIDPISQQPEFKFCAVALTRIAEPASRISPERESHPAALPVS
                     KQAEVGTPNNDIKELDMKHIDALATLLGLDAPPTLTLSAYEQHYLQGFIAALRTDASR
                     LAGGVPVLPVTAPLEPSRRLMLDGMLAGLFARTWLPDGGITALPTTAPAVPAVAASSP
                     SPILVLWASSTGNAESFAAQCAERLKAEEHTVTLSEMGSVTIADLPAIPRVLFIASTF
                     GDGDPPDNGMNFWMALQAETAPSLTEMAFSVLALGDSNYDQFCGFGRRLDARLEALGA
                     QRLLARIDCEPDYQEAATAWLDSIVNALAGVPAPAANRAVTAAMVTVADEGDADAPVL
                     TAASAPIFSRNAPLPARLVINQRLNAPGAEKETRQFAFDIADSNVSYEAGDALGIWPT
                     NSPELVAEILSALKLSPATVVTVKDKGDMTLAEALSQHVEIARITPEFLQFVSQRSGT
                     SALADLLQEERKEELKQWLWGRQIVDVLQAFPIQVQADELLSVLKRMQPRLYSISSSP
                     KVTPHQIHLTVSTVRYGVEGQSRGGVCSTFLADRAAESGMVPIFIQKSAHFRTPQHPD
                     TPIIMVGAGTGIAPFRAFLQERQATKAQGKNWLFFGEQYAATDFYYREELEKLQRDGY
                     LHRLDTAFSRDQHEKIYVQHRMCEQGAELWRWLEEGAHFYVCGDASRMAKDVDLALRQ
                     VAQAHGGMNSEQAAAYVAKMAQDKRYVRDVY"
     gene            complement(635550..635625)
                     /locus_tag="PC1_RS02715"
                     /old_locus_tag="PC1_R0018"
     tRNA            complement(635550..635625)
                     /locus_tag="PC1_RS02715"
                     /old_locus_tag="PC1_R0018"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(635590..635592),aa:Met,seq:cat)
     gene            635766..636269
                     /locus_tag="PC1_RS02720"
                     /old_locus_tag="PC1_0547"
     CDS             635766..636269
                     /locus_tag="PC1_RS02720"
                     /old_locus_tag="PC1_0547"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DKG5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="G/U mismatch DNA glycosylase"
                     /protein_id="WP_012773254.1"
                     /db_xref="GI:502366301"
                     /translation="MITDILAMNLQVVFCGINPGLSTAHHGYHFANPSNRFWKVIHHV
                     GFTERLLTPAEEQHLLDTGCGITMLVERPTVEATELGRDELLQGGNAIVEKMERYQPR
                     ALAVLGKQAFSQAFGIKKVSWGRQSLNIGETQVWVLPNPSGLNRATLESLVASYQELH
                     QALQDKA"
     gene            complement(636366..638204)
                     /locus_tag="PC1_RS02725"
                     /old_locus_tag="PC1_0548"
     CDS             complement(636366..638204)
                     /locus_tag="PC1_RS02725"
                     /old_locus_tag="PC1_0548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971474.1"
                     /note="sigma factors are initiation factors that promote
                     the attachment of RNA polymerase to specific initiation
                     sites and are then released; this is the primary sigma
                     factor of bacteria; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="WP_012773255.1"
                     /db_xref="GI:502366302"
                     /translation="MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIIDSDQIEDI
                     IQMINDMGIQVMEEAPDADDLLLAENTNDADEDAAEAAAQVLSSVESEIGRTTDPVRM
                     YMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAGESRL
                     SDLITGFVDPNAEEDIAPTATHVGSELSSEEMDDDDEESEDDDDSEDDNSIDPELARE
                     KFTELRDQYETTRKVIKEHGRSHALAVQEILNLSEVFKQFRLVPKQFDFLVNSMRSMM
                     DRVRTQERLIIKLCVEQCKMPKKNFVTMFTGNETNSTWFAAAVAMGKPWSEKLNDVEE
                     DVTRSLQKLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKK
                     YTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIR
                     IPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMET
                     PIGDDEDSHLGDFIEDTTLELPLDSATSESLRSATHDVLAGLTAREAKVLRMRFGIDM
                     NTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
     gene            complement(638359..640113)
                     /gene="dnaG"
                     /locus_tag="PC1_RS02730"
                     /old_locus_tag="PC1_0549"
     CDS             complement(638359..640113)
                     /gene="dnaG"
                     /locus_tag="PC1_RS02730"
                     /old_locus_tag="PC1_0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971476.1"
                     /note="synthesizes RNA primers at the replication forks;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_012773256.1"
                     /db_xref="GI:502366303"
                     /translation="MAGRIPRVFINDLLARTDIVDLIDARVKLKKQGKNYHACCPFHH
                     EKTPSFTVNGDKQFYHCFGCGAHGNAIDFLMNYDRLEFVETIEELATQYGLEVPYESG
                     TGPTQLERHQRQSLYELMGQLSGFYQQALSQSVGTPALQYLQQRGLSAEVISHFAIGF
                     APPGWDNVLKRFGRNNDDRSTLNDAGMLVTNDQGRTYDRFRERVMFPIRDKRGRVIAF
                     GGRVLGDGTPKYLNSPETEIFHKGRQLYGLYEAQQSHAELKRLLVVEGYMDVVALAQF
                     GIDYAVASLGTSTTADHIQLLFRATDLVVCCYDGDRAGREAAWRALETALPYLNDGRQ
                     LRFMFLPDGEDPDTLVRKEGKAVFEQRMEQALPLSQFLFETLQQQVDMSSPDGRTKLS
                     TLALPLIGQVPGETLRLYLRQQLGNKLGILDDSQLDRLLPKVAEQAQPYQPPQLKVTT
                     MRILIGLLVQNPRLAAEVPDLALEGIEEDKVAGLSLFQDLVKTCNASPGMNMGLLLEK
                     YRDSKYRKQLETMASWNHMIVEEELDEKFRISLAELYDQLLKQRQETLIARDRTHGLS
                     AKEKKELWSLQLALTRKH"
     gene            complement(640267..640482)
                     /gene="rpsU"
                     /locus_tag="PC1_RS02735"
                     /old_locus_tag="PC1_0550"
     CDS             complement(640267..640482)
                     /gene="rpsU"
                     /locus_tag="PC1_RS02735"
                     /old_locus_tag="PC1_0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C5BHG0.1"
                     /note="a small basic protein that is one of the last in
                     the subunit assembly; omission does not prevent assembly
                     but the subunit is inactive; binds central domain of 16S
                     rRNA; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="WP_001144069.1"
                     /db_xref="GI:447066813"
                     /translation="MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTE
                     RKRAKASAVKRHAKKLARENARRTRLY"
     gene            640710..641723
                     /locus_tag="PC1_RS02740"
                     /old_locus_tag="PC1_0551"
     CDS             640710..641723
                     /locus_tag="PC1_RS02740"
                     /old_locus_tag="PC1_0551"
                     /EC_number="3.4.24.57"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6D9D3.1"
                     /note="universal genome maintenance protein;
                     Kae1/Qri7/OSGEP/YgjD family protein; in Archaea, some Kae1
                     are found as fusion proteins similar to two distinct
                     proteins in yeast that are involved in the KEOPS complex;
                     kinase associated endopeptidase 1 (Kae1) and a
                     serine/threonine protein kinase (Bud32); in Pyrococcus
                     Kae1 has atypical AP endonuclease activity and inhibits
                     the kinase activity of Bud32; the protein is essential in
                     Escherichia coli and Bacillus subtilis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA N6-adenosine threonylcarbamoyltransferase"
                     /protein_id="WP_012773257.1"
                     /db_xref="GI:502366304"
                     /translation="MRVLGIETSCDETGVAIYDTETGLLANQLYSQVKLHADYGGVVP
                     ELASRDHVRKTVPLIQAALREAGLQAGDIDGVAYTAGPGLVGALLVGATVGRSLAFAW
                     DVPAIPVHHMEGHLLAPMLEDNPPAFPFVALLVSGGHTQLISVTGIGEYRLLGESIDD
                     AAGEAFDKTAKLLGLDYPGGPMLSKMAQAGDSQRFTFPRPMTDRPGLDFSFSGLKTFA
                     ANTIRSNGDDDQTRADIARAFEDAVVDTLAIKCRRALDETGFKRLVMAGGVSANRTLR
                     QCLGDVMAKRGGEVFYARPEFCTDNGAMIAYAGSVRLAHGASQTLGVSVRPRWPLAEL
                     PAV"
     gene            complement(641821..642291)
                     /locus_tag="PC1_RS02745"
                     /old_locus_tag="PC1_0552"
     CDS             complement(641821..642291)
                     /locus_tag="PC1_RS02745"
                     /old_locus_tag="PC1_0552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004093684.1"
                     /note="regulates arginine biosynthesis when complexed with
                     arginine by binding at site that overlap the promotors of
                     the arginine biosynthesis genes; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine repressor"
                     /protein_id="WP_012773258.1"
                     /db_xref="GI:502366305"
                     /translation="MRNSTKQEDLVKAFKALLKEEKFSSQSEIVQALQDEGFENINQS
                     KVSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDVDYNDAVIVIHTSP
                     GAAQLIARLLDSLGKSEGILGTIAGDDTIFTTPARGFSVKQLYEAILVLFEQEL"
     gene            642762..643700
                     /locus_tag="PC1_RS02750"
                     /old_locus_tag="PC1_0553"
     CDS             642762..643700
                     /locus_tag="PC1_RS02750"
                     /old_locus_tag="PC1_0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DKH1.1"
                     /note="oxidizes malate to oxaloacetate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="WP_012773259.1"
                     /db_xref="GI:502366306"
                     /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAV
                     DLSHIPTAVKIKGYSGEDAKPALAGADIVLISAGVARKPGMDRSDLFNVNAGIVRNLV
                     EQIAVTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAE
                     LKGKQPQDINVPVIGGHSGVTILPLLSQVPGISFSEQEVADLTKRIQNAGTEVVEAKA
                     GGGSATLSMGQAAARFGLSLVRALQGESGVVECAYVESDGKHARFFAQPVLLGKDGVV
                     ERKDIGTLSAFEQNALSSMLDTLKQDIELGETFIKN"
     gene            complement(643770..644033)
                     /locus_tag="PC1_RS02755"
                     /old_locus_tag="PC1_0554"
     CDS             complement(643770..644033)
                     /locus_tag="PC1_RS02755"
                     /old_locus_tag="PC1_0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010283012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_012773260.1"
                     /db_xref="GI:502366307"
                     /translation="MILRKQDWHPADIIAALRKKNTTLAAVSRAAGLSSSTLANALSR
                     PWPKGEWLIADALNIHPSEIWPSRYYDPETNELIDRKKLIRPD"
     gene            644221..644607
                     /locus_tag="PC1_RS02760"
                     /old_locus_tag="PC1_0555"
     CDS             644221..644607
                     /locus_tag="PC1_RS02760"
                     /old_locus_tag="PC1_0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010283013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="WP_012773261.1"
                     /db_xref="GI:502366308"
                     /translation="MKKEWFATSELVGVGGLPKSRQGLNKRAREDGWEKRRRKGVQGR
                     GVEYSIHSLPDTVKKSLLLEIEPSAYSAKQPAALAVWMQIYQQLSEKERDELIAYILR
                     VGVSSTLSQLGITPSDEEPISSMEID"
     gene            644855..645229
                     /locus_tag="PC1_RS02765"
                     /old_locus_tag="PC1_0556"
     CDS             644855..645229
                     /locus_tag="PC1_RS02765"
                     /old_locus_tag="PC1_0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="WP_010283015.1"
                     /db_xref="GI:497968859"
                     /translation="MDKEWFATSELVGVGGLPKSPQGLNKRARDDGWEKRRRKGVQGR
                     GVEYSIRSLPNEVRNSLLVKENPPTEYYRIDNEPTLLSSWVHIFHQLSVDERTRLINF
                     ILREGTIAMLSRLDDVTIDQTA"
     gene            complement(645315..646286)
                     /locus_tag="PC1_RS02770"
                     /old_locus_tag="PC1_0557"
     CDS             complement(645315..646286)
                     /locus_tag="PC1_RS02770"
                     /old_locus_tag="PC1_0557"
                     /EC_number="2.5.1.30"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010302542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octaprenyl diphosphate synthase"
                     /protein_id="WP_012773262.1"
                     /db_xref="GI:502366309"
                     /translation="MNLEQITTLTAQDMAAVNNVILEQLNSDVVLINQLGHYIISGGG
                     KRIRPMIAVLAARALDYNGDKHVTVAALIEFIHTATLLHDDVVDESDMRRGKATANAA
                     FGNAASVLVGDFIYTRAFQMMTSLESLRVLALMSEAVNVIAEGEVLQLMNCNDPDITE
                     ESYMRVIYSKTARLFEAAAQSSSILAGATPEQEKALQDYGRYLGTAFQLIDDLLDYSA
                     DGKTLGKNTGDDLNEGKPTLPLLHAMHNGNAEQSSLIRKAIEEGNGRHLLEPVLAAMQ
                     QCGSLDYTRQRAEEEADKAISALQQLPETPYRIALEGLAHLAVQRDF"
     gene            646543..646854
                     /gene="rplU"
                     /locus_tag="PC1_RS02775"
                     /old_locus_tag="PC1_0558"
     CDS             646543..646854
                     /gene="rplU"
                     /locus_tag="PC1_RS02775"
                     /old_locus_tag="PC1_0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4WEZ9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="WP_010283026.1"
                     /db_xref="GI:497968870"
                     /translation="MYAVFQSGGKQHRVSEGQTVRLEKLDIATGEAVEFDQVLMVANG
                     EEIKIGVPFVDGGKIKAEVVAHGRGEKVKIVKFRRRKHYRKQAGHRQWFTDVKITGIS
                     A"
     gene            646874..647131
                     /gene="rpmA"
                     /locus_tag="PC1_RS02780"
                     /old_locus_tag="PC1_0559"
     CDS             646874..647131
                     /gene="rpmA"
                     /locus_tag="PC1_RS02780"
                     /old_locus_tag="PC1_0559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007369914.1"
                     /note="involved in the peptidyltransferase reaction during
                     translation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="WP_012773263.1"
                     /db_xref="GI:502366310"
                     /translation="MAHKKAGGSTRNGRDSNAQRLGVKRFGGESVLAGNIIVRQRGTK
                     FHAGTNVGCGKDHTLFALTDGKVQFEVKGPKNRKYISIVAE"
     gene            647221..648183
                     /locus_tag="PC1_RS02785"
                     /old_locus_tag="PC1_0560"
     CDS             647221..648183
                     /locus_tag="PC1_RS02785"
                     /old_locus_tag="PC1_0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773264.1"
                     /db_xref="GI:502366311"
                     /translation="MNTKQQTGIGLCLALTTAVCWGALPIAMKQVLVVMEPYTIVWYR
                     FIIASIGLGIILSSRKNLPPMRVFRHRRWWVLLLIATAGLLGNFVFFSSSLQYLSPTA
                     SQVIGQLSPVGMMFASVLILKEKMRGTQVIGAIMLICGLILFFNTSLIEIFTRLTDYT
                     LGVLLGVCASAVWVSYGVAQKVLLRRLTSQQILFLLYVLCVVFITPFAKPEVIFQLSG
                     WQLICLLFCGANTLIGYGALAEAMARWQASQVSAVITLTPLFTLLFSDLLALGWPTFF
                     AAPVLNWVGYVGAFVVVAGAMFSAIGHRFLPGKKEPVPPLMVKK"
     gene            648444..649616
                     /gene="obgE"
                     /locus_tag="PC1_RS02790"
                     /old_locus_tag="PC1_0561"
                     /gene_synonym="cgtA; obg; yhbZ"
     CDS             648444..649616
                     /gene="obgE"
                     /locus_tag="PC1_RS02790"
                     /old_locus_tag="PC1_0561"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6D9C3.1"
                     /note="ObgE; essential GTPase; exhibits high exchange rate
                     for GTP/GDP; associates with 50S ribosomal subunit;
                     involved in regulation of chromosomal replication; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase CgtA"
                     /protein_id="WP_012773265.1"
                     /db_xref="GI:502366312"
                     /translation="MKFVDEATILVVAGDGGNGCVSFRREKYIPNGGPDGGDGGDGGD
                     VYLLADENLNTLIDYRFEKSFRAERGQNGQSRDCTGKRGKDITIKVPVGTRVLDQGTG
                     EVLGDMTRHQQSLMVAKGGWHGLGNTRFKSSVNRAPRQKTSGTKGEERELTLELLLLA
                     DVGMLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDSEQSFVVADIPGLI
                     EGASEGAGLGIRFLKHLERCRVLLHLVDLAPIDESDPVENAKIIINELEQYGAGLAEK
                     PRWLVFNKVDLIDKAEAEKRAKEIATALGWEGKYYLISAANREGVTPLCWDVMSFLKA
                     NPKVTAIAESAPEKVEFMWDDYHRQQLAEIEKEAEEEWDDDWDDEDDEGVEIIYQK"
     gene            complement(649687..651120)
                     /locus_tag="PC1_RS02795"
                     /old_locus_tag="PC1_0562"
     CDS             complement(649687..651120)
                     /locus_tag="PC1_RS02795"
                     /old_locus_tag="PC1_0562"
                     /EC_number="3.4.16.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914111.1"
                     /note="penicillin binding protein 4; penicillin sensitive;
                     catalyzes the formation of D-alanine from
                     D-alanyl-D-alanine; one of four, DD-carboxypeptidase
                     low-molecular weight penicillin-binding proteins that
                     remove terminal D-alanine from pentapeptide side chains;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="WP_012773266.1"
                     /db_xref="GI:502366313"
                     /translation="MRFSSIVTGLACAFVLHANAASVEDHRQYLPDGANLALLVQKVG
                     STTPSMAFNSQQMALPASTQKVITALAALLQLGPDYRFVTTMESHGPVTSGILNGNLI
                     VRFSGDPTLKRQQIRNMVQELRKRGIKEIAGDVLIDTSVFASHDKAPGWPWNDMTQCF
                     SAPPGAAIVDRNCFSVSLYSAPKAGDNAFIRVASYYPVQMFSEVRTLAKGSADAQYCE
                     LDVVPGELNRFTLTGCLTQRTEPLPLAFAIQDGASYAGAIVKDELQQADIRIKGSLRR
                     QTQPGAAGSVLAQTQSAPLHDLLTIMLKKSDNMIADTVFRTIGHERFSVPGTWRAGAD
                     AVRQILRQKAGVDLGNSIVVDGSGLSRHNLISPETMMQVLQYIAQHDNELNYITMLPL
                     SGYDGTLRYRGGLHEAGVDGKVSAKTGALQGVYNLAGFITTASGQRMAFVQFLSGYAV
                     PPEDQRARRVPLVRFESRLYKDIYQSN"
     gene            651389..651865
                     /gene="greA"
                     /locus_tag="PC1_RS02800"
                     /old_locus_tag="PC1_0563"
     CDS             651389..651865
                     /gene="greA"
                     /locus_tag="PC1_RS02800"
                     /old_locus_tag="PC1_0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971506.1"
                     /note="necessary for efficient RNA polymerase
                     transcription elongation past template-encoded arresting
                     sites; arresting sites in DNA have the property of
                     trapping a certain fraction of elongating RNA polymerases
                     that pass through, resulting in locked ternary complexes.
                     Cleavage of the nascent transcript by cleavage factors
                     such as GreA or GreB allows the resumption of elongation
                     from the new 3'terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreA"
                     /protein_id="WP_012773267.1"
                     /db_xref="GI:502366314"
                     /translation="MKQFPMTLRGAEKLREELDHLKSVRRPEIIAAIAEAREHGDLKE
                     NAEYHAAREQQGFCEGRIQDIEAKLSNAQVIDVTKMTANGRVIFGATVTVMNLDNEEE
                     QTYRIVGDDEADFKQNLISVNSPIARGLIGKEEDDVVVIRTPGGDVEYEILKVEYL"
     gene            complement(651994..652287)
                     /locus_tag="PC1_RS02805"
                     /old_locus_tag="PC1_0564"
     CDS             complement(651994..652287)
                     /locus_tag="PC1_RS02805"
                     /old_locus_tag="PC1_0564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316313.1"
                     /note="RNA binding protein found associated to pre-50S
                     subunit of the ribosome; putative role in ribosome
                     assembly; necessary for optimal growth but not cell
                     viability; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_010283039.1"
                     /db_xref="GI:497968883"
                     /translation="MNLSNKQKQHLKGLAHPLKPVVMLGNNGLTEGVLAEIEQALAHH
                     ELIKIKVATEDRETKALIVEAIVRETGAANVQVIGHTLVLYRPAKERKIVLPR"
     gene            652431..653060
                     /gene="rrmJ"
                     /locus_tag="PC1_RS02810"
                     /old_locus_tag="PC1_0565"
     CDS             652431..653060
                     /gene="rrmJ"
                     /locus_tag="PC1_RS02810"
                     /old_locus_tag="PC1_0565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971510.1"
                     /note="Specifically methylates the uridine in position
                     2552 of 23S rRNA in the fully assembled 50S ribosomal
                     subunit; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA large subunit methyltransferase E"
                     /protein_id="WP_012773268.1"
                     /db_xref="GI:502366315"
                     /translation="MANKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQ
                     SDKLFKPGMTVVDLGAAPGGWSQYVVTQIGGNGRIIACDILPMDPIVGVDFLQGDFRD
                     ELVLKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPKSMYLVELALGMCRDVLAPGGS
                     FLVKVFQGEGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVATGRKL"
     gene            653117..655057
                     /gene="hflB"
                     /locus_tag="PC1_RS02815"
                     /old_locus_tag="PC1_0566"
                     /gene_synonym="ftsH"
     CDS             653117..655057
                     /gene="hflB"
                     /locus_tag="PC1_RS02815"
                     /old_locus_tag="PC1_0566"
                     /gene_synonym="ftsH"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010302563.1"
                     /note="inner membrane metalloprotease; may be involved in
                     degradation of aberrant cytoplasmic and membrane proteins;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent metalloprotease"
                     /protein_id="WP_043881707.1"
                     /db_xref="GI:762767009"
                     /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNGRRVDYSTFLTEVNQD
                     QVREARINGREISVIKKDSNRYTTYIPVNDPKLLDNLLTKNVKVVGEPPEEPSLLASI
                     FISWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEA
                     KEEVSELVEYLREPSRFQKLGGKIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISG
                     SDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLN
                     QMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVH
                     MRRVPLSPDIDASVIARGTPGFSGADLANLVNEAALFSARGNKRVVSMVEFEKAKDKI
                     MMGAERRSMVMTEKQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLP
                     EGDAISASRQKLESQISTLYGGRLAEEIIYGVEHVSTGASNDIKVATSIARNMVTQWG
                     FSEKLGPLLYAEEEGEVFLGRSVAKAKHMSDETARIIDQEVKSLIERNYVRARELLMA
                     NMDILHSMKDALMKYETIDAPQIDDLMGRKKEVRPPAGWEESRSDNDSGNGGGTPKAP
                     TPVDEPQTPNPGNTLSEQADDK"
     gene            655175..656008
                     /gene="folP"
                     /locus_tag="PC1_RS02820"
                     /old_locus_tag="PC1_0567"
     CDS             655175..656008
                     /gene="folP"
                     /locus_tag="PC1_RS02820"
                     /old_locus_tag="PC1_0567"
                     /EC_number="2.5.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971514.1"
                     /note="catalyzes the formation of dihydropteroate from
                     2-amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine
                     diphosphate and 4-aminobenzoate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="WP_012773270.1"
                     /db_xref="GI:502366317"
                     /translation="MQLVARDSTLDLSCPHVMGILNVTPDSFSDGGKHNKLDAALLHV
                     QEMVTAGATLIDIGGESTRPGADEVSTEEELERVVPVVEAIAQRFDVWISVDTSKPEV
                     MTASALAGAHLINDIRALQEPGALEAAAATGLPVCLMHMQGMPRTMQHKPHYDDLMQD
                     IGNFLQQQIDRCVNANIPKSKLLLDPGFGFGKNLAHNYALLARLSELHRFELPLLVGM
                     SRKSMIGQLLNVPPAQRVHGSVACAVIAAMQGAQIIRVHDVKETADAMRIVEATLSAK
                     E"
     gene            656016..657353
                     /gene="glmM"
                     /locus_tag="PC1_RS02825"
                     /old_locus_tag="PC1_0568"
     CDS             656016..657353
                     /gene="glmM"
                     /locus_tag="PC1_RS02825"
                     /old_locus_tag="PC1_0568"
                     /EC_number="5.4.2.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822537.1"
                     /note="catalyzes the conversion of glucosamine-6-phosphate
                     to glucosamine-1-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="WP_012773271.1"
                     /db_xref="GI:502366318"
                     /translation="MSNRKYFGTDGVRGKVGDTPITPDFVLKLGWAAGKVLARHGSRK
                     IIIGKDTRISGYMLESALEAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISAS
                     HNPYYDNGIKFFSIDGTKLPDEVEEAIEAELEKPLTCVESAELGKASRIVDAAGRYIE
                     FCKGTFPSELSLNGLKIVVDCANGATYHIAPSVLRELGAKVIAIGCEPDGMNINEECG
                     ATDVRQLQARVLAEKADVGLAFDGDGDRLIMVDHLGNKVDGDQILYIIAREGLRQGQL
                     RGGAVGTLMSNMGLEVALKQLGIPFARAKVGDRYVLEMMQAKGWRIGAENSGHVILLD
                     KTTTGDGVIAGLQVLTAIVRNHMSLHDLCSGMKLFPQILVNVRFTGENDPLEDKKVQQ
                     ITQDVEKELAGRGRVLLRKSGTEPLIRVMVEGEHEETVIALANRIADAVKAAG"
     gene            657603..657935
                     /gene="secG"
                     /locus_tag="PC1_RS02830"
                     /old_locus_tag="PC1_0569"
     CDS             657603..657935
                     /gene="secG"
                     /locus_tag="PC1_RS02830"
                     /old_locus_tag="PC1_0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="WP_012773272.1"
                     /db_xref="GI:502366319"
                     /translation="MYEALLVIFLLVSIGLVALIMLQQGKGADMGASFGAGASATLFG
                     SSGSGNFMTRMTAILATLFFIISLVLGNLSSLQKKGGAWDNLNQPEKAEQTTTPAAPS
                     TPASDIPK"
     gene            657960..658046
                     /locus_tag="PC1_RS02835"
                     /old_locus_tag="PC1_R0019"
     tRNA            657960..658046
                     /locus_tag="PC1_RS02835"
                     /old_locus_tag="PC1_R0019"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:657994..657996,aa:Leu,seq:gag)
     gene            complement(658107..659123)
                     /locus_tag="PC1_RS02840"
                     /old_locus_tag="PC1_0570"
     CDS             complement(658107..659123)
                     /locus_tag="PC1_RS02840"
                     /old_locus_tag="PC1_0570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-alkenal reductase"
                     /protein_id="WP_012773273.1"
                     /db_xref="GI:502366320"
                     /translation="MNPLENKLIVLDHHPDGPAQLEHFRFEKRHINALQPGEYLVENK
                     WLSIDLYTRPRLNKNTAYVSPIKQGEVIQGETIGYVVATKNPHFQVGDCVFTFSGWQK
                     YYVGTPQDFITHRLPPTTLSPSIFLSVVGTPGRSAYFGMNKIAKPKAGETLVVSAASG
                     GVGSVVGQLGKQAGCRVVGLAGSEEKCRYVVDTLGFDACINYKEDDLNRALRAACPNG
                     IDIYFENVGGRISLFVAKLLNEGARVPVCGSAAQYNQDPDVDASSTVAFFSSLPDAPL
                     SRFFLVTEWFKDYAEANIWLLDAVEKGRLKYRESIVEGIENAPQAFIDLLDSKHFGKQ
                     LVRL"
     gene            complement(659176..659802)
                     /locus_tag="PC1_RS02845"
                     /old_locus_tag="PC1_0571"
     CDS             complement(659176..659802)
                     /locus_tag="PC1_RS02845"
                     /old_locus_tag="PC1_0571"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773274.1"
                     /db_xref="GI:502366321"
                     /translation="MSHPPSLTVWRYLRSRDALLTIIIPVILYNIAFLQLGAGIALLI
                     TAIYSGVLQLFSRWQGYLPIIALILVSGLSHYLYLEGVMLLGIHQESVFLSISGALST
                     VIIFTIYSIKGRPVIQILAEQATPDLKTLPVYGTPQYVRVWNEVSLVWILVYLVKAII
                     IYLLSLQPGLPMDTLVLISGWPLTLLLVIFSFRWPKHRWTSHAHDNAS"
     gene            complement(659867..663940)
                     /locus_tag="PC1_RS02850"
                     /old_locus_tag="PC1_0572"
     CDS             complement(659867..663940)
                     /locus_tag="PC1_RS02850"
                     /old_locus_tag="PC1_0572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioester reductase"
                     /protein_id="WP_012773275.1"
                     /db_xref="GI:502366322"
                     /translation="MTQLPTAKLTSLSLDELKKLAREKKKTSNTSSGKAITPHATPGR
                     VHFPMTSAQKRIWMLSQYLDDSQVYNNPYVLACRIEHDMEPRRVQQTLDYLMQQHDIL
                     RTTFRLVDNDVCQHIADDMSFPFSFEDISAFSEEDIEKYVSETAIAKGNIVFDLENGP
                     LVYLHMVKTHPYNYVLFLTFHHIISDGWTVNVLFKMLMENYFRLLQGGTLPIEKTLQF
                     ADYALAEDRWYTEGEYQTGLAYWAKKLDGITGQLDLATDYPRPAKMSTAGGIISQFFD
                     SSFCQRLQTCATQHQATQFHVILTAYQLLLHKYSGQQEIIIGAPFANRNLPATQNMMG
                     LFMNTLPLRFDIDPDASIASLIEGVRVECEESMKYQDVPFNYILDEIAYVRNPQINPV
                     FQAMLTYQVFPHFHSNSGFKYKPLKVDYGTAKLDLNLWVEEDKDNDGLLFTMNYSSAL
                     FSSNTIQRMLNDLRTVIETLINQPQLTVRDISLLGDEERRATIAQCRPTANTLPPTVH
                     RQFEQQAQHRPNAIAVRCEGRTLTYAQLNERANQLAHQLQKDGLAHGECVALFMPKSE
                     YYVVAILAVLKAGGCYVPVDMDLPAQQVEFILQNSAARRVIIDEQAPGEMLPCVYVRQ
                     NRSTMPDNNPSQPQPVTDGPAYIIYTSGSTGKPKGVQVKHSQLSHYCQAIRPVLNLSS
                     DARYGMFSSFTTDLAHTVLFPALIHQGQLDVITTELLRSPQELFAYLAHYPVDCIKIT
                     PSHLATLLTSPQAEALLPRQLLVIGGERVPLSLIKRVREFPLPCRILNHYGPTECTVG
                     VTTYPVPEDLSAISGNYLPIGKPLSDSHVLLLDPYHQLVPAGLPGEIYLGGSHVAEGY
                     IGLPEQNHTRFIPHPYLEGERLYRSGDKGRFLPDGNLEFMGRLDRQVKVRGYRVELTE
                     IEQALQQVANATHVAIKQNTLPHGEAVLTAYVCGITDAHQTAVKAALQKKLPDYMQPE
                     RWVWLETMPLTASGKINYAALPLPSAEKRESLHTPENQRERDLHEIYRDILQNDAIDT
                     QESFFTLGGNSLSALKLILNINQHFGTSLSLGQLFENSSIAQLARVIDEKGTQTQAAR
                     VTINRGQPEDKPTLLLVHPAGGNVLCYSALARELGESYPVYGIQVPDFSVNQPYNADI
                     KALAAFYLSQAGDIIHHSRLVLGGWSLGATIAFEMAQQLAAKGITPTVLVLDQPAPEI
                     NIDGSTDMNEAERLAYFAHKVALFTGTSFDLSEQSLADMSNAQRTARFLTEFKRVGLV
                     PESIGPKAFQDFLNILQTHIYATDAYRSEPYSGDVLVVEADDILPGRIRLPESGLGWR
                     RLTSGCLTVLPTSGDHISMMNAPHISRIAEQLKKVLR"
     gene            complement(664019..669520)
                     /locus_tag="PC1_RS02855"
                     /old_locus_tag="PC1_0573"
     CDS             complement(664019..669520)
                     /locus_tag="PC1_RS02855"
                     /old_locus_tag="PC1_0573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010279672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoacyl synthase"
                     /protein_id="WP_012773276.1"
                     /db_xref="GI:502366323"
                     /translation="MKQQEQFRDKDIAIVGMSARFPGAEDTAIFWQNLLDGVETISTF
                     SEEELRESGIEEEMIASPNYIRRRGILGNAQHFDANFFDITPRDAEIMDPQHRVFLEC
                     CWHAFEDAGYVPATYPGKVGIFGGTGTAWHLSKVNAHPEVQKYASGASVVTNNDKDYV
                     TTRVSYKLNLKGPSVNVQTACSTAMVAVVMGMNSLLNGESDLIVAGGVSVDTPERRGY
                     PYMQGGMESADGRCYAFDSRANGTVFSRGAGVVLLKRLNDAVRDGDHIYAVLKGGAVN
                     NDGNLKAGFTAPSIDGQIAVAKQAIANAQLDPATINFVEAHGTATALGDPIEFTSLTQ
                     TFQEYTDKTQYCRLGSVKTNIGHTDAASGMASLIKASLALETGKLPASLHFESPNPNI
                     EFETSPFIMNTELSELEPSETPHRALVNSFGVGGTNACVILEAAPPLNAGDTHNDSLL
                     VLPFSAKSRTALEDMKRRLRDYLSAHDDANLADIAYTLQVGRQKFSHSTAVIGKDRDS
                     LLAKLDQPSLVVTQQGKSKKSVVFMFPGQGNQYVNMARELYDTYDVFRASMDQCCDYL
                     EPILDVNLTSIIFQDSDNIAESRINETQFTQPSLFVVEYSLAKLWMSWGIQPDVMIGH
                     SVGEYVAACLSGVFSLEDALKAVALRGKMVQALPAGDMLAVLLDEESLKAKLHGSKLE
                     IAAVNYPGLCVIAGASNDIARFQQQLEDSNIFCKHLDTSHAFHSHMMEPMLPAFKKVI
                     DSIKLHAPQIPFVSTVNGAWVTEELAKNSDYWVRHVRNPVLFSHAFKTLMAEEHHDFV
                     FLEVGPGRSLESSAKQHFSAEDGALIYASLPTAKDVALSGEHLLSTLGALWASGVDVP
                     WHLHHSEQHRRRIPLPGYPFERKRFALPALSSASPDAQSEQSVKAKKRKQADIGDWFY
                     MPTWKKTIPAKYMAGKRVEAENTCWLILTDTQGIAERTKQILEKDGHQVFFVSPGTQY
                     QETLSEGRYTLNPASRADYVRLLKSLTEQGLRPSRILYLWNLTAEEQVQPLEHTYLSS
                     PLNTFYPALYLQQALVNENLLDDLHITFATSNTFSVMGERIASPENALLVGPSRVFYH
                     EYPEVQCHLVDIDLKQNAVQLDEFAHSLIAESHIATHGNLVAYRGNQRWEESYQAVHL
                     KQDDLGLPAELKDDGVYLITGGLGGLGILLANHLSEKSHATLILTYRAALPPREEWQA
                     WIQQHPVDDPVSEKLASILRLEARGNLIHLAQVDVNDYHGMRDMLSAFPQVDGVFHTA
                     GVAGGGIIPLKNDADCANVLDPKVAGSLILDELLQDKQPDFFILFSSITSIVGDEARI
                     DYCSGNAFMDAFAHYRNQHRRGRTVSLNWGKWGDVGMAVRWGKQLQEKKNSKLAAVEE
                     TKGDLLTYLEREGMQESYQVNLTVQDWVIDEHRLAKQPSLVGATILSLLHEFMTCFKP
                     QESLQVKNLMLTKPVIYTDAWPRQMKLFITPDGKGYKFSLKSRGVLELAWQEHAFGGI
                     GNGAPASDLTPQSIDAIKQRCTTQVPYAPFLTELDNANTGENFLSFSQRWNNHREIVQ
                     GNNEWLIHKVLGNEYTHDLTRYPYHPALIDATAISCLSLITQENFLPISYGKMTFLSP
                     LETECYVHARLKQAYQPQDNAIVMDITFLSPAGVPLLVLENYTLMKMTMGNQLATPEN
                     TTAATAATVKVNLADKDILLPEGVDAIKRQLAHLEFEQLVVVTSDLDQLIYESIPEQE
                     TPEFILQDSEATEGYARPALSVDYVAPENDIEKEIVKVWQSILGISGIGVNDSFTELG
                     GNSLLAVQVVSTVSGIFEIDIRVDLFYQNQTVQGLATLILTELEALLQE"
     gene            complement(669660..669932)
                     /locus_tag="PC1_RS02860"
                     /old_locus_tag="PC1_0574"
     CDS             complement(669660..669932)
                     /locus_tag="PC1_RS02860"
                     /old_locus_tag="PC1_0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773277.1"
                     /db_xref="GI:502366324"
                     /translation="MSANQLNVSSAVKAKVASAIKFVLSHQNSSKPAHYYAIGQKILP
                     YAKKYWGTKSIPAIPVSIKASLQHPSASNLQSLISRVTAGVAGSKK"
     gene            complement(670032..670304)
                     /locus_tag="PC1_RS02865"
                     /old_locus_tag="PC1_0575"
     CDS             complement(670032..670304)
                     /locus_tag="PC1_RS02865"
                     /old_locus_tag="PC1_0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010279676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioester reductase"
                     /protein_id="WP_012773278.1"
                     /db_xref="GI:502366325"
                     /translation="MSNDKAILPSEIEKNIISIWRTVLNNPKVSIQENFFDAGGNSLL
                     MSKVYREIKNKIESPISIVDLFQYPTVQMLSKRISEIHAGKSSSKK"
     gene            complement(670315..671826)
                     /locus_tag="PC1_RS02870"
                     /old_locus_tag="PC1_0576"
     CDS             complement(670315..671826)
                     /locus_tag="PC1_RS02870"
                     /old_locus_tag="PC1_0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide synthetase"
                     /protein_id="WP_012773279.1"
                     /db_xref="GI:502366326"
                     /translation="MASAKVLHTLFEQQWHQTPDAIALRSDTETLTYRQLEQRANAMA
                     SALLQRGVKPKDVVGIYLNKSPNLIVSLLGVLKTGACYLPLDPYYPHERLDYMVNHAN
                     ARLVITDDEHALKLAPGHREIVDLNQLDLSTQSTPALPTVSEEDLCYVMYTSGSTGTP
                     KGVMVSHRTVINYLVWMQNAFGLRHEDVVLNQSTFSFDVSVWEIFWPLIAGASCAVIT
                     EDAKYDPLLLAEFMCRHQVTVAQFVPTALRVIVDAHVLSRCTSLCHIFSGGEALDQTL
                     VNDLSLQYPGKIHNLYGPTEATIFACHWHCQPGAEENIAPIGRPIPHAIAYVLNEAQQ
                     PVNPGESGELYLAGDILAKGYLHAEKLTQERFVDDPFSHPSGQKMYKTGDWVKQRADG
                     VLEFIGRIDSQVKLRGHRIELAEIETHLQALPPINHAAVILETRPENAAPSLSAFYVL
                     RHQQHIDIQEIKAHLAKTLPFFMVPSHFVALEKMPTHPNGKIDKSKLCSYVNN"
     gene            complement(671929..672558)
                     /locus_tag="PC1_RS02875"
                     /old_locus_tag="PC1_0577"
     CDS             complement(671929..672558)
                     /locus_tag="PC1_RS02875"
                     /old_locus_tag="PC1_0577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010299991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773280.1"
                     /db_xref="GI:502366327"
                     /translation="MDSQFIGSVINALPLENMISGPLQAMINAQVQASKAYTDFLLSV
                     CIQNNKAVAIQFDYDETLIDESGVAKGAVTKTMRIPLIAAITHPIISIEEGTIDFELE
                     VTQSESSSDDTGEDGNLAASLGWGAFKVKMAGRVSHKSAQTRATDTRAKYSIHTQVKR
                     QPAPEALMRVIDFLTDAAIRPNIPNGESTSPASENASPPASAEQQEASS"
     gene            672887..675982
                     /locus_tag="PC1_RS02880"
                     /old_locus_tag="PC1_0578"
     CDS             672887..675982
                     /locus_tag="PC1_RS02880"
                     /old_locus_tag="PC1_0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioester reductase"
                     /protein_id="WP_012773281.1"
                     /db_xref="GI:502366329"
                     /translation="MKNRKTVFEIISEWSLKSPDKTAVEFNGDRLNYQQVELRSRLLA
                     DYLLSHYPNNKRGRIAVYLEPGVMMPVVLLAILKAGYTYVPLSHFHPSERIIQILDDS
                     SAFLLISTRSMLNKTAIDKVFSSTLVLEDIHYPAEPVAVLPPVCENDLAYILYTSGST
                     GKPKGVAIEHRNLSYYLNWFNEDVWPETRATLPLTSSLSFAAAVTQLYAPLLRGDTLF
                     ILPADSLNEPDVLLRWHQQHPDGAIYCVPTVWDELLRYQAASAHAWALPKTVFLSGEP
                     VSFDLKERTFQQIPDVRLFNLYGPTETTANCSFAELAPGKGVTLGKALRGSEILIVDE
                     SLRPVAEGEEGEICAFGEGVARGYINRDELTQQRFFTHVRADKSDWGHRTGDLGKRMP
                     DGEIVYLGRIDRQIKINGIRIEPEEIEIVLRQHGDIDKALVRPIQENGRQRLVAYLVS
                     RNPSLATNDLRRFLQDKLPRAMHPSHFIMLETLPKLPNGKLDVSRLPAPCPQRPELGY
                     PVKTAGNELEQELIDIWQEVLGFRELGANDNFFDLGGDSLQAMNARLLIRKRLFSDID
                     YPLFFNNATPHLLAFIVPYYVNDDEPTFDEGTTDIEALTPSSQQRYFLTLDQLSPEPS
                     VYQLAFRLTIGGTLDESAVEWSLGRILEGNPVLRTRFDLDRLQCLEGDYPIEAIPIER
                     LTACSPGGLANTLSDRQLLELVNTPEMDLEHSPLTCFHLVSLTAQRHILLGRVHHTVF
                     DHDAIGLFFNQFIDYVRAYSAGDRSYRVGSEERYLRYRQQQRRTNDQCYPRERQFWLD
                     KMEDYLTAGADATAFPLSESQEGENYWCIFSDTLTQAIKHYAQQHRTTPFVCMLTAFT
                     LLLKTTNYRHVPIGIPVSNRMLADNATTIGCFVNMVTYYDDAPAQESFSTLLARSQNK
                     IHAILDNQTLPYDVLMADVRARGWSDQLRFPVSFNYLTAMPPAVQINETEYQIADIAN
                     HQARLDLTLSVYDDDALTLCFNYQQAAFEAEEIAALSHQYHQILMDIVQPNATSSYGK
                     P"
     gene            complement(676230..676661)
                     /locus_tag="PC1_RS02885"
                     /old_locus_tag="PC1_0579"
     CDS             complement(676230..676661)
                     /locus_tag="PC1_RS02885"
                     /old_locus_tag="PC1_0579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773282.1"
                     /db_xref="GI:502366330"
                     /translation="MDTSQLPIIYDILISDIIASVAGLFGGLSISFFWRPQKLNNYDK
                     FIAALIIIIISISAAFSLVGIIAELLHVNISKMENAIGLGYLVGAISVGLVTLLANFF
                     SYRENNDILDVASEIKQARKGVHLINEAQKKTPDDKTPPAP"
     gene            complement(676718..677179)
                     /locus_tag="PC1_RS02890"
                     /old_locus_tag="PC1_0580"
     CDS             complement(676718..677179)
                     /locus_tag="PC1_RS02890"
                     /old_locus_tag="PC1_0580"
                     /EC_number="3.2.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="muraminidase"
                     /protein_id="WP_012773283.1"
                     /db_xref="GI:502366331"
                     /translation="MANIPETINEAGLSLIKSFEGLKLTKYRDTAGKWTIGYGHLILP
                     NENFDNGITPQEADLLLRQDLKTAENGVQHYVNVDLNGNQFGALTSFTYNLGVNSLKT
                     STLLRLLNQGDYVGAAAQFPRWDKDGEQVVEGLLRRREAEKALFLQSITPN"
     gene            complement(677172..677765)
                     /locus_tag="PC1_RS02895"
                     /old_locus_tag="PC1_0581"
     CDS             complement(677172..677765)
                     /locus_tag="PC1_RS02895"
                     /old_locus_tag="PC1_0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773284.1"
                     /db_xref="GI:502366332"
                     /translation="MSFKNWITGKNKKPDDVDHSQGKNPHSTLNDCATSSKAMTLADI
                     ARGMQHAATAANQFIAHQYQQTLDPFFERGADGALTPKTVSIQLDSRHHIELPLVALS
                     TPRGLMLEKMKVQMTVRTDAVNKDEITSPLDDYNISNFHVSMSPSGKNTKGRNSQHVD
                     IEMQFTALEPPESIMRLIDEYTNLVLPKITQEEKNNG"
     gene            678199..678813
                     /locus_tag="PC1_RS02900"
                     /old_locus_tag="PC1_0582"
     CDS             678199..678813
                     /locus_tag="PC1_RS02900"
                     /old_locus_tag="PC1_0582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010279684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_012773285.1"
                     /db_xref="GI:502366333"
                     /translation="MNVVIIDKSPVFIQGLSVGLNDFIHDVNIVGVKEIDDVWSCLEG
                     MKNAFILLNCNKENGEYSFFLETLHEKYIGVSVIIMVDAIERHILNNYLKHHVMGVVL
                     KTSPVDSIAQALKTVSMGMVCLPDDGVIYEGWSVDNSVKGKLSERQHEVLQLIASGAS
                     NKQISRTLNISAGTVKSHLESIFRRLNVRNRTQAAIVLLEEERR"
     gene            679139..679215
                     /locus_tag="PC1_RS02905"
                     /old_locus_tag="PC1_R0020"
     tRNA            679139..679215
                     /locus_tag="PC1_RS02905"
                     /old_locus_tag="PC1_R0020"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:679173..679175,aa:Met,seq:cat)
     gene            679434..679886
                     /locus_tag="PC1_RS02910"
     CDS             679434..679886
                     /locus_tag="PC1_RS02910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010279686.1"
                     /note="required for the maturation of the 30S ribosomal
                     subunits; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation protein RimP"
                     /protein_id="WP_010279686.1"
                     /db_xref="GI:497965530"
                     /translation="MSTLEQKLTEMISAPVAALGYELVGIEFIRSRQSTLRIYIDSED
                     GITVDDCADVSHQVSAVLDVEDPITVAYNLEVSSPGLERPLFTAAHYLHFVGEEVTVV
                     LRMAVQNRRKWLGVIKAVDGEMITITVEGKDEVFALSNIQKANLVPHF"
     gene            679908..681437
                     /gene="nusA"
                     /locus_tag="PC1_RS02915"
                     /old_locus_tag="PC1_0584"
     CDS             679908..681437
                     /gene="nusA"
                     /locus_tag="PC1_RS02915"
                     /old_locus_tag="PC1_0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971524.1"
                     /note="modifies transcription through interactions with
                     RNA polymerase affecting elongation, readthrough,
                     termination, and antitermination; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor NusA"
                     /protein_id="WP_012773287.1"
                     /db_xref="GI:502366335"
                     /translation="MNKEILAVVEAVSNEKAVPREKIFEALETALATATKKKYEQEID
                     VRVSIDRKTGDFDTFRRWLVVNEVTQPTREITLEAAQFEDSSLDVGGYVEDQIESVTF
                     DRITTQTAKQVIVQKVREAERAMVVDQFREQEGEIITGVVKKVNRDNISLEVRPIDGS
                     NTSAEAVIGREDMLPRENFRPGDRIRGVLYSVRPEARGAQLFVSRSRPEMLVELFRIE
                     VPEIGEEVIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGER
                     IDIILWDDNPAQFVINAMAPADVVSIVVDEDTCTMDIAVESSNLAQAIGRNGQNVRLA
                     SQLLKQHRSDDRWELNVMTVEDLQAKHQAEAHAAIDVFTKHLDIDDEFATVLVEEGFS
                     SLEELAYVPIKELLAIEGLDEETVEALRERAKAALTTLALAHEESLGDGQPAEDLLSL
                     PGLSRELAFKLAAIGVCTLEDLAEQGVDDLTDIEGLNDEQAGELIMAARNICWFGDDN
                     E"
     gene            681463..684162
                     /gene="infB"
                     /locus_tag="PC1_RS02920"
                     /old_locus_tag="PC1_0585"
     CDS             681463..684162
                     /gene="infB"
                     /locus_tag="PC1_RS02920"
                     /old_locus_tag="PC1_0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DKK3.1"
                     /note="Protects formylmethionyl-tRNA from spontaneous
                     hydrolysis and promotes its binding to the 30S ribosomal
                     subunits during initiation of protein synthesis. Also
                     involved in the hydrolysis of GTP during the formation of
                     the 70S ribosomal complex; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_012773288.1"
                     /db_xref="GI:502366336"
                     /translation="MTDVTVKSLAAEIQTPVDRLIQQFADAGMTKSASDAVTQHEKET
                     LLAHLNRDRGNAQGKLTLQRKTRSTLNVPSTGGKSKSVQIEVRKTRTYVKRDPIDAQQ
                     AEEEEQARREAEEQAQRAAEEQAKREAELREAAEKAKRAADEQAKREAAEKAKRDVAE
                     KEKVTNQQNENMTKPAQAEKAKREAEAAELKRKAEEAARLKVEEEARRIAEEARRMAE
                     ENAGRWEAESAKPEESADYHVTTSHHAREAEDENDRQVEGERRSRSRAGKVTKQKKGN
                     RQSESKADREEARAVTRGGKGKRKPSSLQQSFNKPVQAVNRDVVIGETVTVAELANKM
                     AVKGSQVIKVMMKLGAMATINQVIDQETAQLVAEEMGHKVILRRENELEEAVMSDRDT
                     GVAAEARAPVVTIMGHVDHGKTSLLDYIRSTKVAAGEAGGITQHIGAYHVETDNGMIT
                     FLDTPGHAAFTAMRARGAQATDIVVLVVAADDGVMPQTIEAIQHAKAAQVPVVVAVNK
                     IDKPEADPDRVKTELSQYGVMPEEWGGESQFVHVSAKAGTGIDELLDAILLQAEVLEL
                     KAVRSGMANGVVIESFLDKGRGPVATVLVREGTLNKGDIVLCGFEYGRVRAMRDELGR
                     EITSAGPSIPVEILGMSGVPAAGDEATVVRDEKKAREVALYRQGKFREVKLARQQKSK
                     LENMFANMTEGEVSELNIVLKSDVQGSCEAISDSLQKLSTDEVKVKIVGSGVGGITET
                     DATLAAASNAIILGFNVRADASARRIVESESLDLRYYSVIYDLLDEVKQAMSGMLAPE
                     YKQEIIGLAEVRDVFKSPKFGAIAGCMVTEGIVKRHNKIRVLRDNVVIYEGELESLRR
                     FKDDVNEVRNGMECGIGVKNYNDVRPGDMIEVFETIEIKRTIA"
     gene            684237..684635
                     /gene="rbfA"
                     /locus_tag="PC1_RS02925"
                     /old_locus_tag="PC1_0586"
     CDS             684237..684635
                     /gene="rbfA"
                     /locus_tag="PC1_RS02925"
                     /old_locus_tag="PC1_0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DKK4.1"
                     /note="associates with free 30S ribosomal subunits;
                     essential for efficient processing of 16S rRNA; in
                     Escherichia coli rbfA is induced by cold shock; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="WP_012773289.1"
                     /db_xref="GI:502366337"
                     /translation="MAKEFSRTQRVAQEMQKEIAIIIQREVKDPRIGMATVSGVEVSR
                     DLAYAKVFVTFLNDNEPEQVKTALKALQDASGFIRTLVGKAMRLRVVPALTFSYDNSL
                     VEGMRMSNLVTNVVRNDTERRSVTGEDQED"
     gene            684635..685579
                     /gene="truB"
                     /locus_tag="PC1_RS02930"
                     /old_locus_tag="PC1_0587"
     CDS             684635..685579
                     /gene="truB"
                     /locus_tag="PC1_RS02930"
                     /old_locus_tag="PC1_0587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773290.1"
                     /note="catalyzes isomerization of specific uridines in RNA
                     to pseudouridine; responsible for residues in T loops of
                     many tRNAs; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="WP_012773290.1"
                     /db_xref="GI:502366338"
                     /translation="MSRPRRRGRDVHGVLLLDKPQGVSSNDVLQKVKRIFNANRAGHT
                     GALDPLATGMLPICLGEATKFSQYLLDSDKRYRVIARLGQRTDTSDADGNVIEERAIG
                     FSATELEQALEGFRGTTQQVPSMYSALKYQGRKLYEYARQGLTVPREAREITVYELQF
                     IRWEGDELELEIHCSKGTYIRTIIDDLGEKLGCGAHVIYLRRLQVATYPIERMVTLEQ
                     LATLVEQAQAQELSPSLSLDPLLMPMESPVIDFPEVNLTPVVAGYLKLGQPVQAANTP
                     LNGMVRITEGDAHTFIGMGEIDGDGRVAPRRLVVEYPV"
     gene            685701..685970
                     /locus_tag="PC1_RS02935"
                     /old_locus_tag="PC1_0588"
     CDS             685701..685970
                     /locus_tag="PC1_RS02935"
                     /old_locus_tag="PC1_0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004933502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_010279698.1"
                     /db_xref="GI:497965542"
                     /translation="MSLSVEAKAKIVADFGRGTNDSGSTEVQVALLTAQINHLQGHFS
                     EHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTSLIERLGLRR"
     gene            686220..688340
                     /locus_tag="PC1_RS02940"
                     /old_locus_tag="PC1_0589"
     CDS             686220..688340
                     /locus_tag="PC1_RS02940"
                     /old_locus_tag="PC1_0589"
                     /EC_number="2.7.7.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="WP_012773291.1"
                     /db_xref="GI:502366339"
                     /translation="MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTV
                     VGAKNAKPGQSFFPLTVNYQERTYAAGRFPGGFFRREGRPSEGETLISRLIDRPIRPL
                     FPEGFLNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFSGPIGAARVGYLNDQ
                     YVLNPTTDELKESRLDLVVAGTEGAVLMVESEADLLSEDQMLGAVVFGHDQQQVVIEN
                     INALVAEAGKPKWDWHAPEVNVSLEQRVQALSEARLGDAYRITEKQERYAQVDVIKAD
                     VEAALLAEDETLNAGEIQEILGNVEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVL
                     PRTHGSALFTRGETQALVTATLGTERDAQTIDELTGERTDRFLLHYNFPPYSVGETGM
                     VGSPKRREIGHGRLAKRGVLAVMPKASEFPYTVRVVSEITESNGSSSMASVCGASLAL
                     MDAGVPIKSAVAGIAMGLVKEGDNFVVLSDILGDEDHLGDMDFKVAGSREGITALQMD
                     IKIEGITREIMQVALNQAKGARLHILGVMEQAISTPRGDISEFAPRIHTIKISTDKIK
                     DVIGKGGSVIRALTEETGTTIEIEDDGTVKIASTDGEKAKHAIRRIEEITAEIEVGRV
                     YQGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQ
                     GRVRLSIKEATAPTQEAAAPSSEE"
     gene            688481..689365
                     /locus_tag="PC1_RS02945"
                     /old_locus_tag="PC1_0590"
     CDS             688481..689365
                     /locus_tag="PC1_RS02945"
                     /old_locus_tag="PC1_0590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013573825.1"
                     /note="lipoprotein that appears to be involved in cell
                     division; interacts with the periplasmic protease Prc and
                     may be activated by protease processing; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein NlpI"
                     /protein_id="WP_012773292.1"
                     /db_xref="GI:502366340"
                     /translation="MKPFLRWCYVATALMLAGCSNTDWRKDAVLAIPLQPTLQQEVIL
                     ARMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALTIRPDIPEVFNYL
                     GIYLTQAGNFDAAYEAFDSVLELDPTYNYARLNRGIALYYGGRYLLAQDDLLAFYRDD
                     PNDPFRSLWLYLVEREINPETAKVALKKRYDDAKKGPWGWNIVEFYLGGISEKTLMQR
                     LQEEATDNTSLAEHLSETDFYLGKHYLSLGDKNTALALFKLTVANNVHNFVEHRYALL
                     ELALLGQEQDDLSGSDQQ"
     gene            689540..691417
                     /locus_tag="PC1_RS02950"
                     /old_locus_tag="PC1_0591"
     CDS             689540..691417
                     /locus_tag="PC1_RS02950"
                     /old_locus_tag="PC1_0591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773293.1"
                     /note="participates in the assembly of the large subunit
                     of the ribosome; plays a key role in optimal cell growth
                     at low temperature and is required for normal cell
                     division; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA helicase"
                     /protein_id="WP_012773293.1"
                     /db_xref="GI:502366341"
                     /translation="MTDLVTSFADLGLNTSILNALTDLGYEKPSPIQAECIPHLLNGR
                     DVLGMAQTGSGKTAAFSLPLLNNLKPELKAPQILVLAPTRELAVQVAEACNDFSKHMH
                     GVNVVALYGGQRYDVQLRALRQGAQIVVGTPGRLLDHLKRGTLDLSNLSGLVLDEADE
                     MLRMGFIEDVENIMAQIPAEHQTALFSATMPEAIRRITRRFMKDPQEVRIQSSITTRP
                     DISQSYWTVQGMRKNEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAALN
                     GDMNQALREQTLERLKDGRLDILIATDVAARGLDVERISLVVNYDIPMDAESYVHRIG
                     RTGRAGRAGRALLFVENRERRLLRNVERTMKLTIPEVELPNAELLGQRRLAKFAAKVQ
                     QQLESSDLDMYRALLTKLQPQEELDVETLAAALLKMAQGERPLILPPDPVFRPRREFR
                     DRDDSRGDRRRDPRDSRESRDGDRPQRRERRDAGEMELYRIEVGRDDGVEVRHIVGAI
                     ANEGDISSRYIGNIKLFASHSTIELPKGMPGDLLSHFTRTRILNKPMNMQLLGDAQPH
                     ERRGGGRPGGERRDGAAPRRSFGGGERREGNGGERRERSFNRDNRDGASRAPRRRPAD
                     A"
     gene            complement(691528..692535)
                     /locus_tag="PC1_RS02955"
                     /old_locus_tag="PC1_0592"
     CDS             complement(691528..692535)
                     /locus_tag="PC1_RS02955"
                     /old_locus_tag="PC1_0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773294.1"
                     /db_xref="GI:502366342"
                     /translation="MSTPSQAAVFSVLDLAPIPQGATARDAFHRSLDLAQHTEKWGYH
                     RYWLAEHHSMTGIASAATSVLLGYLASGTARIRLGSGGVMLPNHSPLVIAEQFGTLES
                     LYPGRIDLGLGRAPGTDQRTMMALRRHLNADIEDFPRDVQELQRYFADAQPGQPVQAV
                     PGQGLHVPIWLLGSSLYSAQLAARLGLPFAFAAHFAPDMLLEAFRLYREHFIPSATHT
                     KPYAMVCVNVVAAESDRDARFLFTSMQQQFINLRRGTPGPLPAPVENIDTVGSPAEQF
                     GADQALRLSIVGDRAKVRHGLQSLLRETQADEVMINGQIFDHQARLQSFEIAMDVRQT
                     L"
     gene            complement(692701..693579)
                     /locus_tag="PC1_RS02960"
                     /old_locus_tag="PC1_0593"
     CDS             complement(692701..693579)
                     /locus_tag="PC1_RS02960"
                     /old_locus_tag="PC1_0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_012773295.1"
                     /db_xref="GI:502366343"
                     /translation="MKYALGNILYYWPKEDVEAFYQAAVSSSADIVYLGETVCSKRRL
                     MKVADWFNVAREVASSGKQVVISTLALLQAPSELTELKRYVENGEFLLEANDLGAVNI
                     AAERNLPFVAGHALNCYNAYTLRILHKQGMVRWCMPVELSRDWLQNLLNQCEELGFRH
                     QFEVEVLSYGHLPLAYSARCFTARSEDRPKDECETCCLSYPQGRKMLSQENQQVFVLN
                     GIQTQSGYCYNLGNELTSMRDLVDIVRLSPNDISTLAMLDKFRANEQGTAPLALENQA
                     DCNGYWRRVAGLELVP"
     gene            complement(693591..694586)
                     /locus_tag="PC1_RS02965"
                     /old_locus_tag="PC1_0594"
     CDS             complement(693591..694586)
                     /locus_tag="PC1_RS02965"
                     /old_locus_tag="PC1_0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015854999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_012773296.1"
                     /db_xref="GI:502366344"
                     /translation="MELLCPAGNLPALKAAIDNGADAVYIGLKDDTNARHFAGLNFTD
                     KKLQEAREYVHRHRRKLHIAINTFAHPDGYQRWQRAVDMAAQIGADVLILADIAMLEY
                     AAERYPHIERHVSVQASATNTEAIRFYHRHFDVSRIVLPRVLSIHQVKQIARTSPVPL
                     EVFAFGSLCIMAEGRCYLSSYLTGESPNTVGACSPARFVRWQQTENGMESRLNNILID
                     RYQDDENAGYPTLCKGRYLVDGQRYHALEEPTSLNTLELLPELMAANIASVKIEGRQR
                     SPAYVSQITQVWRQAIDRCRANPETFVPTQAWMDALGAVAEGTQTTLGAYHRKWQ"
     gene            694963..695487
                     /locus_tag="PC1_RS02970"
                     /old_locus_tag="PC1_0595"
     CDS             694963..695487
                     /locus_tag="PC1_RS02970"
                     /old_locus_tag="PC1_0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sterol-binding domain-containing protein"
                     /protein_id="WP_012773297.1"
                     /db_xref="GI:502366345"
                     /translation="MLEKLRAQIVRQGPSLLGKPLKFTPFALQRQVLEQMLGWQFRQA
                     LEEGDLAFLESRWLKIEVRDVGLQWFMTLRDGRLVVSHDETPDVSFSADANDLILIAA
                     RKEDPDTLFFQRRLRIEGDTELGLYVKNLMDAIELEAMPAPLRIGLLQLANFVEAGLQ
                     EGVVQTANHAPVSC"
     gene            695481..696023
                     /locus_tag="PC1_RS02975"
                     /old_locus_tag="PC1_0596"
     CDS             695481..696023
                     /locus_tag="PC1_RS02975"
                     /old_locus_tag="PC1_0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_012773298.1"
                     /db_xref="GI:502366346"
                     /translation="MLVRVEIPVDAAGIDSLLRRAFPTGAEADLVHQLREDGLLTLGV
                     VATDDEGGVVGYAAFSPVLIEGEDRQWVALAPLAVDESLRRQGVGEKLVYEGLDALNE
                     FSYTAVVVLGEPAYYSRFGFVPATEHQLHCRWPDSESTFQVYPLADNQVAGENSSEGE
                     SGFEQATGLVEYAEPFNRFL"
     gene            complement(696048..696347)
                     /locus_tag="PC1_RS02980"
                     /old_locus_tag="PC1_0597"
     CDS             complement(696048..696347)
                     /locus_tag="PC1_RS02980"
                     /old_locus_tag="PC1_0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6DKL5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease"
                     /protein_id="WP_012773299.1"
                     /db_xref="GI:502366347"
                     /translation="MTEHIEHPQWYLYILRTITGALYTGITTDVSRRLNQHQTGKGAK
                     ALRGKGELTLVFHCLAGDRSNALKLEYRIKQLSKNQKERLVQDQPQTLCISDTMY"
     gene            696551..698029
                     /locus_tag="PC1_RS02985"
                     /old_locus_tag="PC1_0598"
     CDS             696551..698029
                     /locus_tag="PC1_RS02985"
                     /old_locus_tag="PC1_0598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010279726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_012773300.1"
                     /db_xref="GI:502366348"
                     /translation="MTLKRYIPPALAVAFSSCFLSLGYAAELAEKDRETIVNAVANYS
                     TQMTTVAQQIWSKPELGYLETNTSRLLQDELKAAGFSVEAGVAGIPTAFVATAGKAGG
                     PVIGILAEMDALPGFSQAATPERAPVAGIEAGHACGHHLFGAGSVGAAIALKQWLEAT
                     GKPGQIRVYGTPAEEGGSGKVYMTRAGLFKDVDVMLHWHPGDENSASQDYSLANVNGK
                     FRFYGHSAHAALAPEKGRSALDGVEALNFMVNAMREHVPQETRIHYVITDGGKAPNVV
                     PDFAEVYYYVRHPDPAVVSSVTDRIRKAAEGAALGTETRYEFEILGGVYSLLPNNVLG
                     KVMDDSLRSVGTPQWDKADTDFATALQKTLDQAKLPPLSSAANIAPYHFGQTGYASTD
                     VGDVSWVVPTVGLGTATWVPGVPAHSWQAVASGGMAIGYKGMDVAAKTLAVTGAKLLS
                     DPALIQQAKAEFDKSRGENFHYKPLLGDREPALDYRKPSAGK"
     gene            698564..699343
                     /locus_tag="PC1_RS02990"
                     /old_locus_tag="PC1_0599"
     CDS             698564..699343
                     /locus_tag="PC1_RS02990"
                     /old_locus_tag="PC1_0599"
                     /EC_number="4.1.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773301.1"
                     /note="catalyzes the formation of D-glyceraldehyde
                     3-phosphate and acetaldehyde from
                     2-deoxy-D-ribose-5-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribose-phosphate aldolase"
                     /protein_id="WP_012773301.1"
                     /db_xref="GI:502366349"
                     /translation="MNKLTTAAQRALELMDLTTLNEDDTDEKVAALCRQANSPAGKTA
                     AICIYPRFIPLAKKVLREQGTPDIRIATVTNFPHGNDDVDIAVAETKAAIAYGADEVD
                     VVFPYRALIAGNAQIGFELVQACKAVCQDAHVLLKVIIETGELKQDALIRQASEIAID
                     AGADFIKTSTGKVPVNATPESAAIMLKTIRDKGVGERVGFKAAGGVRNAEDAAIYLQL
                     ADDIMGAEWATALHFRFGASSLLASLLTTLGHAAVAPQGSY"
     gene            699490..700818
                     /locus_tag="PC1_RS02995"
                     /old_locus_tag="PC1_0600"
     CDS             699490..700818
                     /locus_tag="PC1_RS02995"
                     /old_locus_tag="PC1_0600"
                     /EC_number="2.4.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidine phosphorylase"
                     /protein_id="WP_012773302.1"
                     /db_xref="GI:502366350"
                     /translation="MFLIQEIIRKKRDGKALSEEEIRFFINGIRDNTVSEGQIAALAM
                     TIYFHDMSMDERVALTLAMRDSGTVLDWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMV
                     AACGGYVPMISGRGLGHTGGTLDKLEAIPGLDIFPNDDDFRRIIQQVGVAIIGQTSSL
                     APADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYALSE
                     QLAQAIVGVANNAGCRTSALLTDMNQVLASSAGNALEVREAVRFLTGESRNPRLYDVT
                     MALCGEMLLAGGLASSADDAHSRLQAVLDNGKAAEVFGRMVAAQRGPGDFVEHYDRYL
                     PVATLSKPVFATREGIVTAMDTRALGMAVVSLGGGRRQATDTIDYSVGLDSMISLGER
                     VDAQRPLAVIHANTEAQWQQAANDVRAAIQLGDTAPEKTPMVYRRVSAEA"
     gene            700907..702130
                     /locus_tag="PC1_RS03000"
                     /old_locus_tag="PC1_0601"
     CDS             700907..702130
                     /locus_tag="PC1_RS03000"
                     /old_locus_tag="PC1_0601"
                     /EC_number="5.4.2.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6D990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopentomutase"
                     /protein_id="WP_012773303.1"
                     /db_xref="GI:502366351"
                     /translation="MKRAYIMVLDSFGIGSSADAERFGDAGSDTLGHIAQACAAGTAD
                     KGRSGPLHLPNLSRLGLGKAAEASTGTFPAGLDENADIIGAYAHASEISSGKDTPSGH
                     WEIAGVPVLFDWGYFKDEENSFPQDLLDKLVKRANLPGYLGNCHSSGTVILDQLAEEH
                     MKTGKPIFYTSADSVFQIACHEETFGLDKLYELCEIAREELTEGGYNIGRVIARPFIG
                     DKPGHFERTGNRHDLAVEPPAPTILKKMVDEKGGEVVSVGKIADIYAQVGITKKVKAT
                     GIDALFDATLKEMDSAGDNTIVFTNFVDFDSAYGHRRDIPGYAAALELFDRRLPEMLS
                     RVKGDDILILTADHGCDPSWHGTDHTRENVPVLIYGPNVKPGSYGHRETFADIGQTVA
                     AYFGLSPMDYGKSIL"
     gene            702176..702895
                     /gene="deoD"
                     /locus_tag="PC1_RS03005"
                     /old_locus_tag="PC1_0602"
     CDS             702176..702895
                     /gene="deoD"
                     /locus_tag="PC1_RS03005"
                     /old_locus_tag="PC1_0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971563.1"
                     /note="catalyzes the reversible phosphorolysis of
                     ribonucleosides and 2'- deoxyribonucleosides to the free
                     base and (2'-deoxy)ribose-1- phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine nucleoside phosphorylase"
                     /protein_id="WP_012773304.1"
                     /db_xref="GI:502366352"
                     /translation="MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLENAREVNNVR
                     GMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITEFGVKKIIRVGSCGAVREDVKLR
                     DVVIGMGACTDSKVNRMRFKDHDYAAIADFDMVRNAVDAAKARDVSVRVGNIFSADLF
                     YTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALAICTVSDHIRTGAQTTSEER
                     QNTFNEMIEIALESVLLGDNE"
     gene            complement(702948..704696)
                     /locus_tag="PC1_RS03010"
                     /old_locus_tag="PC1_0603"
     CDS             complement(702948..704696)
                     /locus_tag="PC1_RS03010"
                     /old_locus_tag="PC1_0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_043881872.1"
                     /db_xref="GI:762768395"
                     /translation="MQTLKRFYSLVAPFWLTTRATLLWLLLLLIMSLTLSVVWISVQY
                     NNWSRDFYDALADYFQHASIYDMAVRYLAYTLLFVLVIICGNWLKKQLIIRWRDTMTH
                     QYEQDWLRNHAHYQLSAGLDNPDQRIAEDIRLLIEQSLELLLSLLKNTARFFSFIAIL
                     WQLSGVHTFTLSGYTITIHGYLVWIALAYAALASVVTHRLGHRLHKLNIERQRAEADY
                     RATLLRVRDNSEQIAFYQGSDAEQQRMRQHFLPIVQNWQRLMAREFRLESFTTSYFRF
                     SLIIPVFATLPLFLARQVSLGAIMQARSAFGYVLDAFGWFIDAYRQLVQWSSTIERLW
                     EFQQRLRLLPAPETPRHESHALSINALSVPRPDGSPYFAPLTLTLQAGEWAAFSAASG
                     TGKTTLLRALAGLWPVSQGDWHFPAGHTLFLPQKAYLPQDTLRQVLCYPQAQLADIAQ
                     LTAVLEQTGLASLIPRLDDTENWSRVLSGGEQQRLSLARALLLRPTLLCLDEATSQLD
                     DAAALQLLDHIRTVLPRTIVLAVSHQPAVLACFTHQIRLTPLAPEKKIRTENNIVDPS
                     VTVPEADRQQVSYGRI"
     gene            complement(704745..707240)
                     /locus_tag="PC1_RS03015"
                     /old_locus_tag="PC1_0604"
     CDS             complement(704745..707240)
                     /locus_tag="PC1_RS03015"
                     /old_locus_tag="PC1_0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_012773306.1"
                     /db_xref="GI:502366354"
                     /translation="MALIPFFSTQRTPSKLAIAVHLLLCGAPIFAHSTATAAETAAVA
                     ATKTYAIPAGPLNQQLNQFAAQSGVYLVGDAQLATGKTGPSLQGNYSVDGGFSALLAG
                     SGLQVIPQPNGAWRLQRIPQEDEMLVVAGVNRNGVTEGTQSYTTRSMNTATQLNLSPR
                     ETPQSVSVVTRQRMDDQNMTSLDEAMKQTTGINVVNQNSYQVKYESRAFVMDNIKEDG
                     VNFSSQNSVSNMGAVQSSSESPDLAIYDRVEILRGASGLSQGNGEPGGTVNLVRKQPT
                     HNFQASGSVGAGSWDNYRSELDVSGPLNDDASLRGRLVGVYQDKQSFKDYEHSERKVL
                     FGTLAYDLTPSTTVTGGINWQKTRGVPDVYGVPFATDKSSLNLPRSTYLGASWNRIEF
                     EKINPFVELEHHFDNDWTLKTALNYIHSRAASSYIGIINGTSGVNPATGNSVLNNNLR
                     YDNKAEQWGYNLSLNGPFELLGRSHELVVGGDYQKENFDNNHIRINNTSTVNIFNWQP
                     NSLAEPDWSNTSLYNNHYNDRFNLYQRGAFATARFELADDWKLILGGRYSAYSYDEYF
                     TNHLRNTSSLSSLHASNEFVPYGGLLWDFADNYTWYLSYAEIYKPQSEKDRNGNLLPA
                     ITGTNYETGIKGEFFDGDLNTSLALFRIIQENRAMTVANSSVCLIGTSCSQPEGKVQS
                     QGVELDVTGKLAEGWQVQTGYTLTNSKYLEGSASERAAQFSPRTPKHMFKLYTSYNLP
                     GELNQWTIGAGMTAQTETQTYPNRTFGLSQGGYTLFNANVRYQYSKNLSFNLVGNNLT
                     DKTYFLNLNNRHLSGNNYYGDPRNFMLTAKWNF"
     gene            complement(707388..708365)
                     /locus_tag="PC1_RS03020"
                     /old_locus_tag="PC1_0605"
     CDS             complement(707388..708365)
                     /locus_tag="PC1_RS03020"
                     /old_locus_tag="PC1_0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron dicitrate transport regulator FecR"
                     /protein_id="WP_012773307.1"
                     /db_xref="GI:502366355"
                     /translation="MNNPSLNKPSFIALQQASQWYAQLCDREPGDEHYHHWQRWMDES
                     EEHRHAWEFVLTVSQRFQPLRGDGQQPALDTLLHKPASMTRRRALKLAALLSTGTLLS
                     WLTYRHTPLKDSLLAMTADHHSAVGEIKSLTLPDNTRLWLNTASAIDIRYSDQRREIA
                     LLAGDILIETAADARPFFVTTAQGRMQALGTRFSVAQEPEATTLTVYQHAVDASARYA
                     SAARRVNAGYHLRFNADGQGSILPNQQNDADWSHGRLQADNMPLGEVVAQLSRYRHGY
                     LACQPAIADLRVMGTFPLTDTDMALNMLAQAFPVRIHRRFPWWVTVEPR"
     gene            complement(708362..708904)
                     /locus_tag="PC1_RS03025"
                     /old_locus_tag="PC1_0606"
     CDS             complement(708362..708904)
                     /locus_tag="PC1_RS03025"
                     /old_locus_tag="PC1_0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_012773308.1"
                     /db_xref="GI:502366356"
                     /translation="MSSANIDTSADMHQLYCQHHGWLQGLLRKRLGNLCDAADLAQDV
                     FVRLLLKPRQFDSHAGARAYLSVMAQGMCVDLWRKREIERVWLASLAEQPEPVALSAE
                     DSNIILETLYQVDAMLRALPEKVRAAFIMAQVQGRPYRDIAEALGVSERMVKKYMAQA
                     MLHCVLLEAEIDADGQDARS"
     gene            complement(709086..709982)
                     /locus_tag="PC1_RS03030"
                     /old_locus_tag="PC1_0607"
     CDS             complement(709086..709982)
                     /locus_tag="PC1_RS03030"
                     /old_locus_tag="PC1_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012773309.1"
                     /db_xref="GI:502366357"
                     /translation="MDKLSLTLDLDALRSFVTGMEYGSFALAATRLCRSTSAISAQLK
                     KLEQQCGAKLVVKQGRHLVLTHTGEILIGYARRLLALNDEAQRAVKGELLQGEIRIGM
                     QEDFGESLMPGILGEFKRHHPGLRIIARIDRNQALLTALDNNALDMALLWQPENTTRE
                     GRLIDQCQLEWIKHPDLDIKTLLAQGDPLPLVMLESPCLMRSRATTCLDRAGIAWKVV
                     FISHSLSGIWAAVQAGLGITVRTRIGIPNNLHIMGNILPSPGTLGIRLEQRTENQAVH
                     NVQAVLGQLMEKALLNVKLESP"
     gene            710083..710382
                     /locus_tag="PC1_RS03035"
                     /old_locus_tag="PC1_0608"
     CDS             710083..710382
                     /locus_tag="PC1_RS03035"
                     /old_locus_tag="PC1_0608"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773310.1"
                     /db_xref="GI:502366358"
                     /translation="MAKSLDRETLARVAPKLAELSIDTLFNDIWKRETLSPRERSLIT
                     LGALTAQGRVQQLPWHINFAQQNGLTREEIVEVFTHLAFYAGWPAAVSALGCLEE"
     gene            710387..710776
                     /locus_tag="PC1_RS03040"
                     /old_locus_tag="PC1_0609"
     CDS             710387..710776
                     /locus_tag="PC1_RS03040"
                     /old_locus_tag="PC1_0609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="decarboxylase"
                     /protein_id="WP_012773311.1"
                     /db_xref="GI:502366360"
                     /translation="MPFTRITLRQGYSDVQISQISDILQQSLIGEFAVPPADRFQIFE
                     TLPAGQRIFDRHYKSGGRSDDFILFHIFAGKPRTREQKRNFFRMLSERLHGVLNIHPD
                     NVMVIIQFNTADEWSFSNGQMLSEEIL"
     gene            complement(710916..711395)
                     /locus_tag="PC1_RS03045"
                     /old_locus_tag="PC1_0610"
     CDS             complement(710916..711395)
                     /locus_tag="PC1_RS03045"
                     /old_locus_tag="PC1_0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773312.1"
                     /db_xref="GI:502366361"
                     /translation="MKKYTLATTLLCGLFSLSAYAVQITAVTASAYDSDKGHKPANIA
                     DGDVKTRWAANGESWVQLELDKEQSVENFVLVPFKADERKLKFSVSYSTDGKTWKKLA
                     DNLVTSSNAKDGEKFTFPAVKAKFFKLDTFGTDVNKWSAINEISFNSAAQVPAQAIK"
     gene            complement(711597..712040)
                     /gene="rimI"
                     /locus_tag="PC1_RS03050"
                     /old_locus_tag="PC1_0611"
     CDS             complement(711597..712040)
                     /gene="rimI"
                     /locus_tag="PC1_RS03050"
                     /old_locus_tag="PC1_0611"
                     /EC_number="2.3.1.128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914153.1"
                     /note="alanine acetyltransferase that specifically
                     acetylates ribosomal protein S18; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine acetyltransferase"
                     /protein_id="WP_012773313.1"
                     /db_xref="GI:502366362"
                     /translation="MNTISSLTPADLAQAFKIEQASHAFPWTEKTFVSNQGERYFNIK
                     LNHDGQLAAYAITQVVLDEATLFNIAVHPDHQRQGLGRQLLEHLIDEMERRGILTLWL
                     EVRESNARAIALYESLGFNEVSVRRDYYPTAQGREDAILMALPLG"
     gene            complement(712009..712422)
                     /locus_tag="PC1_RS03055"
                     /old_locus_tag="PC1_0612"
     CDS             complement(712009..712422)
                     /locus_tag="PC1_RS03055"
                     /old_locus_tag="PC1_0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773314.1"
                     /note="with the chi subunit binds to single-strand binding
                     (SSB) protein and acts as a bridge between the DnaX clamp
                     loader complex and the SSB; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit psi"
                     /protein_id="WP_012773314.1"
                     /db_xref="GI:502366363"
                     /translation="MESRRDRLLQQLGITQWTLRRPTVLQGEIAVSLPAQVRLVIVSA
                     EPLADDEPLLADVLHSLALTPSQAYRLTPQQIEMLPADVRCHSWRLGIEEPIALQGVQ
                     LSSPLLSELYQNADAKRALWQQICEHEHDIFSDAS"
     gene            712582..713628
                     /locus_tag="PC1_RS03060"
                     /old_locus_tag="PC1_0613"
     CDS             712582..713628
                     /locus_tag="PC1_RS03060"
                     /old_locus_tag="PC1_0613"
                     /EC_number="2.1.1.52"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_012773315.1"
                     /db_xref="GI:502366364"
                     /translation="MSALTPASEVILRHSDEFLSRRVLFAGDLQDTLPAQFEAASVRV
                     HCNQYHHWQQMTKPLGENAQFGLVADAALVADSDTLIYYWPKSKQEAEFQLRNLLSLL
                     PVGAEIFVVGENRSGVRSAETVLSDFVELVKIDSARRCGLYHGRIDKQSSFTLDDWWD
                     EYVTDGVIVKTLPGVFSRDDLDPGSRLLLSTFEPHMKGKVLDIACGAGVLASVLAKQS
                     PKIRLTLSDVSAAAVESSKATLTANALEGEVIASNVYSDINGRFDMIVSNPPFHDGLQ
                     TSLQAAEMLIRGAVTHLPIGGQLRIVANAFLPYPALLDAAFGSHEVLAQTGRFKVYQA
                     TVGRPPRTGSKGRR"
     gene            complement(713637..714629)
                     /locus_tag="PC1_RS03065"
                     /old_locus_tag="PC1_0614"
     CDS             complement(713637..714629)
                     /locus_tag="PC1_RS03065"
                     /old_locus_tag="PC1_0614"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="WP_012773316.1"
                     /db_xref="GI:502366365"
                     /translation="MQQRKLGANGPLVSAIGLGCMGMSDFYSTAQDEKESIATLHRAL
                     ELGVTLLDTADMYGPHTNEQLLGKAIKGKREQVFLATKFGIIRDPANPNARGICGKPD
                     YIRRSVEGSLTRLGTDVIDLYYQHRIDPTVPIEETVGTLAELVQEGKIRYIGLSEASV
                     TTLERAHRVHPITALQSEYSLWTRDMEADILPTCERLGIGFVPYSPLGRGFLTGAIRS
                     PDDLAADDFRRTNPRFSGENFGKNLLLVEKINQLAQEKQVTPSQLALAWVLAQGEHIV
                     PIPGTKRRRYLEENVAALEVTLTQEELAAINAIFPPDAAAGERYGKESMAALNQ"
     gene            714743..715648
                     /locus_tag="PC1_RS03070"
                     /old_locus_tag="PC1_0615"
     CDS             714743..715648
                     /locus_tag="PC1_RS03070"
                     /old_locus_tag="PC1_0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012773317.1"
                     /db_xref="GI:502366366"
                     /translation="MDHIQSMRVFVRIVELGSFSRAAERLALPRATVSNTIKQLEGRL
                     GVRLLQRTTRQVQITDEGRVYYERCLQLLAEIEEIDTLFTQQKQQPVGKVRVDMPHSL
                     ARDIVVPALGDFYARYPQVTLMLSANDAAINVLREGVDCVLRAWQTDDETLATRHLPS
                     MPQITCASADYLARYGVPRSLDDLSGHHMVGYFSLRTEYLYPLEFMSGNERITRMLPS
                     ILQVNGADAYIASACAGLGIIQAPRRGLRPFLESGELVEILPEIPPPAMPLYVMYAPG
                     RFLAPRIRVFIEWLDELFTHSAAAR"
     gene            715752..715838
                     /locus_tag="PC1_RS03075"
                     /old_locus_tag="PC1_R0021"
     tRNA            715752..715838
                     /locus_tag="PC1_RS03075"
                     /old_locus_tag="PC1_R0021"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:715786..715788,aa:Leu,seq:cag)
     gene            715912..715998
                     /locus_tag="PC1_RS03080"
                     /old_locus_tag="PC1_R0022"
     tRNA            715912..715998
                     /locus_tag="PC1_RS03080"
                     /old_locus_tag="PC1_R0022"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:715946..715948,aa:Leu,seq:cag)
     gene            716078..716164
                     /locus_tag="PC1_RS03085"
                     /old_locus_tag="PC1_R0023"
     tRNA            716078..716164
                     /locus_tag="PC1_RS03085"
                     /old_locus_tag="PC1_R0023"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:716112..716114,aa:Leu,seq:cag)
     gene            complement(716286..716576)
                     /locus_tag="PC1_RS03090"
                     /old_locus_tag="PC1_0616"
     CDS             complement(716286..716576)
                     /locus_tag="PC1_RS03090"
                     /old_locus_tag="PC1_0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_043881708.1"
                     /db_xref="GI:762767022"
                     /translation="MLTAMITACGLWSVSWCMGKHLSSAWGVLLPCAIMPLLALLDLN
                     LTHLKVIIAIALLATLVMLFHQRLRHYLLLPSCVALAGGLAALSVMFNLTTL"
     gene            complement(716683..717585)
                     /locus_tag="PC1_RS03095"
                     /old_locus_tag="PC1_0617"
     CDS             complement(716683..717585)
                     /locus_tag="PC1_RS03095"
                     /old_locus_tag="PC1_0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012773319.1"
                     /db_xref="GI:502366368"
                     /translation="MELRYLRYFVAVAQARHFTRAAENLGISQPPLSQQIKKFEQEIG
                     TPLFKRLTRGVEMTEAGQALYEDACRILQLTDSAIARTRSIARGEKGSLNVGFSPSAM
                     YHPTVLSLLHRYCQQHPYVQPQPKEENPATLITALQERNIDIAFLRLPCELSDDINGE
                     ILAEEPMKLVLPAGHALSHKAQVSLSELRQEPLIIFPREVCPGLHDMIIRTCYLSGYG
                     PKPSPFAPQLTATIGMVAAGFGITLIPESLACIKADNVTYHDIGMPEIHTQIAAIWRK
                     HERSAVIVNLIHLIRQHLSSQRSD"
     gene            717714..718496
                     /locus_tag="PC1_RS03100"
                     /old_locus_tag="PC1_0618"
     CDS             717714..718496
                     /locus_tag="PC1_RS03100"
                     /old_locus_tag="PC1_0618"
                     /EC_number="4.1.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-acetolactate decarboxylase"
                     /protein_id="WP_012773320.1"
                     /db_xref="GI:502366369"
                     /translation="MKTNVSEQSCEEAFASYAYDFHRQRADSVIYQTSLMSGLINGVY
                     EGNRTMAELLEHGDFGLGTFNSLDGELVALNSQIFQLLSDGSARAAKPEQKTPFAVMT
                     FFRPTETIRFDRWTSREDVHRQIDEIVGTDNLFCALRIDGNFRCVETRTVPRQCRPYK
                     PMQEAVEGQPTFHFEHRNGSVIGFRSPAYTQGINVAGYHEHFITDDRQGGGHILNYDV
                     EHGTLTFGVVAKLIIDLPQDREFLNADLSSENLNSVIKSVES"
     gene            718518..720197
                     /locus_tag="PC1_RS03105"
                     /old_locus_tag="PC1_0619"
     CDS             718518..720197
                     /locus_tag="PC1_RS03105"
                     /old_locus_tag="PC1_0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914159.1"
                     /note="catalyzes the formation of 2-acetolactate from
                     pyruvate in stationary phase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase"
                     /protein_id="WP_012773321.1"
                     /db_xref="GI:502366370"
                     /translation="MEKSTEQQSWSCGAELIVKHLEAQGVKHIFGIPGAKIDRVFDEL
                     EDSTIQTIPVRHEANGAFMAAAIGRLTGKAGVTLVTSGPGCSNLVTGLATATAEGDAV
                     VALGGAVKRADKLKLTHQSLDTVSLFQPVSKFSAEVTASSAISEVLANAFRAAESGRP
                     GGAFVSLPQDIINEPVSSPVLACPNLPLLNGAPHSDVAEAAKRLREAKNPVLLLGLMA
                     SQQENAEALRRFLHRSQLPVTSTYQAAGVIDQQQFGHFAGRVGLFNNQAGDKLLQQAD
                     VIVTVGYSPIEYDPVLWNSGKATLIHIDVLRAEIDSAYHPDIELLGNIAMTVDALNAC
                     MSEPVILSASTQAVLQDRQRQRHDLSTRAINMAGFAIHPLRLVRAMQDIVNEDVTLCV
                     DMGSFHIWLARYLYSFRARQILMTNGQQTMGVALPWAIAASLIQPGKKVVSVSGDGGF
                     MQSSMELETAVRLKSNLLHIIWVDNGYNMVEIQQIHKYHRPAGVTFGPIDFKAYAEAF
                     GAKGFAVESADELVSKLRQAMDVDGPAVIAIPVDYSDNHWLMGNLNISVLI"
     gene            720332..721795
                     /locus_tag="PC1_RS03110"
                     /old_locus_tag="PC1_0620"
     CDS             720332..721795
                     /locus_tag="PC1_RS03110"
                     /old_locus_tag="PC1_0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773322.1"
                     /db_xref="GI:502366371"
                     /translation="MLKSVRRLIRRGLIVIGVIAMTLLAIRIYDTQSGPPLAPWHTYV
                     PDELSTDELDKSDWAAYLKQETLIFLQVNQHVTQELDEDEQRPVNRYFSGSPVYPGKF
                     QHDWNRSYELSPEGELKGAVVMLHGLTDSPYSLRHIAERYRQRGFFVVGIRLPAHGTV
                     PGALTDVQWEDWLAATRLAVREATSHLTLQQGQRLPLHIVGFSNGGALALKYTLDTLD
                     NPALARPDQLILISPMIGITSYARFAGLAGLPAIFPAFAKSAWLGILPEFNPFKYNSF
                     PVNGARQSWLLTHELQSQLSRKAQANALVDLPPVLTFQSVMDFTVSTRAVITAFYNLL
                     PANGSQLVLFDVNRTVNFGPLLRESTNGAVSQLLPATPRHYDTTVISNAAPNSSHAVA
                     FDVVAGAVQEQTRELGMDYPSDVYSLSHVSLPFPDSDSLYGRFSQNPTEFGLPLGKIT
                     PRGERSALVVDLDTLLRLSSNPFYPYLIQRIEEKIPQ"
     gene            complement(721840..722991)
                     /locus_tag="PC1_RS03115"
                     /old_locus_tag="PC1_0621"
     CDS             complement(721840..722991)
                     /locus_tag="PC1_RS03115"
                     /old_locus_tag="PC1_0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-1,2-propanediol oxidoreductase"
                     /protein_id="WP_012773323.1"
                     /db_xref="GI:502366372"
                     /translation="MANRMILNETSYFGTGAIAHIVDEVKRRGFRKALLVTDKDLVKF
                     GVAAKVTEKLDAAGLPYDIYDEVIPNPTISVVEKGIERFKASQADYLIAIGGGSPQDT
                     CKAIGIIINNPEFADVRSLEGVAATRRPAVPIIAIPTTSGTAAEVTINYVITDEEKRR
                     KFVCVDPHDIPIVAIVDPDMMASMPASLKAATGIDALTHAIEGFTTKAAWELTDTLHL
                     KAIEIISRSLRDSVAGKPKGVEEMALGQYIAGMGFSNVGLGLVHGMAHPLGAFYNTPH
                     GVANAILLPHIMAYNADYTGEKFRNIAIAMGVKNAAAMPIAQAREAAINAVRQLSHDV
                     DIPPRLRDVGVREEDIPALAQAAFDDVCTGGNPRDTNIDEINALYRSIY"
     gene            723554..724669
                     /gene="gcvT"
                     /locus_tag="PC1_RS03120"
                     /old_locus_tag="PC1_0622"
     CDS             723554..724669
                     /gene="gcvT"
                     /locus_tag="PC1_RS03120"
                     /old_locus_tag="PC1_0622"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6D8W9.1"
                     /note="catalyzes the transfer of a methylene carbon from
                     the methylamine-loaded GcvH protein to tetrahydrofolate,
                     causing the release of ammonia and the generation of
                     reduced GcvH protein; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminomethyltransferase"
                     /protein_id="WP_012773324.1"
                     /db_xref="GI:502366373"
                     /translation="MAKQTPLYQQHLADGAKMVDFHGWMMPLHYGSQLDEHHIVRREA
                     GIFDVSHMTIVDLHGARTREFLRYLLANDVAKLTQPGKALYTGMLNASGGVIDDLIVY
                     FLTEDYFRLVVNSATREKDLAWIEQHAAPFGIEIREREDLALVAVQGPQAQEKVQAIL
                     KAKGLSDADVAAVASMKPFFGKQAGDFFVATTGYTGEAGYEIALPNEQVVDFWQQLLA
                     AGVKPCGLGARDTLRLEAGMNLYGQDMDEGISPLAANMGWTIAWQPEDRQFIGREALT
                     HQREKGTDQLVGLVLTEKGVLRNDLPVRFTDSDGVMREGVITSGSFSPTLGVSIALAR
                     VPLGIGEQAIVQIRNRELPVHVTKPGFVRAGKAIVQY"
     gene            724845..725237
                     /locus_tag="PC1_RS03125"
                     /old_locus_tag="PC1_0623"
     CDS             724845..725237
                     /locus_tag="PC1_RS03125"
                     /old_locus_tag="PC1_0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971594.1"
                     /note="part of multienzyme complex composed of H, L, P,
                     and T proteins which catalyzes oxidation of glycine to
                     yield carbon dioxide, ammonia, 5,10-CH2-H4folate and a
                     reduced pyridine nucleotide; protein H is involved in
                     transfer of methylamine group from the P to T protein;
                     covalently bound to a lipoyl cofactor; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein H"
                     /protein_id="WP_012773325.1"
                     /db_xref="GI:502366374"
                     /translation="MSNVPAELKYTTSHEWVLHEGGGIYSVGITEHAQELLGDMVFID
                     LPEVGTVVAAGDDCAVAESVKAASDIYAPISGEIVEVNDDLESSPELVNSAPYADGWL
                     FRIRISDESDLDELLDAEGYQASLEEDE"
     gene            725355..728225
                     /locus_tag="PC1_RS03130"
                     /old_locus_tag="PC1_0624"
     CDS             725355..728225
                     /locus_tag="PC1_RS03130"
                     /old_locus_tag="PC1_0624"
                     /EC_number="1.4.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6D8X1.1"
                     /note="acts in conjunction with GvcH to form
                     H-protein-S-aminomethyldihydrolipoyllysine from glycine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine dehydrogenase (decarboxylating)"
                     /protein_id="WP_012773326.1"
                     /db_xref="GI:502366375"
                     /translation="MTQTLSQLEHDGAFIERHIGPSVSQQQHMLSVVGATSLDALIRQ
                     IVPQDIQLPSPPAVGEAATEHEALSELKAIAGRNQRYKSYIGMGYSAVLMPPVILRNV
                     LENPGWYTAYTPYQPEVSQGRLEALLNFQQVTQDLTGLDLASASLLDEATAAAEAMAM
                     AKRISKLKQAERFFVADDVHPQTLDVVRTRAETFGFEIVVGKAEDALKDDAVFGVLLQ
                     QVGTTGELHDYSDLMAALKARKVVSCVASDIMALVLLTAPGKQGADIVFGSAQRFGVP
                     MGYGGPHAAFFACRDEHKRAMPGRIIGVSRDAAGNTALRMAMQTREQHIRREKANSNI
                     CTSQVLLANIAGMYAVFHGPEGLKRIAGRIHRLTDILAAGLTQGGLLLRHRSWFDTLT
                     IEVADKDAVLSRALSFGINLRSDLASAVGITLDEATTREDVLALFAVLLGDDHGLDIG
                     ALDAAISQQAATIPAGLLRQDAILSHPVFNRYHSETEMMRYLHRLARKDLALNQAMIP
                     LGSCTMKLNAAAEMLPITWPEFAELHPFCPPEQALGYRQMIEQLSGWLVQLTGYDAIC
                     MQPNSGAQGEYAGLLAIRRYHESRNEAGRHLCLIPSSAHGTNPASAQMAGMDVVVVAC
                     DKQGNIDLHDLREKAQAAGEQLSCIMVTYPSTHGVYEETIREVCQIVHQYGGQVYLDG
                     ANMNAQVGITTPGYIGADVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFVPGHQVV
                     KIDGVLTEQGAVSAAPFGSASILPISWMYIRMMGAEGLKQASQMAILNANYIATRLQQ
                     AYPVLYTGRDGRVAHECILDIRPLKESTGISEMDIAKRLIDYGFHAPTMSFPVAGTLM
                     VEPTESESQVEIDRFVDAMLAIRAEINRVAQGEWPLDDNPLVNAPHTQAELVADWAHP
                     YSRELAVFPAGSEHKYWPSVKRLDDVYGDRNLFCSCVPMSDY"
     gene            complement(728363..728737)
                     /locus_tag="PC1_RS03135"
                     /old_locus_tag="PC1_0625"
     CDS             complement(728363..728737)
                     /locus_tag="PC1_RS03135"
                     /old_locus_tag="PC1_0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043881873.1"
                     /db_xref="GI:762768399"
                     /translation="MENFFAKALANYKNNGKVSAYLGKMGGFERSSQSNLSGIYKSHI
                     RIPGEDTPWPESQLLHRRVSDNFLVFAIHNIHPLHIQVIAIIKPDGHEKIKKLLPTII
                     KITESKFQSLNERQLNSLSYYK"
     gene            complement(728767..729366)
                     /locus_tag="PC1_RS03140"
                     /old_locus_tag="PC1_0626"
     CDS             complement(728767..729366)
                     /locus_tag="PC1_RS03140"
                     /old_locus_tag="PC1_0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773328.1"
                     /db_xref="GI:502366377"
                     /translation="MLGLEAMAIVNQGPDKIENVFNNVSQPIERSISDFDRSHRNSVS
                     KKQASDALKVIYRVMTPIERCCEKYKEFIDILSNGNDEDIAALDIQRNDIDKLHEQIN
                     QIDHGITRLLYTFFVAENNKAWLPHLATLMTMKNHAINTFIEYKKLTMGVATLGTQFL
                     PLEYEEAEEFNDEELAAFKKSVEDNHKRLGMEPPAWKTA"
     gene            729603..730475
                     /locus_tag="PC1_RS03145"
                     /old_locus_tag="PC1_0627"
     CDS             729603..730475
                     /locus_tag="PC1_RS03145"
                     /old_locus_tag="PC1_0627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_012773329.1"
                     /db_xref="GI:502366378"
                     /translation="MRAKFFPYLVLLPTLVFLLAFTYFPLLRSVIDSLYDTRLNADAP
                     LFVGMDNFVRLVQDAVFWQALLNNVLYILMTVVPGVLLALLLAVLLWENTRVNRWLRT
                     AFFFPMIIPLVSAATLWLFIFMPGLGLLDYYLAKVFGPMNNNYLGMSDSALVAVSVIG
                     IWKFAGYYMLFFLAGLQAVSASAREAALMEGASRRQVFFYVTLPLLRPTIAFVVTIAF
                     IYAITQIDHVAVMTRGGPNNATTVLLYYIQDLANDTHDLGKASAATFLTLAMLFAFSI
                     MNLKVLEKGAHYER"
     gene            730465..731364
                     /locus_tag="PC1_RS03150"
                     /old_locus_tag="PC1_0628"
     CDS             730465..731364
                     /locus_tag="PC1_RS03150"
                     /old_locus_tag="PC1_0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012773330.1"
                     /db_xref="GI:502366379"
                     /translation="MSAENQIVDVRSMKSQHVENRSVTNPLRITTRFTLPLLLICAAL
                     LWVSPFIWMLSSSVSSSSFGVDMASLLPRFPLTLDNFRDAWDSANWLQLYTNTLIFAV
                     GTFLVQLVTITTAGYIFAYHEFRGKTLLFYLLLIQLMIMPVAMMVPNMMTLKQLGLLN
                     TLTGVMMPYFASAFGVFLMRQAFLNIAKEIEEAALMEGCRWWQVVFHVLIPMTWPSIL
                     AFATVSITYHWNEYLWPLMVLNDPDKQVLTIGLVSFAMGAESGGQWGLICAGTLLVCL
                     PLMVAFVVFQKQFLSSFGFSGIK"
     gene            731402..732226
                     /locus_tag="PC1_RS03155"
                     /old_locus_tag="PC1_0629"
     CDS             731402..732226
                     /locus_tag="PC1_RS03155"
                     /old_locus_tag="PC1_0629"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010307505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3',5'-cyclic-nucleotide phosphodiesterase"
                     /protein_id="WP_012773331.1"
                     /db_xref="GI:502366380"
                     /translation="MLLAQISDLHFRSEGRKLYEFIDINGENAKVINQLNALSERPDA
                     VVISGDIVNCGSPQEYQVAQRVLQMLDYPMYVIPGNHDDKQHFLNAMRPLCPQLGDDP
                     ENIRYAVDDFPMRLLFIDTSLAGQAKGWLTPSTLGWLEQQLQEHSTRETAIFMHHPPL
                     PLGSAHMDRIACENGSELLTLIERFPQLTRIFCGHTHRLIMTQHRQAIIATVPGTVHQ
                     VPYFYYDDTSYYNLEPASVVMHRYVPVTGLVSYSQSIASNSGPYLYDPRISCPVDA"
     gene            732226..733314
                     /locus_tag="PC1_RS03160"
                     /old_locus_tag="PC1_0630"
     CDS             732226..733314
                     /locus_tag="PC1_RS03160"
                     /old_locus_tag="PC1_0630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012773332.1"
                     /db_xref="GI:502366381"
                     /translation="MAVIQLRNISKRFEHTQALASLSLDIADGEFLVLVGPSGCGKST
                     LLRMLAGLEEVSDGQILLGDDDITTWSPKQRNFSMIFQNYALFPHLTVEQNITFGMRM
                     RGEPKADYPQRVQRVASLLQLEPLLKRKPGKLSGGQRQRVAMARAIVRDPHLFLMDEP
                     LSNLDARLRSDVRDGIMDLHRQLKTTTVYVTHDQIEAMTMADRIAVLDRGVLQQVGTP
                     EQLYSHPANVFVAGFIGTPAMNLVTLPCTDGHAILQTLPVALPASEETHSLTHVLLGI
                     RPEHITEHAASDGELSLPGTVKQRELFGAEYLIHVDTPLGNIRYRRPNRDGVPDVGAS
                     VVLHFSPQDCHWFSGQTARNLSQEKRHA"
     gene            733307..734614
                     /locus_tag="PC1_RS03165"
                     /old_locus_tag="PC1_0631"
     CDS             733307..734614
                     /locus_tag="PC1_RS03165"
                     /old_locus_tag="PC1_0631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010279811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012773333.1"
                     /db_xref="GI:502366382"
                     /translation="MRKPRMMALAITLLMSGSALAKQNIDFMFPAPVDGKLTMEMTRI
                     IKEYNQSQDQVEVRGIFTGNYDTTKVKAEAAAKAGDPPALVIMSANFTADLVIKDEIL
                     PMDELFKYGNEKATPFLTKNFWPALHQNAQVMGVTYAIPFHNSTPILYYNEDMLKKAG
                     FNEPPKNWDEVVAVAKKLTDPAKGQWGIMIPSTNDDYGGWMLSALTRANGGAYYNADY
                     PGEVYYNTASTKGALQFWRDLVYRDKVMPAGVLNSKQISAAFFSGKLGMTMLSTGALG
                     FMRENTKDFQLGVAMMPEKERRGVTIGGASLVSFKGISEEQKKAAWQFMNYLVSPEVS
                     GNWSRFTGYFAPRMAAYDLPEMKDYLAKDPRAAIALSQLQYAHPWYATYETVAVRKAM
                     ENQLAALLNDPAKKVDDAAAAAQKEADGIMKPYVDKTALRDVK"
     gene            complement(734661..735923)
                     /gene="lacY"
                     /locus_tag="PC1_RS03170"
                     /old_locus_tag="PC1_0632"
     CDS             complement(734661..735923)
                     /gene="lacY"
                     /locus_tag="PC1_RS03170"
                     /old_locus_tag="PC1_0632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773334.1"
                     /note="lactose/proton symporter; mediates lactose/proton
                     symport through the membrane by utilizing the proton
                     gradient to drive transport of galactosides; member of
                     major facilitator superfamily; functions as a monomer with
                     12 transmembrane segments; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligosaccharide/H+ symporter"
                     /protein_id="WP_012773334.1"
                     /db_xref="GI:502366383"
                     /translation="MPTTSCYYKNNRNFWIFGAFFFLYFFIMATCFPFLPIWLADVIG
                     LNKTNTGIVFSFLSLFAILFQPFLGILSDKLGMKKHLLWVISVLLLFFAPFFLYVFAP
                     LLKINVILGALVGGLYIGFSFSAGAGAIEAYIERISRQHHFEYGKARMFGCFGWGICA
                     STAGMLFNINPDIVFWMGSGSAIILIVLLCLAKTESNPTAAVMDSLGANASPFSVKLA
                     LGLLANRQFWLLVLYVIGVACIYDVYDQQFANFFKSFFSSQEQGNQIFGFVTTAGEAA
                     NALVMFCTPWLINRIGAKNALLVAGTIMSIRILGSACATSVTEVIILKMLHAFEVPLL
                     LIGIFKYIANTFDSRLSATIYLVGFQFAKQFMAIFLSSAAGNLYDRIGFNQTYLILGG
                     IALTFTAISAFTLSSSRSTASMRSQAVH"
     gene            complement(736017..738161)
                     /locus_tag="PC1_RS03175"
                     /old_locus_tag="PC1_0633"
     CDS             complement(736017..738161)
                     /locus_tag="PC1_RS03175"
                     /old_locus_tag="PC1_0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="WP_012773335.1"
                     /db_xref="GI:502366384"
                     /translation="MMRDLVQLTSAQCDVIVRCAPAAEILYWGPRLRGFSPEDIVSLQ
                     RPVANGRLDVDLPLTLAMEYGRGQFGSPGIEGHRSGYDAAPIFTTTQADVQGNTLTIT
                     AEDTLAGLRLTSELRLDPQTDVLQLRHTLQNLRADVWQVQRLAVTLPVPERASDVMAF
                     HGRWLREFQTHRLTLQHGGFIQESRRGRSSHEYFPAFILGESAFNEQHGSVWGVHLGW
                     SGNHRLRADIKTDGRRVVQAEALYLPGEITLTQSESLTTPWVYAAFSDSGLNGMSQRY
                     HAFLRQSLIQFCGDKPRPVHLNTWEGIYFDHDPEYIMQMASKAADVGVERFIIDDGWF
                     RGRHHDRAALGDWYLDEEKYPNGLMPVIDHVKALGMEFGIWVEPEMINPDSDLFRAHP
                     DWVLQLPGYAQPTGRYQYVLNLNQPDAFTYLLERLSWLLGEHPVDYVKWDMNRELVQP
                     GHEGRLAADAQTRQFYRLLDTLRQRFPHVEFESCASGGGRIDYGVLERTQRFWVSDNN
                     DALERQTIQRGMSYFFPPEVMGQHIGHARCHATYRRHTIAFRGLTALFGHMGIELDPV
                     KADDDELEGYRHYIQLHKTLRPLLHSGTTWRVDMADDTVQATGVVSHDRQHAVFQVAQ
                     LRMPDYSLAGTLRFPGLQPDVRYEVTLLDGPEIKTVREGGGTMRELPPWLRQPIVISG
                     DWLMQAGLALPVLTPETAILIGLSAVTDTAGS"
     gene            complement(738377..739381)
                     /locus_tag="PC1_RS03180"
                     /old_locus_tag="PC1_0634"
     CDS             complement(738377..739381)
                     /locus_tag="PC1_RS03180"
                     /old_locus_tag="PC1_0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010301796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012773336.1"
                     /db_xref="GI:502366385"
                     /translation="MSLKTIANNLGLSVAAVSRALNGHRDISDATRQRIQEEAERIGY
                     RPNTHARRLKMGKSNAVGMVYPYASSLSNDIFFEMIGAISHKLAQHEVDFLLLADEQD
                     ACQGAARLIASHRIDALIVAHTCEQDARLALLQRHNAPFLALGRSQLPHPYAWFDFDN
                     RAGMALATEHLIALGHRRIAILTEDHPQAFIMQRRQGYRDALQRHNLPFHDAYLCCVS
                     PTRRAGYQAMIDLLALPEPPTAIVMDGNVHGDGAVAALQQAGRLSGSHPIALVMYDGL
                     PQDSLTDLNVTAIEQATREQVGEQIASMTQALIAGEAVENLQVLWQPTLRIGKTSFPA
                     "
     gene            complement(739425..740033)
                     /locus_tag="PC1_RS03185"
                     /old_locus_tag="PC1_0635"
     CDS             complement(739425..740033)
                     /locus_tag="PC1_RS03185"
                     /old_locus_tag="PC1_0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_012773337.1"
                     /db_xref="GI:502366386"
                     /translation="MSSSPSTLNFGSMTDVFGFLIEIDKLKSVQRRNKIIGSERHEDS
                     AEHSWHFSVAAMALAPYAGEGVDIQRVIQMALIHDIVEIDAGDVIVYDLSARLAIHDQ
                     EVAAAARIFGLLPEPQRQQFHDLWEEYEANETPSAQFAMVLDRVMPMLMNLSNAGQSW
                     VENGIRLEQVLERAEFIAAINPELWQYLKQHLEEAKAKGWLL"
     gene            740446..741093
                     /locus_tag="PC1_RS03190"
                     /old_locus_tag="PC1_0636"
     CDS             740446..741093
                     /locus_tag="PC1_RS03190"
                     /old_locus_tag="PC1_0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="WP_012773338.1"
                     /db_xref="GI:502366387"
                     /translation="MSKNAQMPDYSLAEEIANSISHGIGVIFGIVGLVLLLVQAVNND
                     AGSVAITSYSLYGGSIILLFLASTLYHAIPSQRIKPWLKKFDHCAIYLLIAGTYTPFL
                     LVGLDSPLAHGLMVVIWGMALLGVIFKLAFAHRFEVLSLITYLVMGWLSLVVIYQMVM
                     KLAPGSVTLLAVGGVVYTLGVIFYACKRIPYNHAIWHGFVLGGSVCHFLAIYLYI"
     gene            complement(741148..742149)
                     /gene="ygfZ"
                     /locus_tag="PC1_RS03195"
                     /old_locus_tag="PC1_0637"
     CDS             complement(741148..742149)
                     /gene="ygfZ"
                     /locus_tag="PC1_RS03195"
                     /old_locus_tag="PC1_0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914175.1"
                     /note="physiological role is not clear; not essential for
                     growth but mutants grow poorly; mutations suppress hda
                     null mutations; may be involved in regulation of ATP-DnaA
                     levels; may also be involved in regulation of tRNA
                     modifications; can bind folic acid and tetrahydrofolate;
                     forms a three domain ring-like structure with a central
                     channel; structurally similar to DMGO protein from A.
                     globiformis; shows sequence similarity to yeast CAF17
                     transcriptional regulato; Hda supressor; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-modifying protein YgfZ"
                     /protein_id="WP_012773339.1"
                     /db_xref="GI:502366388"
                     /translation="MVNQHTAHQLPFASQPPLASAQLAPTLISLDDWALATMVGPDTV
                     KYLQGQVTADVSALADDRHILCAHCDAKGKMWSNLRLFHHGEGFAFIERRNLRDAQLS
                     ELKKYAVFSKTTIAPDDNAVLLGAAGAGIRELLASAFSQLPDADHPVVQHEGATLLHF
                     AHPAERFLLVLSPEQSASLLEQLGDKVSLNDSRQWLTLDIEAGQPIIDSANSAQFIPQ
                     ATNLQALNGISFSKGCYTGQEMVARAKYRGANKRALYWLAGKANQVPQAGDDLELQLG
                     ENWRRTGTVLAASQLQNGEVWVQAVLNNDLTAENVLRVREDADSQITVQPLPYEITD"
     gene            742385..742651
                     /locus_tag="PC1_RS03200"
                     /old_locus_tag="PC1_0638"
     CDS             742385..742651
                     /locus_tag="PC1_RS03200"
                     /old_locus_tag="PC1_0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6D960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773340.1"
                     /db_xref="GI:502366389"
                     /translation="MEIDNKSRIHWACRRGMRELDIAIMPFFEHDYDTLSDSDKRTFV
                     RLLQSDDPDLFNWLMNHGEPKDGELKRMISLIQTRNKDRGPVAM"
     gene            742671..743045
                     /locus_tag="PC1_RS03205"
                     /old_locus_tag="PC1_0639"
     CDS             742671..743045
                     /locus_tag="PC1_RS03205"
                     /old_locus_tag="PC1_0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_043881709.1"
                     /db_xref="GI:762767024"
                     /translation="MQLLSLIVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQ
                     RNIKSRQGEIVLLSETTLNWRQQEWQIVKRPWLLKNGVLLSLQAVNGKDRQQLWLASD
                     SMGDDEWRHLRQLLLQQKNWAR"
     gene            743115..744050
                     /locus_tag="PC1_RS03210"
                     /old_locus_tag="PC1_0640"
     CDS             743115..744050
                     /locus_tag="PC1_RS03210"
                     /old_locus_tag="PC1_0640"
                     /EC_number="2.1.1.48"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010301818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA large subunit methyltransferase F"
                     /protein_id="WP_012773342.1"
                     /db_xref="GI:502366391"
                     /translation="MTKPAVQKNGLHPRNRHRDRYDFPTLKHSYPALIPFVTVNAYGD
                     ESVDFANPEAVKTLNQALLQHFYQIEHWEIPDGFLCPPIPGRADYIHHLADLLAEDNR
                     AVVPREASVLDIGCGANCIYPLIGYREYGWRFTGSEINPIAMKAANQTIEANPGLNRA
                     IRLRRQKSSTAILAGIIHKNETFDAVMCNPPFHASAEDARQGSQRKLHNLGLDKRSPL
                     NFGGQQDELWCEGGESAFIGQMIKESAGFARQCLWFTSLVSRKENLPEIYRALEAVDA
                     EKVRTIDMAQGQKQSRFVAWSFLDTAARTRWLQKR"
     gene            complement(744095..744418)
                     /locus_tag="PC1_RS03215"
                     /old_locus_tag="PC1_0641"
     CDS             complement(744095..744418)
                     /locus_tag="PC1_RS03215"
                     /old_locus_tag="PC1_0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010279849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773343.1"
                     /db_xref="GI:502366392"
                     /translation="MKMLLIAVAGLLLAGCARTDTQEYARNLGGKCDVPQYYAIDFSR
                     FDESAQQIAHATGCGIITDTTLTGAIKPHPVKGYLTRREAVFMAIQGTSLKVTQQEPD
                     TITVE"
     gene            complement(744447..744965)
                     /locus_tag="PC1_RS03220"
                     /old_locus_tag="PC1_0642"
     CDS             complement(744447..744965)
                     /locus_tag="PC1_RS03220"
                     /old_locus_tag="PC1_0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971633.1"
                     /note="An electron-transfer protein; flavodoxin binds one
                     FMN molecule, which serves as a redox-active prosthetic;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin"
                     /protein_id="WP_012773344.1"
                     /db_xref="GI:502366393"
                     /translation="MKIGLFYGSSTCYTEMAAEKIRDILGEELVDLHNLKDVEPQRME
                     DYSTLILGIPTWDFGEIQEDWENIWGQLATLNLKGKVVALYGMGDQLGYSEWFLDALG
                     MLHDQLLPLGVTFVGYWPTEGYDFISPKPLAADGKHFVGLALDEVNQYDLSDERLEQW
                     CEQILQEMASLL"
     gene            complement(745296..745682)
                     /locus_tag="PC1_RS03225"
                     /old_locus_tag="PC1_0643"
     CDS             complement(745296..745682)
                     /locus_tag="PC1_RS03225"
                     /old_locus_tag="PC1_0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773345.1"
                     /db_xref="GI:502366394"
                     /translation="MFSKHYDVEDSHIDFQGVVDGLYYPFYMEWTRHAFMKEALGIDI
                     EEEFKQGKIYMVLEYTLRFRKSLQKGDRLEVTCQLEKNEKRNRVNFVQQIKVGDVTYA
                     EATFVATCLTNGRPSMPEAVTNALAL"
     gene            complement(745883..747211)
                     /locus_tag="PC1_RS03230"
                     /old_locus_tag="PC1_0644"
     CDS             complement(745883..747211)
                     /locus_tag="PC1_RS03230"
                     /old_locus_tag="PC1_0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010279860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_012773346.1"
                     /db_xref="GI:502366395"
                     /translation="MQATTITPTLDAEAEAPPVNSRNKVIVASLIGTAIEFFDFYIYA
                     TAAVLVFPHIFFPQGDPTAATLQSLATFAIAFVARPIGSAVFGHFGDRVGRKVTLVAS
                     LLTMGISTVLIGLLPTYETIGIFAPILLALARFGQGLGLGGEWGGAALLATENAPSHK
                     RALYGSFPQLGAPIGFFFANGTFLLLSWLLTEEQFMSWGWRVPFVASAALVLVGLYVR
                     ISLHEAPVFTKAVKAGKQVRMPLGTLLSKHMKVTILGTFIMLATYTLFYIMTVYSMTY
                     GTSPVPKGLGFSRNSFLLMLMIAVIGFGLMVPVAGYLADAFGRRKTMITITCLMIVFA
                     MLFPYMLGSGNQALVMGFLVLGLSIMGLTFGPMGALLPELFPTEVRYTGASFSYNVSS
                     ILGASVAPYIAAWLTANYGLFYVGVYLAAMASLTLIALLATRETRHQSLG"
     gene            747523..748422
                     /gene="xerD"
                     /locus_tag="PC1_RS03235"
                     /old_locus_tag="PC1_0645"
     CDS             747523..748422
                     /gene="xerD"
                     /locus_tag="PC1_RS03235"
                     /old_locus_tag="PC1_0645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971643.1"
                     /note="site-specific tyrosine recombinase which cuts and
                     rejoins DNA molecules; binds cooperatively to specific DNA
                     consensus sites; forms a heterotetrameric complex with
                     XerC; XerCD exhibit similar sequences; essential to
                     convert chromosome dimers to monomers during cell division
                     and functions during plasmid segregation; XerD
                     specifically exchanges the bottom strands; cell division
                     protein FtsK may regulate the XerCD complex; enzyme from
                     Streptococcus group has unusual active site motifs;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine recombinase XerD"
                     /protein_id="WP_012773347.1"
                     /db_xref="GI:502366396"
                     /translation="MQEHDQALIEQFLDALWLERNLAENTLASYRLDLRTLAEWLAHH
                     DNDLLQAQALDLQAFLADRVDGGYKATSSARLLSAMRRFFQYLYREKLRSDDPSAVLS
                     SPKLPQRLPKDLSEAQVDALLNAPSIEQPLELRDKAMLEVLYATGLRVSELVGLTMSD
                     VSLRQGVVRVLGKGNKERLVPLGEEAVYWIEYYLEHGRPWLLNGQTLDVLFPSNRARQ
                     MTRQTFWHRIKYYAVLASIDSEKLSPHVLRHAFATHLLNHGADLRVVQMLLGHSDLST
                     TQIYTHVATERLKQLHQQHHPRA"
     gene            748548..749264
                     /locus_tag="PC1_RS03240"
                     /old_locus_tag="PC1_0646"
     CDS             748548..749264
                     /locus_tag="PC1_RS03240"
                     /old_locus_tag="PC1_0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971645.1"
                     /note="DsbC; periplasmic protein with protein disulfide
                     isomerase activity; this protein also shows disulfide
                     oxidoreductase activity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-disulfide isomerase"
                     /protein_id="WP_012773348.1"
                     /db_xref="GI:502366397"
                     /translation="MKKGLLLLSLLVATATNFAHADDAAIKQTLTRLDMQGAEILPSP
                     MAGMKTVITDSGVLYISEDGKHLLQGPLYDVSGTMPVNTTNKILIGKMDALQEQMIVY
                     KAAQEKHVITVFTDITCGYCHKLHEQMKDYNALGITVRYLAFPRQGMKSPAAKDMQSI
                     WCVADRNKAFDSAMKGDAISPATCKTDIAAHYQLGIQFGVQGTPAIVLQDGMVVPGYQ
                     GPKEMLAMLEAHKASKKTGG"
     gene            749277..751031
                     /locus_tag="PC1_RS03245"
                     /old_locus_tag="PC1_0647"
     CDS             749277..751031
                     /locus_tag="PC1_RS03245"
                     /old_locus_tag="PC1_0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773349.1"
                     /note="5'-3' single-stranded-DNA-specific exonuclease;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ssDNA exonuclease RecJ"
                     /protein_id="WP_012773349.1"
                     /db_xref="GI:502366398"
                     /translation="MITQLRRRPLAEDIDLPDTVPPLLRRLYAQRGVKAAQELERSLS
                     GLLNYRLLSGIDNAVDLLQKTLAEKRCIVIVGDFDADGATSTALTVLALRSMGCVNVK
                     YLVPNRFEDGYGLSPEVVAQAAALGAEVIVTVDNGISSHAGVEDAHRRGITVLVTDHH
                     LPGEILPDADAMINPNLPDCQFPSKALAGVGVAFYLMMALFVRLRDSDWFTQPLFTQQ
                     GLVKPNLTELLDLVALGTVADVVPLDANNRILVAQGLNRIRAGECRPGIRALLEVANR
                     DASQLVSSDLGFALGPRLNAAGRLHDMKIGVELLLSDDIVQARILANELNDMNQDRRD
                     IEQGMQAEALHLCESLERTRTELPYGLAMYHPEWHQGVVGILASRIKERFHRPVIAFA
                     PAGDGMLKGSGRSIAGLHLRDALERLDTLYPGMMEKFGGHAMAAGLSLHEDRFEDFRQ
                     RFGELVGEWLDPSQLEGVVWSDGELVLPELDLLSTAEMLRYAGPWGQSFPEPTFDGRF
                     RILQPRLLKERHLKAMFEPIGATGKVPLLDGIAFNVDTTIWPDPSIKEVEIVYRLDIN
                     EFRGKRSVQLLIQHLWPR"
     gene            751312..752244
                     /locus_tag="PC1_RS03250"
     CDS             751312..752244
                     /locus_tag="PC1_RS03250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002231350.1"
                     /note="catalyzes the release of newly synthesized
                     polypeptide chains at the stop codons UAA and UGA; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 2"
                     /protein_id="WP_043881874.1"
                     /db_xref="GI:762768402"
                     /translation="MGKERSSLEAIVDTIDQLTQGLEDVAGLLELAVEEDDEDTFNDT
                     TVELDALENKLGQLEFRRMFSGQYDSADCYLDIQAGSGGTEAQDWASMLVRMYLRWAE
                     AKGFKTEIIEESDGDVAGTKSATIKIIGDYAFGWLRTETGVHRLVRKSPFDSGGRRHT
                     SFSSAFVYPEVEDDIDIEINPADLRIDVYRASGAGGQHVNRTESAVRITHMPTGIVTQ
                     CQNDRSQHKNKDQAMKQLKAKLYEFEMQKKNAEKQAMEDNKSDIGWGSQIRSYVLDDS
                     RIKDLRTGVETRNTQAVLDGDLDKFIEASLKAGL"
     gene            752253..753770
                     /gene="lysS"
                     /locus_tag="PC1_RS03255"
                     /old_locus_tag="PC1_0649"
     CDS             752253..753770
                     /gene="lysS"
                     /locus_tag="PC1_RS03255"
                     /old_locus_tag="PC1_0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C6D8Z6.1"
                     /note="class II; LysRS2; catalyzes a two-step reaction,
                     first charging a lysine molecule by linking its carboxyl
                     group to the alpha-phosphate of ATP, followed by transfer
                     of the aminoacyl-adenylate to its tRNA; in Methanosarcina
                     barkeri, LysRS2 charges both tRNA molecules for lysine
                     that exist in this organism and in addition can charge the
                     tRNAPyl with lysine in the presence of LysRS1; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine--tRNA ligase"
                     /protein_id="WP_012773351.1"
                     /db_xref="GI:502366401"
                     /translation="MAESQSQGADQAQDLNNELKTRREKLVALRETGIAFPNDFRRDS
                     TSDRLHAEFDGKENEELEELGVEVTVAGRMMTRRIMGKASFVTLQDVGGRIQLYVSRD
                     DLAEGIYNEQFKKWDLGDILGARGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGL
                     ADQETRYRQRYLDLIANDESRNTFRIRSKVMAAIRSFMVDHGFMEVETPMMQVIPGGA
                     SARPFITHHNALDIDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFT
                     MMELYMAYADYKDLIVLTENLFRTLTQDVLGSTTVEYGDQTFDFGKPFEKLTMREAIC
                     KYRPETNVADLDDLEKATAIAQSLGIKIEKSWGLGRIVTEIFEETAESSLIQPTFITE
                     YPAEVSPLARRNDQNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFAQQVNAKDAG
                     DDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPQK"
     gene            754052..754807
                     /locus_tag="PC1_RS03260"
                     /old_locus_tag="PC1_0650"
     CDS             754052..754807
                     /locus_tag="PC1_RS03260"
                     /old_locus_tag="PC1_0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010301852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_012773352.1"
                     /db_xref="GI:502366402"
                     /translation="MMTYRDAWFELALLTNGRSFPRHTHDEFVISANLSGLETVWLDG
                     ETFVATNDMVTTYNPNQLQGSENAFDRWQCASLYVHPQAFEHYFHQTFRFSRGWNPSP
                     QLAAELKQLVISDLDDSTRQERIILLLAGLMENQHHEPSQSQVKEAERITRIKDGLLS
                     DLSDVPTLDQLAQQENLSVAHLVRSFNQAVGLPPLAWLMQRRMCKARELLRQGTAISQ
                     VAGDVGFADQAHFTKAFNRYNAMTPGQFRRINF"
     gene            754870..755553
                     /locus_tag="PC1_RS03265"
                     /old_locus_tag="PC1_0651"
     CDS             754870..755553
                     /locus_tag="PC1_RS03265"
                     /old_locus_tag="PC1_0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010301855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine transporter"
                     /protein_id="WP_012773353.1"
                     /db_xref="GI:502366403"
                     /translation="MLLIVFTGMLLSLSLCLDLGMVNTAIINRGLRHGPRSAFYIGLG
                     SCFGDLFYATLSVLGLAVVFNLTPVRWVLWIGGGLILIWMTFSMARAAWRDYQVKRFA
                     DLSATANGADFTAPPARYTEFFSGVGMALASPTALLWFAAIGGTIIAQSTDGSAFMIS
                     LFLLGFFVGGVLWTFFLAALVKYGQRLLKERISFYCSLISALLFAYFAWHVISSGYET
                     LFLPLSTAA"
     gene            755635..755708
                     /locus_tag="PC1_RS03270"
                     /old_locus_tag="PC1_R0024"
     tRNA            755635..755708
                     /locus_tag="PC1_RS03270"
                     /old_locus_tag="PC1_R0024"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:755667..755669,aa:Gly,seq:ccc)
     gene            complement(755866..756204)
                     /locus_tag="PC1_RS03275"
                     /old_locus_tag="PC1_0652"
     CDS             complement(755866..756204)
                     /locus_tag="PC1_RS03275"
                     /old_locus_tag="PC1_0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_012773354.1"
                     /db_xref="GI:502366404"
                     /translation="MISKDNAEHYVWGDSCDGWYLVKRQDMSIIHERMPSGAKEKRHY
                     HSESRQFFFVLAGTLTIELEGEAHIITEHQGLEIPPSAKHQAKNESDDDVDFIVVSHP
                     TARGDRIDLL"
     gene            756328..756720
                     /locus_tag="PC1_RS03280"
                     /old_locus_tag="PC1_0653"
     CDS             756328..756720
                     /locus_tag="PC1_RS03280"
                     /old_locus_tag="PC1_0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010308528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773355.1"
                     /db_xref="GI:502366405"
                     /translation="MKPHPIREIIEACDKAISERDFDALMRYYAEDAALVIKPGMVAR
                     GKDDIRKAFIAIADYFRNQLLVEQGNMQVIEGGGDALVIMETVLHYPDEQGSIVTTTR
                     RATYVFRKDADGNWLCTVDNSYGTTLLD"
     gene            complement(756812..757879)
                     /locus_tag="PC1_RS03285"
                     /old_locus_tag="PC1_0654"
     CDS             complement(756812..757879)
                     /locus_tag="PC1_RS03285"
                     /old_locus_tag="PC1_0654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773356.1"
                     /db_xref="GI:502366407"
                     /translation="MTISLPSRLPILAALIASTPALAFATTSTDSSFSHKDWEVVCDN
                     TLTCRAAGYSSEKQYAGEEQDVPGISLLLTRHAGQNTPITADVMLAEVYQAIPKGTTL
                     TLTIDGVDKGLLTPTRDNLWQLNEKQIPVVLQALKGSGKVAFRHNGAVSELSGAGAYA
                     VLLKMDEKQGRIGTTDAITKKGNKSSALPAVPAPVIYAAVTKQAPSRNLTDAEQSALQ
                     KKLLKTLNSDCDRLLPQDDQKAEPIELTPLNDSLSLLSTLCWRAAYNEGYAYWIIDNA
                     MQTQPQLVTTDGTDYENGEITSAHKGRGLADCMSYESWTWDGKTFQQSSVSTTGSCRM
                     IQLGGTWDLPSWTTTVVQSGK"
     gene            758256..759179
                     /locus_tag="PC1_RS03290"
                     /old_locus_tag="PC1_0655"
     CDS             758256..759179
                     /locus_tag="PC1_RS03290"
                     /old_locus_tag="PC1_0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914191.1"
                     /note="Acylates the intermediate (KDO)2-lipid IVA to form
                     (KDO)2-(palmitoleoyl)-lipid IVA in cells subjected to cold
                     shock; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis palmitoleoyl
                     acyltransferase"
                     /protein_id="WP_012773357.1"
                     /db_xref="GI:502366408"
                     /translation="MKIKQTFTRALLHPRYWTTWFGLGVLFLLVQLPYPLLMKIGSNA
                     GRLSRVFLKRRVSIARRNLELCFPTISDDEKEAMIDSNFASLGMALVETGMAWFWSDR
                     RVRHWFDVSGLEHLHQATAKGQGVMVIGIHFMSLELGGRAMGLCRPMMAMYRPHNNKA
                     MEMVQTWGRSRSNKAMIDRKDLRGMVQALKRGEAVWFAPDQDYGPKGSVFAPFFAVKN
                     AATTSGTYTISRLAKPAMMTTVLIRKPDASGYQLVIQPELQDYPYHDEQAAACYMNKV
                     IEKEIMRAPEQYLWLHRRFKTRPAGEVSLYA"
     gene            complement(759227..760711)
                     /locus_tag="PC1_RS03295"
                     /old_locus_tag="PC1_0656"
     CDS             complement(759227..760711)
                     /locus_tag="PC1_RS03295"
                     /old_locus_tag="PC1_0656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_012773358.1"
                     /db_xref="GI:502366409"
                     /translation="MPEKTMTGNGSNAYSPKLCNEDLAPTRAQTWSWYNIFSFWMSDV
                     HSMGGYVVAASFFALGLASWQVLLCLLVGICIVQVCANLVAKPSQMSGVPYAVICRQA
                     FGVFGANIPAVIRGLIAFAWYGIQTYLAAHALMLVLLKFYPSLAPLTQSHWLGLSALG
                     WICFGIMWFLQALVFWHGMNAIKRFIDFAGPAVYVVMTALAIWIVYQTGWENISFTLT
                     SKTLTTSEQLWQMLTATALVVSYFSGPLLNFGDFSRYGKSMQEIRRGNRWGLPFNFLL
                     FSIITVVIVSGTQSLFGRMITDPIETVAHIDSGFAVALGVLTMIIATIGINIVANFVS
                     SAFDFSNCSPQRISFRTGGMIAAVGSVLLTPWNLFNSPELIHYTLDVLGAFIGPLFGI
                     LLMDFYVIKGGKVYVDDLFDATPKGKYWYRNGFNPNAIMALIPAVSIGLIITFTPQWR
                     DAANFSWFIGAFLAAGCYRYLARHECVGAMRKPFAPHGLLLEKE"
     gene            760865..761587
                     /locus_tag="PC1_RS03300"
                     /old_locus_tag="PC1_0657"
     CDS             760865..761587
                     /locus_tag="PC1_RS03300"
                     /old_locus_tag="PC1_0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_012773359.1"
                     /db_xref="GI:502366410"
                     /translation="MNYTYGLEDEQFLQQKDDVIYKALLNAIVEHQLLPGTKLPEEAL
                     AEVFDVSRTGIRKVLQRLAMVQMVTLTPKRGAQVSTPSVEEAREIFQTRRFIECANLS
                     EVALHCQSPHLAALERLIVAEQQAHADQNGAEAIRLSAAFHIQLQAISGNTVLTGIVS
                     QLTLRSSLVIAAYGTPWQQGCRCHDHNDLLALLRNKNVSGLAEAMTRHFDDIVASLRF
                     DRDENVEPDFRRLFGHLKEKLV"
     gene            761584..762321
                     /locus_tag="PC1_RS03305"
                     /old_locus_tag="PC1_0658"
     CDS             761584..762321
                     /locus_tag="PC1_RS03305"
                     /old_locus_tag="PC1_0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp/Glu racemase"
                     /protein_id="WP_012773360.1"
                     /db_xref="GI:502366411"
                     /translation="MKPYVIQVINPNTSLAMTETIGSAARAVASPGTEIIAVCPSQGV
                     PSIEGHFDEAIAAIGVLEQVKQGKVQGVDGHIIACFGDPGLLAAREVASKPVIGIAEA
                     AMHMATLVATRFSIVTTLPRTVIIARHLLQRYGFEHQCAALHAIDLPVLALEQDSGIA
                     QNKVREYCIQSLRQDCVGAIVLGCGGMADLAQELTQELSIPVIDGVSAAVKLIESLSA
                     LGLTTSKQGDLDYPIAKPLSGMFSTLR"
     gene            762337..763296
                     /locus_tag="PC1_RS03310"
                     /old_locus_tag="PC1_0659"
     CDS             762337..763296
                     /locus_tag="PC1_RS03310"
                     /old_locus_tag="PC1_0659"
                     /EC_number="3.5.1.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010285242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allantoinase"
                     /protein_id="WP_012773361.1"
                     /db_xref="GI:502366412"
                     /translation="MITAPAATMYGIENDYPRDLIGYAGQPPHAKWPENARIAVQFVL
                     NYEEGAENNVLHGDAGSEQFLSDIVGAASYADRHMSMDSLYEYGSRAGFWRIHKEFQR
                     RGLPLTVFGVAMALARNPAVVEAIKSANYDVVSHGWRWIHYQHMDIDTEREHMHKAIT
                     VLTTLFGQAPLGWYTGRDSPNTRQLLVEQGNVWYDSDYYGDDLPFWMPVKKSNGDVHP
                     HLIVPYTLEANDMRFASPQGFNSGDQFFTYLKDSFDVLYEEGDAAPKMLSIGMHCRLL
                     GRPGRFRALQRFLDYIQQHERVWICRRQDIAEHWRLYHPYVAR"
     gene            complement(763487..763879)
                     /locus_tag="PC1_RS03315"
     CDS             complement(763487..763879)
                     /locus_tag="PC1_RS03315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010308560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043881710.1"
                     /db_xref="GI:762767028"
                     /translation="MIPLHPRVFQLLIETIYLSHLICPIRTPSASTPNVQSGNSLKTR
                     QYEEKAETVFRRKSKQRFTPHKLIVHFFVILITKKLTPRISASILKNVNSITEKQSTN
                     NEEMTMKLLNKIIAMFENININFGTFNQ"
     gene            764130..765485
                     /locus_tag="PC1_RS03320"
                     /old_locus_tag="PC1_0660"
     CDS             764130..765485
                     /locus_tag="PC1_RS03320"
                     /old_locus_tag="PC1_0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_012773362.1"
                     /db_xref="GI:502366413"
                     /translation="MSNTTRQAGSQGTLDAFFKITQRGSNVRQEVLAGLTTFLAMVYS
                     VIVVPSMLGKAGFPPAAVFVATCLVAGLGSLLMGLWANLPMAIGCAISLTAFTAFSLV
                     LGQQISIPVALGAIFLMGVLFTIISVTGIRSWILRNLPMGVAHGTGIGIGLFLLIIAA
                     NGVGLVVKNPIDGLPVALGNFTSFPVVMSLLGLAATIGLEKRRVPGGILLVIIAISIL
                     GLIFDPNVKFSGFFALPSLTAADGSSLIFSLDIMGALQPMVLPSVLALVMTAVFDATG
                     TIRAVAGQANLLDKDGQIINGGKALTADSVSSIFSSLVGTSPAAVYIESAAGTAAGGK
                     TGLTATVVGVLFLLLLFVSPLAYLVPGYATAPALMYVGLLMLGNVSKLNFDDFVDAMS
                     GLVCAVFIVLTCNIVTGIMLGFGALVLGRICAGEWRKLNIGTVIIAVALVVFYAGGWA
                     L"
     gene            765765..767411
                     /locus_tag="PC1_RS03325"
                     /old_locus_tag="PC1_0661"
     CDS             765765..767411
                     /locus_tag="PC1_RS03325"
                     /old_locus_tag="PC1_0661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_012773363.1"
                     /db_xref="GI:502366414"
                     /translation="MEIFFTILILTLVVSLSGVVTRILPFQIPLPLMQIALGAILAWP
                     QFGLHVDFNPELFMVLFIPPLLFADGWKTPTREFLRHGREIIGLALVLVLITVVGIGY
                     FIYWMVPGMPLIAAFALAAVLSPTDAVALSGIVGEDRIPKKLMGILQGEALMNDASGL
                     VSLKFAVAIAMGTMVFTVSGATLEFMQVALGGLLAGVGVTWIFGKSLRIISRWSGDDA
                     ATQIVLLLLLPFASYLIAEHIGVSGILAAVAAGMTIGQSGVIRSAPLAMRLRANGVWS
                     MLEFVFNGMVFIMLGLQLPDILETSVTQAELDPTVETWMLFTDIAIIYGALLLLRFCW
                     LWVMKRYSMHIQKKRPMIFAEFSTRELWIASFAGVRGAITLAGVLSIPLLLTDGTAFP
                     SRYQLVFIATGVILFSLLCGVLALPFLLRGVVVADKAAHAKEIRMARMAVAEVAIKSM
                     HKMEERLAADREENIDEQVLKEVSARVIGNLRRRLIDKDDPENGLLIENLERRFRLTA
                     LNSERAELYHLRATQQISNETLQKMLRDLDLMEALLIENE"
     gene            767770..768480
                     /locus_tag="PC1_RS03330"
                     /old_locus_tag="PC1_0662"
     CDS             767770..768480
                     /locus_tag="PC1_RS03330"
                     /old_locus_tag="PC1_0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010285248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_010285248.1"
                     /db_xref="GI:497971092"
                     /translation="MRVLVVDDDSVLCHWLGSKLHSHGHSCRMVHDGAHALKAIKDEV
                     YDVVLLDRMLPIMDGFTVLRELQGSRHPPIMLLSALDRDVDRVMGLELGAEDYLGKPF
                     NFNELRLRLDIMARRGKRHVDNPSMLTFEDLQLDRMQRVAWRGGKRIDLTDKEIKLLI
                     ILMENPGQAITRTMLLERVWGYNFDPQTNLIDVHMSKLRAKIDKGFPRPLIKTLRAMG
                     YALGAVDKDKTDVGSHAE"
     gene            768458..769957
                     /locus_tag="PC1_RS03335"
                     /old_locus_tag="PC1_0663"
     CDS             768458..769957
                     /locus_tag="PC1_RS03335"
                     /old_locus_tag="PC1_0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_012773364.1"
                     /db_xref="GI:502366415"
                     /translation="MLAATLNKIKIKKLGQRWQVKIKHWQLLGASQYPDFLCTSNFRQ
                     AITIVFLFLLMMLMCIVGFSSLSETLIRTHVREVILGNIYDYSMQSRLTSADSLITQL
                     RQDNRAKGDELPLFLVMDKQGDILYHNHPLRTHPLSSDSFNTHRLEMRQRTDCRMDVS
                     CLKAEISSPDDPNLIGLSVMLDDGGVLFTAYNIRPMLERVRTIPLVAGAGLFIVLLFC
                     LFVSRHFSLRSLRSVEKIRAALHRYSSGEQQVRMPLSPYDDDFDSLSADINQNLERIE
                     RLMEQVRNTSSHVAHELRTPLTHLQNRLFNLTERAGLDNDVRDELNLAVDEVHKILGL
                     FRTVMRIGEIESGRCVHQFENIEARQLLEEIAEYYQPLAEERGCRLKIEIKAGIQLFG
                     DRALLFQALANLVENALKYAAQGKYITLSVTLYRGWIALSVADRGPGIPPALHTKALQ
                     RFQRLDTWFQSGYGLGLSLVQAITDLHGGKLYLDSSEPGLNVYLCLNRC"
     gene            770280..770492
                     /locus_tag="PC1_RS03340"
                     /old_locus_tag="PC1_0664"
     CDS             770280..770492
                     /locus_tag="PC1_RS03340"
                     /old_locus_tag="PC1_0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010285252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilin"
                     /protein_id="WP_039282903.1"
                     /db_xref="GI:746234313"
                     /translation="MKAKLRSFLRDESGVTAIEYGILAAAMAAAIGAIFGGDGIFVKA
                     LNEKFSQIADQITGTGTSGGTSGAAK"
     gene            770500..771051
                     /locus_tag="PC1_RS03345"
                     /old_locus_tag="PC1_0665"
     CDS             770500..771051
                     /locus_tag="PC1_RS03345"
                     /old_locus_tag="PC1_0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010295689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase A24"
                     /protein_id="WP_012773365.1"
                     /db_xref="GI:502366416"
                     /translation="MADYTHWPQTALLMGCLLWCISTDLLVRKITNRAVLILLLGWLF
                     FSASHVLQSGALDMLALRKTLWALPGAAAVLVVGFLLFLTGRLGAGDVKLMSVLCLWV
                     GQGHQIVFVMVTALAGGVLALSLPLLNTVPTAVAMGIQTTNRIFKSRLPMPPALPADL
                     SQGIPYGVAIAFGAMYVLIFPLF"
     gene            771098..772042
                     /locus_tag="PC1_RS03350"
                     /old_locus_tag="PC1_0666"
     CDS             771098..772042
                     /locus_tag="PC1_RS03350"
                     /old_locus_tag="PC1_0666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010285254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein CpaB"
                     /protein_id="WP_012773366.1"
                     /db_xref="GI:502366417"
                     /translation="MKVNSTYVLSGAFVLAGIVALVVRSHLSSEPPAPPPVVAKAPEK
                     IAVLVAAKDLHPGDFIDSSSVRWQTTDESVSRSFNFVRGRDSQFLLFGATLRETVKEG
                     TQLSSNVVVKPNEPGFVAAVLHKGMRAISVPTSAIASNAGLVSAGDRVDVILSMRRDD
                     QSELPVSRNQPVVMPLLASQTIVRDLRVLALNDKVGTPVYPRLDAMEDGAALDAAAKS
                     RESAVRSRPATYQTVTLEVTPQQAEALTVAKELGILHLSLRSATQDDVVDPLKERQSV
                     TTVPLATDIYGALSAGSGGHKVKVYRGEQKDVVTFPSR"
     gene            772123..773559
                     /locus_tag="PC1_RS03355"
                     /old_locus_tag="PC1_0667"
     CDS             772123..773559
                     /locus_tag="PC1_RS03355"
                     /old_locus_tag="PC1_0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II and III secretion system protein"
                     /protein_id="WP_012773367.1"
                     /db_xref="GI:502366418"
                     /translation="MTMFSLFLKSDFRGTCKRLLAACLFNAVLPVTLTTMMLPATTLA
                     AGVSTAPITDEVHLTVNQGRLLQLADTPDSVLVADPNIASFELPSPGNLFVYAKSVGV
                     TTLYAMDENGNVINAIRLVSEHDLKALGERMKREFPGADIQLEASIPSGVIVRGSVDT
                     PQDAKRVIDSIQAYISASSGGQGGGGGGGEKLPGSSESSGKVINQLKIKTPSQINIQV
                     RVVEVSRKLTSELGFNWAASLSTGSGNMSAGSGSRLNLFNATTGRFSNPTDSGFLNFG
                     RSRLSGLLTAMNQQGMATVLAEPNLTAMSGETAAFAAGGEVPIVLITNNSVSIDYKSY
                     GVILRMTPTLLSANRISLHIAPEVSELTDVGSVQLEGGSRIPALTVRRADTTVELASG
                     QSFALAGMLRSAGSQTINGVPGLSSVPMFGRLFESEATSQEETELVIIATAYVVEPVN
                     AGDLQTPGQGVKMLDSSMPRSASIGYLY"
     gene            773581..774267
                     /locus_tag="PC1_RS03360"
                     /old_locus_tag="PC1_0668"
     CDS             773581..774267
                     /locus_tag="PC1_RS03360"
                     /old_locus_tag="PC1_0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilZ"
                     /protein_id="WP_012773368.1"
                     /db_xref="GI:502366419"
                     /translation="MKTINSNYPPFRPLPLRAAVLTAVFLLAGCGWNKPINDVRMQRF
                     DQPALQPIAVQPSSVSVPLLAAPNGRGFLPESLKQLNIMLKDQGRLSAQTITLIPHSA
                     SGEQMAGRLATVLKNAGANPQNVKQMRRSTASGQNGDLEVISEALVVKTTRCTINDPN
                     QLMVKPYEAIGSLGCATQNNLAMMVAEPRDLIQAKALDDADGVAAVNSIERYHKGEVK
                     ELIDINFEED"
     gene            774282..775481
                     /locus_tag="PC1_RS03365"
                     /old_locus_tag="PC1_0669"
     CDS             774282..775481
                     /locus_tag="PC1_RS03365"
                     /old_locus_tag="PC1_0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_012773369.1"
                     /db_xref="GI:502366420"
                     /translation="MSEITPNDGEELALPLVAFANDVRDVADISDLFTRLKQPDVPVM
                     SGGIAAARQWCELNVPPRILLVDLEGAHWPLPALEELLSVCGPTSQVIATGKEQDVGL
                     YRALLQAGVVDYLVKPFTLDLLAATLAKCEGQQAGPEYARMGRTIAVVGASGGSGAST
                     VAMGLSRLLSGERHLPVALVDFDRRNGDQLLLQGQTDDAGLAAVLETQELDTRLLQRA
                     MLRVDTRLHLLAQKPELGELSPVDVDNVLNLGGALCRMFNQVIWDLPSSYPTGALDVL
                     TYADLRIIVTELTLQDARNVRRVLNEIGDESEGQRLLLVHNQSRFASTAPLSREQFEQ
                     FTGRNIDVVLPNAGHALSQSLTLGALNLAAAPAFQQGLRQLVDLACGVRARPAEKRWF
                     SRWLKRA"
     gene            775542..776945
                     /locus_tag="PC1_RS03370"
                     /old_locus_tag="PC1_0670"
     CDS             775542..776945
                     /locus_tag="PC1_RS03370"
                     /old_locus_tag="PC1_0670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein CpaF"
                     /protein_id="WP_043881711.1"
                     /db_xref="GI:762767031"
                     /translation="MLIRKNNLQKSEAGKSTPQPAPAANVAELKTRPAAENRTQPAAS
                     SASGSAPAARQTDSRTSQRRIIRAQLYDQIDAGKAAMMGRDKLLVQIETVIRRICDEQ
                     RLQLSRQEEEAIAAEMLDEMTGIGPIQPLLSDDTVNDILVNGAGQVFVERFGKLELSP
                     ITFIDEEHVFNTAQRIAAAVGRRIDEASPMVDARLPDGSRVNVITYPLAIDGTTISIR
                     KFMRRNLSLEMLAERRCMSYAMADVLNKAMQARVNVIVSGGTGAGKTTLLNALSQKIG
                     STDRIITIEDAAELQLQQEHVVRLETRPVSAEGTGRVDQRDLMRNALRMRPDRIILGE
                     VRGGESFDMLQAMNTGHDGSLCTVHANTSRDAIQRLENMVMMANMQLPLMAIRRQIAS
                     AVHLIVQIERMRDGMRRVVSITEVCGMENEVIQLQDLFSFNIQGMDGQGLLTGEYVQH
                     IQRPQFYSDKSHLFDAQ"
     gene            776964..777944
                     /locus_tag="PC1_RS03375"
                     /old_locus_tag="PC1_0671"
     CDS             776964..777944
                     /locus_tag="PC1_RS03375"
                     /old_locus_tag="PC1_0671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus biosynthesis protein"
                     /protein_id="WP_012773371.1"
                     /db_xref="GI:502366422"
                     /translation="MSDARLNLITLLVFCSVLMLLLAVNAWRKSRQQRMQREQRWQQI
                     LNEVSPSAAVVASDSILRDEIRTPLMGVPVIGRWLAILWAQMTFIGWKKNLLQRSLAL
                     AAVSLILGMILGQRTLLPLTMGLIFTLVLFVSIGMLLFRSTLQKHLKALRESLPEAID
                     AITRSCRAGVPVANTFSIVAEHLTGPLANEFKTIDHWLRLGIPLRQVIQASATRVPMS
                     EYRFFVVILIINQEAGGRLGETLERLSATLRERRELQLKVQSKTSEARASAKIVAALF
                     PGCLAYLYMKSPDDFSFLFSDPVGTSVLIYALCSVSVGMLITHVMVKRIG"
     gene            777959..778918
                     /locus_tag="PC1_RS03380"
                     /old_locus_tag="PC1_0672"
     CDS             777959..778918
                     /locus_tag="PC1_RS03380"
                     /old_locus_tag="PC1_0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus biosynthesis protein"
                     /protein_id="WP_012773372.1"
                     /db_xref="GI:502366423"
                     /translation="MTVFDDPLLLLALVLMVVGIYLARTQHKTQQYKQLEIRMRGHLP
                     VASIEAASQENILRGQGTTLSPLLEKLLQPIATQGERLSGSERDRRNLRRLLDLAGIR
                     RNEAVGWLVMGKFAAGALFAIALVWGWLPPADRAGLTGVAAGLIGFFVGSMVPEWWLK
                     WRAASRGEKLARAVPDALDLMVVCAEAGLPIGRVLQVVSKELGLSSPEMADELHYTAA
                     ELQILSDRTLAMKHLAERTRVSEIESMVATLIQAERYGTPLSQALRTIADESRKTLIL
                     SLEEKAGKLPAQLSVPLMALILPPIIAIMASPALVRVVRLLAQ"
     gene            779009..779860
                     /locus_tag="PC1_RS03385"
                     /old_locus_tag="PC1_0673"
     CDS             779009..779860
                     /locus_tag="PC1_RS03385"
                     /old_locus_tag="PC1_0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773373.1"
                     /db_xref="GI:502366424"
                     /translation="MVDLVAKLKRGAPMLALLIVSTVLVGCGSSMAIKGSKDEGLRLA
                     RLLRDQGRVEAATEVYARLDSRDALKGAEMLEYASVAALARSPQQTLELYGRARQALG
                     GDTNKMTPEEALAVCLGMGRAQLALGRNSMAQADFACALKAQPNDAGALNGMGVVMDA
                     SGKHAEARQLFEKALQINPADVAALNNLALSWLASGNADKAISLLRSVDESNATGRLN
                     LALAYLSGGREDDARSALATIAQPQRIDGLIDELHQRLQQMQQDKSRGEALLLSSRQR
                     LQLSSPE"
     gene            779860..780420
                     /locus_tag="PC1_RS03390"
                     /old_locus_tag="PC1_0674"
     CDS             779860..780420
                     /locus_tag="PC1_RS03390"
                     /old_locus_tag="PC1_0674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773374.1"
                     /db_xref="GI:502366425"
                     /translation="MAWLRNLGPWRDEGTVQGIVPRHERHWRSTHGVIATEVAFLVPV
                     VLVGVMMLFELARIGLVIAAGSAALDKAVQAFRLDNLASDSAEQMGTRLKARMVEAGY
                     GYLKEDDLTVSVLHFDNLSQLGGLTNGNSSQDNPNGEETTTLPVWSVTVQIKKAFITP
                     LPEVLTLGDTFRYQYKHVFGTELRND"
     gene            780413..781063
                     /locus_tag="PC1_RS03395"
                     /old_locus_tag="PC1_0675"
     CDS             780413..781063
                     /locus_tag="PC1_RS03395"
                     /old_locus_tag="PC1_0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773375.1"
                     /db_xref="GI:502366426"
                     /translation="MTDRSLKTGRSLKTSRSLKPGYFLNGLRRFWFSRCASTAVETAL
                     AFPIVLAIGSLCADIYTVGLERTRMEQRAGAIASILAMQQKLDEKGLQGLLDTVLPTE
                     GLGNYQLLISNVRQTGELYWQLSKGTAESLCAESETLPDEEYLPELPEKDPKEGSKNT
                     SMMVVEICRQGKDVSLLGGLSLGGLLHASSVNRVAIGVVELDDVLRKEAGLEEKDQ"
     gene            781241..782872
                     /locus_tag="PC1_RS03400"
                     /old_locus_tag="PC1_0676"
     CDS             781241..782872
                     /locus_tag="PC1_RS03400"
                     /old_locus_tag="PC1_0676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773376.1"
                     /db_xref="GI:502366427"
                     /translation="MKKTLQNRRVKKDDSRTTLFWREHLSAFIQQEKGAGTGFYVLGA
                     MALLVTAAFIVDTSTATGDATQIKRATDAAALAVGHQATINGEEYSQEETNKLAYEYV
                     KNNLGMNKALSEKLVASDVSVAEGRNSATRKTYTVTVAFETKPSLMSLGARKQEVYST
                     SEVINRPTEIALVMPVTGDMSDADIRSLKSVSRSFVERMLSSADGKRDNLWLSLVPYS
                     QSVNVYDAEDANRIRRWSTPSALNPPELRSLFASGVVSSLADRRFPDRRANLLCMYRG
                     LGREENFFWDEPPVGQFRVYYRHDLPQNGSPGAPPITWRGPNPDLYPWDNNSDAVDTR
                     FIVADRGCPNAALMPLTNEESKLNQRIAEFTPRFNTNYAIAMSWAGAALSPNMRGSDG
                     WGDTTLPLDFNLDGNGDGQKVIVMMANTIGNWFDTDSYNFNRNEFRGSTGTDPARSFA
                     AQRFQDLCSSFRARNIKFYFVGIRPGDPEDFGRNLFDREATPGLLVCTEGEKRMSFID
                     GAGFGAEGVEDQLIQRLDRIAGQIETEGGYVRLVE"
     gene            782930..792598
                     /locus_tag="PC1_RS03405"
                     /old_locus_tag="PC1_0677"
     CDS             782930..792598
                     /locus_tag="PC1_RS03405"
                     /old_locus_tag="PC1_0677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773377.1"
                     /db_xref="GI:502366428"
                     /translation="MTFSRSKSGSGLTRTPRQAWVLEPRMMFDAAAMTTAVDVAAHVA
                     ATETAPGVDATPVKATVTITDSSDSFAPIDLFSEVRVSADKGGHELKDLVITVNRTGA
                     NQAIVIDGTEITLEAANGAKTTEGDGKYGYTVAVSGGATTITVSIASSDAFQPNDVAK
                     LIDGIAYKPLDKTVAGGDVTVTLKSLSDESDTADLNIHSTITIDSKINVAPVVSASDS
                     PELAELIVVPGMEAPQDVRYSSNGAYAYAIGSDGTLGVFTVGEHGKLTLSQTLSDISA
                     LKDVKDIALSADNRSLYAITGDKNIVALSLDDNGQVIQVDGSYTQTTPSQNGNITGLA
                     VSSDGTQVYATTQWNGMVVFTRDATTGSLTLLQVVNDSGIDRSGIVASSGNYVVTIGM
                     GAKHTLSVFQRSDTGKLISVATLETSGEGYGAVDYQLAISKDQQFIYVADPDNGEISV
                     YQLRDGTEGKTLARTDTKTLEGVNAVYLNADGSQLYALSSEGALQIYSVNASTGALSE
                     SGQITNIGDTRGMVLSPDGQSLLIAGEAIQRFSALRTYLYGSDLPFADHIALSDSNLD
                     VLNDGAGNYNGAVITIGRETPSADDQFGLSAGNNLTLQDGKVLQSGTEIGTFTQNQGV
                     LSVTFTADVTKETANAVLKQITYRNIGSQSATETVVLTVTANDGELNSTVTTVALLLT
                     ANSAPTLVSQGGSSLTLDTRGASVTIFKDTAVNTGEAGQALTKLSIGIDGLNNPHQEY
                     LTVDGTVIDLSKDSAGTTVSGYQYSYTYNALSGESSLVLSSVQGISSMAVMKLVDGLS
                     YSTGKESTSASGLRTITLTELQDNGGTANGGSDTATLTVSGSVNLAFNERPTIEATYS
                     PDAALFYNDGKLSDYNERVSAISVSQDGKTLLVTGSEGNNNSGKTYLRVYARDAESGK
                     LTLLQSFTQGEQDDPSTPAIEVNGLNTITTLAQSKDGSSVYVAGGSGSAYSLVQFSRD
                     ATTGLLSYVGVVATQGVNGVSGLDAAVSEIVLSEDGTSLYTINGVTPTDGSTGKNAIT
                     FFSRDTTSGALTFVGSLVGSDTIPVRSPSGIVLSSDGTSAYISNLGNHSITVLSRDAA
                     TGSLNYVTTINKTTIAADANSAEIPKDDRYLTGLQDIVISPDNRFVYVSSNTQGTVSI
                     FSRDVDTGSLTYAGTLDLYNAGHIPANALSLRELVISEDGSALYVAALGSQSVLVFGR
                     DSDSGALTYRNSVELSINTVNHLAVSADGKNIYAGVSSFFAGLNVLNAAANAPYSQTT
                     DAPFATSVTLSDQELDAADDYKGASIAISRNGEASANDRFAFQNGNGLTLSGNEIQYQ
                     GTTIGTFSVSEGTVKVVFTDSVTKTVANQVLHQVTYRNDGDAAGTSIPLNITFSDGGK
                     ETSLLLTLVPNKPPVVDNVEYVPPSGTAGHSYSAELPEDLFRDPENGALTWQVNGLPA
                     GLTFDPETRTISGTPALNGAGSFSITVVATDGSGEQAERTLTLTVASDPAQIPTIGGE
                     SSALQNDYNLEGYDSNSYVDVLSGVRDSQLSADGKTLYVVSSPESGSAVLSVFVRNEE
                     GKFTLSKTFYNYRSVYNDETGQLDKIVDNAALAGASDVTLSADGQYLYVVGSEGNAVT
                     LFRIGSDGELTQAGVLDQAALGGHSLDVRSHIVSQGDYLYLTAAQSGSDNDSRSVLVF
                     KRGTDGTLTSVSQTDNLIGASRLVIDPTGRYLFVSGAGDTVGMVGITGFSIDAEGKLT
                     QVSQIRAEGDDPYYINSLALSPDGKTLYAINADGIQYTLNTITVGADGALSLVATVPF
                     VNDGGDTGEALATGLVVSADGTALFVIGKNISVFARAEDGSLTLKHTISGGWDSPLNI
                     SFSDLQNVELSVDGKQLYLIGGDKVHVLNVGTAGATYTEKTDATVLLPSGRLSDPQLD
                     ALNNGTGNYNGASITVGRQEGGLPEDTFGFKADNDLALDGNNIVKDGTTIATFTKVDG
                     VLTVTFTAAVTKADAQNVLRQITYQNTSQDPEHAGSSPTFVFSINDGDNNVATMDVTV
                     NLIGLNDPAVLTTTVLNPQIPGNGEFVKLFKDTHIDTIESGQTIWQVVLTFDVSGPNE
                     TISVDGSTIVLEKSNGTPRTASGLQYSVEVKDGKATVLLYVGKDGSGTAAIIDSIGYN
                     YLGSDASGERHVTLMIKENNYSGSAPETTLEQAITLTLVPAAETNTAPVITVPGTTPT
                     YTERADPIVLAPDATVSDVQMDKLNGGKGNYDGATLKITLGDGKTALDKLGFNAGNGL
                     TLSGDTLQKDGVTIGQVSNKDGVLTIRFNANAGTIPTTEDVQNTLRQVTYANDSHTPA
                     AQVAVTVTLSDRYLESQVTALSVTITAINDTPVVANDPVLSADELRLVNAYTAIAGLG
                     TVKSAARTTDGLALYVSDDKGAIALFKRDANSGELTYVRTFAAVEGVGGISQLQVSAD
                     GNSVYALRADGNAIVWFGRDAEGNLEHKETIVDNYDIHKSNLYDIKGITLSDDGKTLY
                     VINNYNLLWFTRDTATGKLDYVGLIEGGMWSEPYLWQPSEIVSRGNLLFVTTNTSSGS
                     SLIVYTRGDNGEPTLLGYTRDVTDASGNTVQLSGLEQITVSADGRSIVVASADHIDAF
                     ALDTATGTFTHLARIAAEGTVNGIAFSADARVLYVTQSDGSLTRYVLNGQALTKLDTL
                     KNDGAGFAHLLPVDGGLIALGNGVTVLDEVSRLPVYRIDGPAVIVAPSIVFSDAELDA
                     LNGGAGNYQGASITLQRGETASAGDRFDFTAGNGFTLANGVISKDGQAVATFTQAEGK
                     LTITFTAAISRADATALARQISWATSAPLTGNSTSLTLVLNDGETDSTAQTLGVTLSR
                     EINQPPVGHAELFTPPTAQVGTRWSYTLPNSLFSDAENDTLTLSINGLPNGLTFDAAT
                     RTIGGDPAVSGTFNLTITATDSAGNATVLNVALTVNAASTPVDPGTPTEPANPDNTAT
                     AAPVILVQQGVSLPADADEREREQPLGAIVADLSRPEAQALPTNIVAEPARQRDAGST
                     RQSDAPWVLDPVMSQLMPTLDQVNFSSRASTTVRDSAAVSPTDSNLFLSVRGQTTALE
                     SAFSSVQGALQPDASGALAFSLPQRMFSVREGNATLTLQLANGRPLPAWVQFDARSGV
                     VRITDASAVQVNQIQLALKAQAADGTSRIVPITLQTGQGAGTEMATDRGAMQGPANPT
                     IQPAESRDVERLAPAGKTAFTEQLRQHQPEQDALLAALSELSSLRT"
     gene            792842..794629
                     /locus_tag="PC1_RS03410"
                     /old_locus_tag="PC1_0678"
     CDS             792842..794629
                     /locus_tag="PC1_RS03410"
                     /old_locus_tag="PC1_0678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_012773378.1"
                     /db_xref="GI:502366429"
                     /translation="MNQHIAHFWDSQQHDSQQQNVQHEATPRTAGSRALRIAVTLACL
                     GLAGCAVKPEPVTIEQQVAQALSDRTQMFANQEPVRGTITLDEAIARALKYNLQQRVA
                     LMEQAMEDDLLGVQNLDMLLPKLTARAGLQTRDNVAGSSSQSVTTGRQSLEASTSQDQ
                     TQRTADLTMSWNVLDFGISYFNAKVQANKSLAAEERRRRVVADITRQVRTAYWEAATA
                     QRLQPEVTTALTQARQALEYARQTEQQRLLAPVEALRFQKNMLEMVRQLEIVDSDLVV
                     AKSRLAALMNLPPSSKYDVVVPSESSLVAPKMAYSLDDLENFSMVKRPEVREESYLAR
                     NSVLETRKSLLRLLPGVSLFAGINGDSNSYLVNHQWANAGVQVSGNLLNVLSWSSVKR
                     AGQANEDLAEVRRQALRMAVLTQVNVAWQEYQQSTRMFGRYQELARIQRGILNQTTLS
                     VQHRAETQMEQVRVSTETILTTRARDRSFADVQNALGAVYQAAGLDVLPDNVNDVSLA
                     ALSNSIARTTGNLEKGGVAVPRLSLSTPATPATTTAPAVTASATGSAVTKPITPVAVT
                     PSANAGKPYRVVNTDMWDNLQSLQAGGSR"
     gene            794629..795384
                     /locus_tag="PC1_RS03415"
                     /old_locus_tag="PC1_0679"
     CDS             794629..795384
                     /locus_tag="PC1_RS03415"
                     /old_locus_tag="PC1_0679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="WP_012773379.1"
                     /db_xref="GI:502366430"
                     /translation="MAVGMMRPLLLVSALSLPLWGQAATTGDIRVQLSAQRYTVLSSE
                     IAGKVTDIAVKEGEHFKQGDTLVTFDCTVLREKLNYSNAAENAARKKLAIADRLDKLN
                     SISLSDVDQARSSVSMAQAESGVNRAMLQRCAIKAPFSGRVTETKVKRWESVPEGKEL
                     LAIYDDSAFELEMIVPSRWLVWLKQGSAFQVTLDETGLSYPAEISRLSSAIDPVSQSV
                     KVFGRITQSTAGLLPGMSGVAQIVPPDAGSVSP"
     gene            795381..796736
                     /locus_tag="PC1_RS03420"
                     /old_locus_tag="PC1_0680"
     CDS             795381..796736
                     /locus_tag="PC1_RS03420"
                     /old_locus_tag="PC1_0680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010282274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_012773380.1"
                     /db_xref="GI:502366432"
                     /translation="MTERNTTAAQTEQDIRLALLAELLQLQSRARARETLDELAFFIV
                     NETHNVVKYRQALLWDCDKQRLQAASGLASLDHNAPFCTEFSRLCRQWQEEGRQTQAL
                     QCRELPADDQILWQEHLPEFLLWLPLRLPQGDAPLVLVLARDSAWLPAEIVLLEKLAD
                     AYAHAWSSLLKQRRRQTNTSPKKRRLILAGIVALVLILLIPVRQSVLAPAEIVAHRPV
                     MVRAPVAGVVDDILVRPNQSVSANQPLVRLDVRELENRLESARQAFATADAQYRQAQQ
                     QALFDANSKASLAVLQSRREQAQSDMDFLQRQQERMQLTSPRDGVAIFDDSNDWIGRS
                     VAVGERIMMIADPHDVELEIQLPAADAIALENGADVRLFLNVAPNSAQDARLEQIGYR
                     AAPTPDNVMAYRLRARFTQDDPQLRVGLKGTAKLYGKRTVLFVYLLRKPLASLRVWLG
                     V"
     gene            796739..798868
                     /locus_tag="PC1_RS03425"
                     /old_locus_tag="PC1_0681"
     CDS             796739..798868
                     /locus_tag="PC1_RS03425"
                     /old_locus_tag="PC1_0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="WP_012773381.1"
                     /db_xref="GI:502366433"
                     /translation="MAGGATPAAGLSPLRDELILHAGPANRDGSPSWTLEDPLRGLYF
                     RIGWAEMAMLSRWSMGNAAQIVAEVNQASALTLDDSDVQYFNRFLQANSLTRVSGDDA
                     LAQFSRQVEQSRVSIWRKLLKNYLFFRIPLWHPDRFLGATLRWVEPFFSRTFLKLTLL
                     VAVLGLFLAGRQWETFKHTFLHFFTLEGAALAGLTLCFTKILHEFGHAYTCKRFGARV
                     ATMGVAFLVMMPVLYTDTSGSWKLTRRRQRMAIGAAGMMTELVLAAWATLAWSFLPDG
                     MLRSAAFMLATTTWIMTLAINLSPLMRFDGYFLLSDGLQVPNLQNRGFAIGRWQMREW
                     LFGLGDAPPEHFPRWLQRTLVGYAFAVWIYRFFLFTGIAILVYHMAFKLLGMLLFAIE
                     IGYFVVMPVVNEVREWSKRRKDYRMNRNMTTTLTVSAVVLLLLMIPWQRGVYAPALLR
                     AEQQSSLYMPVPAMVQRIEVQVGQPVRAGQTLFTLSSDALVHERQQLERQIATLNWQS
                     AFQVFNKEAAGDHLRVKQEHDAALQKLQVLQRQSEQLTVRAPIDGVVADMATPLATGE
                     WLGQGEWLAVVTKPTGGLVEAFVSEKDWQRLHTGAKGTFYLQDVSRSSLPLTIVEIAS
                     TATRDLNAAPELASIYGGDIATLSDAQRKLHPEQAVYRVLLSLPEDYRAQPQVLRGTV
                     VMDGEAQSLLVRGWKVMSAVLIRELSF"
     gene            799229..800926
                     /locus_tag="PC1_RS03430"
                     /old_locus_tag="PC1_0682"
     CDS             799229..800926
                     /locus_tag="PC1_RS03430"
                     /old_locus_tag="PC1_0682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010282278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnogalacturonate lyase"
                     /protein_id="WP_043881712.1"
                     /db_xref="GI:762767033"
                     /translation="MLAPYSYSAQDNAVSLSVSGLNTVLDNGLLSVAFGEDGSAVRMV
                     TGGKNIVTNLSGAARDPSKTRSAYLDYYINDVHAKGVKDFVPERVEVLRNDREMAHVA
                     YIDERDGLLRLEYHLIMRRGVSGLYSYVVAENRGSQDVKVSELRNVYRFDPARLDHLY
                     NGDRQGKPLLYSQLEASPKVQDETWRLPDGSIYSKYDFAGYMRAAPFWGVFGNGVGAW
                     LIHGNREYFSGDALKQDLLVHQDAIILNYMTGSHFGTPDMVAPPGWKKFYGPWLLYIN
                     QGDTEQMLADVRRQALTETVSWPYQWVDDSRYVRDRTQVSGRVASQQPMTVVLSSSLD
                     EPFDVQTRGYSYQATTDTEGNFAISHVRPGNYHLAVYANSGTQPGILAEQTLSVSGDK
                     QALPVIALPKAEPVIWAIGQANRQASEFRFGDEARNTLWQHEVPANLTFDIGRSDYQR
                     DWYYAQTKPGKWDICFALQPEKKTYFLNIALAAASNSGMSEPTLPQLAVAVNGRTLET
                     LTYENDKTIYRGALQSGRYHLARIPVSSHLLKNGNNTITLQLKGGSVMYDVVTLSEE"
     gene            complement(801000..802658)
                     /gene="actP"
                     /locus_tag="PC1_RS03435"
                     /old_locus_tag="PC1_0683"
     CDS             complement(801000..802658)
                     /gene="actP"
                     /locus_tag="PC1_RS03435"
                     /old_locus_tag="PC1_0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010282283.1"
                     /note="member of the sodium:solute symporter family;
                     cotranscribed with the acs gene which encodes acetyl
                     coenzyme A synthase; mutations affect acetate uptake;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation/acetate symporter ActP"
                     /protein_id="WP_012773383.1"
                     /db_xref="GI:502366435"
                     /translation="MKIRFMMLFGLLTLPVLAWAADALTGDVQRQPLNIQAIVMFLLF
                     VGGTLYITYWASKKTRSRSDYYTAGGNITGFQNGLAIAGDYMSAASFLGISALVYTSG
                     YDGLIYSLGFLVGWPIILFLIAERLRNLGRYTFADVASYRLQQRPIRSLSACGSLVVV
                     ALYLIAQMVGAGKLIELLFGLNYHVAVILVGILMVMYVMFGGMLATTWVQIIKAVLLL
                     FGATFMAVMVMKSVGFSFDALFKQAMAVHPKGASIMSPGGLVSDPISALSLGLGLMFG
                     TAGLPHILMRFFTVSDAKEARKSVFYATGFMGYFYFLTFIIGFGAILLVSANPEFKDA
                     TGALIGGNNMAAVHLADAVGGDFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYSN
                     VIKKGKATERDELKVSKITVLVLGVVAISLGILFENQNIAFMVGLAFSIAASCNFPII
                     IISMYWSKLTTRGAMIGGWAGLLTAVILMILGPTIWVKILGHATPIYPYDYPALFSML
                     VAFIGIWFFSITDRSEAGQQERARFHAQFVRSQTGVGASKGSSH"
     gene            complement(802655..802966)
                     /locus_tag="PC1_RS03440"
                     /old_locus_tag="PC1_0684"
     CDS             complement(802655..802966)
                     /locus_tag="PC1_RS03440"
                     /old_locus_tag="PC1_0684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010282284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773384.1"
                     /db_xref="GI:502366436"
                     /translation="MNDAIYQRIESNPLFRELVNKRQRFAVFLSLIMLVLYVGFILLI
                     AFAPGWLGTPISPGSSITRGIPIGVGLIAISFILTGIYVYRANGEFDRLTKQLLDEVK
                     Q"
     gene            complement(803092..805053)
                     /locus_tag="PC1_RS03445"
                     /old_locus_tag="PC1_0685"
     CDS             complement(803092..805053)
                     /locus_tag="PC1_RS03445"
                     /old_locus_tag="PC1_0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914219.1"
                     /note="Acs; catalyzes the conversion of acetate and CoA to
                     acetyl-CoA; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthetase"
                     /protein_id="WP_012773385.1"
                     /db_xref="GI:502366437"
                     /translation="MTQHNKHAIPTAIAENALINAQQYENMYRLSVDDPAAFWGEQGK
                     IVDWIKPYKTIKNTSFDPGHISIRWFEDGTLNVAANCLDRHLAERGDQTAIIWEGDDA
                     TESKKVTYRELHQSVCRFANVLKSQGVKKGDVVAIYMPMVPEAAVAMLACARIGAIHS
                     VIFGGFSPEAISGRIIDSSAKLVITADEGVRAGRVIPLKKNIDEALKNPNVTTISSVI
                     VFRRTGKIGEWKEGRDLWWHDLVEKADDHCPPEEMNAEDPLFILYTSGSTGKPKGVLH
                     TTGGYLVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVP
                     TWPDARRMAQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTSRESLRIMGSVGEPINP
                     EAWEWYFNKIGNGKCPIVDTWWQTETGGFMITPLPGAIEAKAGSATRPFFGVQPALVD
                     NLGNPQEGTAEGNLVIVDSWPGQARTLFGDHDRFEQTYFSTFKGMYFSGDGARRDEDG
                     YYWITGRVDDVLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHHMKGQAIYAYITLN
                     HGEEPSSELYTEVRNWVRKEIGPIATPDILHWTDSLPKTRSGKIMRRILRKIAAGDTS
                     NLGDTSTLADPGVVEKLLEEKQAMSTASQ"
     gene            805956..806348
                     /locus_tag="PC1_RS03450"
                     /old_locus_tag="PC1_0686"
     CDS             805956..806348
                     /locus_tag="PC1_RS03450"
                     /old_locus_tag="PC1_0686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="global regulatory protein"
                     /protein_id="WP_012773386.1"
                     /db_xref="GI:502366438"
                     /translation="MSLIFGRNEILGMLSQPVQNDRRAVAVIDEKCKVVCANSAFNAH
                     FGLRAEMNTPVSIDDVLPINVKFAYHDFITNSNVLSTRVVSDLLSDGFAKKQLSTLSF
                     SKLNVENRVLSLLILNQDTVEPSANLAS"
     gene            807087..809480
                     /locus_tag="PC1_RS03455"
                     /old_locus_tag="PC1_0687"
     CDS             807087..809480
                     /locus_tag="PC1_RS03455"
                     /old_locus_tag="PC1_0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel"
                     /protein_id="WP_012773387.1"
                     /db_xref="GI:502366439"
                     /translation="MVKFRTHMLARALRAGVLGASFASVLPMAAVYAASVAPVQQYAV
                     SSGPLNQVLNQFAQQAGVLLSYDPALVAGKRGAGLQGNYSVEQGFQQILSSSSLSAQY
                     SADGSVTLVQRTATAPVPVTAPATTKNDRIVVTAPPNTAMKLDVPISETPRAVAVVTE
                     KQIEERGAQKIDQALRYSSGILATPYGPDNKAEWVTIRGFSDQSRFQNGLATLNEDGF
                     YGQQIEPFGVERIEVLKGPASVLYGQNPPGGLVNVITKRPTRLPQGKVELEYGSNDYR
                     HLAVDSAGPLNDDGSVLYRVVALARDTSGEVDFSKSKRFYLAPSVTFLGENTELTVLA
                     SYMDTKSDMTNGFKLPYGTLHNTPFGKVGYKTSLGEPGINNHDTRQFNLGYEFTHHLN
                     DTWTFHQNLNYSYLNMDLRGAYVLGMYTDPVTNVVSDRLANRGLTYRDGFAQNWATDN
                     RLVGEWQWENIENTLLLGFDYRRANTQSRDANLYSFGAPIDIFNPVYGNYTSPDSQLF
                     DHRSGRHQTGYYVQNQIKYDDRLIFLLGGRYDVAKSRDRNFSSGADTRTDDTKFTKTA
                     GVMYLFDNGISPYISYSESFLPVSGRDSYERPYVPEEGQQTEIGVKYTPEGFNGYASA
                     ALFNLEQKNVKTTDPSNPSMTIQAGEARSRGLELELSGEVYTGLTLTANYTYNEVETT
                     KSGTVGEVGKRLPGLPEHIMSGWATYAFNGKLEGLSIGSGVRYVGSSYGDIANTADMK
                     VPAYTLWDAMIAYDFSKDWRLQVNATNLTNREYVSACNYWCYYGEGRNISANVSYRW"
     gene            809654..810178
                     /locus_tag="PC1_RS03460"
                     /old_locus_tag="PC1_0688"
     CDS             809654..810178
                     /locus_tag="PC1_RS03460"
                     /old_locus_tag="PC1_0688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010295759.1"
                     /note="Member of the extracytoplasmic function sigma
                     factors which are active under specific conditions; binds
                     with the catalytic core of RNA polymerase to produce the
                     holoenzyme and directs bacterial core RNA polymerase to
                     specific promoter elements to initiate transcription; this
                     sigma factor regulates the genes for iron dicitrate
                     transport; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_012773388.1"
                     /db_xref="GI:502366440"
                     /translation="MKSPAAVCPNQPETLNVQQIYHDHHAWLQAWLRRRLGCSQQAAD
                     LAQDTFLRLICQPQGDRIREPRAWLTTVAHGLMVNHWRRKDIENAYLQVLAEQEFHFA
                     PSLEQQAMVVDALLAIDQMLATLPGKVRQAFLLVHLDGLTYRQVAEQLAVSERMVKKY
                     MAQAMLNCLLCQDL"
     gene            810175..811122
                     /locus_tag="PC1_RS03465"
                     /old_locus_tag="PC1_0689"
     CDS             810175..811122
                     /locus_tag="PC1_RS03465"
                     /old_locus_tag="PC1_0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron dicitrate transporter FecR"
                     /protein_id="WP_012773389.1"
                     /db_xref="GI:502366441"
                     /translation="MISSITSSIPKDVLYAAAEWYATLYDEDCSEHDRQAWQRWLRQD
                     DTHQLAWQQVEQIHARFHAVDSQLASSVLSKRGEERRRMLKLLAIVSLTGGAGFSLPW
                     ESYAADYRTGTGETRELSIETGMTLWLNTDSALNQQGSPALSQPLTFQLIKGELMLDN
                     QTAHAARLTTPHGDLAASAHTSQLALRYTSAHSVLSVFSGEVLLQTAVPAARRVTAGQ
                     QVIFTRDKSSEPTPVENFRQSWRKGQLVADNMPLGQFINEVSRYHSGYFHVDSAVTTL
                     RISGVFPLHETDRLLDAVARTLPVKVSRRFSWWVDIQPS"
     gene            811305..812315
                     /locus_tag="PC1_RS03470"
                     /old_locus_tag="PC1_0690"
     CDS             811305..812315
                     /locus_tag="PC1_RS03470"
                     /old_locus_tag="PC1_0690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773390.1"
                     /db_xref="GI:502366442"
                     /translation="MQLLNLKQARLLSFFFIMGGLLILLPLRLLACFIAGFLVYEIVN
                     LLTPYFQRVISGKRARWIVVAVISTLVVSLLSLLFGSLVGLLMQEMKDTAAFNVRIGY
                     ILNDIQQQVAHYLPGYLPVSIEELQRELLQWVQAHIVMLQNMGKSFLHGFVTMLIGMV
                     LGAIVSLYNVDQDTEKPLLKAELLRRVTLLSASFRNIVFAQVKISVVNTVLSAIFILG
                     ALPLCGIHLPFAKTLVVLTFVFGLLPVIGNLISNSIVFLSGLSLSLPIALVALVYLML
                     IHKLEYFLNAQIVGTRIKAHAWEILLAMLVFEAAFGLAGVIAAPIYYAYLKSELKEAS
                     LI"
     gene            complement(812487..814013)
                     /locus_tag="PC1_RS03475"
                     /old_locus_tag="PC1_0691"
     CDS             complement(812487..814013)
                     /locus_tag="PC1_RS03475"
                     /old_locus_tag="PC1_0691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012773391.1"
                     /db_xref="GI:502366443"
                     /translation="MNKPISFKHTFCYGSANLLGSGALAISGAWLMYFYTTFCGLTLV
                     QAAAIFSVASIIDAISNPIMGYISDNFYNTRIGRRFGRRRFFILLGVPLVLVYPMLWV
                     DGFGFWYYLATYVLFELIYTSIMVPYETLATEMTSDFKLRSKLTGSKAIFGKIANFLA
                     AFIPGQFIAVYGKDSSTPFFYTGLVYGAIMCAAMIALYMTSWERPVNEIVRESTSSLW
                     QAMKKLSVDMVSTFRLRIFRKHLGMYLFGFGAEWLFASAFTYFIVFGLKQNTALVSHL
                     NSFSSVMQLISTAAFIGICVKMGFARPFRLALMIVIVSVIAYAALYFANWSEDMTIFV
                     LFAITAVFGLSTGGIYYIPWTVYTFLADVDEVLTGRRREGIYAGAMTFAGKMVRSVIV
                     FAMGWTLSQFGFVSGQSAQPESAVQAIVGVFSLGVIGLALVAIYYTTQMKLDRKNHAI
                     LLEEIARIKAGGAIADVPPHARAVAEELTGWEYEKCWGNNPLGVQSEETKPQVATAQH
                     "
     gene            814397..814771
                     /locus_tag="PC1_RS03480"
                     /old_locus_tag="PC1_0692"
     CDS             814397..814771
                     /locus_tag="PC1_RS03480"
                     /old_locus_tag="PC1_0692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773392.1"
                     /db_xref="GI:502366444"
                     /translation="MSHLMIYAVIYVVFIAVVGLFAFQAWLPSSAPRGLRDRAGILVG
                     VLRCVTLFLVVSAMQILFPNSLLDKLVWLIAAALLVIAVIGGGMSWSSLPWLDETKGK
                     SRTLALGVQSALYLGLLGFIVI"
     gene            complement(814764..816251)
                     /locus_tag="PC1_RS03485"
                     /old_locus_tag="PC1_0693"
     CDS             complement(814764..816251)
                     /locus_tag="PC1_RS03485"
                     /old_locus_tag="PC1_0693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010282328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-mannonate oxidoreductase"
                     /protein_id="WP_012773393.1"
                     /db_xref="GI:502366445"
                     /translation="MTDKIKNIATCELPASVQFPRYDRKALKPRIVHIGFGAFHRAHQ
                     ALLTDRVLNMVGGDWGICEVVLFSDDTMINALRQQDHLFTVLEKAATSNQPIVVGAVC
                     ESLHAKIEGINAIIEKLAAPETAIVSLTITEKGYCMDGTSGKLDRTNKLIQQDLIDPR
                     RPVSVPGLLAEALRLRHERGIAPFTVLSCDNVPENGKTAKAAVLESAGINDRNLIDWI
                     EAQVSFPNTMVDRIVPAATPETLQEIADHLGVADPCAIACEPFIQWVIEDHFTAGRPE
                     WEKAGVQLVHDVLPFEEMKLRMLNGSHSFLAYLGYLAGYDHVSDCMNDENYRRAVSHL
                     MLLEQAPTLSVVDIDLKDYAVQLLTRFSNPALKHRTWQIAMDGSQKLPQRMLESLRWH
                     VSNGGDYRCLALGIAGWMRYVSGKDDAGNPIEIRDPLADKLRHVVEETSDSAERVSAF
                     LNIRSIFGEDLPANHDVFNAIAQAYLKLRDHGAKNTVAALAQDFK"
     gene            816574..817854
                     /locus_tag="PC1_RS03490"
                     /old_locus_tag="PC1_0694"
     CDS             816574..817854
                     /locus_tag="PC1_RS03490"
                     /old_locus_tag="PC1_0694"
                     /EC_number="2.5.1.49"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773394.1"
                     /note="catalyzes the formation of L-methionine and acetate
                     from O-acetyl-L-homoserine and methanethiol; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-acetylhomoserine
                     aminocarboxypropyltransferase"
                     /protein_id="WP_012773394.1"
                     /db_xref="GI:502366446"
                     /translation="MKLESLALHHGYESEATTKSAAVPIYQTTSYTFDDTQHGADLFD
                     LKVAGNIYSRIMNPTNAVLEQRLAAIEGGIGALVLSSGMAAITYSLQALTQVGDNIVS
                     TSQLYGGTYNLFAHTLPRQGVEVRMASFDDFTTLESLIDERTRAVFCESIGNPAGNIV
                     DIAKIAEIAHRHGVPVIVDNTVATPVLCRPFEHGADIVVHSLTKYIGGHGTTIGGAII
                     DSGKFDWVANKARFPLLNEPDPSYHGVVYTDAFGPAAYIGRCRVVPLRNTGAALSPHS
                     TFLLLQGLETLSLRIERHCSNAEALASYLNQHPLVTWVNYGALPDSPYKANCDKITSG
                     KASGIISFGIKGGKAAGGHFIDALKMILRLVNIGDAKSLACHPASTTHRQLNAEELAK
                     AGVSEDLVRISVGIEHIDDIIADVAQALDASQKQ"
     gene            complement(817914..818984)
                     /locus_tag="PC1_RS03495"
                     /old_locus_tag="PC1_0695"
     CDS             complement(817914..818984)
                     /locus_tag="PC1_RS03495"
                     /old_locus_tag="PC1_0695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transpeptidase"
                     /protein_id="WP_012773395.1"
                     /db_xref="GI:502366447"
                     /translation="MSIRAIFTLVLAAAAFSQAAFAVVYPLPAANSRLIGENIEITVP
                     EDSTQPLEHFAAQFQMGLSNMMEANPDADVYLPVPGSKMVIPHQLILPDAPREGIVIN
                     SAEMRLYYYPKGSKTVVVLPIGIGELGKDTPINWTTSVQRKKAGPTWTPTAKMHAEYA
                     ARGETLQKVFPAGPDNPMGLYALYIGNLYAIHGTNANFGIGLRVSHGCVRLRADDIKY
                     LFDHVPVGTRVQFINEPVKATVEPDGSRYVEVHNPLSRTVEEFHSDSPAPISMTPQVS
                     KVLADASVNTSEVDQAIQRRSGMPTKINGLIEQATPAIPVESAAAPVAPEVQPQDSLN
                     AEQNAAPVESQPTTTATDANRS"
     gene            complement(819168..819965)
                     /locus_tag="PC1_RS03500"
                     /old_locus_tag="PC1_0696"
     CDS             complement(819168..819965)
                     /locus_tag="PC1_RS03500"
                     /old_locus_tag="PC1_0696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_012773396.1"
                     /db_xref="GI:502366448"
                     /translation="MKVALGQFAVDREWQQNATTIAEFMSAAQQNGADLLVLPEGVLA
                     RDITNPNMVLTAAQPLDGPFISHLLEASKGNNLTTMLCVHIPNGEGKVWNTLLALRNG
                     EIVAQYRKLHLYDAFSVQESENVLAGEEIPPLLTIAGLNVGLMTCYDIRFPELARRLV
                     LDGADVLVLPSAWIKGPLKEAHWELLVRARALENTTYLVAVGECGVKNIGNSMVVDPL
                     GVVVVQAPETPALIYADIEPERLAYARQILPVLANRRFQKPTLDGEN"
     gene            complement(819987..820523)
                     /locus_tag="PC1_RS03505"
                     /old_locus_tag="PC1_0697"
     CDS             complement(819987..820523)
                     /locus_tag="PC1_RS03505"
                     /old_locus_tag="PC1_0697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914230.1"
                     /note="B-type di-heme cytochrome with a major
                     alpha-absorption peak at 561 nm and a minor peak at 555
                     nm; Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_012773397.1"
                     /db_xref="GI:502366449"
                     /translation="MKGKFAPSQIALHWLVFLLLVVTYATIELRGFAERGSLLRTVMI
                     VTHFSCGVTILVLMLARLFLRHRHTSPAITPQPQRWQSALGSLTHAVIYLLFITLPIL
                     GVASRYYNGRDWMLFGISMPTAATPNFDLAETLIGWHETLAPLGYWLIAAHTAAALFH
                     HYVMKDNTLLRMMPAKRD"
     gene            complement(820808..824341)
                     /locus_tag="PC1_RS03510"
                     /old_locus_tag="PC1_0698"
     CDS             complement(820808..824341)
                     /locus_tag="PC1_RS03510"
                     /old_locus_tag="PC1_0698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate-flavodoxin oxidoreductase"
                     /protein_id="WP_012773398.1"
                     /db_xref="GI:502366450"
                     /translation="MITTDANNAVASVAWRTNEVIAIYPITPSSSMAEQAAAWSSDGG
                     LNIWGDTPRVVEMQSEGGAIATVHGALQTGTLATTFTSSQGLLLMIPTLYKLAGELTP
                     FVLHVAARTVATHALSIFCDHSDVMAVRQTGCAMLCASNVQEAQDFALISQIASLNSR
                     LPFIHFFDGFRTSHEINKIEPLGDEVIRQLLPQQAIDAHRERALTPERPVIRGTASNP
                     DTFFQAREATNRWYDAAYDHVEQAMNNFAAATGRQYQPFEYYGHPEATKIVVLMGSGV
                     GTCEEVVDTLLMRGEKVGVVKIRLYRPFSAKHLLAVIPQTAKSIAVLDRTKEPGALAE
                     PLYLDVMTALAEAFSAGERSLMPRVIGGRYGLSSKEFTPQCVQAIFNELALANPRPRF
                     TVGIYDDVTNLSLPLPEQHFPGNASLEALFYGLGSDGTVSATKNAIKIVGETTPMFVQ
                     GYFVYDSKKAGSLTVSHMRVGPHPINSAYLIDQADFVACHQWQFIDKYSMVERLKPGG
                     VFLINSPYSSDDLWHRLPQEVQAELNQRNARVYCINAAKIARECHLGARINTVMQMAF
                     FHLSQILPADVAVEKLRTAIAKSYGSKGQELVERNWQALSATLEALAEVQLEAVNPDS
                     PQRPPVVSDAAPDFVKTVTAAMLAGLGDTLPVSALPPDGTWPTGTTKWEKRNIAEEIP
                     LWQPQLCTQCNHCVAACPHSAIRAKVVQPDAMENAPASLQSLDVKARDMRGQKYVLQV
                     APEDCTGCNLCVEVCPAKDRQNPEIKAINMESRLDNLTAEKENFDFFLQLPEIDKSTL
                     ERIDIRTSQLISPLFEYSGACSGCGETPYIKLLTQLYGDRLLVANATGCSSIYGGNLP
                     TTPWTTDANGRGPAWANSLFEDNAEFGLGFRLSVDQHRQRAVRLLNKLAPQLPPDLVN
                     ALQEESIAPDLRRQQIEQLRGLLSAINDTDANVLASEADHFVDKSIWLIGGDGWAYDI
                     GYGGLDHVMSLSENVNVLVLDTQCYSNTGGQQSKATPLGAVTKFGEKGKRKARKDLGI
                     NVMMYGHVYVAQISLGAQLNQTVKAIQEAEAWPGPSLIIAYSPCEEHGYDLAFSHDQM
                     RQLTATGFWPLYRFDPRRAEEGKAALVTDSRPPSSSLSETLLKEQRFRRLNSMMPEET
                     AQLYEEAELDLRRRFDFLTMMAGKAEKNPQE"
     gene            824728..825153
                     /locus_tag="PC1_RS03515"
                     /old_locus_tag="PC1_0699"
     CDS             824728..825153
                     /locus_tag="PC1_RS03515"
                     /old_locus_tag="PC1_0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010295790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773399.1"
                     /db_xref="GI:502366451"
                     /translation="MANDEIKNKLVSVLASQQAQGKTPEQAVDHILQALGGRAGDVSR
                     ISVLTSTLIADVLYTVYQDVITHQQVAVILRKLGYAARDIAVALHAIYPQVSVQDVGQ
                     LLQSPEIYPTIDRVALLDALTYAHFSKVESEQAADALGV"
     gene            complement(825232..826800)
                     /locus_tag="PC1_RS03520"
                     /old_locus_tag="PC1_0700"
     CDS             complement(825232..826800)
                     /locus_tag="PC1_RS03520"
                     /old_locus_tag="PC1_0700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_012773400.1"
                     /db_xref="GI:502366452"
                     /translation="MSTAHSPWNPDLGDGRYKNPILCADYSDPDIVRVGDDFYMVSSS
                     FNHMPALPILHSQDLVNWTLINHVFSRFDLPEYEHFQPGKGVWAPSIRYHAGKFWVFF
                     STPDDGIFMSQADDPKGEWSKPHCLKQAKGWIDPCPFWDDDGTAWLIHAFAFSRSGKK
                     HLLQLCKMAEDGRSLLDEGRIVVDGRATQPTIEGPKLYKRNGWYYIFAPAGGVPTGWQ
                     TVLRARSLEGPWQSRIVLHQGSTSVNGPHQGGWVELDNGESWFVHFQDRHAYGRVVHL
                     QPMRWQDDWPLIGEQHNVQGLGQPVLEATKPCVNTPIVMQQPSTSDDFSSATLGRQWQ
                     WQANPDERWLALTHPGLQLFCQPMPTRAGEPSWYDVPNLLMQKFPAEEFEFTTQLTPA
                     LEQVGDRCGLMIYGERFAFLGIEKGAEGLELVTGFGWMSDAQQLEQHQRRLAVLPEQQ
                     NITLRVTVRQNAICQFSWRVDNGEYSVLDDSFAAGPGKWVGAKVGLYALTTASGNSGG
                     HARVKEVNVTAIEQ"
     gene            complement(826853..828289)
                     /locus_tag="PC1_RS03525"
                     /old_locus_tag="PC1_0701"
     CDS             complement(826853..828289)
                     /locus_tag="PC1_RS03525"
                     /old_locus_tag="PC1_0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="symporter"
                     /protein_id="WP_012773401.1"
                     /db_xref="GI:502366453"
                     /translation="MTNNNKLSVAEKIGFGMGDAACGIVYSSVTMFLTYFYTDIYGIS
                     AAAVGVMFLVTRVLDAIVDPLIGIIADRTKTRWGHFRPWLVWFAVPYAVIAVLAYTTP
                     ELNGTGKLVYAYITYTLLMLFYTFINIPYCSLGGVITSDEKDRISAQSYRFTISSMAG
                     LLVSVGTLWLVDWIGGTNKQLGYQGTMMIMGCLAVVMLFFCFFTTQERINPAVDKNQN
                     VWDDVRNLLSNDQWRIVAIITFFSSMAGVMRGAATLYYATYLMVGPEQGSAAGTAMKS
                     AFITTSVVGTIIGAMMAGYFGKRFSSISLFKNINLLLVFVGVILFMVPPQWLAVVFPL
                     YFLIGFFHQMYQPFKWNMMANAADYGEWKTGRRITGLSFSGNLFALKLGMAVAGALVG
                     FSLGWFGYVAGSPTQTPLATAGIIGLLSIGPSLSYLVLYWLVRFYKLDDKTMENIQAD
                     LAKRHSTSDRVPESELPVDQGLTPKGAA"
     gene            complement(828648..829580)
                     /locus_tag="PC1_RS03530"
                     /old_locus_tag="PC1_0702"
     CDS             complement(828648..829580)
                     /locus_tag="PC1_RS03530"
                     /old_locus_tag="PC1_0702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012773402.1"
                     /db_xref="GI:502366454"
                     /translation="MNNMHLDLRRIDLNLLVVFNSVYQHRSVAAAAKELAMSASAVSH
                     ALTRLRNTFSDELFFRVGNTMHPTVLADDIAEPIAESLALLTQGLTPRPHFNPARSSE
                     SFTFSITDYTAFSVFPTLMAQMEKLAPHIKFNLVYSPQKVAITDLLAGKIDFALGFTD
                     MTQAENREIEEIDWIEDSYVIITAAGYPSGKTLTLDDYLAARHLVVTPWNESRGVIDY
                     ALDKLNKKRHIALKTPSMMSAPFIIADSTLIMALPHNIATIFAQLLPLQIHPLPFTVP
                     SYRVKIYSHRRNSRSEASQWIKNLLHSLVTHPIS"
     gene            829686..830168
                     /locus_tag="PC1_RS03535"
                     /old_locus_tag="PC1_0703"
     CDS             829686..830168
                     /locus_tag="PC1_RS03535"
                     /old_locus_tag="PC1_0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_012773403.1"
                     /db_xref="GI:502366455"
                     /translation="MNIVIRPAQKSDASVILDLIIELAVYEKARHEVLASLEDIENSL
                     FGEGATAETLICEIDDKPVGYAIFFMSYSTWLGKYGIYLEDLYIAQAYRNAGAGKALL
                     KQVACLAKERQCGRLEWSVLDWNQPAIDFYKSIGAKPQDEWVRYRMDEKGIADFVTAS
                     "
     gene            complement(830212..830838)
                     /locus_tag="PC1_RS03540"
                     /old_locus_tag="PC1_0704"
     CDS             complement(830212..830838)
                     /locus_tag="PC1_RS03540"
                     /old_locus_tag="PC1_0704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010295795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter"
                     /protein_id="WP_012773404.1"
                     /db_xref="GI:502366456"
                     /translation="MSLHLWLAYTGIIIALIAIPGPSALISMSHGLRYGASRATATVL
                     GGVSAAMILMSCSALGLGAILAASTTAFMVLKIIGAVYLIWLGIASWRSKDMSTAEQD
                     VQEASAPGWFPLFRKGFLVGISNPKDLLFFAALFPNFIDTNAPHALQLIILAVTWAVF
                     DFSIMFIYACTGRRLSGLFSNPRRIKLFNRSTGGIFILAGTTLAASTR"
     gene            complement(831106..831888)
                     /locus_tag="PC1_RS03545"
                     /old_locus_tag="PC1_0705"
     CDS             complement(831106..831888)
                     /locus_tag="PC1_RS03545"
                     /old_locus_tag="PC1_0705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010282351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc transporter"
                     /protein_id="WP_012773405.1"
                     /db_xref="GI:502366457"
                     /translation="MFRKLYLLKFVAIFSISPFVFAKSDILRIGVDLTYPPFQSLDKN
                     GNPSGFDIEVTDAICQSINAKCDYIVNTFDSQIPALLAKKIDIIVPLGVTRKRKESID
                     FSDYVFHVPTKLVARKEANLLPQAELLRGKNIAVQQGTIQEAYANKYWLPAGVIVKSY
                     PDQEAIYEDLYSGRVEGALCPSVAVEFGFLKTPQGKNFELKGPEVTDADLFSLGSAYG
                     IRKEDTKTKQLINQGLKDIVQKGLYAKIQKRYFGDIDLSVKE"
     gene            complement(832253..832831)
                     /locus_tag="PC1_RS03550"
                     /old_locus_tag="PC1_0706"
     CDS             complement(832253..832831)
                     /locus_tag="PC1_RS03550"
                     /old_locus_tag="PC1_0706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012773406.1"
                     /db_xref="GI:502366458"
                     /translation="MRRLYKKTITYLLSKDFLVTLLVLSIMLAIFWYMLWASHLSRRT
                     ILIETFPELTIYLTFGVVLGLIFAGRALYSRSVKKKLKHTLEMFFGGFVLGFLSIVNI
                     FDVYVYLFPDEVISYTSDYKIVFPGPSTGKSSRCEAGIWVKDVHTGQFKQLCSNREML
                     FKKRRQGMDALWITARVNKLGTYIVDYRFTYK"
     gene            complement(833721..834005)
                     /locus_tag="PC1_RS03555"
                     /old_locus_tag="PC1_0708"
     CDS             complement(833721..834005)
                     /locus_tag="PC1_RS03555"
                     /old_locus_tag="PC1_0708"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RelE toxin"
                     /protein_id="WP_012773408.1"
                     /db_xref="GI:502366460"
                     /translation="MSYKLEFEEHALKEFKKLGAPVREQFTKKLKEVLRNPHVPANRL
                     HGMADCYKIKLRSAGYRLVYQVLEHEIVVLVLAVGKRERSEVYQAAKDRL"
     gene            complement(833995..834246)
                     /locus_tag="PC1_RS03560"
                     /old_locus_tag="PC1_0709"
     CDS             complement(833995..834246)
                     /locus_tag="PC1_RS03560"
                     /old_locus_tag="PC1_0709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death protein"
                     /protein_id="WP_005973616.1"
                     /db_xref="GI:492814745"
                     /translation="MSVQPILANAAVSISDFKKSPNAALKEANGEPVAVLTNGRISGY
                     YVSPETWEALADYQEDIELAKIARSRMKGKRVKVDLDEL"
     gene            complement(834509..836836)
                     /locus_tag="PC1_RS03565"
                     /old_locus_tag="PC1_0710"
     CDS             complement(834509..836836)
                     /locus_tag="PC1_RS03565"
                     /old_locus_tag="PC1_0710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_012773409.1"
                     /db_xref="GI:502366461"
                     /translation="MAHLTVTQTVKRASGHWPQLLPAVGIRIDATGQHTACPMCEGKD
                     RFRFDNKEGRGTWFCNQCGAGDGLNLVEKALNLTPTQAALKVGAWLGDLPCSPTAPTS
                     DDADNEAARQRAAVQAQAKLKEAVTQPGNGYLSAKGWPDIAVPTLQGKPLRVGGITYQ
                     PGDVLVPLTTPDGEVANLQLINTQGDKRTLKGGQVKGTFHCFSGKQASVIWLAEGYAT
                     GLTLHQLTDDEVYVALSANNLPSLARELKTRHPAVTLLIAADRDENGTGQTKAEQAAA
                     AVNGRVALPPVFGDWNDVYLAEGADATRQHLNAFTQPEKASPFASLGEAEFKAMSASE
                     KAEKIRDHYRDTLAIDAFGETFFQYQNGAWKVLSYRLLSRDIAALFQKIHAPFTASGI
                     GSVLDTLKLIIPMQEKPQRRLIGFRNGVFDTASGQFKPHRREHWLNTVNDVDYTPFKA
                     GENLADNAPHFWRWLTRAAGNSADKQERILAALFMVLANCYDWQLFLEVTGPGGSGKS
                     ILAEIATMLAGEDNTTAATINTIESSRERSSIIGFSLIVLPDQEKWSGDGAGIKAITG
                     GDAVMVDPKYRDAYSTRIPAVILAVNNSPMRFSDRSGGVSRRRVIIHFGETIPASERD
                     PKLKEKIRAELAVIVRHLMKRFADPNDARTLLQAQQHSAEALEIKRQADPLVDFCGYL
                     LAHGDTTGLYMGNANITPRNPRKYLYHAYLSFMESHGHQKPISLTAFGKVLPNMMSEY
                     GQTYLKGRTNQGIQTNLELKDESDADWLPKREIAR"
     gene            complement(836847..837188)
                     /locus_tag="PC1_RS03570"
                     /old_locus_tag="PC1_0711"
     CDS             complement(836847..837188)
                     /locus_tag="PC1_RS03570"
                     /old_locus_tag="PC1_0711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773410.1"
                     /db_xref="GI:502366462"
                     /translation="MNSNNQSCIPLEVRTAVYRRAVAQAYLDTCRETGIALNCNLTEL
                     EIAIALELEGAHVREHGIATGMEIACAMLGDMVQPTLLTDKPRLTALGHIIMGELCQC
                     ATAATPTTTLH"
     gene            837227..837442
                     /locus_tag="PC1_RS03575"
     CDS             837227..837442
                     /locus_tag="PC1_RS03575"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043881713.1"
                     /db_xref="GI:762767036"
                     /translation="MGHDVAYLVSQQRHQCGHIIGWQRIGFGGGHAALLGVQHIEKHH
                     TNAVRMRQAQVVSVGNGIGIMVIETGG"
     gene            complement(837448..837642)
                     /locus_tag="PC1_RS03580"
                     /old_locus_tag="PC1_0713"
     CDS             complement(837448..837642)
                     /locus_tag="PC1_RS03580"
                     /old_locus_tag="PC1_0713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773412.1"
                     /db_xref="GI:502366464"
                     /translation="MFDSTPLTLDEIADQCRALTHAVIELDNPVAKEVLTFVLAERLE
                     LLAVTLQSPEALETDNGVSA"
     gene            complement(837635..837832)
                     /locus_tag="PC1_RS03585"
     CDS             complement(837635..837832)
                     /locus_tag="PC1_RS03585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="repressor"
                     /protein_id="WP_043881714.1"
                     /db_xref="GI:762767038"
                     /translation="MATTLTPSYPQFTFLFLAVRRAELRALPHREAVIAPDEISARRL
                     LARDYILAFAGRLPVQEASHV"
     gene            complement(838188..838412)
                     /locus_tag="PC1_RS03590"
                     /old_locus_tag="PC1_0715"
     CDS             complement(838188..838412)
                     /locus_tag="PC1_RS03590"
                     /old_locus_tag="PC1_0715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012773413.1"
                     /db_xref="GI:502366465"
                     /translation="MITLTIAGQSVTLDEREALSLCDQLFPAIRNPATVAAREQRFGA
                     LLLSIAPTPAASDSPRRYCASRAGDALTNC"
     gene            complement(838409..838669)
                     /locus_tag="PC1_RS03595"
                     /old_locus_tag="PC1_0716"
     CDS             complement(838409..838669)
                     /locus_tag="PC1_RS03595"
                     /old_locus_tag="PC1_0716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015841427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AlpA family transcriptional regulator"
                     /protein_id="WP_012773414.1"
                     /db_xref="GI:502366466"
                     /translation="MLSATPQTPIPAMPPMPLHPARERLMRLPEVLHVTGISRSTLYE
                     LSSRKAFPANVSLGGKSVAWVESEIHHWVAERIAARQQENHA"
     gene            839217..839978
                     /locus_tag="PC1_RS03600"
                     /old_locus_tag="PC1_0717"
     CDS             839217..839978
                     /locus_tag="PC1_RS03600"
                     /old_locus_tag="PC1_0717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage capsid size determination protein"
                     /protein_id="WP_012773415.1"
                     /db_xref="GI:502366467"
                     /translation="MTQTTTPDTKPVNPLPDTLTKATDYYLRMRKAHTVNASELDNIN
                     TAIARAKEQKTNTEAENQLSDTDWRARFLAARGEMTEELKNQQLQRLAQRELAQEYDG
                     LLAQLEIDQLRQKAKCHISAKDCCNAHASALRDYAEWEFNQALNTISANVIRAIKLKR
                     HMLDITTSELTQGLAYQNPEKVVMDLIVEKLKVKANDYRFDMSNEPVLSSLGLNAPSL
                     PHADFAPVSSLARRTIFFQELKEKEEALKTRSQKV"
     gene            complement(840117..840353)
                     /locus_tag="PC1_RS03605"
     CDS             complement(840117..840353)
                     /locus_tag="PC1_RS03605"
                     /inference="EXISTENCE