GenomeNet

Database: RefSeq
Entry: NC_013422
LinkDB: NC_013422
Original site: NC_013422 
LOCUS       NC_013422            2582886 bp    DNA     circular CON 07-APR-2017
DEFINITION  Halothiobacillus neapolitanus c2, complete genome.
ACCESSION   NC_013422 NZ_ACJO01000000 NZ_ACJO01000001 NZ_ACJO01000002
            NZ_ACJO01000003 NZ_ACJO01000004 NZ_ACJO01000005 NZ_ACJO01000006
            NZ_ACJO01000007 NZ_ACJO01000008 NZ_ACJO01000009 NZ_ACJO01000010
            NZ_ACJO01000011 NZ_ACJO01000012 NZ_ACJO01000013 NZ_ACJO01000014
            NZ_ACJO01000015 NZ_ACJO01000016 NZ_ACJO01000017 NZ_ACJO01000018
VERSION     NC_013422.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02598477
            Assembly: GCF_000024765.1
KEYWORDS    RefSeq.
SOURCE      Halothiobacillus neapolitanus c2
  ORGANISM  Halothiobacillus neapolitanus c2
            Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales;
            Halothiobacillaceae; Halothiobacillus.
REFERENCE   1  (bases 1 to 2582886)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H.,
            Bruce,D., Goodwin,L., Pitluck,S., Davenport,K., Brettin,T.,
            Detter,J.C., Han,C., Tapia,R., Larimer,F., Land,M., Hauser,L.,
            Kyrpides,N., Mikhailova,N., Kerfeld,C., Cannon,G. and Heinhort,S.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Halothiobacillus neapolitanus c2
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2582886)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H.,
            Bruce,D., Goodwin,L., Pitluck,S., Davenport,K., Brettin,T.,
            Detter,J.C., Han,C., Tapia,R., Larimer,F., Land,M., Hauser,L.,
            Kyrpides,N., Mikhailova,N., Kerfeld,C., Cannon,G. and Heinhort,S.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (16-OCT-2009) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP001801.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4083909
            Source DNA and bacteria available from Sabine Heinhorst
            (sabine.heinhorst@usm.edu)
            Contacts: Sabine Heinhorst (sabine.heinhorst@usm.edu)
                      David Bruce (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Metadata-START##
            Organism Display Name :: Halothiobacillus neapolitanus c2, ATCC
                                     23641
            Culture Collection ID :: ATCC 23641
            GOLD Stamp ID         :: Gi02105
            Isolation Site        :: Disintegrated concrete from an outfall
                                     sewer in Melbourne, Australia
            Oxygen Requirement    :: Aerobe
            Cell Shape            :: Rod-shaped
            Motility              :: Motile
            Temperature Range     :: Mesophile
            Temperature Optimum   :: 30 - 40C
            Gram Staining         :: gram-
            Biotic Relationship   :: Free living
            Diseases              :: None
            Phenotypes            :: Carbon fixation, Sulfur oxidizer
            Energy Source         :: Chemolithoautotroph
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 04/07/2017 01:02:39
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.1
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 2,412
            CDS (total)                       :: 2,359
            Genes (coding)                    :: 2,326
            CDS (coding)                      :: 2,326
            Genes (RNA)                       :: 53
            rRNAs                             :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                    :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                             :: 43
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 33
            Pseudo Genes (ambiguous residues) :: 0 of 33
            Pseudo Genes (frameshifted)       :: 19 of 33
            Pseudo Genes (incomplete)         :: 13 of 33
            Pseudo Genes (internal stop)      :: 11 of 33
            Pseudo Genes (multiple problems)  :: 7 of 33
            CRISPR Arrays                     :: 1
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2582886
                     /organism="Halothiobacillus neapolitanus c2"
                     /mol_type="genomic DNA"
                     /strain="c2"
                     /isolation_source="disintigrated concrete from an outflow
                     sewer"
                     /culture_collection="ATCC:23641"
                     /db_xref="taxon:555778"
                     /country="Australia: Melbourne"
     gene            159..1559
                     /gene="dnaA"
                     /locus_tag="HNEAP_RS00015"
                     /old_locus_tag="Hneap_0001"
     CDS             159..1559
                     /gene="dnaA"
                     /locus_tag="HNEAP_RS00015"
                     /old_locus_tag="Hneap_0001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004161180.1"
                     /note="binds to the dnaA-box as an ATP-bound complex at
                     the origin of replication during the initiation of
                     chromosomal replication; can also affect transcription of
                     multiple genes including itself; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiation protein DnaA"
                     /protein_id="WP_041600463.1"
                     /translation="MTSELWQQCIDRLSEDLPVQQINMWIRPLQAELKAENHLILWAP
                     NRFVMDMVAQQYKSKILEQAQILLERPDLQLGLQVGSVPSEQPVDMPAAATLSSKSGA
                     VSSGVAPRVEPMADLAEPDTGAKEFVSHINKKFNFDNFVEGKSNQLARAASQQVAQNP
                     GVGYNPLFIYGGVGLGKTHLMQAVGNAILERSPDAKVVYLHSERYVQQMVSSIKNNTI
                     EEFKDFYRSVNALLIDDIQFFAGKPRSQEEFFHTFNALIEQGQQIIMTCDRYPKEIEG
                     LEERLKSRFGWGLTVAVEPPDLETRVAILQSKAEQSQISLSTDVAFFIAKRVRANIRE
                     LEGALRRVIATAQFTGRPITVESTKEALKDQIAAQAKLITLENIQRTVAKFYNLKLTD
                     LTGARRNRSIARPRQVAMSLAKELTNHSLPEIGEAFGGRDHTTVIHACKKIEELREIE
                     SKLSDDYNLLRHTLNI"
     gene            1623..2735
                     /locus_tag="HNEAP_RS00020"
                     /old_locus_tag="Hneap_0002"
     CDS             1623..2735
                     /locus_tag="HNEAP_RS00020"
                     /old_locus_tag="Hneap_0002"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: protein motif:HMM:TIGR00663"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_012822905.1"
                     /translation="MQFAVDRDRFSSAINQVIGGVEKRQTMQILSNLLLEVADGRLTL
                     VATDLEIQLRTSVDVQMQAPGATTVNARKLADIVKSASQDAKIALTQTDGWLEIDIGT
                     GVFRLASIEAGSFPQMTIDAATQSTVSITQKNLYALIDKTQFSMAQQDVRYFLNGLLL
                     EVKPGQMTAVATDGHRLAYAHLSDERLTENNRQVIVPRKMVSEMLKALDRDSDDEVSL
                     AFRDNQIELLIGENYLISKLIDGKYPDYSRVMPQSNSKILIVSKTELKQVLQRASILS
                     NERFSGAYFYLSPGRLMIESSNAEHESSKETMSVGYDASDLKISFNISYLLNILAVIE
                     SEEVCMELEAPESSVLIKPVMPGDIDSKYVLMPMKL"
     gene            2815..3840
                     /locus_tag="HNEAP_RS00025"
                     /old_locus_tag="Hneap_0003"
     CDS             2815..3840
                     /locus_tag="HNEAP_RS00025"
                     /old_locus_tag="Hneap_0003"
                     /inference="COORDINATES: protein motif:HMM:TIGR00611"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="WP_041600303.1"
                     /translation="MTDCPLSAGFNLLVGDNGAGKTSVLEAIYYLSTLKSFRTQTHND
                     LIARYPDRDRGCAVVRAGVHQDDHDFFMALERCKDQFRLRLGREEVPRASLFVAHLPV
                     LALHAQSDDLVLAGPEFRRKFIDRMAFYLFADFVPAYAQFARMLKQRNAALRTGQSTE
                     IWDPLFIQYGERLNEQRVAALDLLKTVLPQVFEALAPQLSVDMQFHPGHKSGLDLSEA
                     LARNRERDREMGQTLIGPQRADILFTLNDYAFKSFASRGQIKVFTAALTLATAHIWQA
                     QRGKRAVLLFDDFMSEFDAHHSSALLHYLSNMGHQVFISAVDRQQIDFPFDAVFRLDA
                     GQISAVV"
     gene            4029..6482
                     /locus_tag="HNEAP_RS00030"
                     /old_locus_tag="Hneap_0004"
     CDS             4029..6482
                     /locus_tag="HNEAP_RS00030"
                     /old_locus_tag="Hneap_0004"
                     /EC_number="5.99.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_012822907.1"
                     /translation="MSDNTPNDASQNAGQSSGYDSTSIKVLKGLDAVRKRPGMYIGDT
                     DDGSGLHHMVFEVVDNAVDEALAGHCDTVTVTMHADGSVSVSDNGRGIPVDIHAEEGV
                     SAAEVIMTVLHAGGKFDQNSYKVSGGLHGVGVSVVNALSDELELDIYRGGHAYHQSYR
                     LGVPQAPLAEVGATEKSGTSIRFLPSPTIFTDVVFHYDILAKRLRELSFLNSGIRVFL
                     NDEISGRADTFYYEGGIRAFVEHLNKGKTVIHKNVLSFSGQKDSVLVELALQWNDSYQ
                     ENLFCYTNNIPQRDGGTHLTGFRTALTRTLNDYMERAGILKKAKVSTSGEDWREGLVA
                     VISVKVPDPKFSSQTKEKLVSSEVKSAVESLTSERLAEFLEENPQEALLITNKIIEAA
                     RAREAARRAREMTRRKGALDIAGLPGKLADCQEKDPALSEIYLVEGDSAGGSAKQGRD
                     RRTQAILPLKGKILNVEKARFDKMLSSAEVGTLITALGCGIGREDFNPDKLRYHRIII
                     MTDADVDGSHIRTLLLTFFYRQMKELVERGHIYIAQPPLYKVKKGKQEQYLKDDLALN
                     QYLLQLAVDGAALQVNAEAPLISGPALESMAREYLVAQAVIDRLSHRYDPAALKAVLH
                     LPPMTAAEIVEDSALFEAWLNRFTESMNQFADAGVNYSSRFARTEEGLAGIQITRSQH
                     GVSHETFLPAGFFSTADYRVLGELAIQLDGLIGEDARVLRGEKSAPITHFEQAIDWLM
                     QEGRRGLGIQRYKGLGEMNPDQLWETTMNPETRRLLQVRIEDAIASDEIFTILMGDLV
                     EPRRDFIEKFALSAVNIDI"
     gene            6658..7233
                     /locus_tag="HNEAP_RS00035"
                     /old_locus_tag="Hneap_0005"
     CDS             6658..7233
                     /locus_tag="HNEAP_RS00035"
                     /old_locus_tag="Hneap_0005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LemA family protein"
                     /protein_id="WP_012822908.1"
                     /translation="MGVTLSVLLFLVAVIVIWAIIMYNGLVVLKHNVSQAWSNIDVLL
                     KQRHDELPKLVETAKQYMKYEQETLEKVMRARSAVRGAQDRGDIDALGMAEGQLRAGL
                     MDFYAVAEAYPDLKANTSFQHLQQRISGLENMIADRREFYNASVNINNVRIEQFPDVL
                     IAQLFRFRPFKLLTFREDELKDVDLKTLFNQ"
     gene            7248..8171
                     /locus_tag="HNEAP_RS00040"
                     /old_locus_tag="Hneap_0006"
     CDS             7248..8171
                     /locus_tag="HNEAP_RS00040"
                     /old_locus_tag="Hneap_0006"
                     /inference="COORDINATES: protein motif:HMM:PF12483.6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822909.1"
                     /translation="MAWYAHWVGSLDDNGYHFLLVGLILLTLILLVAGIWFVRRTYWI
                     INTPTSNIVSAHQGYIEIEGITKNIDASPLVSPLTGTACVWYWVSVEHREQSFGESKR
                     SDWRRIYQHESDNLIAVEDATGECLVDPESASIRPNMRRQWYGATERPSGVTNSVGGH
                     FFGDYRYTEKLLLPHRNLYVLGWFKTIAHDPYVVENESVASLLRAWKHDPQMMKTFDL
                     DGNGSIDSKEWDQAREAGRQQIQAQQVKELERPQQTHLITANPQSRRPYIISADDQTV
                     LAKRFRRWGYLLWASSVLAFFFWVSAYYVRP"
     gene            8681..9454
                     /locus_tag="HNEAP_RS00045"
                     /old_locus_tag="Hneap_0007"
     CDS             8681..9454
                     /locus_tag="HNEAP_RS00045"
                     /old_locus_tag="Hneap_0007"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014088483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease III"
                     /protein_id="WP_012822910.1"
                     /translation="MKIATWNVNSLNVRKPQVLSWLAQQQPAILGLQELKQVNEAIDN
                     SDFAAMGYQTLLNGQKTYNGVALIYQEELGEPSDVVCDIPALDDPQRRVIAATFGELR
                     VINAYVVNGEAIDSEKYQYKLNWLEAFSNWLALEIAQHPNLVVMGDFNIAPSDADVFD
                     PERFKDAVLCSPPERDYFNRLLAMGFTDALNCFSNEENNFTWWDYRGGGYRRNHGLRI
                     DHILTSPAVQAKATACHVDKEPRGWERPSDHAPVVLTLA"
     gene            complement(9655..12165)
                     /locus_tag="HNEAP_RS00050"
                     /old_locus_tag="Hneap_0008"
     CDS             complement(9655..12165)
                     /locus_tag="HNEAP_RS00050"
                     /old_locus_tag="Hneap_0008"
                     /inference="COORDINATES: protein motif:HMM:PF02687.19"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012822911.1"
                     /translation="MAIVEPPKPATHLGLPRLILLAWRGLWRELRSGALVTMFLALVI
                     AVSAVTAVGFFTDRVDAGMRAQAAEFLAADGRVESPDSLLKWQQKASELGLTTTQTLE
                     FPTVILAGEHTLLVSLKAVGAGYPLRGALTISTGAQQQKIQQEPREGHAWLAPRALAL
                     LDLKVGDSFQIGQKKFTVSATLQREPDVGNFLAQAAPRAMINLADIPATGLVTPASRV
                     THYLLLAVPSGVSTNVLQAFGKSLPADLSLERPENSQPAFKTAFDRAARFLGLAAMVA
                     VLLAGAALMLAAQQYNRLQQDPAALMRAFGVQSRHILYLYTLRLVFLALLAAVPGIAL
                     GGLAQFGLSALLGSLLDFQLPPPSWLPVGFGVSIALVALLGFALPSLIRLQDTPPLRV
                     LNRQLAAPPTAAVLLFGAGLLAIGLLVWLQARDAWLTTYVTGGMVISFAAFIGIVWLL
                     LQALRRYPARGVARFGLARLARSPWSSAMQIAALTLGLTALLLLGVVRGDLVSTWQNQ
                     IPNDAPNFFAINIQPDQVPELTRFFQTNRIDDAGLVAMHRARWTSFNGKAVNADQLTG
                     QAKRLAEREFNLSVMPEHLAADNKIVAGSWQPDAQDAGWSVEQGIAKTLQWQLGDRLT
                     FVVNGAPVTAAITSIRTVDWNSMRPNFFVLGSAVLLPRQSAQFITSFFLPSPNVEQQK
                     ALLRAFPTLTLFDLNQILNEVRTLILRASQAVQYVFLFTLLAGLVVLLSAFAAGEAER
                     IRETAVLRVLGASHRQIMNSLWFEFILIGLLSGLLASIAAGGLGALLALKLFDLPWAL
                     DWRIPLYGLAAGVLLAALFVPYLGRRVLALPPARSLRG"
     gene            complement(12156..12896)
                     /locus_tag="HNEAP_RS00055"
                     /old_locus_tag="Hneap_0009"
     CDS             complement(12156..12896)
                     /locus_tag="HNEAP_RS00055"
                     /old_locus_tag="Hneap_0009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_049772428.1"
                     /translation="MPPEPQTVFHAASLPEDTALILRALRVSKTVTAPGNEPLTILRD
                     ASLTVAEGEAVALMGASGAGKSTLLALLAGLDTPTSGEVELAGFSLNNLNEDERAAVR
                     AGRVGFVFQSFQLIDGLTALENVALPLELQGTANSTAQAKAALDEVGLSHRLHHLPKV
                     LSGGEQQRVALARAFAGTPAILFADEPTGSLDTATGERIIDLLFALRDQHQTALVLVT
                     HDPALAARCNRGYRLQGGLQGGELTPWQ"
     gene            13056..13742
                     /locus_tag="HNEAP_RS00060"
                     /old_locus_tag="Hneap_0010"
     CDS             13056..13742
                     /locus_tag="HNEAP_RS00060"
                     /old_locus_tag="Hneap_0010"
                     /EC_number="3.1.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylesterase"
                     /protein_id="WP_012822913.1"
                     /translation="MRLVLSLLLPALIACSASAAFGQQAPHKTPQKVISSERSHTVLV
                     LGDSLSAAHNLAESQGWVALMQKRLAEKNAGATHKWQIVNASISGETTSGGLSRLPEL
                     LTVVQPGWVLLELGANDGLRGLPLALIRANLQKLIDQSKQSGARVVLLGIMLPPNYGP
                     AYAEPFAAMYQQLAEKNTLPLVPFLLKDVATNPKLMQQDGLHPTAEGEPIVLDNVWAV
                     VKPLWLPSSK"
     gene            complement(14129..14500)
                     /locus_tag="HNEAP_RS00065"
                     /old_locus_tag="Hneap_0011"
     CDS             complement(14129..14500)
                     /locus_tag="HNEAP_RS00065"
                     /old_locus_tag="Hneap_0011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822914.1"
                     /translation="MQPYNPALRQTARHLRSNMTDAEQVLWRHLRRKQVCGVAFYRQK
                     PLLTYIVDFYCPRARLVVELDGGQHFTTAHQGKDQTRDAALSSLGMKVLRFNNLEVLR
                     QMESVLMLIHSEVAFRLAAET"
     gene            complement(14569..15519)
                     /locus_tag="HNEAP_RS00070"
                     /old_locus_tag="Hneap_0012"
     CDS             complement(14569..15519)
                     /locus_tag="HNEAP_RS00070"
                     /old_locus_tag="Hneap_0012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
                     /protein_id="WP_012822915.1"
                     /translation="MNDKLAEAFVGIDVSKDTLDVHIAPSGVSLHETYDEKGIEKIIE
                     ALKAASSTLIVLEATGGLEVRLACELSATGLTVAIINPRQARDFAKATGRLAKTDRVD
                     AAMLAAFAQAIRPAARPLKDADARALEDMLNRRRQLIAMRVQELLRLNTAESKALQKS
                     LKTHIAWLEKQITTVDNDLNTQLRASDVWRAKDDVLKGIPGIGAVTSLTMLSKCPELG
                     ALNRREIAALVEVAPLANGSGKHRGKRSIWGGRAEVRAVLYMAALSAMRFNPDIKAFA
                     ERLKNKGKATKVVIVACMRKLLTIMNAMLKNMQPWVAQIA"
     gene            complement(16642..17178)
                     /locus_tag="HNEAP_RS00075"
                     /old_locus_tag="Hneap_0014"
     CDS             complement(16642..17178)
                     /locus_tag="HNEAP_RS00075"
                     /old_locus_tag="Hneap_0014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_012822917.1"
                     /translation="MLKQMNKSVNKGFTLIELMIVIAIIGILAAIAIPAYQDYTVRAK
                     VTELISVADAAKTGVAEAWTSDGLTGVTNFATSFNAEPATAHQSKYVSAIAIDPNTGA
                     ITVTSSTAAGSGLPTDAQGMTIVLQPNVQNAALVAGATGAIDWACASTSAATAGSNGL
                     AGITLGTMPAKYVPSQCK"
     gene            17753..18331
                     /locus_tag="HNEAP_RS00080"
                     /old_locus_tag="Hneap_0015"
     CDS             17753..18331
                     /locus_tag="HNEAP_RS00080"
                     /old_locus_tag="Hneap_0015"
                     /inference="COORDINATES: protein motif:HMM:PF07963.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tfp pilus assembly protein FimT-like protein"
                     /protein_id="WP_012822918.1"
                     /translation="MRLNPHHASPASASTHPRGSQSRYRRMRGFTIIELMITLVVAAI
                     LLAIAIPSFTYLTVSNKLTTSANSLVSNLAIARMAAIKRNADVGVCGDNTCSVNFPAG
                     SATVIHVGISSIQPGVIDIKNVKALDYGAQGLAHTTTSTAPYNGLIADIYTGQISSNN
                     HRCVYLTSGSVVSTCTESNANCALGGPSGTCQ"
     gene            18315..18794
                     /locus_tag="HNEAP_RS00085"
                     /old_locus_tag="Hneap_0016"
     CDS             18315..18794
                     /locus_tag="HNEAP_RS00085"
                     /old_locus_tag="Hneap_0016"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus modification protein PilV"
                     /protein_id="WP_012822919.1"
                     /translation="MEPVNKPVYGPSQRGVGLIEVLIAVLVLSIGFLGIAALQAKSLS
                     TNNSAMARSMAVVASYSILDAMRADRTNALTGNYNQTVTANACTGNGSLAQTQLNTWC
                     NELAQNLGAQAATTGTVDCKNTGDCTVTVTFDESRVGTNTGGTSGTGVTTITTRAML"
     gene            18791..19822
                     /locus_tag="HNEAP_RS00090"
                     /old_locus_tag="Hneap_0017"
     CDS             18791..19822
                     /locus_tag="HNEAP_RS00090"
                     /old_locus_tag="Hneap_0017"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015447249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_012822920.1"
                     /translation="MSRQTPAAALKQRGFTLIELMIALVLGLIVIGGVISVLLSNQQT
                     YRSNQALSQVQDGSRTAFEFLARDIRQAGLTGCGATAKIANVLNNKGTSWWDTWNNGL
                     QGYAANATAPIAVGTTANLRAANTDSITLMSAGDSGYSVNAPSSTSANFKLNEPNSDL
                     QTGDIIIVCDPNQATILQVSDYQSKSVTVVHNTGNKVSPGNCSDGLGFPTLCTTTGTK
                     YTYQNNAMLAKLNASYWYIGNNSLGTCSATTPQACSLFRSTISVSGGNAAAQAQEIVR
                     GVTNMQLAYLQGGTSFVAAGSVTDWSAVTAVRVTLTVAVPTNPNNINNPEIVQRVFTN
                     TIALRNRVG"
     gene            19825..20643
                     /locus_tag="HNEAP_RS00095"
                     /old_locus_tag="Hneap_0018"
     CDS             19825..20643
                     /locus_tag="HNEAP_RS00095"
                     /old_locus_tag="Hneap_0018"
                     /inference="COORDINATES: protein motif:HMM:PF14341.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441062.1"
                     /translation="MNNIINRGTSKSPFSKGLGWFTKATVLKRRVSPFAKGGARGICG
                     LPHSSLENPPCPPLQKGGMSAVALRKGEASTVALRKGRGERGGFMKTGLDRQRGVALV
                     VALVLLVVVTLVGLAAIRGTTMQQQMTSNFYDREIGFQAAEAGLRTGESWLIANPNNT
                     TLIRDCSDPNNQCFANPFETGAATAGIIQAVPTATFDAGALGAGQPQYVVEKMGICNS
                     GGGGNFAFTNDQNNQGGGNSLVSSGMCYRVTAESNANAAANDRSNVILQSILRL"
     gene            20656..24519
                     /locus_tag="HNEAP_RS00100"
                     /old_locus_tag="Hneap_0019"
     CDS             20656..24519
                     /locus_tag="HNEAP_RS00100"
                     /old_locus_tag="Hneap_0019"
                     /inference="COORDINATES: protein motif:HMM:PF05567.9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 4 fimbrial biogenesis protein PilY1"
                     /protein_id="WP_012822922.1"
                     /translation="MNQSNKNTQIKRSKRHMRYARGNTMNFLHTTMQQVGRVAVRFFA
                     FALLTAMPMITAQAAVDIDQSPLILQKPLPPNIVLMLDDSGSMTWDYMPDFGYLKNNS
                     NNDALINSANNSVYYDPTITYLPPLKADNTSYTNQTDFTNTPVDGFGTTSNDMIDLTN
                     YNGYDDTGNINYSKSVLTNSSYTKTGISRIDCYILYYNDQTAYDYSYSRARKSRPSSC
                     TIYTQVSSGYFQYSTGPAAGPYTVHYVANTSCGTQSNCVVASDKSGVSAPIGVAAGNN
                     IANWFAYYHTRILTTKTGLTLAFSGLDKTYRFGFASINGRNTADIPSPQYSFSTSNNS
                     DNKLAEVQPFGDGSSGTQKAKFWTWITNISPNDGTPLRGALQAVGEYYKTQQPWETSS
                     SDTSEYACRPSYTILTTDGFWNGDTPSGIGNADGQNGPKITTPSTYQYLKTAPYQDGY
                     SDTLADVAMKYWETDLRTSVANEVPTTPSDPAFWQHMTTFTIGLGWDPTNLIRSTSGD
                     ANLTVPQILAWARSGNPPAGSSLTNSSNIWPKPTSNSINNIADLAHAAVNGHGEFYSV
                     KSPDDLVNGLQSALKKIGESPGAGNAVTLSDTALPTDSTAADALYRFRGTFYTGQWSG
                     TLTAENYTTTTTPPSYESFWSTKDLTPSFSTVGTGSSAERLSNRNVWTSTLGNGNKTS
                     SVAFRVATDLSATQQTDLAATIGNSSVTAQTMVNYLLGDSTYAQGNPGGTLRNRDSFL
                     GDIVSSTPVLIAAPQADLYAGTTFTGADTYSTFVNKEATRAPIVYVAANDGMLHAFRV
                     TAGAGYERDGSTVSPVADQAKGTEVYAYMPSAVLTQTGDASITNLANPKYGDVDPVNG
                     TQAVPHQYYNDGRITTQNVYFDKAWHTVLVGTTGRGPAKAIYALDITDPSVLMNPATA
                     DQALLWERSAGDGKTGSSYIGEMVGTPVIAQVDQGGQPSWAVFVGNGYNSAEGKPALL
                     QFDLQTGDLSVHTTTGSVAADGGLAEPGLMQGDKTTGISTYAFAGDLQGHLWKFNLDS
                     ASSTGSVAFNAVDDKGNAQPITSLVTLAYDGVTNSTFALFGTGKYLASADTKDDQVQT
                     WYGVRVGMGADLAGVASATTPVADSSTARSDLTERFAFDFASGDRATSAQTSDTDMNN
                     KAGWFMDLPQTGERIVNRIQLISGKAVATTLIPKVNDPCNTVPAGAVMGVDPFTGANQ
                     LVSTGNGYNLGTKIITVDGKPQQVAINGKVFDAGPAAGVTAVRNADGTISITFNTLGG
                     GLQSLGPLNLGGNQASRLSWRELTN"
     gene            24658..25152
                     /locus_tag="HNEAP_RS00105"
                     /old_locus_tag="Hneap_0020"
     CDS             24658..25152
                     /locus_tag="HNEAP_RS00105"
                     /old_locus_tag="Hneap_0020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilE protein"
                     /protein_id="WP_012822923.1"
                     /translation="MKQIAHKAAARQQLGFTLIELMIVIAIIAIIAAIAYPSYIKSVV
                     KTKRAAAEGCLSEYANYMERFYTTNLRYDKDSAGTANPVVGSPVPAANQLDCSTAQNS
                     GADYAFTVVATAPNAAANPNTYTVTATPTGAQLSRDTQCGTLSINQVGTRTESGSGTV
                     ADCW"
     gene            25490..26074
                     /locus_tag="HNEAP_RS00110"
                     /old_locus_tag="Hneap_0021"
     CDS             25490..26074
                     /locus_tag="HNEAP_RS00110"
                     /old_locus_tag="Hneap_0021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein"
                     /protein_id="WP_012822924.1"
                     /translation="MPNHFTEPGFTPPDSALGFTAIELMMTLIIAMILLAIAIPSFSR
                     MKAQNHLATTANDFVSAFGAARQTAIVKGRPVTLCAGDQSGCFDTVDWSNGWLAFVDA
                     DKSGTLNAGEPVVFTGVARRGDVVVQGNTPVEKPIIFSPLGFASQPGGAFTAGTLRVC
                     VPADIANNARDLVLAKSGRLRVEAKDLSGACPAP"
     gene            26258..26629
                     /locus_tag="HNEAP_RS00115"
                     /old_locus_tag="Hneap_0022"
     CDS             26258..26629
                     /locus_tag="HNEAP_RS00115"
                     /old_locus_tag="Hneap_0022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822925.1"
                     /translation="MQPYNPALRQTARYLRSNMTDAEQILWRHLRRKQVCGVTFYRQK
                     PLLTFILDFYCPRARLVVELDGGQHFTTAHQGKDQARDAALSSLGMKVLRFNNLDVLQ
                     QMESVLMLIYSEVTFRLSAET"
     gene            complement(26886..29708)
                     /locus_tag="HNEAP_RS00120"
                     /old_locus_tag="Hneap_0024"
     CDS             complement(26886..29708)
                     /locus_tag="HNEAP_RS00120"
                     /old_locus_tag="Hneap_0024"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="WP_012822927.1"
                     /translation="MADPFIRIRGARTHNLKNIDVDLPRDALIVITGLSGSGKSSLAF
                     DTLFAEGQRRYVESLSAYARQFLSMMDKPDVDHIEGLSPAISIEQKTTSHNPRSTVGT
                     VTEIYDYLRLLYARAGIPRCPEHGVDLTAQTVSQMVDQVLALPEDSRWLLLAPVIENR
                     KGEHHKLFDEWRSQGFLRVRINGTVYEIDEIPALDPKGKNTIEVVVDRIKIRPDIGLR
                     LAESFETALRMADGRTFVVNMDDDSAHTFSAKHACPICGYALAELEPRLFSFNNPVGA
                     CPSCDGLGVKQFFDPQKVIVNAELSLAAGAIRGWDRRNVYYYQLLLGLSKHYGFDLDT
                     AWQDLPESIQNAILQGSGREKITFTYLSPKGKASTKDHPWEGVLPNMDRRYRETDSQA
                     VREELAKYISESACPSCGGTRLNLAARNVFIENENLPAITHRSISEALAFFQTLDLPG
                     ARGEIAGRIVREISARLGFLNDVGLTYLSLDRSAETLSGGEAQRIRLASQIGSGLVGV
                     TYILDEPSIGLHQRDNDRLLGTLNHLRELGNTVIVVEHDEDAIRAADFVLDIGPGAGV
                     HGGHIVAQGTPEQIAANADSLTGAYLSGKKKITVPKRVTPDAERWLKLYGARGNNLVG
                     DTLEIPMGLLTCITGVSGSGKSTLINDTLYLIAARDLNGASTRPSAYERIEHLNQLDK
                     VIDINQSPIGRTPRSNPATYTGLFTPIRELFAGTQEARSRGYTPGRFSFNVKGGRCEA
                     CQGDGVIKVEMHFLPDVYVACDVCHGKRYNRETLDIRYKGKTISDVLAMTVEDAAPFF
                     DAVPALHRKLNTLLDVGLGYLTLGQNATTLSGGEAQRVKLAKELSKRDTGNTLYILDE
                     PTTGLHFADVEQLLAVLYRLRDQGNTVVVIEHNLDVIKTADWIADLGPEGGSGGGQII
                     ASGTPETVAKIAGSHTGRYLARLLDH"
     gene            29824..30381
                     /locus_tag="HNEAP_RS00125"
                     /old_locus_tag="Hneap_0025"
     CDS             29824..30381
                     /locus_tag="HNEAP_RS00125"
                     /old_locus_tag="Hneap_0025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005316531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_012822928.1"
                     /translation="MATRGINKVIVLGNLGKDPEVRYMPSGGQVTNITVATSETWKDK
                     DSGEQKENTEWHRIVFFGKLAEIAGQYLKKGGQVYVEGRLQTRKWQGQDGQDRYTTEI
                     VANEMQMLGGRGGSGGSGGGQQESGDYEDDGYSNTPPARGAGRAAAAPARPSSGNRDS
                     YGAPPPPPRSPAKSEPNFVDDDIPF"
     gene            complement(30592..32391)
                     /locus_tag="HNEAP_RS00130"
                     /old_locus_tag="Hneap_0026"
     CDS             complement(30592..32391)
                     /locus_tag="HNEAP_RS00130"
                     /old_locus_tag="Hneap_0026"
                     /EC_number="2.3.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase"
                     /protein_id="WP_012822929.1"
                     /translation="MPSKNTHKIISSFMALALLMSTAMAQGATPQTTTADAATITQQA
                     LDATAPATTRAELAAAKPVLAKQAMVVTAQHLATQVGVDILKQGGNAVDAAVAVGYAL
                     AVVHPCCGNIGGGGFMVLHLAEGKTLFLDFREKAPLKATPTLFQDAEGNVVKGRSTHS
                     YLGVGVPGTVMGLNTALATYGSMSRKQVMAPAIKLARDGFVLTAGDVNILHTRREDFA
                     KYPNVSNTFLNHGKPYEVGDRLVQPQLAHTLALISKEGSHAFYRGHIAQAVVKASKEN
                     GGLLSLQDFADYTVNWAQPIACGYHGYTIMSAPPPSSGGTTICQILQLIQPYPIKKWG
                     YGSVKAIHYLVEAERRAFADRNTYLGDPAFVKNPITDLLSPKHIAQMRASIEPDKATP
                     SSEIKGSLGADEGQQTTHYSIVDAKGNAVSITYTINYLFGLGQIAGDTGFFLNNEMDD
                     FTAKPGVPNSFGLVQGRVNQIEPGKRPLSSMSPTIVLKDGKLFMVTGSPGGSTIISTT
                     LESILNVVDFGMNMQQAVDAPRVHHQWYPDLVFIEPGLLTPKTQTTLKDMGYRFKEVT
                     SWGADEAILLNPKTGLLEGANDRRRPAGLAAGY"
     gene            complement(32408..33346)
                     /locus_tag="HNEAP_RS00135"
                     /old_locus_tag="Hneap_0027"
     CDS             complement(32408..33346)
                     /locus_tag="HNEAP_RS00135"
                     /old_locus_tag="Hneap_0027"
                     /inference="COORDINATES: protein motif:HMM:PF04378.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (adenine(2030)-N(6))-methyltransferase
                     RlmJ"
                     /protein_id="WP_012822930.1"
                     /translation="MMNIIVNRYACLNLCLVETMNYQHHFHAGNHADVLKHLVLLQLI
                     ELMQQKPTGFLLLETHAGAGLYDLQATEARRSDEASGGIARLLQATQAADTVPVLIQT
                     YLKQIEQFGSVPNLGYYPGSPLLAVCALRPQDRYIGVELVPKVARELSRNLAQRPMLE
                     PCIPDRRVIARDGEGLAALKADLPPLERRGLFLIDPPYEQPQERDDIAAALQAGLQRF
                     ETGVYALWYPIKQRPYLDRWLNRIAKSTPRPVLTIENSIFPDESGNRLTGSGLLIINP
                     PWQFDTLMQPVLDFVNDALKQDTAAPRAIRWLNPAQ"
     gene            33737..34285
                     /locus_tag="HNEAP_RS00140"
                     /old_locus_tag="Hneap_0028"
     CDS             33737..34285
                     /locus_tag="HNEAP_RS00140"
                     /old_locus_tag="Hneap_0028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphodiesterase"
                     /protein_id="WP_012822931.1"
                     /translation="MDLESHASVCVGIISDTHGAIENSILELMQQCDVIVHAGDILNP
                     DILRRVTPKTGHVIAVRGNNDTVEQWPAGTADLLESLPEVATLRLPGGVLAVEHGHRV
                     NPAHQRHEKLRARHPEARAVVYGHTHHRTIDTSAPIWVLNPGAAGKVRAYGGSGCLLL
                     HASAERWWIEEKTLPNLRAGSA"
     gene            34356..35618
                     /locus_tag="HNEAP_RS00145"
     CDS             34356..35618
                     /locus_tag="HNEAP_RS00145"
                     /EC_number="2.7.1.3"
                     /inference="COORDINATES: protein
                     motif:HMM:PF00294.22,HMM:PF00355.24"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketohexokinase"
                     /protein_id="WP_012822932.1"
                     /translation="MAKILGIGIATLDIINEVEGYPVEDSEQRALAQRQRTGGNVTNT
                     LTVLRQFDHDCALAALLTPDADGRQIQEKLAQRGIDLSSAQILGFGHAPTSYITLNRQ
                     NGSRTIVHYRDLPEFDLNAFLKIDLAPFDWLHFEGRHCMDTAAMLAMARRAAGTKLLS
                     LEVEKERPYLDQLFSFPDVVFFSRAFAEQRGFNDPEAFLNAAHQWAPQAVLVLGWGAT
                     GAYLKESLNDSVQLVPAQPIRGVVDSIGAGDTLIAGVIHARANQANADWRAAVTFGVR
                     LAERKIQQFGFDGLAVDPNANNQPLCHLDDLGPEDAMGVQPVDGIPSVIVVRDHRAIR
                     AYRNVCPHNGSALSKGVRGYLADKSTGPSDGMSLRCRLHNAYFEPLTGACTGGPCPGT
                     HLTPVAIRQVGEMIYLDDLDENSRPTGK"
     gene            35755..38121
                     /locus_tag="HNEAP_RS00150"
     CDS             35755..38121
                     /locus_tag="HNEAP_RS00150"
                     /inference="COORDINATES: protein
                     motif:HMM:PF00563.18,HMM:TIGR00229"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_012822933.1"
                     /translation="MNEDRVGLTSLPQRPCDYAEAWLWVDVNGQGALTATQAITSLDA
                     IAPIDQILETLPQSDAWHQHMGQIGPMENIRDWIWQARWLSADRLDGSHSPLDDANLT
                     NIGGRRLLHVSLYPRLPDDAIGWLDSLPDCVIGRDANQAVVYRNRAAQTFNNPSLLDQ
                     LSRGVPAQCAEGVIEDQVSVDDHGRLRHFQRLLIAAPSPASSVKDFLELYELTTPKSL
                     GKAEGDYGQLIELLVEATHDLIVIKDPEGRWLFANLSIVHSLGLAHVVWLGKTDRELV
                     DLASPTVRGALQFCHETDKAAWNQGQQIRHLETIPCEDGHSLIVDVIKQPVFDDKGKP
                     RAIIVVGRDVTELHTTQEQFQILASQDELTGLLNRRFFQVEAQRWIDMLSDDGSKHLA
                     LLVFDLDYFRSINDSYGHERGDQLLQEMARRLQNECVASPLLIARMGGDEFAILVETD
                     NKPESLSALGEQVKSLTARPFQIEHLTLFTSASTGIVIWPEHGRSIGELLHQADSAMY
                     AAKEQGRNGHAVFSPEIMEHQNRQSALLTALRQSQGDERFFLVYQVQQNASSLAITGV
                     EALLRWQAPSPELAAGPDQFIPLLEKSGLIIDVGGWVLDEACQQIARWREYIGERITV
                     AVNVSSIQLHSPCFIGRVQAALKKSGINPSLLELELTETALVNDPAKAASTLIELKKL
                     GVQLALDDFGTGYSSLSYLTQFEFNRLKIDQSFVRDILVDPKDLVIVKAIVAMGHALG
                     LEVVAEGVETVAERDLLDSLGCDSFQGYLVGRPGKPEEISPMLGVGLL"
     gene            38154..38462
                     /locus_tag="HNEAP_RS00155"
                     /old_locus_tag="Hneap_0031"
     CDS             38154..38462
                     /locus_tag="HNEAP_RS00155"
                     /old_locus_tag="Hneap_0031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BolA family transcriptional regulator"
                     /protein_id="WP_012822934.1"
                     /translation="MSRSERIKKLIEDQMAPVYLEIDNESHLHAGNREETHFRLVIVS
                     ALFEGEALLARHRRVQTLLQAEREGGMHALSLHTFTPAEWQAKGASAAPSPACAGQNH
                     "
     gene            38491..39528
                     /locus_tag="HNEAP_RS00160"
     CDS             38491..39528
                     /locus_tag="HNEAP_RS00160"
                     /inference="COORDINATES: protein motif:HMM:PF08668.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction protein"
                     /protein_id="WP_012822935.1"
                     /translation="MWQWIRQLWATKPTAPPAHLPRLRENGLAAGKPEPISDIIIPDA
                     EQASLVFFQKLLNAPEHPRGYTDALRPDETAWLSARIEDLKRTPTQLTHLVPRLPSVL
                     PKLMTALNNPDTPIRTLTGLIESDPVISSMVLRLINSPAMRVRRENIESLEQAVMLLG
                     FSGMREVVSAAMFSPIGQLGRIEGANPLLVHDVWPISLRAANALRLGLKTRSDHQRPL
                     LSSDEAFDLYLSVLIEHTGLIALLRQKPLTGANTSAAYVARFRALIPAYSARIAEAWA
                     LSENTIRLIRSAPAELEHLRSQARYFSVACALNRRGTLDQAQFLHLCRQLPDYARGWY
                     DLCVTANVSAD"
     gene            complement(39572..41770)
                     /locus_tag="HNEAP_RS00165"
                     /old_locus_tag="Hneap_0033"
     CDS             complement(39572..41770)
                     /locus_tag="HNEAP_RS00165"
                     /old_locus_tag="Hneap_0033"
                     /EC_number="2.7.6.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional GTP
                     diphosphokinase/guanosine-3',5'-bis(diphosphate)
                     3'-diphosphatase"
                     /protein_id="WP_012822936.1"
                     /translation="MPEASVPQPQPEKLVLVAEAAEAEIYFAPLAMTLATYIDPEGIA
                     HVRDAFIFGANSHVGQARQSGEPYISHPVAVAEILAGLHMDEATLTAAILHDVIEDTA
                     VAREEIVARFGEEVARLVDGVSKLTQIRFKSKAEAQAANFRKMMMAMVEDVRVILIKL
                     ADRLHNMRTLGVMRPDKRRRIARETLDIYTPIASRLGLNSLRHELEDMGFSALYPTRY
                     RVISEAVRKARGNRKEIVAGIEERFIHRFGEEGLRVQIDAREKRPYSIYRKMMQKHLT
                     FKEVFDVFAVRIVANSVDDCYRALGIVHNLYKPLPGRFKDYIAIPKANGYQSLHTILF
                     GPHGIPLEVQIRTNEMHQFAESGIAAHWLYKSSHDQGTVTQARAREWLRDLLEIQQKA
                     GNPQEFLESVKVDLFPDEVYVFTPMGEIIELPRRATVVDFAYAIHTDVGNHCVACKID
                     RRFAPLSTPLENGQTIEIITAEGAEPNPNWLSFVVTARARANIRNYLKNLQDSEAIKL
                     GHRLLAKSLNAESIDFNDIKTDRLKRLLAEYHHDGLSDLLREIGLGNRMAPLVARLLM
                     ADENTDEGAESHGAMTSLNATQTPIISGTEGLVVDFAKCCHPIPGDAVVGFLSTGRGI
                     VVHRHDCGNAADVGVHPERWLAVNWADPALGDYQALIVIHAKNVRGGLARIASAAAET
                     GADIDDVRFDDRDVNLTIITVTLRVADRVHLARVMRRIKQVPDVVKVLRP"
     gene            complement(41772..42095)
                     /locus_tag="HNEAP_RS00170"
                     /old_locus_tag="Hneap_0034"
     CDS             complement(41772..42095)
                     /locus_tag="HNEAP_RS00170"
                     /old_locus_tag="Hneap_0034"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="WP_012822937.1"
                     /translation="MARVTVEDCLVKIPNRFELVLMAARRARQIEQGAEPLVPMGKEK
                     PVVIALREIGEGKIDQARIDEIQEHMVVLRSQISEAEIRAELAQFADEDEGSVRRPAT
                     TSDEG"
     gene            complement(42146..42775)
                     /locus_tag="HNEAP_RS00175"
                     /old_locus_tag="Hneap_0035"
     CDS             complement(42146..42775)
                     /locus_tag="HNEAP_RS00175"
                     /old_locus_tag="Hneap_0035"
                     /EC_number="2.7.4.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_012822938.1"
                     /translation="MSQGQLFVISAPSGAGKTSLIKALREQMPDLGLSISHTTRPMRP
                     GEVDGQHYHFVSKPTFESMIAEGAFVEHALVFGNHYGTSKAAVSAVLDKGQDLILEID
                     WQGAEQVRPLFSGAQSIFILPPSREALRERLFGRGQDDADVIARRLAEAEREMQAYPN
                     YDFLIINDDFSQALNQLRCLFESARLRTPRQAEKERVRLENLLNTPKKT"
     gene            complement(42782..43396)
                     /locus_tag="HNEAP_RS00180"
                     /old_locus_tag="Hneap_0036"
     CDS             complement(42782..43396)
                     /locus_tag="HNEAP_RS00180"
                     /old_locus_tag="Hneap_0036"
                     /inference="COORDINATES: protein motif:HMM:PF09335.9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822939.1"
                     /translation="MFGIDIAALLAQYGLLVLAIGCLLEGETVLVLAGLAAHQGMLPL
                     PQVFVIAVVFGWLGDQIFFWLGRWKGDAILLRFPSWAKQKPRLDRWIHKYHAPVVVMV
                     RFMYGLRAAGPVLIGHSGLCPWKFAFYNAIGALIWATIFIALGWVFGQAAERILEQIN
                     HWGHYVFYVGAVVILVIGFVFWIVNRRRAARAVERAALSEQERD"
     gene            complement(43484..43954)
                     /locus_tag="HNEAP_RS00185"
                     /old_locus_tag="Hneap_0037"
     CDS             complement(43484..43954)
                     /locus_tag="HNEAP_RS00185"
                     /old_locus_tag="Hneap_0037"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822940.1"
                     /translation="MRAQSIIKWSVPIIMLAALTGCVTPMSGDVYSRNNAMQMQSVQY
                     GTIESLRGVRIAGTQTPIGAIGGAVVGGLLGSGVGGGLGRDLATVGGAIGGGVAGSAI
                     EEGVTQQNGVEIVVRLDNGRTVSIVQSVGGQIFSLGQRVQVITAPNGTSRVTAG"
     gene            44187..44936
                     /locus_tag="HNEAP_RS00190"
                     /old_locus_tag="Hneap_0038"
     CDS             44187..44936
                     /locus_tag="HNEAP_RS00190"
                     /old_locus_tag="Hneap_0038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012822941.1"
                     /translation="MIELLLAPETWIAFATLTALEIVLGIDNIIVIAILVSKLPEHQR
                     AAGRLFGLALAMVTRIGLLFSLVWLMGLTEPFLHIGELAFSGRDLILLVGGLFLVYKA
                     VTEMHDTMETGGHIETNSTGAMLKKVSIWAVVTQIALIDIVFSLDSVITAIGLVKHIE
                     IMVAAIIVAVLVMMIAAKPISEFVERHPTIKMLALAFLILVGVFLIAESFGQHVPKGY
                     IYTAMAFSLVVESLNIRMRKKREQLTSKVLE"
     gene            complement(44946..45716)
                     /locus_tag="HNEAP_RS00195"
                     /old_locus_tag="Hneap_0039"
     CDS             complement(44946..45716)
                     /locus_tag="HNEAP_RS00195"
                     /old_locus_tag="Hneap_0039"
                     /EC_number="4.2.99.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease III"
                     /protein_id="WP_012822942.1"
                     /translation="MRVISFNANGIRSAARKGFFDWLSEQNADFVCIQETKAQADQLT
                     DPEFCPAGYTCQYVSAEKKGYSGVAIYARRSPDAIITQLGLPEFDAEGRYCAFEYPDL
                     MVASLYLPSGSAGDHRQESKDRFLAAYLPILESYLQKQHKPLILCGDWNIAHKEIDLK
                     NWKSNQKNSGFLPHERAWLDELFDRLGFVDAHRLVAPGEAVYTWWSNRANAWENNVGW
                     RIDYQIITPDLADRVERATVYRDMKFSDHAPLIIDYRS"
     gene            complement(46091..47482)
                     /locus_tag="HNEAP_RS00200"
                     /old_locus_tag="Hneap_0040"
     CDS             complement(46091..47482)
                     /locus_tag="HNEAP_RS00200"
                     /old_locus_tag="Hneap_0040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007161993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600478.1"
                     /translation="MAAALIATPLMAMTPAISFADNGVPDYVQLVKQASPWVVNISSV
                     SNPKTQEAFNNGEMPTFPPGPAGDMFRHFFQEQMPQMKREPIRSLGSGFIISADGYIL
                     TNAHVVNGADKITVRLPDQQTYKAKVIGKDKRTDIALLKIDAKNLPVAPIGNSDNIQV
                     GEWVLAIGEPFGLDHTATHGIVSALGRDLPDESYVPFIQTDAPVNPGNSGGPLINANG
                     KVIGINSQIYTKSGGFMGISFAIPINVAMNVVDQIKSTGHVTRGYLGVLIQPVTYDLA
                     QSFGLDTTKGALVAKVEPNTPAAKAGLKSGDIILKFNGSEIKHSGELPIMVGMSPIGK
                     PATLTLMRDGKQMELNVTIEKLDKKALEAESGTSEAIEKMGLQVTELSPDELQQLNIK
                     YGIKVKSVKNDSQFASVIAPGDILLEVNRMPMKSATDLKKALDSAPKDRPIAIRLLRD
                     GQPLFMAVQLGTQ"
     gene            48094..50388
                     /locus_tag="HNEAP_RS00205"
                     /old_locus_tag="Hneap_0042"
     CDS             48094..50388
                     /locus_tag="HNEAP_RS00205"
                     /old_locus_tag="Hneap_0042"
                     /inference="COORDINATES: protein motif:HMM:PF16655.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441063.1"
                     /translation="MPRASPLPRTSHCHQSGSAKMNATSPSLALAHSNSRRQFLKLIV
                     LTASAGALAACGGGDGGAENISTDTRYFPQSVASGDPAANSVILWTRLGTLGPQTDGQ
                     LRVQVSTQEDFSNLIVDESAVPVAAAHDHCLRLKVAGLKPGTTYYYRFLFSTGNQAWA
                     SSRTGRTKTAPDATANVPVSYAVTSCQDYIGRYYNVWAYLLQTEPDLDFILQIGDYIY
                     ETTGDPSFQTVGSARSITFTDTAGAIQLGDATAPYYAASSVSNYRDLYKAYRSDPILQ
                     QVHERYPMIGIWDDHEYSDDCWGATATYFNGREDEYNPPRRDRAEQVYYEFMPLDDPA
                     IASGALNKDPATLWPNNVLYRRLRFGQNLEAVLLDYRSYRPDHLIPEGGFPGKVVMSE
                     PVLVSILGQTAYDAVKANFGPYVDTTTAPWNSYLTALIPVLAQGYLQAGFTGDAQTKA
                     TDDLTGLVSAFVFNQLIGQFNAAVAAGQIPGASALPAIDSTTYDALPRGIAFLHIGKQ
                     SFFSELGARYAVVQPTFDLYAQYMQATGQYEQDPLGATQRQFLANALASDATFINVIS
                     TVSTAPLRWDLRSATNLPADYQTVFKPNVDQWDGFPQGKQAFLETLANRPGAFLASGD
                     IHASFVTQHQTSSMAMPVADFTGPAISSGTFNNFVESAISGLPGLDSAQKAAANQALV
                     LGLDQTLQASAPADEPIVFADTTHHGIMVFRVDGSQTQVDYLLIDQSAVSQNLTGDSS
                     ALIKAFSRQRFTLDPQTGKVTSAS"
     gene            complement(50405..51196)
                     /locus_tag="HNEAP_RS00210"
                     /old_locus_tag="Hneap_0043"
     CDS             complement(50405..51196)
                     /locus_tag="HNEAP_RS00210"
                     /old_locus_tag="Hneap_0043"
                     /inference="COORDINATES: protein motif:HMM:TIGR01458"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_012822946.1"
                     /translation="MQTTTQAVIFDIGGVLLDGNTPMPGAVDALARLREASIPFLLLT
                     NTTRRSHADLLAALHEAGLDVSAQQLLTPARAAAAWLQSYQTHGVLLIHPGLLPDFAG
                     VDTTLIGAKSEATGPRAVIVGDAGEGFTYTTLNAAFRELMAGATLISLSDSRYFREAD
                     SLSLDAGPFVRLLENAAGVTSNAMGKPGASFFQQAIAALGFSAENITLIGDDVHSDIQ
                     GADAVGLQTILVQTGKYQDGDEDLAPENTLIAKDVLASVYLLNQR"
     gene            complement(51408..52196)
                     /locus_tag="HNEAP_RS00215"
                     /old_locus_tag="Hneap_0044"
     CDS             complement(51408..52196)
                     /locus_tag="HNEAP_RS00215"
                     /old_locus_tag="Hneap_0044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018986219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin binding domain-containing protein"
                     /protein_id="WP_012822947.1"
                     /translation="MSVASGKPIAIGVLIIGDEILSGRRKDTHLAAVIERLAPRGRQP
                     DWAQMIGDDADHIERTLRESQQAGSIVFCFGGIGATPDDLTRASAARAFERPLTRHPE
                     AERRIIAQFGEAAFPHRVHMADFPEQVDLIPNPINNVAGFYLENHFFMPGFPQMAHPM
                     LDWILANPLASLGTLDYREQSIWTIGASENDLLPTMTGLCAEFPDLKFFSLPIGQGER
                     RLIELGFKGASARVAQAIKALQNQLDALDVTHQSERPPTEPTQT"
     gene            complement(52193..53305)
                     /locus_tag="HNEAP_RS00220"
                     /old_locus_tag="Hneap_0045"
     CDS             complement(52193..53305)
                     /locus_tag="HNEAP_RS00220"
                     /old_locus_tag="Hneap_0045"
                     /EC_number="4.99.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018144579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="WP_012822948.1"
                     /translation="MTYQGEPHYAHGSAERMGVLLLNLGTPDEPTTPALRRYLKQFLS
                     DPRVIELPKLLWWPILNLIILNTRPKKSAAAYREVWDHYEDGSPLLTISRQQQRGLQE
                     RLSQQMAGPVSVALGMRYGNPSVATALAELRDAGARRILVLPMYPQYAAATTASTFDA
                     VFDEMKTWRWVPELRFITHYHREPAYLDALAASVREHFAEHGQPQKLVMSFHGVPKRY
                     LLAGDPYHCECHVTGRLLADRLGLSADQYMVTFQSRFGREEWLKPYTDETLKGLPAKG
                     IKHIAVVCPGFSADCLETIEEIGQENREYFEEAGGETYHYIPALNARDDHLDALTHLI
                     RRHTQGWIEHSGYDAQADAQERDRVRANALAMGAER"
     gene            53431..54390
                     /locus_tag="HNEAP_RS00225"
                     /old_locus_tag="Hneap_0046"
     CDS             53431..54390
                     /locus_tag="HNEAP_RS00225"
                     /old_locus_tag="Hneap_0046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin-disulfide reductase"
                     /protein_id="WP_012822949.1"
                     /translation="MSETNTRHARLLILGSGPAGYAAAVYAARANLNPVLITGMEMGG
                     QLTTTTEVENWPGDPGDLTGPALMDRMKAHAEKFDTEIIFDHIQSTNLKQRPFTLKGD
                     SGTYTCDALIVATGASAKYLGLESESKFKGKGVSACATCDGFFYKNQEIAVVGGGNTA
                     VEEALYLANVASKVHVIHRRDKFKAENILIDRLMKKVDEGKVEIHWHSAIDEILGDNT
                     GVTGLRIKQVQTEKTTDIALTGVFIAIGHAPNTGIFEGELDLAGGYIQVKSGTQGNAT
                     ATSVPGVFAAGDVMDHVYRQAITSAGTGCMAALDAKTYLEGLE"
     gene            54484..54804
                     /locus_tag="HNEAP_RS00230"
                     /old_locus_tag="Hneap_0047"
     CDS             54484..54804
                     /locus_tag="HNEAP_RS00230"
                     /old_locus_tag="Hneap_0047"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822950.1"
                     /translation="MDPVIAAYTVLLAVALGLSGFLRGDARRRGRGLLMAATLSGFIV
                     VAAASALVNAVSVPDLILTSLAVFFSAQAATTAFSLLWREISSTRQARGSVPDSDHRE
                     DTST"
     gene            54801..55673
                     /locus_tag="HNEAP_RS00235"
                     /old_locus_tag="Hneap_0048"
     CDS             54801..55673
                     /locus_tag="HNEAP_RS00235"
                     /old_locus_tag="Hneap_0048"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822951.1"
                     /translation="MSVGLQIDLVGWFALALILAALYGLNSEKGERSGNTTWHKPAIG
                     LLSAALLLMLLSVLWTSDGSNVPLAIVMVLLGIVAAPLSSRYRSSRYRDARGSSPQRT
                     LREGILSGLSLITIGTGLSVALLGLTGWFDMDRDAFTWDIRLVSVSSEFIGVWTFAAG
                     LMLWLRLNDYLPQSSPGRNQKRVGLAVLALAVVLSGLSVLFPAYASALMIVVAVLALE
                     LGALSALGVAETRVARVLGQHTGLIGAAIAMLGYVQASLFLLSMGGLIVAAAIHYLRG
                     AMAFNQARRRRTDF"
     gene            complement(55687..56304)
                     /locus_tag="HNEAP_RS00240"
                     /old_locus_tag="Hneap_0049"
     CDS             complement(55687..56304)
                     /locus_tag="HNEAP_RS00240"
                     /old_locus_tag="Hneap_0049"
                     /EC_number="3.1.3.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-deoxynucleotidase"
                     /protein_id="WP_012822952.1"
                     /translation="MLSKSTTPEQSHFFAYLARMKYITRWGLMRNTRTENIQEHSLQV
                     AMIAHALAVIGNELYGETNDIGRIVTVALYHDASEIITGDLPTPVKYFRQDILDSYKA
                     LEAHAERKLTGLLPERLRSAFASTIESAQIEPEVTRVVKAADSMSAYLKCLEEGFAGN
                     QEFKKAESYLLAKLVEMQETMPAVAYFRTHFVEGFALTLDDLSHE"
     gene            complement(56333..57763)
                     /locus_tag="HNEAP_RS00245"
                     /old_locus_tag="Hneap_0050"
     CDS             complement(56333..57763)
                     /locus_tag="HNEAP_RS00245"
                     /old_locus_tag="Hneap_0050"
                     /EC_number="3.1.5.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyguanosinetriphosphate triphosphohydrolase"
                     /protein_id="WP_012822953.1"
                     /translation="MKRTESNWPRWLNAARRRPSQTSPALFHTETRAEIERDYDRVLF
                     STPVRRMADKTQVFPLDHSDSVRTRLTHSHEVANLARSVGLDLVFNRNLAAGLPQALR
                     DVPALLATIGLAHDLGNPPFGHQGEEAIGRWFARHEATVLNPQTGLSEAMRQDFLRFE
                     GNAQTLRLLTKLQLINDDYGLNLTVATLAALIKYPVGSDDIDKKFVVRKKHGFFQSEQ
                     ALVAEVQAQCGLDAGQRHPLTWILEACDDIAYSVLDAEDAVKKGLLSFSDIIAFLRHA
                     ADGDPVVTRVCDAAQEEHRRYRQTDLSPAELNDISMQTFRIRAIGALMQAVADTFLTQ
                     LPAMSAGTFNQELIAASPARALLSTLKACNWQHAYRHKTVLKVELTGFEVIHGLMDAF
                     WYAITDRVDPLDPASARRTPLASYLYQLISENYRRVFEAPSNPMPLRYREAQLLTDMV
                     SGMTDSFAVRSWQQIQEAGFRPNVPY"
     gene            57863..58720
                     /locus_tag="HNEAP_RS00250"
                     /old_locus_tag="Hneap_0051"
     CDS             57863..58720
                     /locus_tag="HNEAP_RS00250"
                     /old_locus_tag="Hneap_0051"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015279160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase NAD-binding
                     protein"
                     /protein_id="WP_012822954.1"
                     /translation="MNIAVLGLGLMGRAIAERLVKAGMTVRGYNRSALSAPPTGVTMS
                     ESVAAAVEPSDIVWVMLADFAACESVLLAENPWDLFKNKLIINGATIGPEQSRALAES
                     IKQLGGHYLESPVLGSTPQAETGTLQILVGGDPADVAVADPVLKALGKPTHFGGIGQG
                     AAVKLAMNQLIGSLTAAFSMSLGLVEREGVDVDTFMNTLRDSALYAPTFDKKLDRMRT
                     RDFAAANFPLKHLLKDIRLFTEVAGAQQIDARMLDGLARILADGVTAGHADEDYSALF
                     GQIVPNITP"
     gene            58846..60408
                     /locus_tag="HNEAP_RS00255"
                     /old_locus_tag="Hneap_0052"
     CDS             58846..60408
                     /locus_tag="HNEAP_RS00255"
                     /old_locus_tag="Hneap_0052"
                     /EC_number="3.5.4.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017412519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/inosine monophosphate cyclohydrolase"
                     /protein_id="WP_012822955.1"
                     /translation="MKNNRTTPRRALLSVSDKTGLLAFAQSLNRHGVALISTGGTASM
                     LRDAGLPVTEVADVTGFPEMMAGRVKTLNPKIHGGILARRGVDEDVMAEHGIEPIDIV
                     VVNLYPFAETVAKPNCQFDDAVENIDIGGPAMVRAAAKNHQDVAIIVDPSDYGRVLSE
                     VEAGGIEAQTRFELAVRAFEHTAHYDGMIADYFGKMVSGNAFAPTFNLQLKKAQDLRY
                     GENPHQEAAFYVEHTPPVGSIAAAHMIQGKALSYNNIADSDAALECVKQFAEPACVIV
                     KHANPCGVAVAEDLTVAYDRAYATDPTSAFGGIIAFNRPLDGHTARTIVERQFVEVVI
                     APEISPEARIEFEAKPNVRVLTVGQWPAVSPARLDFKRVHGGLLVQDDDAARITARDL
                     TVVSERQPTPEELRDLLFAWQVAKFVKSNAIIYASGEQTIGVGAGQMSRVYSARIAAI
                     KAEDACLPVAGSVMASDAFFPFRDGIDAAAAVGIRAVIQPGGSMRDQEVIDAANEHGI
                     AMVFTGIRHFRH"
     gene            60466..62061
                     /locus_tag="HNEAP_RS00260"
                     /old_locus_tag="Hneap_0053"
     CDS             60466..62061
                     /locus_tag="HNEAP_RS00260"
                     /old_locus_tag="Hneap_0053"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein RmuC"
                     /protein_id="WP_012822956.1"
                     /translation="MSSFFAQLPNLPPVWAWAGLASTALLLVALLFVWLVLAQRARQN
                     RQSAAEEIERLNVALAESRHEVTEQELAARQAQRDLTAASTELARTQATLSALSDQLS
                     RMQAERMSERQQSEQRIDVLSRQVQTQAAEQAELQERLAQERRAAAEKLALIDQAQVQ
                     LQQAFQALSADALRANNESFLKLAEENLARFQAGAAQDLNKRQEAIVQMTQPIRERLE
                     QFDVKLNSLEQARTNAYGAMNQQINDLLQIHLPKLHRETADLVRALRQPQTRGRWGEV
                     QLKRVVELAGMLEHCDFEEQVSQSDTGGRLRPDMIVHLPGGRQVVVDAKAPLNAYLQA
                     MEAPSDEARAAALQDHARQVRTHISQLSKKEYFDQFSPTPEFVVLFVPGEVFFSAALM
                     QDPTLIEFGAEKRVIPASPTTLIALLKAVSYGWRQEALAKNAQEMAELGRDLYERMGT
                     LAQHWQKVGKHLDQAVGAFNQSVGSLEGRVLPTARKFRELGAVRSDKEDLPSLTPLTT
                     ETRPLTAQELTGPDSAAAITQKD"
     gene            complement(62045..62242)
                     /locus_tag="HNEAP_RS00265"
                     /old_locus_tag="Hneap_0054"
     CDS             complement(62045..62242)
                     /locus_tag="HNEAP_RS00265"
                     /old_locus_tag="Hneap_0054"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822957.1"
                     /translation="MNLNTELNALSTQELEHLIQAIAAELSERSSKPAKPLDEEEIVQ
                     VLSFELKRHRKQKDEVFNPFA"
     gene            complement(62254..63108)
                     /locus_tag="HNEAP_RS00270"
                     /old_locus_tag="Hneap_0055"
     CDS             complement(62254..63108)
                     /locus_tag="HNEAP_RS00270"
                     /old_locus_tag="Hneap_0055"
                     /inference="COORDINATES: protein motif:HMM:PF00149.26"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_012822958.1"
                     /translation="MTLFKQLLVNPNGRDFVVGDIHGHLSRLEKVLDYHQFKPESDRL
                     IAVGDLINRGTDSLNTLRLLSEPWFFSVAGNHERMISQYRQALTRRQLTADERQKMVS
                     IGAQWLLDAYDALNEDKWADLITEIMNLITQMPLMIQVGNGPEAVGVIHAELPDWDWS
                     RSVTRLERIKKVKFWDQPRDEPSIESLLWGNAQFQSLRNGEQNDRHISGIAWVIQGHS
                     VSNIPRRAGNRLWIDTGADESQSAHGLSIAELGPQLTVTTHFRDLRIRTERFNLTPQP
                     RFHSVLMS"
     gene            63522..63998
                     /locus_tag="HNEAP_RS00275"
                     /old_locus_tag="Hneap_0056"
     CDS             63522..63998
                     /locus_tag="HNEAP_RS00275"
                     /old_locus_tag="Hneap_0056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018954329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822959.1"
                     /translation="MKKIRLLQSAFVLFMLGLLSALPVQAQTVDAKAIDALGGNSLAN
                     HHIVLQETDSDLQRQTLVLNVASNLINAYGDNADIEIVGFGPGISLLFANNEHAKRIE
                     SLAQQGVRFSACMNSLAKATERLGYEPKLNPVAKKVPAGIVRIIDLVDAGYILVRP"
     gene            64169..64549
                     /locus_tag="HNEAP_RS00280"
                     /old_locus_tag="Hneap_0057"
     CDS             64169..64549
                     /locus_tag="HNEAP_RS00280"
                     /old_locus_tag="Hneap_0057"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822960.1"
                     /translation="MTETTASESMSHKEVAEYIANHDADRRGGFVARPILLQKLNEFG
                     SPSLAVLTFEGEKTLTLAGLLSLQPDDEVVLYDDNAPDGAQSFYGVVEDVREGVRPAD
                     SIKRMRLIYLQKKSSDKVLDPREA"
     gene            64607..67444
                     /locus_tag="HNEAP_RS00285"
                     /old_locus_tag="Hneap_0058"
     CDS             64607..67444
                     /locus_tag="HNEAP_RS00285"
                     /old_locus_tag="Hneap_0058"
                     /inference="COORDINATES: protein motif:HMM:PRK11072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional glutamine synthetase
                     adenylyltransferase/deadenyltransferase"
                     /protein_id="WP_081441064.1"
                     /translation="MESPSMINLIEPEMRLHIESAARDAGASVNQLAQLRVLLEVSPF
                     VAENITKQPCLWPFLLEQVNHANGPTGLAERIEQQLSNSPIEDLDQQLRHIRRAEMLR
                     IAWRDVARLAPTTETLRDLSDLADQCVQQALMAHERVLVARHGFPRSKQGAYQQLVVL
                     GMGKLGGYELNYSSDIDLIFLFEEEGETDGPKSISNSEFFIKLGQRVIRSLNEVTRDG
                     FVFRVDMRLRPHGDEGALALSFDAAELYYTTLGREWERYALIKARVIAGDQAAGARLL
                     ALLKPFVYRKYLDFGAFAQLRDMKKAIEREMNRRGMHDNIKLGPGGIREIEFIGQLYQ
                     LLRGGREPKLQSRSILTTLEVLRGLKELPSAIIDELLAGYDFLRRAENRLQMMHDRQT
                     QTLPLDDLDQARLALAMGYSSWGDFMAALDQHRQRIHRYFGEILQTSRDDNVNELPMQ
                     QIWLNNLTPEVAEELLRKQGFDDPESILDTLLAWKRDLSPQLSDTVQHRLDLLMPNVL
                     QEVATHGTSAETLRAVLALVDAVLSRSVYLALLIEQPAALKHLVQLCSASPWIAELLR
                     QQPILLDELVDANNLYSQPDVQALSQEISGFLSRFPDDEERQFDELRRFRQLATLRVA
                     AADAMDILPVMRVSDQLTWIAEVVLEKVLQLAYQQMVTRHGEPRALDEHGAEYTPGFA
                     IIAYGKLGGIELGYGSDLDVVFLHDSTDTSAMTTGQKPIDNQLFFARLAQKIIHILSI
                     RTPSGVLYEVDTRLRPDGAGGLLVSSLQGFEQYQKQHAWLWETQALCRARFIAGQNQI
                     AERFATIRRDTLCAPRDPATLKEAVLDMRQKMRAEHGQTGAGETFHLKRGIGGITDIE
                     FMVQYLLLRHAHAHPEIVAFTDNIRQLRALAQADLLDGERSEQLVTAYQRLRNTSHRR
                     TLNKQSLELPCADFAEERAVVLAAWQQIFEL"
     gene            67499..67957
                     /locus_tag="HNEAP_RS00290"
                     /old_locus_tag="Hneap_0059"
     CDS             67499..67957
                     /locus_tag="HNEAP_RS00290"
                     /old_locus_tag="Hneap_0059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822962.1"
                     /translation="MHIWVDADACPVAVKEILFRAAARTGLPMTLVANQPLAIPRGAS
                     TVRFIQVAGGFDVADNEIVRRLSAGDLVITQDIPLAAEVIEKGGLALNPRGEHYTPDS
                     IKARLSMRHFMESLRESGVNTGGPAKLNQSDRQVFANALDKILLARPGSV"
     gene            68056..68586
                     /locus_tag="HNEAP_RS00295"
                     /old_locus_tag="Hneap_0060"
     CDS             68056..68586
                     /locus_tag="HNEAP_RS00295"
                     /old_locus_tag="Hneap_0060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone Skp"
                     /protein_id="WP_012822963.1"
                     /translation="MDRAVRYGLSVLVFLFAAATQAEVLAAPIKVGYVNSVALMEQAP
                     QADIAKHALEREFSPREREIRALQQQAQTLQGRLDNGGASMGDTERSTLRQQLDQKML
                     RIQQMQSDFQDDLNLKKNEALGKLQQAVLQAIKDVAKTNGYQLVLSDGVVYAAPSVDI
                     TKLVAERLKQLAKGKQ"
     gene            68944..69192
                     /locus_tag="HNEAP_RS00300"
                     /old_locus_tag="Hneap_0061"
     CDS             68944..69192
                     /locus_tag="HNEAP_RS00300"
                     /old_locus_tag="Hneap_0061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine-binding protein"
                     /protein_id="WP_012822964.1"
                     /translation="MEAIQLIRDFLQERTQTDPALVTPDARLETLGIDSFTLLELIFE
                     FEEKYGVSIPNDTQTPETVQDLLNLIARFRQQAEAKPS"
     gene            69189..70436
                     /locus_tag="HNEAP_RS00305"
                     /old_locus_tag="Hneap_0062"
     CDS             69189..70436
                     /locus_tag="HNEAP_RS00305"
                     /old_locus_tag="Hneap_0062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_012822965.1"
                     /translation="MTRPHRVAVTGLGMVSPFGGSTQDFFTRMLAGESAVALYETDDA
                     PRGLSVPAVRCADFDPAERVPKHMLATMDRYAQLGLAAAFEAWAQAGLTLGANEDSPD
                     AGVAWGSALGGTLAYERGYRDLWQNGQERVSPMSVVQGMNNAASAQIGIALGLGNSCL
                     TYTVACASAAAAIGEAFNRIRYGDAKIMLTGGSDAPLAYAVVRAWEAMRVLAPGDRDT
                     AYRACRPFHPDRRGLVLAEGAAALVLEDWDHAVARGAPILAEMSGFGASCDHSHLVRP
                     DAGGQVRALQQALDQAGLAPKDIGYVNAHGTATREGDPTEIQALKTVFGAHAEHLAVS
                     ATKSMHGHVMGATGAIEALITVLALWQDAIVPTAHLDAIDPACAGVRHITQAEHGSDL
                     QAALCSSFAFGGSNAVLAFKACK"
     gene            70516..70800
                     /locus_tag="HNEAP_RS00310"
                     /old_locus_tag="Hneap_0063"
     CDS             70516..70800
                     /locus_tag="HNEAP_RS00310"
                     /old_locus_tag="Hneap_0063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822966.1"
                     /note="Involved in the biosynthetic pathways of fatty
                     acids, phospholipids, lipopolysaccharides, and
                     oligosaccharides; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_012822966.1"
                     /translation="MTDLSQKITDQALVEELANLIVDGLNLEVSAAEIDADAPLFGQG
                     LGLDSIDILEIAMMVSKRYGFALRSDDENNTRIFSSLRHLAQHIAEHRSC"
     gene            70809..71507
                     /locus_tag="HNEAP_RS12050"
                     /old_locus_tag="Hneap_0064"
     CDS             70809..71507
                     /locus_tag="HNEAP_RS12050"
                     /old_locus_tag="Hneap_0064"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein-like protein"
                     /protein_id="WP_012822967.1"
                     /translation="MSRAGLLSRVKAGLILFLLGLDLFLANILSPKAHVSAAVVVLAF
                     LPITLIMLDVLWHTAGKAVALAVAALIVLGGVLLLPQLQAQISLIYLLQHLTANLLLG
                     FWFGRSLWRNRQPVCTQFAGVLHPRMTPLLVQYTTRVTQAWTIFFFAMATTSILLYLF
                     APITLWSIFANSLTLPLLVLMFGAEYLVRRRVLPPEDQLGPLSAFRAYRRSVLARLAQ
                     GRHSNVNPDTPTSK"
     gene            71516..73297
                     /locus_tag="HNEAP_RS00320"
                     /old_locus_tag="Hneap_0065"
     CDS             71516..73297
                     /locus_tag="HNEAP_RS00320"
                     /old_locus_tag="Hneap_0065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003262301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="WP_012822968.1"
                     /translation="MTSFPLIFADPDQLLFYRQQGNAVHTITAREFMADAEALAVDLT
                     TRMGAHQSIINLCQDRYRFMVGFAATILAGKTNLLPSTFTGETLRQIFIDAPDALCLH
                     DHDDWPFPYPHLSLDHLSLSHRALANRCPREPLPDGLGESDHIKPEHVVAQVFTSGST
                     GLPMPHNKTWGKLVRNVEAALQQLGLWRPVSLVGTVPPQHMFGFESLVLLCLIGRCPL
                     WSGKPFYPADIVAALDAMPEPRMLVTTPFHLQALLDAQIALPKIDRLLLATAPLSPEL
                     AERAERVTGAPLFEIYGSTETGQIANRRPTQSTAWTLFPGITLTKAHLDENDELFIAN
                     GEHIEAPVMLSDRIHVRADGRFDLLGRIADQVNMAGKRSSLNYLSAQLKAIDGVTDGV
                     FFLPETKKDRTGKNRVGKDQAITRLCAVVVAPALSAADILAALRDRLDPVFLPRPLIL
                     VENLPYNATGKLPQIALQAILDQHLAALAPKNQTSWRIPSDHPVFAGHFPGHPLVPGA
                     LLLDWVVERVAAYWQVASAGLRIEQAKFTHPVLPDARVTLDLKPEADRCRFTLHVHAG
                     ETNPVAVSGVLSRQSNDEAGDTEARQA"
     gene            73294..74238
                     /locus_tag="HNEAP_RS00325"
                     /old_locus_tag="Hneap_0066"
     CDS             73294..74238
                     /locus_tag="HNEAP_RS00325"
                     /old_locus_tag="Hneap_0066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="WP_012822969.1"
                     /translation="MNASAKAEWQQRPERGSQFMLRVMLWLSRHLGRSVSRWVLYPIA
                     LYFLLFVPAARRASRQYLARVFGRPARLIEVFRHIFTFASTVHDRVYLLDGRDDLFKI
                     EFVNRHWFDSPEGAILIGAHMGSFEALRSAGKTHARRRVSMLMYPENARKINALLALV
                     NPDAANDIIPLGQVDSMLTAQERLAAGHLVGMLADRSLPQDTLRPCVFLGEPAAFALG
                     PFRVAALLKKPVYFMAGLYLGGNRYRVHFDRLADFSDTPRAGRDAAILAAQDRYVEIL
                     ESLCRQAPYNWFNFYDFWSDDSSSDHARTNPPDKEPAD"
     gene            74238..74837
                     /locus_tag="HNEAP_RS00330"
                     /old_locus_tag="Hneap_0067"
     CDS             74238..74837
                     /locus_tag="HNEAP_RS00330"
                     /old_locus_tag="Hneap_0067"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822970.1"
                     /translation="MRQTLFLMLLLLQGLVQPVTVVAAAPSPDWSPASVLHTLAEHRR
                     GEVRFTEQKFIGVLDTPLLSEGTLTFRPPDYLEKHTTSPRDERMTIEGDVLTYTRQSQ
                     TYTLNLAEHPEATAYANSIRGLLNGNAALLRKSYVLKLSGDRAHWVLLLLPTDPRIQS
                     LIKSISVNGSGDHLQRIEYDQANGDRSVMTLLPVIPPTP"
     gene            74834..77248
                     /locus_tag="HNEAP_RS00335"
                     /old_locus_tag="Hneap_0068"
     CDS             74834..77248
                     /locus_tag="HNEAP_RS00335"
                     /old_locus_tag="Hneap_0068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003262298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MMPL domain-containing protein"
                     /protein_id="WP_012822971.1"
                     /translation="MKHQGLEKMSWTERRLPVIGLWLLALALSLAVILHTRFTADMSA
                     FLPEHPTAAQAFLVDQIKDGAISRMILIGIEGGDAATRADASKALGNALRQSGLFTVV
                     RNGDAPTRDQDKTLLFDHRYLLSPDITPERFTVAGLHEAIANGIDLLASPFGMFSQTI
                     FTRDPTAETFAIVGKLGQNTGTDDAPRNQNGVWVSPDGKRSLMMLQTRAAGSDTDAMA
                     RAIEAVRADFSNAVKAHPDGSSLRLLVSGAPVFSVDARALIKSDVERFSIIGSVAVML
                     LLLVVYRSFSMLVLGLLPVLTGIAVAIATVSLGFGTVHGITIGFGTTLIGEAIDYSIY
                     YFIQTQNAPKEGSAFRSAGRSEGMERFWPTIRLGVLTSITGFAALLFSGFPGLAQIGL
                     YSIAGLTTAALVTRFVLPHLGTARLNRHSLAGIGRLLAPVFRAIQALRWGFVLLALAG
                     FVLLVWRHDAIWQTGLSGLNPISGQAKAMDDELRADMNADDARYFIVAKAPTQQAALA
                     AAERIDAALEPLIKQGVLARFDSPAKFLPSVATQRVRQQALPDSTTLTERLDAAVQGL
                     PISASKLKPFVDAVEQARKQTPLTPADLEGTSFGLAVSALLQKQNGEWLTLIRLYVPS
                     VGTLDTARITAALKSSGISDALFVDKDAESSRLFNSYLENTITLSLAGLLGIVILLGF
                     VLRRPARLIRVLLPLLVAVVLVMAGLNLAGEKLNILNLVGLLLIVAIGSNYALFFNQN
                     TAPDHQTLASLLLANLTTVIAFGTLAFSQLPILHAFGSTVAPGAFLALVVAAAFAKPN
                     APKAPA"
     gene            77245..77697
                     /locus_tag="HNEAP_RS00340"
                     /old_locus_tag="Hneap_0069"
     CDS             77245..77697
                     /locus_tag="HNEAP_RS00340"
                     /old_locus_tag="Hneap_0069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822972.1"
                     /translation="MTNAQAQSRTLDHEEIAALIPHQGSMCLLDHVVDWNAQKIACTA
                     ISHRAIDNPLRRNGRLGAAVGIEYAAQAMAVHGALLAARDTAPKKGMITRVQRIALHA
                     ERLDDCPDALRITAKRLMGDERMVRYGFELRCAERMLLEGEASVILDA"
     gene            78057..79043
                     /locus_tag="HNEAP_RS00345"
                     /old_locus_tag="Hneap_0071"
     CDS             78057..79043
                     /locus_tag="HNEAP_RS00345"
                     /old_locus_tag="Hneap_0071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011319416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactate dehydrogenase"
                     /protein_id="WP_012822974.1"
                     /translation="MRVAVFSSKPYDQESLTRANAAFRHELHFFEAALNLQTCSLAEN
                     AEAVCVFVHDQIDAHLLCCLAGRGVKVVALRCAGFNNVDLPAAREVGIDVVRVPAYSP
                     YAVAEHAVAMMLTLNRHTHRAYNRVREGNFALNGLLGFDMNGKTVGIVGTGRIGTVLA
                     RIMIGFGCTVLAYDLYPNDECKALGVRYVPLDELLPQSDIISLHCPLSEETRHLIDSK
                     AIGKMKRGAMLINTGRGALIDTSAVIAALKSGHIGALGLDVYEQEENLFFEDHSEEII
                     QDDVLERLMTFPNVLVTAHQGFFTREAIDAIAKITLNNLKQVEAAEPCPNQL"
     gene            79194..79484
                     /locus_tag="HNEAP_RS00350"
     CDS             79194..79484
                     /locus_tag="HNEAP_RS00350"
                     /inference="COORDINATES: protein motif:HMM:PF07238.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus assembly PilZ"
                     /protein_id="WP_012822975.1"
                     /translation="MLLKPDLRDFQRMPQRAPMRYQNEHDPTWQSAELMDLSASGLAM
                     LTIESLPEGSVLNVEIAPALAVVPPLRAVVEVRRCEPDGEGHLVGVRFVEMY"
     gene            complement(79586..80446)
                     /locus_tag="HNEAP_RS00355"
                     /old_locus_tag="Hneap_0073"
     CDS             complement(79586..80446)
                     /locus_tag="HNEAP_RS00355"
                     /old_locus_tag="Hneap_0073"
                     /EC_number="5.1.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="WP_012822976.1"
                     /translation="MKLTDTKPTAPIGIFDSGVGGLSVYQAVRHALPAEDIIYIADSG
                     FAPYGDRSSDFITERAVAMTDFLIAAGAKAVVVACNTATVIAVTQLRRQFSIPIIALE
                     PAIKPAIEHSQSGTIGVLATRKTIESPAVERLCRTHGVNTRVLLQPCPGFVEQVERGE
                     MDHPDTTDLIRRYVEPLLAAGADTLVLGCTHYVYLAQQIRTIVGPDVSILDSSAAVAR
                     QVGRRIGSSEVAASTGRCGQDQFFTTAASTDHARAVMSTLVGRPVEVHYAGTTRPAST
                     LEAETAQTRD"
     gene            complement(80598..80861)
                     /locus_tag="HNEAP_RS00360"
                     /old_locus_tag="Hneap_0074"
     CDS             complement(80598..80861)
                     /locus_tag="HNEAP_RS00360"
                     /old_locus_tag="Hneap_0074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Txe/YoeB family addiction module toxin"
                     /protein_id="WP_012822977.1"
                     /translation="MSWQLVYTKHAQKDAKKLAASGLKEKAMDLLKVLEENPYQNPPP
                     FEKLVGDLAGAYSRRINIQHRIVYEVLEQAHIVKILRLWTHYE"
     gene            complement(80858..81100)
                     /locus_tag="HNEAP_RS00365"
                     /old_locus_tag="Hneap_0075"
     CDS             complement(80858..81100)
                     /locus_tag="HNEAP_RS00365"
                     /old_locus_tag="Hneap_0075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020162477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="WP_012822978.1"
                     /translation="MAILNATEARSKLYSLIDEANDSHQPIVIKGKRGSAVLISEEDW
                     NAITETLNLLAIPGMRESIQEGLNTPASECAKDLDW"
     gene            81093..81296
                     /locus_tag="HNEAP_RS00370"
     CDS             81093..81296
                     /locus_tag="HNEAP_RS00370"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600304.1"
                     /translation="MAMLHAPLIKAYAITHGRSRPIFQTYRIINGHGMRHLTITPELM
                     QLISGQYFKINKTSDPIDTPQLP"
     gene            complement(81463..81732)
                     /locus_tag="HNEAP_RS00375"
                     /old_locus_tag="Hneap_0077"
     CDS             complement(81463..81732)
                     /locus_tag="HNEAP_RS00375"
                     /old_locus_tag="Hneap_0077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008956573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822979.1"
                     /translation="MKAKDFDKKFEEGQEDIVDDLDLSSARRVNQGQKRINVDFPAWV
                     VESLDREAARMGVTRQSIIKVWLVERLQAESANKPLHGDTAGGAH"
     gene            complement(82067..82297)
                     /locus_tag="HNEAP_RS00380"
                     /old_locus_tag="Hneap_0079"
     CDS             complement(82067..82297)
                     /locus_tag="HNEAP_RS00380"
                     /old_locus_tag="Hneap_0079"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822981.1"
                     /translation="MSKAVPDEPKFPIQLVWIESGDVETYEDARDLLCNLEEFDSNDP
                     VDRNAARLTDALGRHISLVVRIYDDLCECKLE"
     gene            complement(82401..82835)
                     /locus_tag="HNEAP_RS00385"
                     /old_locus_tag="Hneap_0080"
     CDS             complement(82401..82835)
                     /locus_tag="HNEAP_RS00385"
                     /old_locus_tag="Hneap_0080"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600305.1"
                     /translation="MALLVALAFVVSLISFGWWLVFAYNIVTGHTAIEFGTKFAPQML
                     EQASQQKILFTQMREYFVLIGGAIGWGAFFALPNFSNRPFRALPKLLLISCVIGITAA
                     LVMPASVIFKVTPILTVILIFMRCLLIEDHPKHAMDQKNIET"
     gene            complement(82918..83169)
                     /locus_tag="HNEAP_RS00390"
                     /old_locus_tag="Hneap_0081"
     CDS             complement(82918..83169)
                     /locus_tag="HNEAP_RS00390"
                     /old_locus_tag="Hneap_0081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822983.1"
                     /translation="MKQKEIDRWAKARTKGMLMYVLLTGIVSYGIPMFAVMTFLFHHS
                     KLSVVQSAALWLAAGAFYGIATWLVQEHRYRKATDVPQV"
     gene            complement(83469..83678)
                     /locus_tag="HNEAP_RS00395"
     CDS             complement(83469..83678)
                     /locus_tag="HNEAP_RS00395"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600306.1"
                     /translation="MVARPAWLIFVGSVPVDANAARKVKAVGQFLGLKFVALHHVVNQ
                     SHYHLQVVTIVPNKALKRVRLKPAP"
     gene            83787..83966
                     /locus_tag="HNEAP_RS00400"
                     /old_locus_tag="Hneap_0084"
     CDS             83787..83966
                     /locus_tag="HNEAP_RS00400"
                     /old_locus_tag="Hneap_0084"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822986.1"
                     /translation="MRREQLTELESHLTKAASALRAAWILCKHNHMEPTAKELADTVL
                     DVETARDRVKDISTA"
     gene            complement(84404..84736)
                     /locus_tag="HNEAP_RS00405"
                     /old_locus_tag="Hneap_0085"
     CDS             complement(84404..84736)
                     /locus_tag="HNEAP_RS00405"
                     /old_locus_tag="Hneap_0085"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822987.1"
                     /translation="MNIDEVVDLLPDEKLRSDLAKWVNDWKEDDTDITRLEKMLSKWH
                     SYTWFKDDERTLHFLNQLNEFRKTAISNVGGLTMNERLYYFCLFDNWDNGNVQQKDKI
                     RHKLLAQA"
     gene            complement(84810..85118)
                     /locus_tag="HNEAP_RS00410"
                     /old_locus_tag="Hneap_0086"
     CDS             complement(84810..85118)
                     /locus_tag="HNEAP_RS00410"
                     /old_locus_tag="Hneap_0086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822988.1"
                     /translation="MACDKCKELCIRYAIRLPGNLRKAISIASQNVTDGTLIDTTDPS
                     AHSVSFAQLAAGQTWDDIVAYHFRCSCCGEQFSLHAETYHGSGGFWEPVRKAAIRENL
                     "
     gene            complement(85475..86020)
                     /locus_tag="HNEAP_RS00415"
                     /old_locus_tag="Hneap_0088"
     CDS             complement(85475..86020)
                     /locus_tag="HNEAP_RS00415"
                     /old_locus_tag="Hneap_0088"
                     /inference="COORDINATES: protein motif:HMM:PF14002.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="yfeABCD locus regulator"
                     /protein_id="WP_012822990.1"
                     /translation="MTYDEAKKKILIKWLVGAPVVVATSLSSAVSALKMFYFGLDSGD
                     QLSSAIALPIKRLVYLIYENTFFLGFFWKHSPTPTPKELFATSNIAFFVIYLCIFFGM
                     ALVGSARSLSARLAEIDKEIENELIRESVKGNVPRRRQEIQEQVSVPKPGRLSQFHTL
                     YLAPIVAGVVVLVIAKISGLG"
     gene            complement(86050..86634)
                     /locus_tag="HNEAP_RS00420"
                     /old_locus_tag="Hneap_0089"
     CDS             complement(86050..86634)
                     /locus_tag="HNEAP_RS00420"
                     /old_locus_tag="Hneap_0089"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_012822991.1"
                     /translation="MSSQEFYVITGASGAGKSTLIAALDDLGYSTIPEAALAFMREQL
                     ECNGRILPATDRTAFMESVLARSIQDYEAAKSLDAPVFFDRGIPEWLRFLEPSEPNCR
                     IAAECRYASTVFVAEPWPEIYVCDHERTHSYDRAAKSYVPTISAYLQSGYEACVLPKV
                     TVRERVAFVLAQVGAGAQQAAAADRHPATRPAGG"
     gene            complement(87553..87843)
                     /locus_tag="HNEAP_RS00425"
                     /old_locus_tag="Hneap_0092"
     CDS             complement(87553..87843)
                     /locus_tag="HNEAP_RS00425"
                     /old_locus_tag="Hneap_0092"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012824514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822993.1"
                     /translation="MNAYLILDISINDFESFKGYIEKIPAFIQKHDGRYVIQGVEPEV
                     MEGDWKPERVVVIEFPTKEGAKGFLNDPDAQALFDIRHKSTTSKLILAEGCL"
     gene            complement(87840..88211)
                     /locus_tag="HNEAP_RS00430"
                     /old_locus_tag="Hneap_0093"
     CDS             complement(87840..88211)
                     /locus_tag="HNEAP_RS00430"
                     /old_locus_tag="Hneap_0093"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002969201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_041600487.1"
                     /translation="MIDHIGMAISDYDKSKKFYSKALAPLGIGLVAEVQGWAGFGKDG
                     KPEFWFGVHEKIQNPMHIAFSAVSREEVNKFYEAAILAGAKDNGKPGVREIYHPNYYG
                     AFVIDPDGHNIEAVCHAEENK"
     gene            complement(88585..89196)
                     /locus_tag="HNEAP_RS00435"
                     /old_locus_tag="Hneap_0094"
     CDS             complement(88585..89196)
                     /locus_tag="HNEAP_RS00435"
                     /old_locus_tag="Hneap_0094"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012822995.1"
                     /translation="MSDCGCGAEQAEKLERTTLAYLLSINGVMFVVEAALGFYAQSTG
                     LIADSLDMLADATVYGISLYVVGKGISQQAKAASVSGVLQIILGLGVLFEVVRRSLYG
                     SEPQSMLIMAVGLLALIANVACLMLISKHRDGGVHMRASWIFSTNDVIANVGVICSGA
                     LVWLLGSRYPDLVIGAIISAVVVRGGIKILKDAKATKSQEIVT"
     gene            complement(89303..89782)
                     /locus_tag="HNEAP_RS00440"
                     /old_locus_tag="Hneap_0095"
     CDS             complement(89303..89782)
                     /locus_tag="HNEAP_RS00440"
                     /old_locus_tag="Hneap_0095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012824522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_041600307.1"
                     /translation="MSSNFTIERAIADDAQEVAVMVGELLAEIMNAIGVQAFNFDLAE
                     TTSRLQDFLNREKYFVFVARGVSGNPAGFIALYESYALYAEGTFGTIPELYVRPDYRT
                     NGLGLRLVSQAKSFGAARGWKRLEVTTPPLPQFDRTLAFYEREGFAISGGRKLKVSL"
     gene            complement(90138..90461)
                     /locus_tag="HNEAP_RS00445"
                     /old_locus_tag="Hneap_0096"
     CDS             complement(90138..90461)
                     /locus_tag="HNEAP_RS00445"
                     /old_locus_tag="Hneap_0096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822997.1"
                     /translation="MSDNEIQAQGSSMSLRKSIGIYAAFLAVFIILVNLSFSTTWFPG
                     VIAFFAYLVFGFLLNRIVLRGLIEWHPMYNTIENVSSAKLSSFLLWPISYAGLFFRLA
                     VNKVL"
     gene            complement(90867..91082)
                     /locus_tag="HNEAP_RS12420"
                     /old_locus_tag="Hneap_0097"
     CDS             complement(90867..91082)
                     /locus_tag="HNEAP_RS12420"
                     /old_locus_tag="Hneap_0097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012822998.1"
                     /translation="MEIILASTLTCPECGHKETETMPTDSCQWFYECKGCGVLLKPKK
                     GDCCVFCSYGSVPCPPIQQGTGSCCSS"
     gene            complement(91085..91495)
                     /locus_tag="HNEAP_RS00450"
                     /old_locus_tag="Hneap_0098"
     CDS             complement(91085..91495)
                     /locus_tag="HNEAP_RS00450"
                     /old_locus_tag="Hneap_0098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012822999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury transporter MerC"
                     /protein_id="WP_012822999.1"
                     /translation="MRLTAISEKLGSLGAIVSAMGCASCFPVLGSLGATIGLGFLAKF
                     EGLFINTLLPIFAVIALVSVAISWWSHRQHIRGILGVAGPAMVLATLYLFWTDSWSTY
                     MFYFALALMFAVGVWDIVSPPNKKCAIPISSSEG"
     gene            complement(91540..91896)
                     /locus_tag="HNEAP_RS00455"
                     /old_locus_tag="Hneap_0099"
     CDS             complement(91540..91896)
                     /locus_tag="HNEAP_RS00455"
                     /old_locus_tag="Hneap_0099"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823000.1"
                     /translation="MLNLLYGLWLESPPIRAPGFIAALVVAGLGGYLCFAKVRVKAWN
                     VFSKSLAVAFCCFVILLIFAIIGILVVSTGILGMARSWASFGDAYVWGVFSLPLLAFF
                     LSLGSFALTNHSRATR"
     gene            complement(91913..92266)
                     /locus_tag="HNEAP_RS00460"
     CDS             complement(91913..92266)
                     /locus_tag="HNEAP_RS00460"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823001.1"
                     /translation="MSAADQKTLKDAAMADIRLVEEILRRWDPIGVEPGIVAPADEYD
                     SYAPHIVSMAKSGCTVKALAAHLEHLGSDTMGLGSSNELSRSHSLKFAAEILVALQPS
                     NNSLKSDAAKPRTLG"
     gene            complement(92363..93529)
                     /locus_tag="HNEAP_RS00465"
                     /old_locus_tag="Hneap_0101"
     CDS             complement(92363..93529)
                     /locus_tag="HNEAP_RS00465"
                     /old_locus_tag="Hneap_0101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823002.1"
                     /translation="MNLPNDIDSLRERVQKILDPIVSAVDKGTKAEKDFLFTASRTDA
                     GRGLPSYYLVYFLFVDLLGYKNLGQFEKVAWSVPIDYNGTAYLLEHRKMGMGLFAADK
                     EKQEGECQEIVKKIKKAAKAAQPYFEWIANEAAKQSKLNVLNHSLRLHDRYSFLESEH
                     KKKLEEAISRKDERIKTQHSENSWSVRMPYYELKRESEWLALSAIDAFYSFTEHVFIH
                     AAILKGHLLTGEDVANLADKDWASKFKACLDVQENSVKPHYDKLVAIKRQIRNYMAHG
                     AFGKNGEAFQIHSGAGAVPLLMPHQKGSSRFSMQSGTEFQEEEAISAIEEFMRFYWES
                     NDFPEVMYIKSTLPSILTYASDATYKNAMASTEDMESFVDYLIGVHDRAGDMDW"
     gene            93675..93935
                     /locus_tag="HNEAP_RS00470"
     CDS             93675..93935
                     /locus_tag="HNEAP_RS00470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011634422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_041600489.1"
                     /translation="MNRQEFNQQPPKLLDRVRAEIRVRHYSIRTEEAYVDWMRRFILF
                     HRKRHPADMGAEEVGAFLSYLATERQVAASTQNQAKSTLLFL"
     gene            94056..94408
                     /locus_tag="HNEAP_RS00475"
                     /pseudo
     CDS             94056..94408
                     /locus_tag="HNEAP_RS00475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020159697.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            94568..95170
                     /locus_tag="HNEAP_RS00480"
                     /old_locus_tag="Hneap_0103"
     CDS             94568..95170
                     /locus_tag="HNEAP_RS00480"
                     /old_locus_tag="Hneap_0103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019645487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="WP_012823003.1"
                     /translation="MSEFWNQKYARDDYFYGEQPNDFLHSQIFRLPTGARVLVVGDGE
                     GRNGVWLAEQGFTVTTVDGSHVGCDKSRALAAQRKVSLEIVCADLLTWDWPVGAFDAV
                     VSVFLHFSPDERKVAHARIQAALVHGGWLIIEQFHPNQLNGYTSGGPKAVDMLTTMGD
                     LADDFNAIDWWLLAEGTTRLEEGPGHSGLGYVSHGVGRRQ"
     gene            complement(95561..98821)
                     /locus_tag="HNEAP_RS00485"
                     /old_locus_tag="Hneap_0104"
     CDS             complement(95561..98821)
                     /locus_tag="HNEAP_RS00485"
                     /old_locus_tag="Hneap_0104"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012585965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SNF2-like protein"
                     /protein_id="WP_012823004.1"
                     /translation="MTRPIHLPFTLADITDYFGAHEIKKAEPYARHAVQLMHVENGYI
                     NAEVQGTVRTPYDVHINFYHDTDGKVFFDAECSCPVGYQCKHAAATLIAALNNHQHTI
                     PGVSAQTLAWLDQWRQSTTNAAKAMKEMLVYLLKPPSGRELLAKVYLNKVRVGKEGPI
                     LESAKTWYNIDGALRKPPRFVQQVDRSILHLINDQPFGFGYNGFSLENDLGEMALDLM
                     CDTGRLYIERNHTPLKRGADRAARLQWRREGDTLHPELVAEPEAKLFALSAFWYLDAH
                     TGEVGRLSTAEDPSKIKHLLSIPPVTEQALPLVATVLAESAPDLAPPIQSEATATAID
                     IAPTPVLSLHTLAARRINPYRSYDRKIDGFDVAEFAFDYDGVRVGLDDCSGLSQDARG
                     HWVFIKRQADDEARWARQLRKHGLTRIPANVLDDARALYGLENEAAWVEFMTEALPKL
                     RAAGWLVEIPDDFRHVWHEPQGWDATVNEEGAGWFDLDLGVLIDGQRLSLTPMLSELF
                     AREPRWLDSSYIDEQPDDASVILHSHENLRIRVEAGRIKTIVRQLIDLFDRPQGDSLR
                     LHTLDATRLETLPEDMRPNESIHALEVARRIRSAGAAVAVEAPEGLGIELRGYQREGL
                     GWLSHLRTLGVGGILADDMGLGKTAQTLAFLLREKQQGRLGHPALIVLPTSLIFNWRH
                     EAKHITPALRVLTLHGANRSALFDQISKHDIVLSTYPLVWRDIEALEQHTWSQLILDE
                     AQTVKNASSQAAQAIRRIKSEHRLSLTGTPMENHLGELWAQFDFLLPGFLGDKTAFTR
                     AFRTPIEKHGDTIRRDLLARRLRPFLLRRRKEDVAAELPPKTSIIRSVSLEGAQRDLY
                     ETVRSAMDEKVRQSIDSMGLARSHIVILDALLKLRQVCCDPRLLPSSKTGQSAKRPTQ
                     SAKLDLLLTMLPELVDEGRRILVFSQFTSMLALISEALTKAKLAHSMLTGETRDRETV
                     VRQFQNGDTPVFLISLKAGGVGLNLTAADTVIHYDPWWNPAAEDQATDRAHRIGQTRQ
                     VFVYKLVTEGSIEEKILALQDKKAKLAEGVLSGDGSAFTKFSEVDIQALMAPLPRD"
     gene            99273..99587
                     /locus_tag="HNEAP_RS00490"
                     /old_locus_tag="Hneap_0105"
     CDS             99273..99587
                     /locus_tag="HNEAP_RS00490"
                     /old_locus_tag="Hneap_0105"
                     /inference="COORDINATES: protein motif:HMM:PF04023.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FeoA family protein"
                     /protein_id="WP_012823005.1"
                     /translation="MLALSQLLSRSEIPAMPHTSSQHNPARSASFGIGLAARGSRVRV
                     VGLTGEHPALAKRLEGMGIHAGSELEILQREGGALIVRIGSSRVALGTGMVHKILVTA
                     QS"
     gene            99584..99838
                     /locus_tag="HNEAP_RS00495"
                     /old_locus_tag="Hneap_0106"
     CDS             99584..99838
                     /locus_tag="HNEAP_RS00495"
                     /old_locus_tag="Hneap_0106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter FeoA"
                     /protein_id="WP_012823006.1"
                     /translation="MTTNVQITLLDLKPGDVGVVKGFAPGNADYRRRLMAMGLTPGTR
                     FTVTRLAPLGDPIQLQVRNFALTLRKDEACLLRIERADAS"
     gene            99908..102244
                     /locus_tag="HNEAP_RS00500"
                     /old_locus_tag="Hneap_0107"
     CDS             99908..102244
                     /locus_tag="HNEAP_RS00500"
                     /old_locus_tag="Hneap_0107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron transporter B"
                     /protein_id="WP_012823007.1"
                     /translation="MATFTVGLIGNPNCGKTTLFNALTGLRQKVGNWPGVTVDRKVGT
                     FDVGADRVELVDLPGTYSLDAASSASLDEAIAREYALSGEADVIINILDASNLERNLY
                     LTTQLLEMRVPLILAVNMLDLAEEAGIHIDFAALEQRIGCPVVPITAAKKQGLDELKR
                     RLVERAAHADEPGIKIEYAALIETALRELKPKIEPVAAAQNIDPRWMGVKLLESDRLT
                     LATIDDSLRTDVEAAQEKIRAHLDEEADVFIADARYTFIHQLTSASVTQRGQLRRSLT
                     DRIDAIVLNRFLGIPIFLLMMYLLFVMSFNGGSIFLDFFDQATHTIFVSGFAHVLQLV
                     HAPDWLITFLATSVGGAIQLVSTFIAPIGMTFLFLSLLEDSGYMARAAFVMDRFMRKI
                     GLPGKAFVPMIVGFGCNVPAVMATRTLEDPRERLISALMQPFMSCSARLVIYMAFVAV
                     FFRENGGQIVFALYVLGIVLAILTALLLKKTALRGEATPFIMELPTYHVPTLRGLLLT
                     TWERLSVFILRVGKVIIVASVIVTLLSSFSTSGKPLGEGEVGDSILGSIGKTITPVFH
                     PMGITDENWPAAVGLLSGVVVKEIVMGTLNGVYTRMDAGDAAKAAADEPKPKTFDFWG
                     GLAAAVQTIPDNAKAFAKGFFDPLGFGQVEQTQQSNLQQAAAQQDLDATTLSRMGNLF
                     TTSAAIAYLIFILLYIPCVNTMAAIYRETRSRAWTLFAIVWGIGLAYGLAVLFYQFAN
                     FNAHPMQSLVWLVVILAALIAVIVALKRNGQRLVHVPH"
     gene            102268..102612
                     /locus_tag="HNEAP_RS12055"
                     /old_locus_tag="Hneap_0108"
     CDS             102268..102612
                     /locus_tag="HNEAP_RS12055"
                     /old_locus_tag="Hneap_0108"
                     /inference="COORDINATES: protein motif:HMM:PF09012.8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823008.1"
                     /translation="MNSSRLLTPSQLKAYLKFRGTAPLRDVLLHFDAAPSAVLHLLAF
                     WRERGHIRQIAVTPAVCDKGCGGCGSGDVCTPDPHEYDLIEWVESSASPVCFDVLSDY
                     DEAWKPGSPHGV"
     gene            complement(102736..103629)
                     /locus_tag="HNEAP_RS00510"
                     /old_locus_tag="Hneap_0109"
     CDS             complement(102736..103629)
                     /locus_tag="HNEAP_RS00510"
                     /old_locus_tag="Hneap_0109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018232778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_012823009.1"
                     /translation="MKFHDYYATLGVERTATQAEIKKAYRKAAQKYHPDRNKEAGAEE
                     KFKEINEAYDVLGDEEKRQRYDTLGSNYRAGEDFRPPPGFDPNQFGDQYGGAGFSDFF
                     SSIFGGGFDPGAAHGGRRTRAARGPDYEMALSLSVQEMIEGGSKSVTTDHPETGRKTL
                     KVTIPKGSTPGKRMRLTGQGGSGANGGPAGDLYLVFQLEANSLFTLDGNDVLYNLPVT
                     PWEAALGEKVTVPTPTGGKISMTIPAGSQSGSRLRVRGRGLAGGDYFVTVMIHTPPAK
                     TDEARDFYREMKASMPFNPRD"
     gene            complement(103831..103956)
                     /locus_tag="HNEAP_RS00515"
                     /old_locus_tag="Hneap_0110"
     CDS             complement(103831..103956)
                     /locus_tag="HNEAP_RS00515"
                     /old_locus_tag="Hneap_0110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011370693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="WP_012823010.1"
                     /translation="MKILSSLKSAKTRHKDCQIVRRRGKVYVINKTNPRFKARQR"
     gene            complement(104152..104227)
                     /locus_tag="HNEAP_RS00520"
                     /old_locus_tag="Hneap_R0001"
     tRNA            complement(104152..104227)
                     /locus_tag="HNEAP_RS00520"
                     /old_locus_tag="Hneap_R0001"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(104192..104194),aa:Phe,seq:gaa)
     gene            104375..104971
                     /locus_tag="HNEAP_RS00525"
                     /old_locus_tag="Hneap_0111"
     CDS             104375..104971
                     /locus_tag="HNEAP_RS00525"
                     /old_locus_tag="Hneap_0111"
                     /EC_number="4.2.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="WP_012823011.1"
                     /translation="MMPARTAEITRDTAETQIELRINLDGSGRAEFKTGVPFFEHMLD
                     QIARHGLIDMDLTAQGDLHIDDHHTVEDCGIVFGQALAKAVGDKRGITRYGHAYVPLD
                     EALSRVVIDLSGRPGLVFSCSFTRASIGRFETQLVEEFFRGLVNHAGMTLHIDNIRGD
                     NAHHQAETIFKAFGRALRMALSPDPRQADQIPSTKGSL"
     gene            104974..105624
                     /locus_tag="HNEAP_RS00530"
                     /old_locus_tag="Hneap_0112"
     CDS             104974..105624
                     /locus_tag="HNEAP_RS00530"
                     /old_locus_tag="Hneap_0112"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH"
                     /protein_id="WP_012823012.1"
                     /translation="MAEAIAIVDYGMGNLRSVAKAVAHVAPAGTEVRITDSAEYILSA
                     DRVVFPGQGAAADCMAALKSRDLIAPLTEAAKTRPFLGICMGMQVMLDHSDENGGVHL
                     LAWFKGAVQRFPAGVDASGLALKIPQMGWNEIRQVRPHPLWHGVADMSRFYFVHSYYC
                     APEDASLTVGETEYGLRYTAALARGSVFAIQSHPEKSADDGLTLLKNFTRWDGRFD"
     gene            105661..106416
                     /locus_tag="HNEAP_RS00535"
                     /old_locus_tag="Hneap_0113"
     CDS             105661..106416
                     /locus_tag="HNEAP_RS00535"
                     /old_locus_tag="Hneap_0113"
                     /EC_number="5.3.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-((5-
                     phosphoribosylamino)methylideneamino)imidazole-4-
                     carboxamide isomerase"
                     /protein_id="WP_012823013.1"
                     /translation="MLLIPAIDLKAGQCVRLKQGRMDDDTVFSDDPVAMAQRWVDAGA
                     RRLHLVDLDGAFAGSPKNRESIAAICAAFPELPIQVGGGIREEETIEQYLAMGVSYVI
                     IGSKAVSDPHFVSDACLSFPGHVIVGLDARDGKVAIDGWAKTSNTDATDLARRFEQDG
                     VSSIVFTDIARDGMMQGANMEATRALARAVRIPIIASGGMTDMADIDRLIDAADDGVA
                     GAIIGRALYEGGIDLGMAQSRVDARCGVPPFTE"
     gene            106496..107269
                     /locus_tag="HNEAP_RS00540"
                     /old_locus_tag="Hneap_0114"
     CDS             106496..107269
                     /locus_tag="HNEAP_RS00540"
                     /old_locus_tag="Hneap_0114"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase cyclase
                     subunit"
                     /protein_id="WP_012823014.1"
                     /translation="MSLAKRIIPCLDVADGRVVKGIQFESLRDAGDPVEAARRYNLEG
                     ADELTFLDISASHEGRDTMRHVVEQVAEEVFIPLTVGGGIRALADVRSLLNAGADKVS
                     INTAAVFNPDLIKEIADSIGAQCLVVAIDARRVSQPGEPLRWEIFTHGGRKPTGLDAV
                     EWANRMAEYGAGELLVTSMDRDGTKQGFDLELTRAIADSVPVPVIASGGVGNLDDLTA
                     GILQGHADAVLAASIFHFGTYRISEAKANMAAAGIEVRQ"
     gene            107266..107676
                     /gene="hisI"
                     /locus_tag="HNEAP_RS00545"
                     /old_locus_tag="Hneap_0115"
     CDS             107266..107676
                     /gene="hisI"
                     /locus_tag="HNEAP_RS00545"
                     /old_locus_tag="Hneap_0115"
                     /EC_number="3.5.4.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823015.1"
                     /note="PR-AMP cyclohydrolase; functions in histidine
                     biosynthesis from PRPP; converts 1-(5-phosphoribosyl)-AMP
                     to
                     1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]imidazole-4-
                     carboxyamide during the histidine biosynthesis pathway;
                     binds zinc and magnesium; forms homodimers; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-AMP cyclohydrolase"
                     /protein_id="WP_012823015.1"
                     /translation="MTVPLWIDAVQWTDDGLVPAIAQDAQTGRILMFAWMNRVALEQT
                     VSTGEAVYFSRSRQRLWHKGEESGHVQRVQEIRLDCDGDVILLQIEQIGGIACHTGRE
                     SCFFRRLVDGQWQITDPVLKSPGEIYGEGAHGHE"
     gene            107663..108037
                     /locus_tag="HNEAP_RS00550"
                     /old_locus_tag="Hneap_0116"
     CDS             107663..108037
                     /locus_tag="HNEAP_RS00550"
                     /old_locus_tag="Hneap_0116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP diphosphatase"
                     /protein_id="WP_012823016.1"
                     /translation="MATNNPGELLAQLAAVIEQRKQADPGSSYVAQLFAKGRSKIAQK
                     VGEEGVEVALAAVSGDNVAIVSEMADLWFHSMVLLADAGLSHQAVLDELGERFGLSGL
                     EEKASRPQSIKSGASKTGNHKN"
     gene            108062..108343
                     /locus_tag="HNEAP_RS00555"
                     /old_locus_tag="Hneap_0117"
     CDS             108062..108343
                     /locus_tag="HNEAP_RS00555"
                     /old_locus_tag="Hneap_0117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatA"
                     /protein_id="WP_012823017.1"
                     /translation="MGSFSIWHWLVILAIVLLLFGTKRLKNLGGDLGSAIKGFKNAVK
                     DEEKKDADTAASEGSKESLSHKEADSSRVIEGEAVRRQNANDESGNKPS"
     gene            108390..109016
                     /locus_tag="HNEAP_RS12060"
                     /old_locus_tag="Hneap_0118"
     CDS             108390..109016
                     /locus_tag="HNEAP_RS12060"
                     /old_locus_tag="Hneap_0118"
                     /inference="COORDINATES: protein motif:HMM:TIGR01410"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatB"
                     /protein_id="WP_012823018.1"
                     /translation="MFGFSIWEIFLILVIALLVVGPERLPGLARTIGTWVHKIKKFVA
                     NAKAELDSEFNFQDMKDILNSQESEIAKLRALVEETRQEVNESGRQVLGAVDDAEASF
                     RAAAQSEQEVAGAPLKAIDDAAPAEQPVSAENKQAKTGKDADAATGKVKTSAPTSVPL
                     SFDEEIRMLEESSGQAFKRPFAPAEPVDAPSNTADANKPSPDSDSKTS"
     gene            109082..110113
                     /locus_tag="HNEAP_RS00565"
     CDS             109082..110113
                     /locus_tag="HNEAP_RS00565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012636809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatC"
                     /protein_id="WP_081441171.1"
                     /translation="MAGFLGHLVELRNRLLKGVLAVLVLFLILFPFRNELFTMLADPL
                     SRHMPAGSTMIAVEVASPFFIPLKLTALTAVFIAIPFLLYQLWAFIAPGLYKHERKLV
                     APLVFSSTILFYLGAAFAYFVVFPVVFGFLSTAGPSDVNFAPDIGEYLSFVTSLFFAF
                     GFVFEVPVAIVLLVIVGVVTPDKLAGFRRYAILIAFIIAAILTPPDVLSQFMMALPII
                     MLYEFGLFVSRFFYKAKLARAAEVEAEESGAADDESDEAVSARHAEYEAKAQTQADEP
                     LDMDKAFDEAEADQRRLESDSSASDDGPESNTAGRTEEGEQPSTGSKPEDEPNAPSEP
                     SPKKPDSPV"
     gene            110181..111722
                     /locus_tag="HNEAP_RS00570"
                     /old_locus_tag="Hneap_0120"
     CDS             110181..111722
                     /locus_tag="HNEAP_RS00570"
                     /old_locus_tag="Hneap_0120"
                     /EC_number="5.4.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase"
                     /protein_id="WP_012823020.1"
                     /translation="MSRTAPRNPVLLIIMDGIGVNPSRENNAYALANTPNLDYLFSHH
                     PHTVIEASGRACGLPDGQMGNSEVGHLTLGCGDLIRQDLVRIDDAIADGSFYENTALV
                     EAAQKAAADHRPLHLIGLVSDGGVHSHINHLLALIDLASRHGARPLVHMITDGRDTAP
                     KSARSYLPELEASLKAAGGAIATISGRYYAMDRDQRWERTALAWETIVRGDGPRAESA
                     EAALEASYADGKTDEFVLPMALKAFEPIEAGDSVIFFNFRNDRPRQLTEALAQTDFSG
                     FDRGDYQTVRVTCLTEYDPRFLSPIGFPPERPKNVLAEVISQAGIKQFHCAETEKYAH
                     VTFFFNGGKETPFAGEDRYMAPSPKVATYDLQPEMSAHEVADATIAAVEREEYGFVLV
                     NFANGDMVGHTAVRDAVIKAVETVDLEVGRLVQVAQKHGYSIIVTADHGNCDEMVDPV
                     TGEPHTQHTVYPVPCLLIDETEPRLRTGGGIANIAATVLELMGLPVPKKMKRSLLLNS
                     SNVSE"
     gene            complement(111734..112534)
                     /locus_tag="HNEAP_RS00575"
                     /old_locus_tag="Hneap_0121"
     CDS             complement(111734..112534)
                     /locus_tag="HNEAP_RS00575"
                     /old_locus_tag="Hneap_0121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron export ABC transporter permease subunit
                     FetB"
                     /protein_id="WP_012823021.1"
                     /translation="MNIETLSAIDLGLAALLVVALGVVQFLMGLGLQRSLVIGTVRMT
                     LQLLLVGLVLKTLFESAHLVWIGLMALVMLALAGYEVSARQKRPIKGWRGYVIGLLSM
                     GVTAAIITLLALIVIISPQPWYTPQYAIPLLGMILGNTMTGIGLALNHLTQTAWSNKS
                     RIEARLLLGQTATQAMADLRTEALRAGLIPTLNMLAAAGLISLPGMMTGQILAGAPPM
                     EAVRYQILIMLLITAATGFGSLLAVHLGARRLFDDRQRLRLERLGQRS"
     gene            complement(112531..113148)
                     /locus_tag="HNEAP_RS00580"
                     /old_locus_tag="Hneap_0122"
     CDS             complement(112531..113148)
                     /locus_tag="HNEAP_RS00580"
                     /old_locus_tag="Hneap_0122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018946705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012823022.1"
                     /translation="MLFEARNVTGEPGSGVRYRPVSLQLEAGEILTIYGQSGIGKSQF
                     LRALADLTPHTGDVLLDGVSQTKIRPENWRQQVGYVPAESGWWADVVAQHFSEQPPEA
                     WLSMLSLAPELLDAPVERLSTGERQRLALVRALVLQPKVLLLDEPTANLDQRNAQKLI
                     ELVKTYAQSEQAAVIWVSHDVDERALLGNRSLEICADTTHQAHRS"
     gene            complement(113272..114618)
                     /locus_tag="HNEAP_RS00585"
                     /old_locus_tag="Hneap_0123"
     CDS             complement(113272..114618)
                     /locus_tag="HNEAP_RS00585"
                     /old_locus_tag="Hneap_0123"
                     /inference="COORDINATES: protein motif:HMM:PF00034.19"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600309.1"
                     /translation="MQFPALIVTGVVTRAGDFFLHLTVFDLEVPVAQGHTPKVDSSAK
                     FVGLVGTVLLLAAIYYLVTSLIHVVTGQTYKNEFSPGDAPSVASATSAPASPTSEAAS
                     SSPAPTTTPVAAVSGGDAAAGKTKYATCAACHGADGKGNGGAFPNLTKLNAADAEAIL
                     HAFKKGDKAYLSKHGLGGARYGTMAPQAAGLSDADIADLAAYIAELGGHSASAAEPAA
                     APAAATSTTASASTGDAAAGKTKYATCAACHGADGKGNGGAFPNLTKLNAADAEAILH
                     AFKKGDKEYLAKHGLGGARYGTMAPQAAGLSDADIADLGAYIAELGGHSASAAPAAAE
                     AAPAAKPAAAAAPTQKIVSSEVVAWGHALFSSCAVCHGAAGEGGKLFAAPKLAGLPYD
                     SVVSLLNLYRKGQQMGANSYAMIPQAKHLTDSEINALASYIAVMNNSADHGATATE"
     gene            114766..116844
                     /locus_tag="HNEAP_RS00590"
                     /old_locus_tag="Hneap_0124"
     CDS             114766..116844
                     /locus_tag="HNEAP_RS00590"
                     /old_locus_tag="Hneap_0124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823024.1"
                     /note="catalyzes branch migration in Holliday junction
                     intermediates; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase RecG"
                     /protein_id="WP_012823024.1"
                     /translation="MVKIAAQQRSVPQKLHLPVDSLAGVGPRVAAQLVRLSIESIGDL
                     LWHLPLRYENRGQIVPLGYHLIGQSVLIHVTIAEAKSLMRGKARQVAQGYDDAASITL
                     WQFGRFGPTLQTGQSYLLFGEVREGASGLEMAQPELIQSAQLEAIVPIYPSTEGLSQS
                     KLRTLVGQALRVALHDLDECLPAPIRQRFGWPTMLAALQRIHAPVLADGVPTRDEPAF
                     ARMIGEELLAHLLALRLKRHEQSRDHAPRLSAPGRLYQELLAQLHFLPTKAQTRVLDE
                     IRADMAQGSPMLRLVQGDVGSGKTLVAAGAALTAIEQGYQVALMAPTALLAEQHQRNF
                     SQWFSPLGIDVQLLSGQQSASERRASLAALAEARSLMVIGTHALFQERVAFDQLGLVI
                     VDEQHRFGVHQRLALSDKGTHPDRAGHRPHQLVMTATPIPRTLAMSAYADLDVSIIDE
                     LPPGRTPITTALVRSDRRDQLIERISTVCAEGRQAYWVCPLVEDSERIEAQAAESTAE
                     LLREQLPHLTVGLVHGRMSAAEKNTQMARFKSHEVDLLVATTVIEVGVDVPNASLMII
                     ENADRMGLAQLHQLRGRVGRGRTDSYCVLLFDEPISDKARARLSLMRETQDGFRLAEA
                     DLAQRGPGEILGTRQTGLAKLRVADLVRDADLLDTARQLADELIAAQSPDIKPLIQRW
                     VGAAHQYGQV"
     gene            117014..117433
                     /locus_tag="HNEAP_RS00595"
                     /old_locus_tag="Hneap_0125"
     CDS             117014..117433
                     /locus_tag="HNEAP_RS00595"
                     /old_locus_tag="Hneap_0125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat-shock protein Hsp20"
                     /protein_id="WP_012823025.1"
                     /translation="MSIVRYEPFGLLSQLQRELARSEGSTATAEWSPSVDIKEEPDRF
                     VILADVPGVQPQDIDVHMENGQLTIKGEKKTEATAEDKNYKRIERTYGSFYRRFGLPD
                     SAEADKISARTKHGVLEIVIPKRESVQPRKINVVSED"
     gene            117857..118837
                     /locus_tag="HNEAP_RS12065"
                     /old_locus_tag="Hneap_0126"
     CDS             117857..118837
                     /locus_tag="HNEAP_RS12065"
                     /old_locus_tag="Hneap_0126"
                     /inference="COORDINATES: protein motif:HMM:PF12833.5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_012823026.1"
                     /translation="MALFEFSSAGQRGTEQLDAAVAHYAQIGRVLVEPDQQSGFAYNA
                     RIMQERPLAVGSLSVTAARVTRTRAHAAEGNPYDVLGVVLDAGEVEVSLEGRAPFRYA
                     HGEAFLWRGDEAGRSHYLSPQTRLLNIALPRATLEGGLAHPDRAEGRRLAASPEFRLL
                     AAYATAFLDVCPKLAPESTQTVALQLQDLALLALGANRDSAEQARNRGVRAARLVAIK
                     SDVEAHLLDPELSVRWVLRRHRISERYLRALFADEASSFGDFVLERRLARAWLRLIDP
                     RQHSTPIGVIAAESGFGDPSWFNRAFRRRFGVSPSEARAIYLTGNGADRC"
     gene            118927..120123
                     /locus_tag="HNEAP_RS00605"
     CDS             118927..120123
                     /locus_tag="HNEAP_RS00605"
                     /inference="COORDINATES: protein motif:HMM:PF00691.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441065.1"
                     /translation="MPFSPIRRAVYAVCPLSAVAIMRPSLHMDCGGARMKQPFMAIVL
                     TVSGSALLAAGSAIAFDFGDVLKRTVERATQSEVQRKVDQETRKTVRCALGDTRCEKA
                     ARADAEADAADADPAAGEHADAGGDHPLIAPYRGSVRKERDVDAFNEYLRIVGRAGKA
                     AKTERLEGKLTRLRYDNPKGRSTFEIERNYRDALTARGFRVDYECVKRTVCGTTDKPS
                     WQSLNGINLGIAGDVRYFTGKLAYGSGAAYVSVAVNPTVTYVHVLETASMERDMVAVD
                     ADALAAGLEKDGRVRLDGIFFDSGKALLKPESNPALDQAVQLLRQQASLKLLIAGHTD
                     DTGSHAANQKLSQQRAEAVRNALLARGIAADRLTAQGFGSGVPLADNASDAGRAQNRR
                     VELVKQ"
     gene            120120..121379
                     /locus_tag="HNEAP_RS00610"
                     /old_locus_tag="Hneap_0128"
     CDS             120120..121379
                     /locus_tag="HNEAP_RS00610"
                     /old_locus_tag="Hneap_0128"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823028.1"
                     /translation="MKRGLVAGGVIAVVGLASMAAGFVPNPFDAPGVEVVESGGEAAR
                     GAGEIRAPAPSDNPFDAPIPVVESGSPEARDLVGEEIIGPDPFVLPPIPVVESGSAEA
                     RALGERFSNPEAQRLREAAWRADSRFSVNPDSIPGHYRFDLRQRLRVDSADGLVDMSC
                     FVNSRDASLICPDWGLSGWGLDLETAQGKLDFVLRQADGDVFACGRHRDVGPACLQLG
                     EEIGPAFAWLRNMGLHQALLDSIPATPQALGEGPGGGVQGVRARTADGYLQLWFDRRA
                     STIATQMPWLGLGVGVMKDSRARVNRTVRRARFEGADRDGGDVVIDLVELEPARLERR
                     LDGYRVVTAFTAQALDEATSLGQHLHALQREAVGIRAELDACPSGTVGRDCRKHHRER
                     LKALDTRARDRALDFGERHGLPVPERP"
     gene            121407..121916
                     /locus_tag="HNEAP_RS00615"
                     /old_locus_tag="Hneap_0129"
     CDS             121407..121916
                     /locus_tag="HNEAP_RS00615"
                     /old_locus_tag="Hneap_0129"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823029.1"
                     /translation="MTIKATCNAALLLIAAGFTPSVFAVECRVVERIGNHFKDHILTD
                     IRGLAVGEYEVSPRKNLIVHSVDDIRFTGCRAVVKATIEVERKVRRDAKGNARIAGDI
                     DPDSVKLVDPSVGKWEFCFTKEPRIEKMKLSNTAGIGERQYKKIANRVWPRERCYTFI
                     VPKDEERPR"
     gene            121913..122284
                     /locus_tag="HNEAP_RS00620"
                     /old_locus_tag="Hneap_0130"
     CDS             121913..122284
                     /locus_tag="HNEAP_RS00620"
                     /old_locus_tag="Hneap_0130"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823030.1"
                     /translation="MSRSVASRVVKPVALLAIASLLAAAAHATTGKLTKREPVQRPPT
                     DSNGCMIESISGSLSFSYQLEGRAKREAIDNWKKQVKRKAPPEFASWKHANRYTKSMN
                     CDKYKGKFSCWAKAHPCERPR"
     gene            122315..123301
                     /locus_tag="HNEAP_RS12070"
                     /old_locus_tag="Hneap_0131"
     CDS             122315..123301
                     /locus_tag="HNEAP_RS12070"
                     /old_locus_tag="Hneap_0131"
                     /inference="COORDINATES: protein motif:HMM:PF14525.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_012823031.1"
                     /translation="MNLKNTPATLLPFNMVSGRYEGLEPVREAWSQLVCLDVMPAEPT
                     VPKLSASIWSLGDLKIGTFDGSAVKMVRTTKLAQDCADDLIICIERKTPTRATWGGAG
                     ARVFVPGDIHLWRADGTMQCETKGAFSALLLSIPRTVLSNHGIDIAPLLREGGICGNS
                     PETRLLCRYTDSVLGEVDALSPMGVSCCLSHLVDLAMLVLGGRNTVRLANRHRVRSVR
                     LASIKSDIDAHLLNPELSVGWVLRRHRISERYLRSLFADEDTSFTRFVLERRLMRAHA
                     ALDQSGRSISEIAYDCGFSDLSWFNRAFRQRFDMTPSQARAGLLDLSLERDG"
     gene            123488..126406
                     /locus_tag="HNEAP_RS12075"
                     /old_locus_tag="Hneap_0132"
     CDS             123488..126406
                     /locus_tag="HNEAP_RS12075"
                     /old_locus_tag="Hneap_0132"
                     /inference="COORDINATES: protein motif:HMM:TIGR04393"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane autotransporter barrel
                     domain-containing protein"
                     /protein_id="WP_012823032.1"
                     /translation="MFMDTRAQTKKAPWSSCRFQRFWLWVTTSALALVIAQLAQADEW
                     TGVTDDDWFNSANWSFFVVPTSSSPRLVIIDAGSSNPARIGGAGIDNAEATTMDIGVN
                     RNGVLEIEGGSRRLFSGDATLGRFWGSRGVVGVNGPDAQWGILGNLVIGNEGSGQITL
                     ENGATLGVSGNVDFARFRLAGFGQASEGALIINGGSFVQDPDTGTFGIGISGDATLEI
                     SNGGQLVSGYTTLGLNADGTAEASIYSNDATRLSRWQANNLRIGGAGQAGLAIGQGAV
                     VHVAGDALIGDEAGSRGTVLVFREASSAVDAGILNIGGALAVGEGGHASLLIGNGGKV
                     DVAGVVVIADNASASGNLVVGSAGELNTHHDGIYVGALGEGELTLSEGGRALLHGGAV
                     TLGFFAGSSGTLNIGAADGSDARAPGVLDASNVRFGAGAGTLVFNHTGHDYVFSSDIS
                     GNGLIKHRAGGTTLTGDGSAFTGGVFLEGGRLSVNGLLGGGIDVAGGTLAGTGQVGAV
                     ILRRGSQIAPGNSIGTLKVAGDITIALGSDYEAEVNAAGASDLIHATGTATINGGSIN
                     VLPSPDFAVGTPYTLLTADGGLVGAGFDAVNFDSLFVSPVLSDDANHVFLTITQTTDF
                     VAVARTSNQVAAAGGIQSVASGLLFGAIASLGDADEARRAFDDISGEVHASIKTALIE
                     DTRFVRSATLSRQIGEGEDSGLWTKSFGSWGRWDSDGNAGELSRHLGGLLFGRDSLVL
                     EDIQLGWVAGYARSSLHIDERASTSTADSYTLGAYVGRRWDAFSLKGGVAHSWHRLDT
                     ARTVAFSGFTDNLSANYSARAFQTYGEAAYSLDIEGARIEPFTNLTYVHLSTDVYSET
                     GGAAALTAASQSIAETFTTIGLRGKSQFDFGGAPTHISGSAGWRHAFGNTPTATHHFS
                     GADNFTVTGVPIAVDALALDLGVSVNLTQDATIGLSYHGQFGSSLIDQGLRASLNVAF
                     "
     gene            complement(126577..127962)
                     /locus_tag="HNEAP_RS00635"
                     /old_locus_tag="Hneap_0133"
     CDS             complement(126577..127962)
                     /locus_tag="HNEAP_RS00635"
                     /old_locus_tag="Hneap_0133"
                     /inference="COORDINATES: protein
                     motif:HMM:PF00512.23,HMM:TIGR00254"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_012823033.1"
                     /translation="MADTHPCDAHIRHDLRTPLNHMIGYTEMLLDDLPPTCNDLLSPR
                     LKTLLDDAYRMLETINRPAPMSSGHFDGLFPDWRAKMALIEADFNGLKSTIENAWQEA
                     CPDVEKIGSAIGNMRALLESLSAKPSIDLGDARSQQNARETATHATGGSGHAGGHLLI
                     VDDRQENLELMQRRLIREGYRVTVSNSGREALDRLESEQFDVILLDWLMPDMSGTEVL
                     AKIRSKSSAHEQPVIVVTARHGSETIVDALTQGANDYLAKPLDFPVALARIATQVYLR
                     RVTQQLADANRQLKQFSYIDGLTAIANRRKFDEYLMTTWRRAQQEGAPVSLILIDVDY
                     FKRYNDSLGHEAGDHALMRVAKAVSSSLYRVKDLAARYGGEEFAVILPETELADALSV
                     AERVRSAVMSLELPHPDSTVMPVVTASLGVGEWRPTAFCEPSALINLADKGLYQAKAS
                     GRNQVGTLGQN"
     gene            complement(127966..128337)
                     /locus_tag="HNEAP_RS00640"
                     /old_locus_tag="Hneap_0134"
     CDS             complement(127966..128337)
                     /locus_tag="HNEAP_RS00640"
                     /old_locus_tag="Hneap_0134"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_012823034.1"
                     /translation="MARILLVEDNEMNRDMLSRRLARKGYEVLLAVDGGEGVAMAKSQ
                     QPDLILMDMSLPVLDGWEATRAIRAEPATEAIPIIALTAHAMDGERAKALEAGCNDFD
                     TKPVDLPRLLEKIEQQMAKRD"
     gene            complement(128341..130917)
                     /locus_tag="HNEAP_RS00645"
                     /old_locus_tag="Hneap_0135"
     CDS             complement(128341..130917)
                     /locus_tag="HNEAP_RS00645"
                     /old_locus_tag="Hneap_0135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_012823035.1"
                     /translation="MLQNLRIGTKLTGFLILAFLISIAVSGFFLSSAMNKKAEAEIQT
                     RAEMLSRMMNAVRSYTSLHISPKLQQRLFTEQQFISETVPAFSARIIFNSFRDDPAFA
                     DFRYKEATLNPTSPHDQADAFESGLVAKFRADPSIKILSGFRELNGRNLFYTARPLAV
                     TKASCLQCHSTPQAAPKSLVATYGDKNGFGWKLGEIVSAQTIYVPSDEIFAQGHQYLL
                     WSMGIFFGVFAVGTTLLIWQIRRTVVIPIQRLTAAARAIGTGSATREQMAVFDQPQMQ
                     QLARRGDEPGELARSFQSMAHEVADREQNLNTAVMQRTEELEQALKIAGEARKEAEDA
                     NQTKSQFVANMSHELRTPLNAIIGYSEILLEESEDDGNTQYAPDLERILNSGKHLLAL
                     VNDILDISRIEAGKMELYLESFPICREIQTVIDTARPVIDKNQNSLVFECDDSLGHMR
                     GDLTKFRQILLNLISNAAKFTQVGTLTLSVRREDTDHFTIAVADTGIGMNEEQLGRLF
                     QVFSQADASTTRKYGGSGLGLSISRHFARMMGGDITATSTPGSGSVFTVSLPLTVEPQ
                     TQTEPANATDIPSQPSAPSTNAALDKQAETILVIDDDPSVHDLLKRSLGRAGYRVITA
                     SNGTDGLAMARIDRPDFITLDIMMPGVDGWSVLTSLKADPDLKDIPVFVLTMTNEKSL
                     GYALGAAQFLTKPVNKDALLGLLRQYKRHPDRCHVLMIDDDADNRNLIRRVLEPEGTV
                     VDEATDGQSGLDWLSSHAAPDLVILDLMMPNMDGFAFIDALRQRPEFNSLPVLVLTAK
                     TLTDDDRQRLSQRVEYIIERDGLNEELLVGRLHEQLCTHRKNIPSTPSGKAADGDERK
                     ET"
     gene            131115..131918
                     /locus_tag="HNEAP_RS00650"
                     /old_locus_tag="Hneap_0136"
     CDS             131115..131918
                     /locus_tag="HNEAP_RS00650"
                     /old_locus_tag="Hneap_0136"
                     /inference="COORDINATES: protein motif:HMM:PF13672.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441066.1"
                     /translation="MHRLNVELTTAPAPALEFMGADRHVGGRAYQQDQVICLSTPDMK
                     YQLVVVADGVGGHWGGEMASKTVIEVARRLFPAQLNQFPASGGFLEYFCQTANDEIRA
                     RAARENQEAFSTVVALLTTPGRAYWAHVGDSRLYGFKGAELVHQTNDHSLVQALFDQG
                     RITADERRVHPERNRVLNVLGLNDTVQPTLGEISLTPDMAFLLCTDGFWEHVAVSEMP
                     LILAAADLSFAASVWVRQAARRAGAGGDNVALALWRSPPRSKRGWLSFR"
     gene            131937..133043
                     /locus_tag="HNEAP_RS00655"
                     /old_locus_tag="Hneap_0137"
     CDS             131937..133043
                     /locus_tag="HNEAP_RS00655"
                     /old_locus_tag="Hneap_0137"
                     /inference="COORDINATES: protein motif:HMM:TIGR00383"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium and cobalt transport protein CorA"
                     /protein_id="WP_012823037.1"
                     /translation="MSFENRRVGTADRVGMAPGALLEDTHSVPAQIELIHYREHDSSA
                     IDPASLQAMQTAIAAHDGVTWLHVQGLPSKAFLEEMGARFGLHPLLLEDIQSRDQRPK
                     LDEYVEHLFAVFSVPRWQGDGAVLEQFSLLLGDGYVISIHDAQSDITDILRARLAQSS
                     SRLRQHGADYLFYSLIDLIIDQIYPLLETFGGTVDELEERLVTNPGHRALPDIQSAKR
                     TLNQLRRQLWPTREVISHLIRGVSNEPLLEAGLRPYLNDLYDHTVSVMDMLETYRDTV
                     TGLIDIHLSSVSNRLNEIMRTLTVISTLFIPLTFVTGIYGMNFGNNADSPFAMPELRW
                     YFGYPLILSVMVAVALGMILFFKRRGWIFSRDRF"
     gene            133150..134403
                     /locus_tag="HNEAP_RS00660"
                     /old_locus_tag="Hneap_0138"
     CDS             133150..134403
                     /locus_tag="HNEAP_RS00660"
                     /old_locus_tag="Hneap_0138"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012348608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441067.1"
                     /translation="MCAVWCQNRGRAMYISLVTETFDPDINGVATTLKQIHSALLSSG
                     HRVQLVCPRGKTARVLDDMLEVPGLALPFYTDVRLGLPVGRRLKRRWQNERPDLVHIA
                     TEGPLGYAALRTAKALGLPITSSLHTNFHTYMRFYRVGWLAAPVMRYLKWFHNRTART
                     FIPTGQQAEALGLSGFDRLAVLGRGVDTALFNPERRDAALRAQWSQHSGRAAGDESKV
                     ALHVGRLAPEKNLDLLLQTFNAMRVAQPDMIGVVVGDGPERARLEKALPWVIFTGMKR
                     GAQLARHYASADLFIFPSQTETFGNVLLEAMACGLICVSFDYAAGKHLIHDGKNGYLV
                     PLGDDARFIKAAVDLIRVDGPEIRQMGSRARDVAATYDWTRVTRAFEQHLKDVLQVES
                     AQSASDEQPALQGSGRSTNQGKTGV"
     gene            134342..134968
                     /locus_tag="HNEAP_RS00665"
                     /old_locus_tag="Hneap_0139"
     CDS             134342..134968
                     /locus_tag="HNEAP_RS00665"
                     /old_locus_tag="Hneap_0139"
                     /inference="COORDINATES: protein motif:HMM:PF01569.19"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441068.1"
                     /translation="MSSLLCRDPADRRIRVKRESDMTAFIRTVRSSSLLNRYLHWEEV
                     IMYRLNLVNAMRGLRRLFAICSRLGDGVAWYVAAALIALFVGEQAWLPMSAMMLSAGV
                     GLGIYASIKRLTARPRPHMAHDGLVLSVAPLDKYSFPSGHTLHAVNFAIQIAVFAPGL
                     AWLVIPFALMVALSRMVLGLHYLSDVLVGGVIGALIAVSSLWVVGTLS"
     gene            135220..136077
                     /locus_tag="HNEAP_RS00670"
                     /old_locus_tag="Hneap_0140"
     CDS             135220..136077
                     /locus_tag="HNEAP_RS00670"
                     /old_locus_tag="Hneap_0140"
                     /inference="COORDINATES: protein motif:HMM:PF11356.6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein GspC"
                     /protein_id="WP_012823040.1"
                     /translation="MSWSKSRFVWIPSALFLILLATAGVLAARITWMWLAPAPAYVAP
                     PESGAEASEQSQSASVEQIGSWHLFGQAATPDNPTATKISASQLGATLEGTISGSPLP
                     LVMLRVGGEVRLLQAGDTLSAGVRIVSIAPDRVVISNQGRLESIAFPKPQSLDQAPAP
                     SAASLTTANPRDVSASAVAPTVRAQAEEIRHNPQTLLRFVTVSPVQQNGEISGYSLRP
                     VPGQEALMRALGLMPGDVLTSVDGMPVNDPALLPRVMPLLNSGQPLQVLVERGGQPLS
                     MTINLDSLQ"
     gene            136074..138251
                     /locus_tag="HNEAP_RS00675"
                     /old_locus_tag="Hneap_0141"
     CDS             136074..138251
                     /locus_tag="HNEAP_RS00675"
                     /old_locus_tag="Hneap_0141"
                     /inference="COORDINATES: protein motif:HMM:TIGR02517"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein GspD"
                     /protein_id="WP_012823041.1"
                     /translation="MMNTARRIRGQASSLVIFMALTLVTAEVLINSPVRAADAPPPGI
                     SRVQGDNSDTDKVTLNFRDMDIGALIEAVSKVTGKNFIVDPRVKARVTVISAKPMSPQ
                     KLYDVFLSILQVNGFAAVPAGAVIKIVPEINARSDAQPVNPGSSAVGDQMVTEVVHLR
                     YVPAAPLLTVLRQIMPQQAALSVYPDSNSLVITDRAGNIDRLKKILAKVDQPAVGDVE
                     IIRLKRASADSVVSTLKALFGASGGGGAKGAPVPGGGAGGNFSSVPAFAADDRTNSVL
                     LSGDAVSRAKMRAIILNLDMPQTNYGNTRVFRLKYANAEDLVDVLKGIVSTNGATSTG
                     ATATKEATTNPDNNQLEIAADKSLNALVVTASPSRMQTVESVIDQLDIRRKQVLVEAI
                     IAEVSNGVTKKLGTQFLVGGGSGTVPIGISTFNGLLSSVASSAAQAGTGSVGSAIGLG
                     LAGALGDGGNIGVGRYGQGGADFALLVSALAGNSGNNILSTPSLLTLDNQEASIVVGQ
                     NIPIVTGSYAQTGSATSPTNPFQTITREDIGVKLKVTPTISPDGTVRLKIEQEVSSLD
                     SAAQSSAGLITNKRNVTTTVQVDDGDVVVLGGLIDDSTNSNQQSVPGLGDIPILGNLF
                     RYRSASTNKRNLMIFIRPLIVGDGGKLSEFSREQYNRIRQSQQDTFDKRSLVNPSDWS
                     VLSPEQNFQRNLPIPMPQNIQTLMDQDRARSQTASGQTAAPRP"
     gene            138262..139770
                     /locus_tag="HNEAP_RS00680"
                     /old_locus_tag="Hneap_0142"
     CDS             138262..139770
                     /locus_tag="HNEAP_RS00680"
                     /old_locus_tag="Hneap_0142"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein GspE"
                     /protein_id="WP_012823042.1"
                     /translation="MTVDADTHAHLAKTSPLSYGYARRFGVLIEPDTTAEAAWIVRHC
                     KPLPVSVLAELGRKLPDGFTLDWLETDEFERRLARAYEGGSSVAQTMVDDLGDGGLDA
                     LANTLNTPIDLLEADDEAPIIRLINALLSEAVREGASDIHLESFESRMVVRFRVDGML
                     REVLEPPRAVAGIIVSRIKVMANLDIAEKRVPQDGRISLRLAGRPVDVRVSTLPSGQG
                     ERVVLRLLDKEAGRLTLDNLGLTRELQARLNKLIHRPHGILLVTGPTGSGKTTTLYAA
                     LSEINTRERNILTVEDPIEYYLDGVGQTQVNPKVEMTFARGLRAILRQDPDVVMVGEI
                     RDVETAEIAVQASLTGHLVLSTLHTNSAIGAITRLRDMGVEPFLLSSSLIGVLAQRLV
                     RRLDARYREAYTPDASECALLGLDASQPPTLYRVSEEARQRGQGYLGRTGVYELISID
                     ADTRRLIHDGAAEPAIEAQVRKHSSSILAYGAALVMAGVTTTEELLRVTAEG"
     gene            139777..141000
                     /locus_tag="HNEAP_RS00685"
                     /old_locus_tag="Hneap_0143"
     CDS             139777..141000
                     /locus_tag="HNEAP_RS00685"
                     /old_locus_tag="Hneap_0143"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012636815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein GspF"
                     /protein_id="WP_012823043.1"
                     /translation="MAAFEYSALDAQGKTRKGVIESDSARGARSLLRDQGLAPLTIEA
                     VVADQSTAGGMQGWMSRFQSLNPTELALFTRQISTLIAAGLPIDAALSGIIRQTENPR
                     IRRIVTAVRSKVVEGHSLAQGLATFPRAFSELYRATVAAGEESGHLEAVLERLADYTE
                     GRQATTQKVQMALFYPALLTLMAVAVVIGLVTYVVPQVVQVFVQMKQTLPPLTRGLIA
                     VSAFLREQWPWILLGMAAFAIWFYWALRQPKFAFRWAQIQLKLPLIGRLIRGFNAARF
                     ARTLSILSAAGVPMLKALTISGEVVASEPMRRAIKEATDRVREGAPIARSLEQSRLFP
                     PMMLQLIAAGEQSGALGNMLERAAVQQERELDTLINALLGLFEPILILVMGGVVLLIV
                     LAILIPIFDLNQMVH"
     gene            141003..141503
                     /locus_tag="HNEAP_RS00690"
                     /old_locus_tag="Hneap_0144"
     CDS             141003..141503
                     /locus_tag="HNEAP_RS00690"
                     /old_locus_tag="Hneap_0144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein GspG"
                     /protein_id="WP_012823044.1"
                     /translation="MMSYFSSRLSSQAARIERGNGLISRGFTLIEVMVVVVILAILAT
                     IVVPKIMDRPDDARIAKAKQDIRAIDSALQLYKLDNLTYPTTDQGLEALVKPPANAKN
                     WRQGGYLDRLPIDPWNNPYQYLSPGQHGAFDVYSLGADGQPGGTGADADIGNWQEEGG
                     ATNTGN"
     gene            141512..142153
                     /locus_tag="HNEAP_RS12080"
                     /old_locus_tag="Hneap_0145"
     CDS             141512..142153
                     /locus_tag="HNEAP_RS12080"
                     /old_locus_tag="Hneap_0145"
                     /inference="COORDINATES: protein motif:HMM:PF07963.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_012823045.1"
                     /translation="MLALRAVLDARHAPYAGRHQRMGRQRCAQGFTLIELIVVIVIIG
                     ILVGFVVMSMNKRAPDDVGVCQARMASWLAQQAVAANRLDQTIYIQNASTKSPSAFVL
                     NHPSAQLQTAASKQTSQNANESPAFVANIISRLDWDKGCALMARPSAADTFAAKDPRA
                     DAVIAVTPDGIWSLPSGAPQSKPEITVRGDKQKTLPINLSSGFGEQASAGSAP"
     gene            142153..142545
                     /locus_tag="HNEAP_RS12085"
                     /old_locus_tag="Hneap_0146"
     CDS             142153..142545
                     /locus_tag="HNEAP_RS12085"
                     /old_locus_tag="Hneap_0146"
                     /inference="COORDINATES: protein motif:HMM:TIGR01707"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein GspI"
                     /protein_id="WP_012823046.1"
                     /translation="MTTTTKTRAQGFTLLEVLIALVVLAIALAAVIKVSGQSAQTLDR
                     LRADTAATVIADDLCARLQLSAQAPELGTRQSQVEINGQSWRVRQTVSAGQVPGVLKV
                     AYLVETPAPYAGQASIVTYFYPPAQKAP"
     gene            142542..143303
                     /locus_tag="HNEAP_RS00705"
                     /old_locus_tag="Hneap_0147"
     CDS             142542..143303
                     /locus_tag="HNEAP_RS00705"
                     /old_locus_tag="Hneap_0147"
                     /inference="COORDINATES: protein motif:HMM:TIGR01711"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein GspJ"
                     /protein_id="WP_012823047.1"
                     /translation="MSVHDSLIQGVGSTRCSIKRAASGFTLLELLVAIAIFALVAVMA
                     YGGLNTVIKQSAIVEDQMGQLNAMQNGLRQMRGDLTFAVDRFARDALGGDVPEFAGGG
                     LNLLTLTRLGASNPWAAAEPQLALVRWRLENGNLERATFVPPDGAVGNSAEQPDWRII
                     LRNVSKIQLTFYDQNNQSMLDWPPINQPSAGLPKAVEVLLTVNNLPPLRMTVAMVSDW
                     PEAAPANPPGGTNNGAEPATSPQTQTQTEVEAERR"
     gene            143300..144247
                     /locus_tag="HNEAP_RS00710"
                     /old_locus_tag="Hneap_0148"
     CDS             143300..144247
                     /locus_tag="HNEAP_RS00710"
                     /old_locus_tag="Hneap_0148"
                     /inference="COORDINATES: protein motif:HMM:PF03934.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein GspK"
                     /protein_id="WP_012823048.1"
                     /translation="MTRVNRFASPTRQQGVALIVALLVLAIATGLAAAVMVRNQNALD
                     ATAAFENGARADQLANSAFLLAKALLDRDDRNSDGPADLWAQPLANIPIDGATVSLTI
                     SDLQGRFNINNLLLPDGKVNLLGKERFARLLNLLNLSPDISNEIIGWIDPSRSLSLGF
                     NSAASRSGNMPAGQPMMSVTELRSLAGVTPAYYDKLAPYVTALPIGTPVNLNSAPPLV
                     LQAIGANAASLPVVADSKTPPPNIGSVADFLARPGFAGAVTQPDGLSVNSQFFLCAVT
                     VQFDQVVRHRYALIYRPQSGPSQVIALSNEPCLTGSSCL"
     gene            144220..145470
                     /locus_tag="HNEAP_RS00715"
                     /old_locus_tag="Hneap_0149"
     CDS             144220..145470
                     /locus_tag="HNEAP_RS00715"
                     /old_locus_tag="Hneap_0149"
                     /inference="COORDINATES: protein motif:HMM:PF05134.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretory pathway component PulL-like
                     protein"
                     /protein_id="WP_012823049.1"
                     /translation="MSDRLFLFVTNREATELHWWQPEHSAQSASPALGDWDAFADWQA
                     KANLRRPVTLSVLLPDSVCSRLIVPIPGTRREKALQALPFALEDLVADDLSQLYPVLA
                     ERPLSPGRWPVLLVDADVRTRVLDALKDQGLVPQHLVAMADTLPQPEMGEFCVWVDPV
                     QEHISVLTGPHEGMALAPSTVHNAAEQLAEWLPRMTPAPNRVAFHVPLDQPAHWPEGI
                     EFTAQAAPDWAQWHQLWQAGLEQNRALSAITSAKAVNDQQWQRRWWQVAAAAGVVLVL
                     LLVAQGIKTAQMNHQAERLQTQITQDFHAALPQITRMVNVRVQLQQALDQRVGAHEDT
                     FMPALAAFGSAYQVAKPQDAQLVIKSIRFGEQQLTVELTAQKYAVLQQLLEHLKKNAP
                     AEVKQIDAGVDAGVAHMRIGIKAL"
     gene            145507..146025
                     /locus_tag="HNEAP_RS00720"
                     /old_locus_tag="Hneap_0150"
     CDS             145507..146025
                     /locus_tag="HNEAP_RS00720"
                     /old_locus_tag="Hneap_0150"
                     /inference="COORDINATES: protein motif:HMM:PF04612.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway M protein"
                     /protein_id="WP_012823050.1"
                     /translation="MMKAPVWFSSFWQQRNQSERRTLTLAAIALVALVGYQFVWSPMQ
                     QAVQRAHDRLAQAEQLAAFTAQAKKALMQAGPKSAQPSADSPMLWVEQAARTVGIEQQ
                     LVQRQPDGDDRVQLKFAAVPFDLLLRWLAQANDAGLSVQSANITPKNGDSSDAAGLVD
                     AEITLAKRAAAS"
     gene            146022..146858
                     /locus_tag="HNEAP_RS00725"
                     /old_locus_tag="Hneap_0151"
     CDS             146022..146858
                     /locus_tag="HNEAP_RS00725"
                     /old_locus_tag="Hneap_0151"
                     /inference="COORDINATES: protein motif:HMM:PF01203.17"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein N"
                     /protein_id="WP_012823051.1"
                     /translation="MSRTPLKELALRRPRSLVRLGVFIVLVSWFTALLATAPITLIPV
                     SRLTLPPGVQLQPLGGTVWHGQWRLSLPRAPDMTVQTDFLPSSVFRLQLAWHVQAQTD
                     ARTSPTNANPNIGADLAIGFKQLNVRNFQGRMSADSPLIASLTAWPLSGLIDFSGDAS
                     LVRTKRGFDLQAARATANWRNAEITTTEPLALGDLVFDAKIAQGQLNATVKPAPNNAG
                     PLLGELNLAGTWPVAKAPAVRGYVQPTARASAALRQQLSLLGRPDASGKITIQGVLPG
                     RY"
     gene            147180..147905
                     /locus_tag="HNEAP_RS00730"
                     /old_locus_tag="Hneap_0152"
     CDS             147180..147905
                     /locus_tag="HNEAP_RS00730"
                     /old_locus_tag="Hneap_0152"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823052.1"
                     /translation="MWQTIKNLWFQDPSAKPILINDTAVRIRAGMLLAIPIYMGFTLW
                     SARFGGHWIVDGDTIHDTLDTDWDGHIIYSANVIRRTWDYTIQTYVLFYGLFEMIAGM
                     FVWTSRLSPTILLSSFLARKQHALWKPLTPKRYAWSLGAFMIALCLIFFNPSTFADWV
                     NAIAGRTLLPDTSQYLSYWIPSLVFVCVAFMWLEAVLGFCVGCKIHWLLVKLGVHKEE
                     CLACNNIDWDEIARRKAEQAGNG"
     gene            complement(148001..149407)
                     /locus_tag="HNEAP_RS00735"
                     /old_locus_tag="Hneap_0153"
     CDS             complement(148001..149407)
                     /locus_tag="HNEAP_RS00735"
                     /old_locus_tag="Hneap_0153"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049772433.1"
                     /translation="MKINSIHLCTLACAGGLAGWPQMSLADAPVAPVYDQAQLDQMAK
                     AMATMQAQIKAMQAKLAAVRAKNATLEAQQETERKNQSAKKVNNKPDATKPSQTDKSL
                     IQRVADAVAKKNAAPIKVGGAVRFNYTLEQFNQNSRNTVGDLNFDTFRLNLDGQIDNV
                     ILSAEWRYYDYMQVIHHAWVGYKFTPNWLVRAGVVKVPFGNLPFNSNSYYFSSLFYAG
                     FEDNYQLGLSTTYDLGNWRFDAAFLKNPQPNGFGTSSYSENVVGFDNGLDPSDPNYQR
                     TDAKPINTVVGRAEYTWKANDDLTLKPGLSLMRGSLYGQNQREGDYHAYAAHLVADWQ
                     RWNLKLEYADYDYALNNKLAERLVYGAYAYNSFGPTSAKAVTAGVAYALPVHWGPISK
                     LNFYNDFSRIYDKNDGIDPTWMNVSGVSVVAGPVFAYFDFVQGKNQPFVGGNLAPARG
                     SGNAPINRLFNINLGYYF"
     gene            150296..152344
                     /locus_tag="HNEAP_RS00740"
                     /old_locus_tag="Hneap_0154"
     CDS             150296..152344
                     /locus_tag="HNEAP_RS00740"
                     /old_locus_tag="Hneap_0154"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-aspartyl-peptidase"
                     /protein_id="WP_012823054.1"
                     /translation="MSTSAPKKLNSTLLAPVFIPSIIVITLLVIGTVADPKRAGDAFS
                     ATLAFITNDFGWFYMLAVALFLIFIVVVAISPWGKIKLGPDHAEPEYSFSAWFAMLFS
                     AGYGIALLFFGVAEPVLHYADPPVGDPRTIEAARQSMQITFFHWGFHIWAIYGLVGLV
                     LAYFGFRHGLPLSMRSALYPLVGDRIYGPIGHTVDVFAVLGTMFGIATTLGLSVAQLN
                     AGLNYLWPSVPVNITVQIISIALITALATLSVVAGMDAGIKRLSQLNMLLAIALMLFV
                     FAVGPTVFILKTFMQNTGSYLSNIVERSFSLEAYTGGKWIGNWTLFIFGWTIAWAPFV
                     GLFIAKISRGRTIRQFVLGVMVVPTLFTFFWFSVFGDTALHAIMVDGYTHLIDQVEQN
                     KAIALFKLFEHLPFASITSFLAIILIVTFFVTSADSGALVVDSLASGGALRTPVWQRI
                     FWASSQGVLAAVLLLAGGLSALQTASITSALPFAIIMLISAVGLWRALQIEGYRETSL
                     QHHMNSGRHNRLGDSNHWEKRLRNLVDFPSRENVSKYIETTVADSLKTVEAELKKQDW
                     PVKLTQNKELCRYKLSVISGEDMAFEYEVRLRGFAKPSYAFPAITRDNDGDEQYYRAE
                     VFMRRGGLAYDVYGYEKDQLISDVLDHFEKYMHFLHTTPAILPWKVVDDEEGEVSGAK
                     "
     gene            152452..153762
                     /locus_tag="HNEAP_RS00745"
                     /old_locus_tag="Hneap_0155"
     CDS             152452..153762
                     /locus_tag="HNEAP_RS00745"
                     /old_locus_tag="Hneap_0155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012823055.1"
                     /translation="MLKTVVSIQALLLGMAILLAGSGMLSTLLGLRAQQEGMSTTVLG
                     LVMSGFYLGYILGTYLLPSLIRRVGHVRVFAAMAALSASAALLHGLWLNEWLWLTLRV
                     ISGFALLGLYMVIESWLNAQISHYRGQIFGIYMMVSLLALAVGQFLIGIYGVSGLASF
                     MVVALLFALGLVPVALTRATQPVPVEAARLSVRAIYDNAPTGLIGSLLSGTATGALWG
                     LAAVYGAHIGLDAARAALFVALLIFGGALLQWPIGKLSDHYDRRWVLIGLGLAGILSG
                     GVMIAITLISGPGNIADSPLRWALWIGGLLFGGFVFSVYAISVAQTHDRLSNDQVLEA
                     TRTLLLVNGIGALFGPLSAGMFMSWFGANGLIGFIMLVLSVLGLFTYWRIRIDRPVPE
                     DERGEFVVTTRTSAAAADWDPRTPEAGDRLSEQFADELLTTKSG"
     gene            complement(153774..155000)
                     /locus_tag="HNEAP_RS00750"
                     /old_locus_tag="Hneap_0156"
     CDS             complement(153774..155000)
                     /locus_tag="HNEAP_RS00750"
                     /old_locus_tag="Hneap_0156"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012823056.1"
                     /translation="MSTTLTDTPQPVSPAAPVETQYRVLGAISVSHFLNDLMQSLMIS
                     IYPLFKSNFDLSFAQIGLITLCFQLTASILQPLIGQAIDRRPMPYSLVLGMGFTFSGL
                     ITLAFAPSYGFLLAGAAMVGIGSSIFHPESSRVARMASGKRPGLAQSIFQVGGNGGSA
                     AGPLLAALIVIPHGQVSISWFSAAALLAMVVLFFVGRWATVQHRKPKTARHLPPVDLS
                     RSMRLWILFGLLTLMFSKFLYLASMNNYLTFYLMHRFELPVQSAQLHLFILLFAVAAG
                     TLMGGPIGDRIGRQRVIWLSILGVAPFTLLLPHMGLEVQSILLLVIGFVLASAFPAMV
                     VYAQELFPNRIGAVSGLFFGFAFGTAGIGAALLGQFADHFGIDTLIFYCSFLPLIGVI
                     ALLLPDLREVPASSPT"
     gene            155248..156309
                     /locus_tag="HNEAP_RS12090"
                     /old_locus_tag="Hneap_0157"
     CDS             155248..156309
                     /locus_tag="HNEAP_RS12090"
                     /old_locus_tag="Hneap_0157"
                     /inference="COORDINATES: protein motif:HMM:PF01476.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding lysin domain-containing
                     protein-containing protein"
                     /protein_id="WP_012823057.1"
                     /translation="MRASMVFSFRTMLLVTLLTLGAVSISGCAQVQDFGKMLKNAQTS
                     SATPSSASDAATGVGQKKSADKPAPSLSLKQIMYLIENGEHAQARAALETFLKNDPKN
                     PMARNLQKQLTIDPAKALGPAVSTYTVQPGDTLGGLAAKFLGNPMDFVILGRYNDIKR
                     GRDLQVGQTIKIPSKKKLKALPDEPQTIKANEPTAETPAVIPATSEGAESSTSTEKPA
                     LPASESQTVNSTVVKSNTLVKPISPAEEAKALAAQQAGLAAMQKNQLEEAAKDFSRAL
                     AIDPSLELAKTRAAQVQQKRVQQYHEAALVAYRKQHLDEAIALWDKALALDPNYEPAL
                     GYRARAQELKRRLGQLNQQ"
     gene            complement(156405..158078)
                     /locus_tag="HNEAP_RS00760"
                     /old_locus_tag="Hneap_0158"
     CDS             complement(156405..158078)
                     /locus_tag="HNEAP_RS00760"
                     /old_locus_tag="Hneap_0158"
                     /inference="COORDINATES: protein
                     motif:HMM:PF00069.23,HMM:PF00672.23"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_012823058.1"
                     /translation="MSKMFGRFEIQGELGRGAMAIIYRGYDPKIERTLAIKTLRPEFS
                     AHAEYRERFLTEAKAAGTLNHPHIVTIFDVGEVDGIPFIAMELLTGMTLGQFGESHPE
                     GIPPGTLVELAIQIADALDFAHRHGVVHQDIKPENIILQHDQLNIKMMDFGIARIIRD
                     ADAPSSKGARAFLSGTPQYMSPEQITDQPIDGRSDLYSLGVVLFELLAGHRPYQDDDH
                     WVVWQKVLKDPLPTLRPLNPRTPPDLIELVNTLLAKDPDGRYQSAAGVAADLRSIAQR
                     MNEGTERWLSSSVIPLRIRWPLLMALVVAVAMVLGMIWVYHKQNNVITELAYDYGFSL
                     SEWVAVQTAEDLLLQDKLALQSWVDSMSHNREIVYMAIRGDKGQIEAQTRGDQLVARM
                     AAQLKEDHVVLSRGDLRVYAVQQDAGAPFYVFETPITYQNHTIGQLRIGLTTDALATA
                     NRTTLLTLLTWFAIVLLVVVAGTYWLTRRLQMPLDAVSNALDQIKMGRLEHRIRMHRR
                     DDFERLFAAYNAMADVLEARQLQRDASQIEQDLPLGVDKHLATVKDPVE"
     gene            complement(158292..158810)
                     /locus_tag="HNEAP_RS00765"
                     /old_locus_tag="Hneap_0159"
     CDS             complement(158292..158810)
                     /locus_tag="HNEAP_RS00765"
                     /old_locus_tag="Hneap_0159"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopeptide-binding protein"
                     /protein_id="WP_012823059.1"
                     /translation="MENVQYQTKPQYAGTQGTLLVAKNDDRIHSLDETEQPAHINLDQ
                     PALIGLTPPFINQRFTLRQGKTTIGRRADNNIVLADGSVSSLHAWIIEDNGQYRVMNI
                     LSTNGSFVNDARITEAPLQDGDRIRFGGVELQLHTGLANKKTASSGKNILLAFAAIGI
                     VALVALGWVFMR"
     gene            complement(159004..159393)
                     /locus_tag="HNEAP_RS00770"
                     /old_locus_tag="Hneap_0160"
     CDS             complement(159004..159393)
                     /locus_tag="HNEAP_RS00770"
                     /old_locus_tag="Hneap_0160"
                     /EC_number="1.7.1.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006747331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent 7-cyano-7-deazaguanine reductase
                     QueF"
                     /protein_id="WP_012823060.1"
                     /translation="MSTQPSKTLETFPNPFPDRDYTIHMTIPEFTCLCPKTGQPDFAT
                     ITLDFVPDQLCVELKSLKTYMWSFREEGGFHEAMTNGILNDLVAAISPRFMRVTGEWN
                     VRGGIYTNVVVEHRQPGWTPAPKIDLP"
     gene            159510..163034
                     /locus_tag="HNEAP_RS00775"
                     /old_locus_tag="Hneap_0161"
     CDS             159510..163034
                     /locus_tag="HNEAP_RS00775"
                     /old_locus_tag="Hneap_0161"
                     /inference="COORDINATES: protein motif:HMM:TIGR02168"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein SMC"
                     /protein_id="WP_081441069.1"
                     /translation="MWLWSGRMRLTRLYLAGFKSFAAPTEILLPAERVAIVGPNGCGK
                     SNLIDAIRWVLGESSAKQLRGQSLDDVIFAGSGQRPAASQAVVELSFDNSARRLSGPF
                     GAYDQIVICRSLGRDGQSRYSINQTRVRRRDVVDLFLGTGVGARSYSVIEQGQINRVV
                     DAKPEDLRAYLEETAGISLYRERRRETESRIQQTQDNLSRLSDIADELGRQKTQLERQ
                     ARTAERYRELQKKRRRQVVEQAAVQVVLTERANAALDAEWQTAQAHMTTVAERMAQVE
                     LRCAQEDEARTSAQSDLQQVQARQYQLGAEQAQLQGRLGELAARIESAEQQRQDDLAQ
                     RTRLEAACTRLQAELSRLAEERRTLESQRQQAAEQRAKAQAELRAADTHLNEMRAEWA
                     RSHDDLARPQQDLAAAKAEHAALLRQLQRLETERASVTSRDFTEPMAASIQQIQDAET
                     RMGALEQSHSAGEVVLAEQQTVLAELSDRAAAMQKEAQTLRQNADALQAERRGLERAL
                     AAHQTSKDDAPRAERLIQRLAKAHADAWWGHALGAGIEAACVDDLDALMVAWRADQIP
                     ATGWWVAPDSQRSEPKSDLEQKRSPSDALAPWLRDWQHTRHPAPSLNEALAQRHTLPS
                     GHCFVLADGWQVGRHWIGRGGSDQAAVRLAQQTRLAELQQAGTEAETTAEQAQIEYQR
                     IQNQLAQQRKQVERLVAEQHQFEQQRQRLHWSLEDLRRKYQQLKQQQADRAANVARME
                     AEHKQLSADRGQLEDTIRRLEQIVAQARSARDAFNARQQTAEQTVQVLRRQAGEAGQA
                     LQQLERTVDRNQHQFEQAQQSLARDEAQMVQIDQRLAQFADRLDGLITQQSERQAEFT
                     ALSARQHEIAQAEKAALALVHEHTQAVQTAGVERHETQVALEKARAAVQALELQRAQL
                     AVREDHAGEALTLALDQWRDDQQSLDAEAIKRLADIPNIAEAQAAELSTLEQQIARLG
                     AVNLTAIEAFAEAEARKSELDGQIEDVQAALDQLQEAIRTLDKQTRAQFRSVFDAVNA
                     RIGPLFVQLFGGGEARLELSGADDLDAGVLLFAKPPGKKVTQLSLLSGGERALTAVAL
                     IFALFELNPAPFCILDEVDAPLDEANVGRFCAMVSAMSDRVQFLFVTHNKTTMASASA
                     LVGVTMREAGVSRIVSVDVDRAVQLLES"
     gene            163039..164034
                     /locus_tag="HNEAP_RS00780"
                     /old_locus_tag="Hneap_0162"
     CDS             163039..164034
                     /locus_tag="HNEAP_RS00780"
                     /old_locus_tag="Hneap_0162"
                     /inference="COORDINATES: protein motif:HMM:PF04354.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZipA"
                     /protein_id="WP_012823062.1"
                     /translation="MEWLRWIFLAAGVLALAGIVWVYLRHKSEQAVELGSGRTEANLD
                     DPIDVRIRAQEDARAKSADITLDSALDEAINEGIIGQVKVKERVDPVITPATEPHEVE
                     PEPLRWQHPTFTRKNEPEPIDVDDALGLADAEGVIGAVRRKMLDDVPETTGSLFRRRQ
                     TPHFSYQEKQDSSSDHAELEAPSSAQSTQKNIKQNMGRDADPVVLPLLVASTDGAVFP
                     GDRVENLIEEIGFEYGALSIYHYPGELGETLFSLMNGVKPGTFDRGNSASFATPVLAL
                     FMQLPLDGPSESLILDQMIDIARDIADQLGGEVLDDQRLPLTSESIDRYREQLNS"
     gene            164040..166097
                     /gene="ligA"
                     /locus_tag="HNEAP_RS00785"
                     /old_locus_tag="Hneap_0163"
     CDS             164040..166097
                     /gene="ligA"
                     /locus_tag="HNEAP_RS00785"
                     /old_locus_tag="Hneap_0163"
                     /EC_number="6.5.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823063.1"
                     /note="this protein catalyzes the formation of
                     phosphodiester linkages between 5'-phosphoryl and
                     3'-hydroxyl groups in double-stranded DNA using NAD as a
                     coenzyme and as the energy source for the reaction;
                     essential for DNA replication and repair of damaged DNA;
                     similar to ligase LigB; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase (NAD(+)) LigA"
                     /protein_id="WP_012823063.1"
                     /translation="MASSLPDLFSAPSEDGDRARLLALRDEIERHNFRYYVLDDPEIS
                     DAAFDRLMRELQQIESAHPEWITPDSPTQRVGSPTFTTRFAPVTHHQAMLSLDNVFSV
                     EEWDAFTQRIQDRLKRDAPLVFAAEPKFDGLAINLIYRQGQLVQAATRGDGQTGEDVT
                     LNVRTIAAIPQQLPDSLLSCDLLEVRGEIVMSHKAFAALNAAADARGDKRFVNPRNAA
                     AGSLRQKDPRITAKRQLQFFAYGVGAVDGADLPDSQLGLLDWLADLGFTVSEWRRRCE
                     GRDEVLAYQQEMSARRSQLDYDIDGVVFKINAQSEQDALGFVAKAPRWAIAFKFPAEE
                     ATSRVHAVDFQVGRTGALTPVARIDPVFVGGVTVSNITLHNIDEITRKDIRIGDTVVV
                     RRAGDVIPEVVRVLPELRPADARLVALPATCPVCGSEVVRAEGEAIARCSGGLFCPAQ
                     RREAIKHFASRKAMNIDGLGEKWIELLLEHKLVEHVDDLFHLTVPQVLTLPRMGEKSA
                     QNLVDALSAAKQTTLPRFLYALGIREVGEVTAAGLAAHFRNLDALNAATLEDLQAVPD
                     VGPVVAQHVFTFLRQPHNQEVIRNLIDAGVHWPAIVATDANALPLAGRTYVLTGTLVG
                     MSREEAGERLKALGAKVSGSVSSKTTAVIAGSEAGSKLTKANDLGVPVLDETDLQKLL
                     RNL"
     gene            166155..167123
                     /locus_tag="HNEAP_RS00790"
                     /old_locus_tag="Hneap_0164"
     CDS             166155..167123
                     /locus_tag="HNEAP_RS00790"
                     /old_locus_tag="Hneap_0164"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008985435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octaprenyl diphosphate synthase"
                     /protein_id="WP_041600514.1"
                     /translation="MTVDQIRELAAPDMARVNTVIQAKLASDVALINQLSQYIIGAGG
                     KRFRPMVLMLAAQALGGTSPWAAQMAAVVELIHTATLLHDDVVDESTLRRGRDTANAL
                     FGNAASVLTGDFLYSRAFEMMVEVQEPRVMAILAQATNRIAEGEVLQLMNMGDADVSE
                     DRYVDVIVRKTATLFAAATQLAAVLEGQPEEVEAALTAYGLHLGTAFQLIDDVLDYTG
                     DEAHTGKHVGDDLAEGKPTLPLIIAMQRGDEATVAMIRRAITEQDARDIEAICSAIEH
                     TGALAYTAHRAQAEADRAKQAIAAVPDSPFKEALLALADAAVVRNH"
     gene            167157..167233
                     /locus_tag="HNEAP_RS00795"
                     /old_locus_tag="Hneap_R0002"
     tRNA            167157..167233
                     /locus_tag="HNEAP_RS00795"
                     /old_locus_tag="Hneap_R0002"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:167191..167193,aa:Pro,seq:cgg)
     gene            complement(167318..167785)
                     /locus_tag="HNEAP_RS00800"
                     /old_locus_tag="Hneap_0165"
     CDS             complement(167318..167785)
                     /locus_tag="HNEAP_RS00800"
                     /old_locus_tag="Hneap_0165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_012823065.1"
                     /translation="MTLDRYDRQILTLLQENGRLSNQELADAIGLSASPCLRRVRALE
                     ESGLILGYRALLDARKLGLNLVALLHISMDQHTPERFAHFEQQVARLPEVIECLLITG
                     QTADYQLKVIVTDMDAYQILLLNQITRIEGVTGVQTSFVLRRVLDKTSLPIPD"
     gene            168060..169853
                     /locus_tag="HNEAP_RS00805"
                     /pseudo
     CDS             168060..169853
                     /locus_tag="HNEAP_RS00805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019719177.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
     gene            169850..171724
                     /locus_tag="HNEAP_RS00810"
                     /old_locus_tag="Hneap_0167"
     CDS             169850..171724
                     /locus_tag="HNEAP_RS00810"
                     /old_locus_tag="Hneap_0167"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012823066.1"
                     /translation="MIQLQSVSLRRGTQLLLENANLTLQPGYRLGLVGRNGTGKSSLL
                     ALLEGKLTPDAGNVDRAGGQRLATVAQEMDDLDVSAVESVLAGDVEYDRISKAIATAE
                     LAEDGMALATLYHDLEAIDGFTARSRAARLLDGLGFAPDAIDRPVRSFSGGWRMRINL
                     ARALLAPSDILLLDEPTNHLDLDAVFWLEQWLINYPGSLVVVSHDRDFLDQVCTHIAH
                     LENKSLTVYTSNYSGFEQMRAERQAQNAALSAKIERERAHLTAFVDRFRAQATKAKQA
                     QSRIKALARLPVLAATHADSTFTFSFRPAPNSPDPLLTMEHLELGYNGKALLKNIDLT
                     VRAGDRIGLLGANGAGKTTLMRVLGGAEKPMAGELFISAGVRVGYYAQHQLEQLDPRD
                     TPMTALERIAGRASTQEVRNFLGGFGFIGDRAFENIEPFSGGEKARLALALLVWQAPN
                     LLLLDEPTNHLDLEMREALAAALQTFEGALVVVSHDRSLIEMVCDNFWRVHDGKVGVF
                     DGDLDDYRRVLTDERRAANAPAKPAETTKPKSESTWRPATKKPAGKPDKRTDKRVAEI
                     EHRLSAVVLALQALDTQLADPDLYAGPDATRANELTSQRQTLAEEHEALELEWLSLND
                     "
     gene            171795..172319
                     /locus_tag="HNEAP_RS00815"
                     /old_locus_tag="Hneap_0168"
     CDS             171795..172319
                     /locus_tag="HNEAP_RS00815"
                     /old_locus_tag="Hneap_0168"
                     /inference="COORDINATES: protein motif:HMM:PF00300.20"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohistidine phosphatase SixA"
                     /protein_id="WP_081441070.1"
                     /translation="MRFKRIMDILLIRHAPAEDREQFALTGQADELRPLTPRGIERMQ
                     LAVRGLVTLALPIERLITSPLVRAQQTAQIVAPALEIRQFDTEAMLSPQVPNASLIDW
                     LRKQPRVDGLALIGHEPNLSQLAETLLCGSANGCMPLKKGGAILLRFAEGIAAGQGQL
                     IWSLTPGILRTLAD"
     gene            172415..172978
                     /locus_tag="HNEAP_RS00820"
                     /old_locus_tag="Hneap_0169"
     CDS             172415..172978
                     /locus_tag="HNEAP_RS00820"
                     /old_locus_tag="Hneap_0169"
                     /inference="COORDINATES: protein motif:HMM:TIGR03902"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhombosortase"
                     /protein_id="WP_012823068.1"
                     /translation="MTDRNQKWLISFLVVAIAVAILLLHGGNELRYDRADILHGQFWR
                     VFTGNFVHANWRHLASDMAGLLIWTALAGYLETRRSYLVLLAGTGLGVGVGLLLLDPH
                     VGWYVGLSGILHGLFAASAIRLLSRKEWLGGFALLAALTLKILWEQRYGDLGTAKLLG
                     VPVLVDAHLYGAVTGAVIVLALLFFRR"
     gene            173038..174135
                     /locus_tag="HNEAP_RS00825"
                     /old_locus_tag="Hneap_0170"
     CDS             173038..174135
                     /locus_tag="HNEAP_RS00825"
                     /old_locus_tag="Hneap_0170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transaldolase"
                     /protein_id="WP_012823069.1"
                     /translation="MSQNDLSVLHSSQGQSLWLDNLSRALLNEGQLAELVQNFGIRGL
                     TSNPSIFKKAIVGSPYYTDDIAALKKQYDDVESVYEHLVVKDIQQACDLLRPIFDESH
                     GEDGWVSWEESPRIAHNATSTVASAERLKKLTDRPNLLIKVPATDEGIEAFELLIARG
                     ISVNVTLMFSLDQVKRVFAAYVRGLKALRASGGAVSRVRAVASLFMSRVDTLVDQQLN
                     EIGTEAALQLRGKAALALGGMAYQHYRDVFEGEAFAELAKFGARSQYLLWASTGTKNP
                     DYSDVLYVENLIAPKTINTLPEATLKAFADHGRIASTLKPRLAEDKKVWDALAGVGID
                     MDGAVGHQLLDEGLDQFAQAFEDLLAAIAQS"
     gene            complement(174196..174966)
                     /locus_tag="HNEAP_RS00830"
                     /old_locus_tag="Hneap_0171"
     CDS             complement(174196..174966)
                     /locus_tag="HNEAP_RS00830"
                     /old_locus_tag="Hneap_0171"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823070.1"
                     /translation="MKHAQQNEHQDTSISVEEINAFIDDELIHEDRQRVREHVKKNPE
                     LTQLICDIDQVQDWIKEAYEIVPEPPHTKANWRIHALLPGALAAMALLSVGALAGWFA
                     SKISSADTDGAHAATMLQANNQIQNVEFASAPTAQTRNVILRLGSDSPRKFTETLNRI
                     EHVMKTSAHQPGFQMEVLANSDGLNFLRADTSPYAKQIEALMKKYPNLHFMVCGTSLK
                     NLEESGQKAALLPNVRVTSSAVEQVAQRIREGWSYSAI"
     gene            complement(174963..175508)
                     /locus_tag="HNEAP_RS00835"
                     /old_locus_tag="Hneap_0172"
     CDS             complement(174963..175508)
                     /locus_tag="HNEAP_RS00835"
                     /old_locus_tag="Hneap_0172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013029833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600516.1"
                     /translation="MTFNHRLEQLRPRLYRLAFSWCKESYLAEDLVQEAMIRALQKQA
                     QLRDEELLDRWVIRILANQWMDHVRSHVRDENIDDMEQTISTDEHQSPDSVHGRDEMI
                     ERVRSAVMRLPEMQRIVVTLVDLEEFSYKEVATTLDLPIGTIMSRLSRGRQSLRNLLI
                     ETKNAATEERRKSECHLRRVV"
     gene            175789..176268
                     /locus_tag="HNEAP_RS00840"
                     /old_locus_tag="Hneap_0173"
     CDS             175789..176268
                     /locus_tag="HNEAP_RS00840"
                     /old_locus_tag="Hneap_0173"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823072.1"
                     /translation="MIRLRQKIVMTALLLGLIGTAPTVMANPAAEPVSQAVQDKPFAE
                     ARVALQISDAAGPKQQLVLNVASNLIKFYGADKVDVEIVAFGPGLRLLFKDNALGDQI
                     QSLAAEGVRFSACANTIAAMSKKLGYEPELNPEARIVPAGIVRLVQLNKAGFFVSRP"
     gene            176452..177756
                     /locus_tag="HNEAP_RS00845"
                     /old_locus_tag="Hneap_0174"
     CDS             176452..177756
                     /locus_tag="HNEAP_RS00845"
                     /old_locus_tag="Hneap_0174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate porin"
                     /protein_id="WP_012823073.1"
                     /translation="MNNNIRILPSAVSKKILIAGLCSGLLIAAPNAFSANWIMLQGTE
                     KPGIAPPVKLWGFIQPTYQKDFSSSYNGKYVPPKLIGPNLDSQSSFNIMRARIGVRGA
                     PFFLDDKVNYFLLTEFGDNAMTDGGRYGSYRPTLTDASVTLNYIKGARIRLGLFKYPG
                     AEEGLQGIGSLNYINYTDVTNQMLLERFPDAGDKNIPPQSTPNADMNAFSNPATGFRD
                     VGVQVFDAFDVGKWEHTYAVMLGNGSGVRMSDGNASKDVYLYWSSAYLFDKKNKGPMS
                     PSVKMFSWYQSGKRTNAYNTAQEQDRKRYGAGVTYLKKPYRVTAEYMWGKGMIYQGAN
                     NPQTLFNDYKANGGYVEGGWFIPNTKWELDLRYDRYQRNVDLPTQTRFSTWTAGVQYH
                     FTPKTRVTLDYAMRRYSSDVVPQNNQLQDVGGRLALQVTAIF"
     gene            complement(177803..178861)
                     /locus_tag="HNEAP_RS00850"
                     /old_locus_tag="Hneap_0175"
     CDS             complement(177803..178861)
                     /locus_tag="HNEAP_RS00850"
                     /old_locus_tag="Hneap_0175"
                     /inference="COORDINATES: protein
                     motif:HMM:PF01590.24,HMM:TIGR00254"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_012823074.1"
                     /translation="MTKKAQNTLDPILDRLASVLAKSTDTATLVRPLLELMEHLTGLD
                     SVYLTRIDWSNQVQTIMFTRNCHELVIPEGLEVPLEHTLCRRAIEEQHFFEPDVPKHW
                     ADAHLAIDMGIQTYLSAPVRLADEEIFGTLCALGADSTEISPSTQRIVQLFANLIAHQ
                     IDRERLITHLQADNRAIGELAMTDALTGLPNRYSLRRALKRELANVRRMDQVLHLAFI
                     DLDQFKEINDRHGHDAGDQFLQAIADALRNGLREGDFVARYGGDEFVAFGISKNTAIA
                     ADEAAFAARLSDLTVGRFALASTIIDYPGASIGVVTSTPEDHDIDELIERADQAMYRL
                     KKNRRATRRLSDGGENNT"
     gene            complement(178858..179517)
                     /locus_tag="HNEAP_RS00855"
     CDS             complement(178858..179517)
                     /locus_tag="HNEAP_RS00855"
                     /inference="COORDINATES: protein motif:HMM:PF08534.8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein disulfide oxidoreductase"
                     /protein_id="WP_012823075.1"
                     /translation="MTRSAPPDDKHDRTPHGVPDSSGNSPRNSPEKTPETPPEKPPET
                     SPKKRRRWRRWLIEIAVFVGVLLAVRAYMAPAIPTDFADAPLPAITFPTLTNGTTGPG
                     TITLGSNPRPTALVFWATWCGVCHVELPWLNELAKTHRIITVAMQSGSADAVRQYLNK
                     NQLDHLPVINDPDGQIAKKFGVSVTPTLFFIAPDGRIAMAETGITSPWGIRLRLWWLG
                     L"
     gene            179601..180782
                     /locus_tag="HNEAP_RS00860"
                     /old_locus_tag="Hneap_0177"
     CDS             179601..180782
                     /locus_tag="HNEAP_RS00860"
                     /old_locus_tag="Hneap_0177"
                     /EC_number="6.3.2.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantothenoylcysteine decarboxylase"
                     /protein_id="WP_012823076.1"
                     /translation="MRILVGISGGIAAYKSIILIRRLRDAGAEVRVVLTENAAQFVTP
                     LSLQAVSGQPVRTHLFDPEAEAGMDHIALARWADVIVIAPASADILARMASGMANDLL
                     TTLVLATTAPVTVAPAMNQQMWAHPAVQANLNTLEKRGVRVIGPASGTQACGEVGAGR
                     MVEPEEMATQILRARSCVDWRGKQVVITAGGTREPIDPVRFIANRSSGKMGFAMAAAA
                     REAGAEVTLICGPNGLPAPAGVHRVDVETAVEMQSAVAAVERMDVFIGAAAVADYRVQ
                     TPAEHKLKKSAEFDSLTLTLVKNPDIISEVARRVPKPFVVGFAAETENLQTYAEQKRR
                     AKGMDVICANAVGEGLAFDQPDNALSVIWSGGVHHFERAEKTQLSAHLIELIDKIMSR
                     E"
     gene            180787..181272
                     /locus_tag="HNEAP_RS00865"
                     /old_locus_tag="Hneap_0178"
     CDS             180787..181272
                     /locus_tag="HNEAP_RS00865"
                     /old_locus_tag="Hneap_0178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823077.1"
                     /note="catalyzes the formation of dUMP from dUTP; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="WP_012823077.1"
                     /translation="MPIEQGNKTARPTVEVKWLDARLGDTIPRPDYATSGSAGLDLRA
                     CLAEPMVLNPGQTELIPTGMAIHIEDPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDY
                     QGQLFVSVWNRSAQPFTIDIGERIAQLVVVPVVQVAFETVEEFTPSHRGSGGFGHTGR
                     A"
     gene            181310..182197
                     /locus_tag="HNEAP_RS00870"
                     /old_locus_tag="Hneap_0179"
     CDS             181310..182197
                     /locus_tag="HNEAP_RS00870"
                     /old_locus_tag="Hneap_0179"
                     /EC_number="2.7.2.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018954816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="WP_012823078.1"
                     /translation="MTSYAPEVTAEVLMEALPYIQRLFDKTIVIKFGGNAMVDEALQD
                     AFARDIVLLKQVGLNPVVVHGGGPQINQLLEKLGKQGEFVQGMRVTDRETMDVVQMVL
                     GGLVNKDIVALINRHGGRAVGLTGRDAGLVRARKLKVSRQTAEMLEPEIIDIGHVGEV
                     ASIDPSILNLLESKDFIPVIAPIGVGEDGAAYNINADVVASKIAQVLGAEKLLLLTNT
                     AGVLDKEGKLLTGLSARDVEALIENGTIYGGMLPKIDFALDAVRGGVKTVQIIDGRVP
                     HAVLLELLTDKGVGTLIRS"
     gene            182540..182836
                     /locus_tag="HNEAP_RS00875"
     CDS             182540..182836
                     /locus_tag="HNEAP_RS00875"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014002537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049772550.1"
                     /translation="MKVASHLLKYYGKGKVDVEIVAFGPGLKLLLAENNPQAPMIAKL
                     SAEGVRFSACGNAIHHATQMLGYAPKLVPAARVVPAGIVRVHDLAVAGYFADKP"
     gene            complement(182847..183539)
                     /locus_tag="HNEAP_RS00880"
                     /old_locus_tag="Hneap_0181"
     CDS             complement(182847..183539)
                     /locus_tag="HNEAP_RS00880"
                     /old_locus_tag="Hneap_0181"
                     /inference="COORDINATES: protein motif:HMM:PF13511.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441071.1"
                     /translation="MIVWQRNALMSSVKIHTGFSSPLPLLPRFRTLCFSHVFVVSITM
                     MCTGFVSVAHADLYRWTTKDGMVHYGDNMPSSQALEGYDLINPATGEVIRHIDRARTP
                     QELAAEAAAKTAEEKKRAEEVAQAQRDRMLLDLYSNTSDLERARKQRLDEIDALIKQN
                     QNALDRANERSKHAQASSEQKAAFKDVIQLRKNLFDLQERRDETSKRFAEDLQRLEQL
                     QAKGKPLDQAGK"
     gene            complement(183708..184925)
                     /locus_tag="HNEAP_RS00885"
                     /old_locus_tag="Hneap_0182"
     CDS             complement(183708..184925)
                     /locus_tag="HNEAP_RS00885"
                     /old_locus_tag="Hneap_0182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012823081.1"
                     /translation="MTPVHGIRPNAAQFMLQLLQVFLVGSLVGMTRTVLPELAESDFG
                     LTAGSFLALATFVVVFGLVKALLNLFAGSLSDRWGRRRVLIAGWVSALPIPLLILYGP
                     NWGWIILATVFLGINQGLSWSMALNSKLDLTHARQRGLVNGFNEFAGYGGVAIAGMLS
                     ALAVHALGARTGLFIFTLAIIVLALLIALAAVRETRPWAMLHQGNPTIEPIGMRALFA
                     YASWKNRSLLALNQAGMVEKFTDAMVWLFFPVFFMGKGLSLVASGSLIAIYGVVWGAG
                     QLITGPLSDRIGRTIMIVGGMWLCGLGVVAVSLSHSIVLWGLELGLIGIGMAMLYPTL
                     GAAVADQAEPAQRASILGIYRFWRDLGYAVGGLLLGLTAQWSGGILLPFWLVGLSMAA
                     SGLWAAVVANESQ"
     gene            185244..185927
                     /locus_tag="HNEAP_RS00890"
                     /old_locus_tag="Hneap_0183"
     CDS             185244..185927
                     /locus_tag="HNEAP_RS00890"
                     /old_locus_tag="Hneap_0183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_012823082.1"
                     /translation="MAFKQDLNDQFARMGKVLGSGRRLELLDYLAQAPRSVEQLAEVS
                     GLTVANTSQHLQKMQQAGLVRANRQGKYIIYQLADGEVVTLLNTLHTLADRHLAEVRA
                     LVATHLAPRDALAPITLDELRPHMASGDMTLIDVRPPQEFAAGHLPSAVNIPPDQLAS
                     ALDRLDPKRPVVAYCRGRYCAFSYDAVAALRERGFSARRLAVGFPEWQLAGHPVIYPA
                     TSPTNQASL"
     gene            185924..186892
                     /locus_tag="HNEAP_RS00895"
                     /old_locus_tag="Hneap_0184"
     CDS             185924..186892
                     /locus_tag="HNEAP_RS00895"
                     /old_locus_tag="Hneap_0184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013105041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_012823083.1"
                     /translation="MTEPTAIAALRTHLAHHIVGQAALVDRLLIGLLTGGHLLVEGLP
                     GLAKTTAVKALAEGVHARFKRVQFTPDLLPADLLGNEIYHPETRTFTFEAGPLFNEII
                     LADEINRAPAKVQSALLEAMAERQVTVAGESRKLPALFLVMATQNPLEQSGTYPLPEA
                     QLDRFMLHVSLSYPERQDEYDILARTLAGTLGRDDDEATGLTVDEVLNARADVRAVHC
                     DAALQRWVVDVVAATRAPEKASDALESLAGMVLVGASPRGALAWVQSAQALAWLNGRD
                     FIVPDDLLELAGDVLRHRLILSPKALVSGLSRDAIITRLCAEIPFP"
     gene            187055..188128
                     /locus_tag="HNEAP_RS00900"
                     /old_locus_tag="Hneap_0185"
     CDS             187055..188128
                     /locus_tag="HNEAP_RS00900"
                     /old_locus_tag="Hneap_0185"
                     /inference="COORDINATES: protein motif:HMM:PF01882.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF58 domain-containing protein"
                     /protein_id="WP_012823084.1"
                     /translation="MNTLRYLFHSLKNRSTHHAAGEPVDAVAPTSAVIETAWQLGGQL
                     PPLASEQLPAAVWFPGDQRAVRLGQGMDFESLRAYQPGEPSHLIDWRISARTPEPVVR
                     VFREPAQRQCHIVLDTSDSMFFGTRRQLKITQALTVAHLLTAAALHQNLSVALHTPGL
                     ANRVPRHPATSRAALLNQLQEIGQWLAPPATPQPIDWTGFRGRMQGCLPEGQIVIVLS
                     DFQTDFTEDASLMGWLPLAKKQRLMLLSVIDPAERLLPDMGAVTFMAQPPQRLDTHDP
                     AVRAELSERFTRRQSAVRAFCQGVGGLFDEIQTVTDVPALIDGFGELLLTGHSRQSAE
                     QPQHHPVNNAPNRASNRSMGASS"
     gene            188125..188670
                     /locus_tag="HNEAP_RS00905"
                     /old_locus_tag="Hneap_0186"
     CDS             188125..188670
                     /locus_tag="HNEAP_RS00905"
                     /old_locus_tag="Hneap_0186"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600313.1"
                     /translation="MNQDAMIHPPDGLPDGAPKGLVDVWMPNAPTAASHAKAMLGHAI
                     EHHAVGIVVWGLLLGVLIGFAIWFWRDWRGRVLRWQIRRLQHLLRRHPDQVPEPLGAA
                     LTWALSKYFQPRYFKASSALDRRALSPDWRTLVMRLDILRFGPKAAHEDWFALLRAMQ
                     ECSRRNATAAATAQVNRMPHS"
     gene            188678..189697
                     /locus_tag="HNEAP_RS00910"
                     /old_locus_tag="Hneap_0187"
     CDS             188678..189697
                     /locus_tag="HNEAP_RS00910"
                     /old_locus_tag="Hneap_0187"
                     /inference="COORDINATES: protein motif:HMM:PF00092.26"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VWA domain-containing protein"
                     /protein_id="WP_012823086.1"
                     /translation="MSGFDGMTSLGMTSLGLTSLGMASPWWLLALLPLPWAFAPLKRY
                     LTHRPAAIMLRHPLIVDHQHTPPPARRAGLIVGLWLASYAALVIALTHPVWQGEFLPA
                     PPPARSILLLVDASPSMQAEDFPAGKDRFIARIDAMKQGLLRFIAARPQDRFSVIVVT
                     NSAGTLVPMTTDHAVLDYWIRQLRAGINGSDTALGDGLAMAIRSIAAQSQAGQPAPLL
                     VVWTDGFSTGGLMTPAEALALARAYGIKLFTVNLAPKGSPPDQGQPSLAQLADLTGGK
                     PILASDLAAMNAVTDQIAASVAPKSATPTERRHIPLYAGFVILATALFLWAQILLWRE
                     PEAAS"
     gene            189700..191658
                     /locus_tag="HNEAP_RS00915"
                     /old_locus_tag="Hneap_0188"
     CDS             189700..191658
                     /locus_tag="HNEAP_RS00915"
                     /old_locus_tag="Hneap_0188"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823087.1"
                     /translation="MLSSTANIFGLHDVLVWLSQRPLVMPHLAEPLWLGLLLVPLALF
                     IWRWRARQKILNYADESLQHWAMQRASQASTTWAGRLRGRLIPSFWLLFWFSLALTLA
                     GPQVMKAKNEQLATRPPVLFVVDDTAAMSVADVSPNRQSRATALLELLGQALNTHRLG
                     LMIDNGEAGLLLPPTGDANLFAFYLKQLAHLAHPLAVPHPDRAFDWIAQMPDMRGGVV
                     VWLTSGDANSFQGALGSRELAAAQALNKADVRLIAVTVAGAGGPLLKDGLPLKNTQDQ
                     VITSQPAPQRVAELAKLTGGAATQTHTLPQDVAFIRQAVSAVPNRAPDKNSAKAQRSL
                     HELPLMLAWLSLLALAALSLGLKPLNGFVARLLRPNKTKPPIAAFLLVAIHGALMSAL
                     VAGLSFAPSGAWAADKPNHTAATFMSRSADDAEVAAGNRALKAGSYAQAQVAFSAAKG
                     YAARFGAGLAAFRRADYAFAVDQLQMAVTLAHTPTQKAQAAFNLGDALTLAGRYAEAR
                     DAFTYVLSIKPPDETLTAAALTNRGIVQKMLQSFAKNGKNSTRFQGHQAAKYGYFKDP
                     EKSRMDKEIQKSQGASAGSSQASTTATQPTTPFALNAATESSARSKLTLIHDAPAPLL
                     DGLLRQQPYHLPTLTAPGKNQAMPAGAP"
     gene            191745..193094
                     /locus_tag="HNEAP_RS00920"
                     /old_locus_tag="Hneap_0189"
     CDS             191745..193094
                     /locus_tag="HNEAP_RS00920"
                     /old_locus_tag="Hneap_0189"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600314.1"
                     /translation="MGQPACAFDIPTPQNQPKTINTTPFGVPQDFGPVTALPPITDLD
                     TQSGAGHLPDGMTVQTRITPMPNATANGFLERAPFLVTLTITDRNKTLASLTLHRPYG
                     EHIQTRRIDIDQQLRSIDGRMANVRVYRFAVTPLAAGDIELKFAEMTFREVGDSATRY
                     AFIPVARTLTVRPLPGFWPAYLPVTPRLAISSEPLPKLAAGQPVDWVLHITGQNLTTY
                     ALSKLLDEQLIGTAALGVGHAEIRRATDDKPPADDPLAQTFTVRISLLPDPQGQGDTN
                     GMLPELRLPFIDSTVADPGQHISETVLPARSISWPAPASARVLDAVQFWWWRVLLLLV
                     VAYGLGYALNDARKRWQRRCQHRAAQVELAELDTPRAVLHRLRQLTGESSIKGMIERA
                     PNPRFIAALQALDAACYGNSDGPVSENCLDNWPQTHQELVRWLPKVFFNAPRPTASD"
     gene            complement(193091..193804)
                     /locus_tag="HNEAP_RS00925"
                     /old_locus_tag="Hneap_0190"
     CDS             complement(193091..193804)
                     /locus_tag="HNEAP_RS00925"
                     /old_locus_tag="Hneap_0190"
                     /inference="COORDINATES: protein motif:HMM:PF13899.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441072.1"
                     /translation="MLAQPCAARSLCLNMGYIIKLSTSFEAQSPISMIGGDQMTKMPT
                     HHRASARRRFSLMLLMTAFFIATPVYAAAQNGGDSDSGVEMVGNVAYVDHLTNLPADF
                     AVMREKKIPMMIFFHASYCGYCVQVDNQFLIPMRLDPEFKGRLLIRRVLVDGDTKYIG
                     LDGKEHDYPHLANKLEVRGVPYILFLAPDGSRITSIQGTAYEFYDYYLSKDINLATDC
                     AKHPNQKKCDGSKNGPGLN"
     gene            complement(194015..194362)
                     /locus_tag="HNEAP_RS00930"
                     /old_locus_tag="Hneap_0191"
     CDS             complement(194015..194362)
                     /locus_tag="HNEAP_RS00930"
                     /old_locus_tag="Hneap_0191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="High potential iron-sulfur protein"
                     /protein_id="WP_012823090.1"
                     /translation="MSTHHSDSASSPTRRHFLSVAVKSAVLIPMAGMGMARLAVAADL
                     PHLSPSDPTAKALNYVEVASESKSSAYQSGDACDNCALYQGDRKADWGPCAVFPGKDV
                     ASKGWCSSYVKMG"
     gene            194496..195998
                     /locus_tag="HNEAP_RS00935"
                     /old_locus_tag="Hneap_0192"
     CDS             194496..195998
                     /locus_tag="HNEAP_RS00935"
                     /old_locus_tag="Hneap_0192"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823091.1"
                     /translation="MSFTSKQDDSNWYLEQTLAYAVADLCLPAQADRVPNPRMIAWNE
                     SLAAEMALDLPSEETRAQIFSGNIIPSGAAPSAQAYAGHQFGNFVPLLGDGRALLLGE
                     VIDRHGKRRDIQLKGAGRTPFSRGGDGKAALGPVLREYLVSEAMHALGIPTTRGLAAV
                     TTGETLWRKGEVPGAILTRVAASHIRVGTFEFLAARGGDAVRLKQLADYVIHRHYPTL
                     KDSALPYSALLEAVVDAQANLVARWMSVGFVHGVMNTDNTSIAGETIDYGPCAFMEAY
                     HPKTVFSSIDLQGRYAYGNQPNIARWNLARFAESLLPLIDTDGDAAIAQANAVLADFP
                     GRYSQHWLAAMRPKLGLSSDTGVSDSADTELIHWFLAAMQSERVDFTKGFRQLSTVVR
                     GNVEPLRSLFNGSADFADWLEHWNTRIAQEKGTADERAERMDAVNPVIIPRNHQVEAM
                     IEAAVREGDFSPFHALLAAVTHPFEDRPEWQNYCEPAPASFGPFTTFCGT"
     gene            complement(196011..197153)
                     /locus_tag="HNEAP_RS00940"
                     /old_locus_tag="Hneap_0193"
     CDS             complement(196011..197153)
                     /locus_tag="HNEAP_RS00940"
                     /old_locus_tag="Hneap_0193"
                     /inference="COORDINATES: protein motif:HMM:PF10129.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823092.1"
                     /translation="MSHTPTQPTQTNRLLYLDFLRGLMLIGITLGHFGPTFEWLMWQP
                     LGFFSNAEGFVLLSGTVFGLVYAKLEQRDPASMAVKARKRAWLIYLSHLGLLLFVALY
                     TWATNGWADDWRSHAQFIAEAPALGLILGTLLIYQPPLLDILPMYALFVLIAPGIIRQ
                     LVAGRVWLVLGVSLVIWWLFSQVVGGGHWRTTIADSLGMGFPFQVGEFDPLTWQVLFF
                     FGTALGVLMFQRRLPRQPQIVLALIAMVAVVLFFGLRHELIAMPAFWNPAWVDRHELA
                     WLRLVNIAALIYTFWTLLYLARKVNWPAWARALPKPFACLGRHSLAVFSVHVVLIYLT
                     IPIQMTYPLFWRYVIGLSLILILLALACGLDIRAKRQRQTQLIPVR"
     gene            197336..197824
                     /locus_tag="HNEAP_RS00945"
                     /old_locus_tag="Hneap_0194"
     CDS             197336..197824
                     /locus_tag="HNEAP_RS00945"
                     /old_locus_tag="Hneap_0194"
                     /EC_number="2.3.1.178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013835161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminobutyrate acetyltransferase"
                     /protein_id="WP_012823093.1"
                     /translation="MTLDYREPRLDDGARIHQMVLEAGTLDVNSAYLYFLLSDHFRDT
                     CVVAESDSVLCGFLTAYRLPRAPDTLFIWQVAVHPDWRGQGMASGLLEALTGRAWFDD
                     IRRVELTISPDNTASQALFRRWAARLDRPLTVSPYLSSELLNAGQDTGHQPEDLYSIA
                     LR"
     gene            197858..199147
                     /locus_tag="HNEAP_RS00950"
                     /old_locus_tag="Hneap_0195"
     CDS             197858..199147
                     /locus_tag="HNEAP_RS00950"
                     /old_locus_tag="Hneap_0195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="WP_012823094.1"
                     /translation="MDIDLFEKYESNVRGYIRSFPTIFTRAKNATVWDHHGKSYIDFF
                     GGAGSLNYGHNDPAVQEAMIDYIQRDGMLNALDKATDAKYHFIKKFQETILLPRGLDY
                     KIQFVGPTGTNAVETALKLARKVKQRSKIVAFTNAYHGHTLGALAVTGNEFYHDDYYG
                     VPLNVTKMPFDQYFDEDDQMDSIDMMRRYYEDGSSGYEVPAGIIVETIQGEGGINVSS
                     IEWLKKLEKMCRDLDILLIIDDIQVGNGRTGNFFSFERAGITPDIITISKSIGTGLPM
                     AIVLMRPEIDQWSPGEHTGTFRGNSLAFIAGATALKRWDNDEFAKEIRRKGEWVEKRF
                     RAIKARFPDHISDVRGLGMIWGIESSIEGFCNEVSREAFEHGLLAETAGATDQVIKFL
                     APLTISQAELDKGLDILEAAIEATAAKHPTTKQEVTA"
     gene            199144..199551
                     /gene="ectC"
                     /locus_tag="HNEAP_RS00955"
                     /old_locus_tag="Hneap_0196"
     CDS             199144..199551
                     /gene="ectC"
                     /locus_tag="HNEAP_RS00955"
                     /old_locus_tag="Hneap_0196"
                     /EC_number="4.2.1.108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823095.1"
                     /note="N-acetyldiaminobutyrate dehydratase; catalyzes the
                     formation of the osmoprotectant ecotoine from
                     gamma-N-acetyl-alpha,gamma-diaminobutyric acid; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-ectoine synthase"
                     /protein_id="WP_012823095.1"
                     /translation="MIVRRLTPDILGTEREVEAENGNWVSRRLVLADDGVGFSFHDTI
                     IRAGTETYIHYANHIEGVYCVSGNGEIHDIANDTTHKISDGMMYLLNNHDRHYLRGGT
                     EDMRLICVFNPPLTGKEVHDENGHYPLLLPGID"
     gene            complement(199779..200633)
                     /locus_tag="HNEAP_RS00960"
                     /old_locus_tag="Hneap_0197"
     CDS             complement(199779..200633)
                     /locus_tag="HNEAP_RS00960"
                     /old_locus_tag="Hneap_0197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="WP_012823096.1"
                     /translation="MTSNQPDLPAVDSGLNWSADWPQTCEAMRRIARQHMSMAATEVE
                     TKADGSWVTAVDHAVQAAVQDWLAERFPAIGFLGEEMTDEEQNAAWARCLAGEQALWV
                     VDPLDGTSNFRAGFPVFSLTLTLLQHGRVIAGLVYDPERDELFHARRGSGAFLNETRL
                     DVRTLPALPLARCLAIVDFKRLNKMLACRLAGDAPYASQRSIGSVALDWCWIAAGRVQ
                     VYVHGKQKPWDYAAGQLIALEAGASSAALDGHRDALDDELKLAPRSAVVAVSESLMDE
                     WLAVLLNP"
     gene            complement(200739..201752)
                     /locus_tag="HNEAP_RS00965"
                     /old_locus_tag="Hneap_0198"
     CDS             complement(200739..201752)
                     /locus_tag="HNEAP_RS00965"
                     /old_locus_tag="Hneap_0198"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018912324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese"
                     /protein_id="WP_012823097.1"
                     /translation="MRQRCLGKFAFWCFFSFLSCAATQAHATAMLTLPGPVVCAQWLH
                     AHSRDVQIVDVRDDPDSLSTPPIFYTQNGQKHLKRVGGHIPSALSVDFLALRNTHRVD
                     GLSLDFQFPTPAEFQSLMQSICLQSNEPIVIAPTGDSAISLQEGALLALELTVYGVPT
                     SEIALLNGGTHAWITAGFPISTNTIFPASGSHWRAKPARASILAHTADVRRQLDRGGL
                     VLDARPLDQFVGITHSPVVTLPGRIQGATALPAEVMYTRAEDGSWHFLTPEQYRNVLA
                     ALDIEMDSRTKADAIVYCNTGQYAAGAWFILNRIIGDSDIRSYEGSLYNWEHHGLPVV
                     GLK"
     gene            complement(202045..202833)
                     /locus_tag="HNEAP_RS00970"
     CDS             complement(202045..202833)
                     /locus_tag="HNEAP_RS00970"
                     /inference="COORDINATES: protein motif:HMM:PF09849.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441073.1"
                     /translation="MNTRYAPPIERPLMNAQEHTLLTDLLNKLKEAAPGAAAAKDPEA
                     DQLIRDTLAATPDAAYLLVQRHLLLEMSLERAQAELKAIQAKASGSFLGGSIGYAADS
                     RPTQTNAYGQPIGRAEPAAVAATTSQAATSTTRPPFGGGSFLGTAAATATGVLGGALL
                     FQGIEHLMGGGLGGSALAGNQPVEDVTSLTENVYESPADMSADTASGGWDNASMADNG
                     SAFDDPMADPIDPMQSDNSGLFDQGNSGGGLFDGLFGGGDDDWV"
     gene            complement(202943..203884)
                     /locus_tag="HNEAP_RS00975"
                     /old_locus_tag="Hneap_0200"
     CDS             complement(202943..203884)
                     /locus_tag="HNEAP_RS00975"
                     /old_locus_tag="Hneap_0200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional riboflavin kinase/FMN
                     adenylyltransferase"
                     /protein_id="WP_012823099.1"
                     /translation="MQLIRGLCALPAFPDGCVVTLGNFDGVHLGHQAVLRQAADQARE
                     FGLPLVVLIFEPLPREFFAPHAPVARLTRLRERAAFIAELGVVDVLLVHPFNAAFAQS
                     TAEAFVEQVLVDALHARRIVIGDDFRFGKNRQGDFALLEQLGQRFDFSVQAAATWALD
                     GERVSSTRIRSHLTERDVAGAARLLGRPFTLCGRVIHGDKRGRQLGFPTANVALHRRL
                     SPLRGVFAVKTTLPDGAIVNGVANVGTRPTVDGQDARLEVHLFDFDRDIYGQMVRVAF
                     CHPLRDEQKFSSLEALMEQITRDASAARAWHDHAAHP"
     gene            204104..204946
                     /locus_tag="HNEAP_RS00980"
                     /old_locus_tag="Hneap_0201"
     CDS             204104..204946
                     /locus_tag="HNEAP_RS00980"
                     /old_locus_tag="Hneap_0201"
                     /EC_number="3.1.21.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II restriction endonuclease"
                     /protein_id="WP_012823100.1"
                     /translation="MNKKSDFEKALKEFVTTLQGYISSEDGQWTIKGFVDMYKNIYTI
                     SSDTKIISKILEIHIFPKLLELSEKHGYKIVLADHQNYYPDISFVDNDDDSVRFAVDF
                     KTTYRQPSKPHLCNGFTLGSHGKYFEDRTSTKNIQFPYGSYSGHYCLGIIYDRVDSRD
                     IDETKIYSLDSLTSITSVVGKFSFFVAEKWRIASDKSGSGNTANIGSINNIADIIEGK
                     GMFSNLGEEWFDDYWMNYKKITVPDGKGGTKKITNLKEFVAYRKGDVSLIVPKQNRTP
                     GKSK"
     gene            204946..205860
                     /locus_tag="HNEAP_RS00985"
                     /old_locus_tag="Hneap_0202"
     CDS             204946..205860
                     /locus_tag="HNEAP_RS00985"
                     /old_locus_tag="Hneap_0202"
                     /EC_number="2.1.1.72"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA adenine methylase"
                     /protein_id="WP_012823101.1"
                     /translation="MKVSVPPIKSQGIKTKLVPWIKSLVPEKFRGRWVEPFMGTGVVA
                     FNVAPDKALMCDTNPHLINFYSAIKSGAITPEIVRGYLVKEGALLQEKGGEHYYSIRE
                     RFNESHSPLDFLFLNRSGFNGMIRFNRKGWFNIPFCKKPNRFAQAYVTKIVNQVSSVS
                     RLIAAKDFDFKCQSFDETISEAKTGDIIYCDPPYIDRHADYFNSWDESHEISLFKNLS
                     EARCDFILSTWHHNDYRKNEYIESHWNNFNILTKEHFYHVGGSEKNRNPMIEAIVTTI
                     DTKLYEYPEAPKQEQLTLLEPKLHYKSA"
     gene            complement(206010..206315)
                     /locus_tag="HNEAP_RS00990"
                     /old_locus_tag="Hneap_0203"
     CDS             complement(206010..206315)
                     /locus_tag="HNEAP_RS00990"
                     /old_locus_tag="Hneap_0203"
                     /inference="COORDINATES: protein motif:HMM:PF11582.6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823102.1"
                     /translation="MIPNALMLSLIARQSLEGELVDQLSELADYPLFLVSNVRGHNDT
                     HHGLSVAEQVEGTAPLIRLSLFTDEPTANRIIDHLRANFRNAGIRWWRIPLATGMID"
     gene            complement(206312..209416)
                     /locus_tag="HNEAP_RS00995"
                     /old_locus_tag="Hneap_0204"
     CDS             complement(206312..209416)
                     /locus_tag="HNEAP_RS00995"
                     /old_locus_tag="Hneap_0204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CusA/CzcA family heavy metal efflux RND
                     transporter"
                     /protein_id="WP_012823103.1"
                     /translation="MLNRLIAFSLAQRLMVLLAAILVAGFGWMAFSTIPIDAYPDISP
                     TQVQIILKAPGVTPTEVETRITAPLETSLLGIPNQTMLRSTSKYGISVITLDFAEGTD
                     IYWARQQVNEALSSARGDLPAGTTGGVAPITTPLGEAFMFTLQSPTLSLTERRHLLDW
                     VIRPALRAVKGVADVNSLGGFVRTFEVIPNPTQLAAQKLTTDDLMRVIEQNNRNDGAG
                     RLDVGEEAWLVRSEGRIKTLDDLGNLVIAQHNGQPIHVRDVATVRIGAITRLGAVTHS
                     GKGETVEGLVLTLRGANARAVVAGVEQRLAEIKPSLPPDLKINVFYNRADLVNAAVHT
                     VSKALLEAVVLVLILLILFLGNLRAAVTVALTLPMAALITFILMKQFGMSANLMSLGG
                     LAIAIGMLVDAAVVVVENTVAHLAEAHKHPNLPRLHIVYRSVREVAAPVFSGILIIML
                     VFLPLLSLQGLEGKLFSPVALTIIFALGASLVLSLTLIPVIASLILGKVTDHEPWLVR
                     QLHRIYEPALNFALKRPLPVVAVAIAGLVVAGLLYTQIGKTFMPSLDEGTIVMQVENL
                     PSTNLGTTIALNTNIQKTLMAKVPEIAQIVGRSGSDELGLDPMGLNDTDTFIILKPKD
                     QWQASSIDEVREKIRAVISTLPGFNFSFTQPIEMRVSEMLTGSRGDLAIKIFGSDLTE
                     INTLSNEIKSVVSAIPGAQDVATTDNEGLLYLNIAVNQAAAARNGLSVNQLEDILRAQ
                     IEGQLAGIVQEGVARTPILIRADALTDAPQKLSSLPIALPNGTVQPLSNLAIVERTTG
                     PVFVTREMGSRFAVVRANVSGRALTDFVADAKNQIAEKVEMPTGYRLEWGGQFENQQR
                     AAARLAIVVPIALGLIFVLLFTTFNSVRQATLVFANIPFALIGGVVALYISGEYLSVP
                     ASVGFIALLGIAVLNGLVLVSYFNQLAAQGLDIEQVVRQGALRRLRPVMMTASIAALG
                     LVPLLFATGPGSEIQRPLAVVVIGGLVTSTLLTLILLPILYKRFGQSSDQRRAQQPLP
                     EAKA"
     gene            complement(209416..210552)
                     /locus_tag="HNEAP_RS01000"
                     /old_locus_tag="Hneap_0205"
     CDS             complement(209416..210552)
                     /locus_tag="HNEAP_RS01000"
                     /old_locus_tag="Hneap_0205"
                     /inference="COORDINATES: protein motif:HMM:TIGR01730"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="WP_012823104.1"
                     /translation="MNQHKHTSLTLMRTTALALLAISATVSTNSLAAAEASSPTAITI
                     PDAMRPNLNVKTQPIEFSKQVPVTQGMVTISAASSNQASMQVSAPADGQVMGTLPQVG
                     QAVQAGDILFEIASAQLGDAMAQWQMAKAKVTLAQQNLNRDTALFKDGLIAKKRLEAT
                     RGEAQMASAELKAASARLKAAGADSSAQNGGINLGVRAPITGVITQRMVMPGERVTTG
                     QSLFDITATQDQWWLLAISPNKAPAAGQKAELKIAGCPESASVQLMDLAVDPTNQLIT
                     LRARPNAPCATLRPGQVSTATLWVEQAKPAASLPISALTELDDNTHVFVQRGQNYFSI
                     PVTRVGEADGQAFVTGQFEPGDRVVSSGISQLKALSMGMGMGGE"
     gene            complement(210549..211937)
                     /locus_tag="HNEAP_RS01005"
                     /old_locus_tag="Hneap_0206"
     CDS             complement(210549..211937)
                     /locus_tag="HNEAP_RS01005"
                     /old_locus_tag="Hneap_0206"
                     /inference="COORDINATES: protein motif:HMM:PF02321.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441074.1"
                     /translation="MKKTAAMRMSFLIKSTQPAKSGVSFAPSIPPGRKGLGLALIINL
                     SLTLLSGTAWAAAPPQTEPAQKTWAQLINQTEQRIEQNLVTEADRVRFESEQARANGI
                     LAGAPVVDGLYRSDRLMSDFGANEMEIGVRLPLRRFGQSDAWRALAEQSALSAKTRTE
                     ANRLILLGDLRQMAWDWRRAEVELSTAKERNRIMQRDLAAVTKQLKHGEAAEVDRMSV
                     ESRALAVQEAVTAAQMQLDTIQTRWQQLTGTSQLPLDLGQVTPTEQALLNNPELNTPD
                     GLLAQQPLLRQMASEVGMSTARIEAERAAGAGTPEIGLGVKRDRGDRGVPYDNSLQLT
                     LSIPFGGQKYRDPALAEMAQQRATAQVALIKNTQQILGEVMALRQRIAAWPSRLTQLD
                     RRAALSEKTLTLKQKALRLGELDWTRLLDFEREAADARLQARLAHIAYQADQSSLKQT
                     LGLMPAANRDSQ"
     gene            212094..212882
                     /locus_tag="HNEAP_RS01010"
                     /old_locus_tag="Hneap_0207"
     CDS             212094..212882
                     /locus_tag="HNEAP_RS01010"
                     /old_locus_tag="Hneap_0207"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_012823106.1"
                     /translation="MTDTIHDSAISPNAPRILVVDDDPGIQTLLGRYLREQGFDVRVV
                     GSGAEMDIALAADPRVDLLVLDIMLPGEDGLSIARRLDPKTRPPVIMLSARGEDIDRI
                     VGLEIGADDYVPKPFNPRELLARIRAVLRRQRMEPDARGKQDERIRVGDFAIDPQTRQ
                     AFLSDGALDLTHGEWQLLQFFMERPNRVINRDQIMDYLKGYERSAFDRSIDVRITRLR
                     RKIETNPTEPRYLVTIWGEGYLFAPSGRSPRSPDASTAVVGERT"
     gene            212879..214294
                     /locus_tag="HNEAP_RS01015"
                     /old_locus_tag="Hneap_0208"
     CDS             212879..214294
                     /locus_tag="HNEAP_RS01015"
                     /old_locus_tag="Hneap_0208"
                     /inference="COORDINATES: protein motif:HMM:PF00512.23"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="WP_012823107.1"
                     /translation="MIRKNRTPRVWSLFSTTALTLIASVSFILVFALSAVTWFAMVPM
                     AKRSADDLAALIVLSAQTWVELPKDAQPLLAAELKDQHGIEIEEIQTLSRQHGTVLPY
                     VRFLHDAVVRRLNACPPNTKDPATGECVYMGILPNNAGYWLELPMADDVLRFEFSPDR
                     VGYRIPFTLGIILIGGIVLTLILALFLTRRLTRPVSQLAEQVSRGLPDAPLPLTGPQE
                     TRVLIDAVNRRSAEVARLLENRTVLLAGISHDLRTPLTRLSLGLALTQDDIEPALQAQ
                     MQADIEQMNRLIAEVLHIARGVSQDSSEPIPLYPWLTRFAAEWEQRDTGIALMVDEAT
                     KMLEIDVATDSLQRILDNLVENAHRYGRPPIILRSVQTEDAQILCVEDEGQGLTVAEI
                     GRLREPFARKDEARSGVTGYGLGLSLAQALAQAQGWTLDLYAPGEHPYTPDGLMPKGL
                     VACLRLPRAVAPVRPLSPRNI"
     gene            214686..216095
                     /locus_tag="HNEAP_RS01020"
                     /old_locus_tag="Hneap_0209"
     CDS             214686..216095
                     /locus_tag="HNEAP_RS01020"
                     /old_locus_tag="Hneap_0209"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017925545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I glutamate--ammonia ligase"
                     /protein_id="WP_012823108.1"
                     /translation="MSVSHAMKMMEENGVKFVDFRFTDTRGKQQHVTYPAGRVDEDSF
                     ESGIMFDGSSIAGWKGINASDMILMPDAGSAVMDPFSEESTMILICDVIEPDTMQGYT
                     RDPRSVAKRAEAYIQASGLADVAYFGPENEFFVFDDVRWGNEMSGSFVKIDSKEAAWN
                     TGKEYEDGNMGHRPGVKGGYFPVPPVDSLHDLRQTMCLVLEDMGQTVEVHHHEVATAG
                     QCEIGVAFNTLVKKADEVQNLKYVLHNVAHSYGKTLTFMPKPMFGDNGSGMHVHQSMA
                     KDGKNLFSGDSYAGLSEMALYYIGGIIKHAHALNAFCNPSTNSYKRLVPHYEAPVKLA
                     YSARNRSASIRIPFVSNPKARRIELRFPDSTANPYLAFAAMLMAGIDGIQNKIHPGEA
                     ASKNLYDLPPEEEKNIPEVAFSLDEALDALEKDREFLKRGDVFSDDLIDAYLELKRGE
                     VQRLRMLPHPVEFEMYYSL"
     gene            complement(216269..216736)
                     /locus_tag="HNEAP_RS01025"
                     /old_locus_tag="Hneap_0210"
     CDS             complement(216269..216736)
                     /locus_tag="HNEAP_RS01025"
                     /old_locus_tag="Hneap_0210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensory protein TspO"
                     /protein_id="WP_012823109.1"
                     /translation="MSSFLVYAISFVLVILVAASGGRFRPDRWYAELKKPVGLPPNWV
                     FPVVWISLYAMMAVAAAWVWLAEPSDLRTAGLIIYAAQLVFNAAWSWLFFGLHRTGLA
                     LIDLLVLITLVSINTWLFVQVDTWAGLLLVPYLIWLLIALYLNASVCWLNRRT"
     gene            complement(216936..219419)
                     /locus_tag="HNEAP_RS01030"
                     /old_locus_tag="Hneap_0211"
     CDS             complement(216936..219419)
                     /locus_tag="HNEAP_RS01030"
                     /old_locus_tag="Hneap_0211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2309 domain-containing protein"
                     /protein_id="WP_012823110.1"
                     /translation="MTTLTSLQRSEAQRNHIVDLIDKACLRIAPIWPLDSFVAVNPYL
                     GLIDQPFDTVGRYLEQTVGESLFMDHGWFADKIAQGEITDDDLAQAAQQLDPSISLDT
                     IKQQLAVHRQPAPALPLVTNELDRRDAPPVSEFVIEQVSQFMANYYDRGQALWHLPKE
                     ASASLFAQWRRYTLINRSASAVGLKQVRQHLLAVPSDAIDALFWALDQINLPESRLPD
                     YLFTLLKTIGGWASWCRYLHFQAGLHGESQHDLRDLLIIRLVWVALVIKETSSAGRQQ
                     WRAKLNDWFDPAKLVASPSATATASTKAQSSRIDEILLAAAEQAFRRRINAGLNRQPA
                     DAPDQQAERPTVQAAFCIDVRSEVFRRHLEASSPGLETIGFAGFFGLPIDYCRMGESE
                     ARLQNPVLINPAYRAQETGDPAIAQHRHARQSRGAIWKQFKLSAASCFTFVESAGLSY
                     VPRLLADSLGWHRSSLPPDAPGLTPEERARLHPQLVKLDGGALSTQEKVDLAEKVLRG
                     LGLTHTFAPIVLLAGHGSSTTNNPHRAGLDCGACAGQAGDVNARVAVQLLNEAAVRLG
                     LIERGIAIPRDTRFVAALHDTTTDHIELLDLDQSGIESDQLSSLTQALKQAGELTRLE
                     RLVTLEAQVDTVDAEKQATFRGRDWSQVRPEWGLAGNAAFIAAPRWRTRGLDLGGRAF
                     LHDYDWRHDKEFGVLNVIMTAPLIVANWINLQYYGSTVDNLHQGAGNKVLHNVVGGTV
                     GVIEGNGGDLRVGLAMQSLHDGEQWRHEPLRLSAYIEAPIAEIDKIIAGHDMLNALIN
                     NRWMHILHIDDNGIPHRRHAHGDWRPEPI"
     gene            complement(219465..221120)
                     /locus_tag="HNEAP_RS01035"
                     /old_locus_tag="Hneap_0212"
     CDS             complement(219465..221120)
                     /locus_tag="HNEAP_RS01035"
                     /old_locus_tag="Hneap_0212"
                     /EC_number="1.6.99.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase subunit 5"
                     /protein_id="WP_012823111.1"
                     /translation="MTIEFSHTTGLLLLAMPALLLMAAVIKPKQGAAYARAYRQRVQW
                     TSFAAFGLALLAVVSFLFARQQNLMLGAGSLPAGLGLLALSIQVNGLTLVLASLVSFV
                     LSVIARYSVQYLDGDPQQARFFRLLAVTGGFFLLVVISGNLGLFTLAIIATGFGLHRL
                     LSFYADRPRAIMATHKKSIFSRTADALLLAATVLIGHQIGSLEFSQISAYVHAQDHLS
                     IALHVAAWLIVLAAILKSAQFPFHGWLIQVMEAPTPVSALMHAGVVYSGAIIVLRTSE
                     LLAADGTALLLLALIGLMTLAIGSLVMLTQSAIKSSLAWSTAAQLGFMMLELGLGLFG
                     LALLHLVGHSLYKAHAFLSSGSMTDHLRQAKVLKNRPISVVAWFTTVIVSGLFTLGIA
                     AAMGLSIDQEPMLPAVLTIIALATAQLMLKALSHGTWREILVAAGAAIAMTGVYVFLH
                     EVFITGFADTLAATPQRAPLLDLLLMAITIITFLFVAWLQGPGKTLMSPERQFALFVH
                     LNNGLYLDRWVERLAFRFWPEKVGRAPKKSCAVIPPNPSGIEP"
     gene            221411..222358
                     /locus_tag="HNEAP_RS01040"
                     /old_locus_tag="Hneap_0213"
     CDS             221411..222358
                     /locus_tag="HNEAP_RS01040"
                     /old_locus_tag="Hneap_0213"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012823112.1"
                     /translation="MTDAATLGARKLLRHATLRQVEVFESVARHVSFTRAAEELHLTQ
                     PSVSAQVKSLAEVVGEPLYEQVGRRIYLTDAGQIVERSCREVIDILSNAEMSLSELNG
                     MRKGRLRLSVITTAKYFAPLALGDFSLQYPDIDLELVISNRDTLLKRIEDNRSDLYVM
                     GQLPRTRLDLEVIPFAPNPLVVIAHRDHILAKERNISMERIAQESFIMREPGSGIRHK
                     VEEHFARHQQSIKTRLVLDGNEAIKHAVAGRLGISVVSAHALNLENSQEPLVKLDVQS
                     FPLQSMWNIVYPRGKALSVVARQFLSFLKIHGGDYLHIG"
     gene            222448..222801
                     /locus_tag="HNEAP_RS01045"
                     /old_locus_tag="Hneap_0214"
     CDS             222448..222801
                     /locus_tag="HNEAP_RS01045"
                     /old_locus_tag="Hneap_0214"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823113.1"
                     /translation="MTGTYPEKAQPSASRLLRHLNVMTLVEGASLIALVLIAVPIKYG
                     LDFPLAVKVVGPIHGALFVWTMGVLLVSVIAGRLAISKGAGVFLAALIPFGGLWSHRL
                     LDRELAHHEPKSPVK"
     gene            223050..223448
                     /locus_tag="HNEAP_RS01050"
                     /old_locus_tag="Hneap_0215"
     CDS             223050..223448
                     /locus_tag="HNEAP_RS01050"
                     /old_locus_tag="Hneap_0215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoacyl-tRNA hydrolase"
                     /protein_id="WP_012823114.1"
                     /translation="MTISIDVNDVEFTAIRSQGAGGQHVNKVSTAIHLRFDIRASALP
                     DEAKEKLLAVSDSRISRDGVIVIKAQRFNSQDKNRADALARLQALVAQALRPVKPRKP
                     TKPTRGAQLKRLAKKVQRGQTKLLRGRVVE"
     gene            223467..224009
                     /locus_tag="HNEAP_RS01055"
                     /old_locus_tag="Hneap_0216"
     CDS             223467..224009
                     /locus_tag="HNEAP_RS01055"
                     /old_locus_tag="Hneap_0216"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823115.1"
                     /translation="MAQKATVYKVDLDISDMDRSYYLSHHLTLALHPSETESRMMFRL
                     LAFALNAQEALQFTRGLSADDEPDIWLKDLTGAIDLWIEVGLPDERRLRKACGRAKQV
                     LVYAYGDRAVSVWWAKSAREFARLDNLRVFSIDDESLDGLTALIGRGMHLSVSIQDGD
                     IWFSDGEGNVPITVRSLQPA"
     gene            224238..225791
                     /locus_tag="HNEAP_RS01060"
                     /old_locus_tag="Hneap_0217"
     CDS             224238..225791
                     /locus_tag="HNEAP_RS01060"
                     /old_locus_tag="Hneap_0217"
                     /inference="COORDINATES: protein motif:HMM:PF03190.13"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823116.1"
                     /translation="MKRYTRWVGLFSVLLLLPQWAQAADIHWQPYGPAVFAKAKAENR
                     LILLDMVAVWCHWCHVMEDKTYSDPAVANEINAHFVAVRVDHDARPDLAERYRNYAWP
                     ATIILRPDGGEVLRKAGYIPPERMMKLLHQAEQLPVLAPEPEQVADAAPSSGDPLSST
                     VRNMLIRNHLSLNDPVLGGLKLPQKFLVEGEVRWDMYLAAHGDKQAKKRAIAYLNAAL
                     KLIDPVFGGAYQYSTHGDWQHPHFEKIMSVQADYLRVYSQAYTQFGDDRYRQAIAAIA
                     GYLNQFLSAPDGGFHPSQDADLVQGEKANTYFAKDRAARLAEGVPRVDPHQYTAQTAM
                     AIEGLLDAYHATGDRQYFFRAMAGLDWVLRHRRLDDVGFKHDAKDVAGPYLIDNLYMA
                     RVYLALYRITQTPMWLTQAEQLGDWISTHFTRSEGGLFSAVPDGTPVLPVPQVDQNLQ
                     AAGFYLGLAQASRKRHYLETATNILAYLARPAVASARSSNAGILLYDAQRDALAKSLP
                     KKTKDAPAS"
     gene            226041..227918
                     /locus_tag="HNEAP_RS01065"
                     /old_locus_tag="Hneap_0218"
     CDS             226041..227918
                     /locus_tag="HNEAP_RS01065"
                     /old_locus_tag="Hneap_0218"
                     /inference="COORDINATES: protein motif:HMM:PF05787.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823117.1"
                     /translation="MNKNILALAIAGVFSLGLAGCNSSDDTTASATPEPANPAPTGTT
                     LATPTGAAQNEFMVATDFTVPGYTSNLNGASDTLQTAAVDAAKTQPFGFHKLVATGYE
                     DNNETFGWIKDKDKKGLVFADGSKYICNGTNQGVGSGLDNSSLIKQADGSLRLVAQFE
                     CQVGAMYTAGIDQDAVTGALSMKPNSLQFIDQSSEFGGYTHCAGMVTPWNTHLGSEEY
                     EPNARLDSQTSVGKTDDTFYNATFPFWTGSVDSAQNNDPATGMNPYFYGWIPEVKADG
                     TGFTKHYSMGRVSHELAYVMPDQKTAYLSDDGTNDGFYKFVADKAGDLSAGTLYAAKF
                     TQTDATAGGKFTLSWISLGHADDATIRAEVAKRPVFDDLFATATPDATTNACPADFTR
                     INTEAGLECLQIKTGMDEIASRLETRRYAAMMGATTELRKTEGITFDAATKTMYVAIS
                     SIERGMEDGYSTVKKTDKYDKGGNNDIRLPANTCGAVYALPVDTNYNATAWNVVIAGT
                     PTTYDANSPYTNNYCDVNGIANPDNINMIPDTSLLMIGEDSGAHINNVYWAYDLDTKS
                     LKRVLTVPKGAEVTSTFWYQFGNFAYLSVVGQHPLKKESTATPDQKQTLLGYIGPFVK
                     N"
     gene            228104..229846
                     /locus_tag="HNEAP_RS01070"
                     /old_locus_tag="Hneap_0219"
     CDS             228104..229846
                     /locus_tag="HNEAP_RS01070"
                     /old_locus_tag="Hneap_0219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823118.1"
                     /translation="MRRSVDKTILITSLVALPFLLANCGGSGTDTAKTTTSDGAADKT
                     VVSLNSDAMLNPAAYIPPQCYTQTRDETGAFAGKSSNPCFACHNMGKEPNYTNDADLQ
                     LTYAMPAFAQKNNWSNLFIDRRPEIAAIDDAKILEYVRQDNYHDAAGLVALQRVLNAP
                     LPAGWDANGDGKWNGYIPDAYFSFDETGFDHAPDGSYTGWRAFAYAAFLGTFWPTNGS
                     TDDVLIRLASAFREKTDGTFDLTIYTVNLAIMQAMIQRQNVPIAAVDERIFGVDLNRD
                     GQLGTATQITYDWSPTEGRNMQYVGLAGEHLAQGQVHIAAGLYPEGTEFIHTVRYLDP
                     VGGEVGIGMSARMKEVRYAVKRGWNNFAQLKSYADGEVLEDMRFPDRLRRFVGNIETG
                     LQNGTGWYYAGFIEDKQGDLRPQSKEELSACMGCHSALSVTTDSSFAFPRKLNADQAD
                     GWYHWTQRAKGLNGLPEPQYANGVYEYTHYLDINHAGDEFRENKEVIAKFYGTGSTLI
                     PAEVDALHHDIGTLLLPSKERAIALDKAYYLIVQEQSFNKGRDAIIEPPVNIHKTVGE
                     DEATGVNEIYLIPR"
     gene            229934..232051
                     /locus_tag="HNEAP_RS12425"
                     /old_locus_tag="Hneap_0220"
     CDS             229934..232051
                     /locus_tag="HNEAP_RS12425"
                     /old_locus_tag="Hneap_0220"
                     /inference="COORDINATES: protein motif:HMM:PF16409.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PKD domain-containing protein"
                     /protein_id="WP_012823119.1"
                     /translation="MKRLFLFVFALVLSLGHLPIVNATTFFSEDFASKSLGQMTTVNV
                     ASNANWVYGSYQGDDFAKMNGYGADVASDDWLLTPQITLPAGAAANLFYTTIKGFDGP
                     ALQAMISTDYDGSGTPTAVQAATWTTLGGALPTNTTGYSSATSSGPVDLSAYADQKVT
                     IAFHYTSTGTVSGAAATWEVLDVQVGDGGAAPSVAASASETSVLTQTPLTFNAKINGG
                     TPPLQAVWQFSDGLTQTGAQVQHQFLNPGDYTATVTVTDANGLSATSAPVNVTALKPQ
                     AYVLPEPKGTLRVATFNTYLNRTVEGELAADLGAGDAQAAAVAEIIQRVRPDVILLNE
                     FDYDPSGDALDLFERRYLAIGQNGAHSIQYPYHYVAPVNTGVQSGKDLDHNGTPGDPG
                     DAFGFGSFPGQYGMVILSMYPIEADKVRTFQKFLWKDMPNALLPKNPDGSSYYTPAEL
                     DVFRLSSKSHWDVPVYVNGKTLHILASHPTPPVFDDGTLGVDKDVVDWNGTRNHDEIR
                     LWADYIDPAKSGYIVDDKGGKGGLSANARFVIVGDENADPKKGDSTNKAILQLLDNPL
                     VTDTDPTSIGALDNTDARFGASADDTIEDGLRLDYVLPSTFGVTVDQGQVFWPGRTYD
                     LSRLTGFQTVISSDHRMNWQDMTLNVTAVDDVMPSEPAPDSGNTATSNDGGSGAVGPW
                     ALLLLTGPLLLARIIRRKHNNPA"
     gene            complement(232259..233389)
                     /locus_tag="HNEAP_RS01080"
                     /old_locus_tag="Hneap_0221"
     CDS             complement(232259..233389)
                     /locus_tag="HNEAP_RS01080"
                     /old_locus_tag="Hneap_0221"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600317.1"
                     /translation="MRASLPPIDTWAPRNTRYSSFPRKLEPRKINKLDSRIRGNDGFF
                     ELPTYRLAALFCLLFFIGHSTFAATLPAIVDEASGLTRSPQHVGVYWTHNDNINLPAS
                     SKKGVPLLFAINNDGKLLGTLKLDGVRQRDWEAITHLDLDGNPTLVIGDIGDNRGTWP
                     DYRLWFVPEPVALKTNITQRPTAIIRFRYSDQVPAPRRQGGFSGGHDAESLVFDAEHR
                     EFLILTKREKSARLFAIPLTSRVNLSDGKPISAQEKKAAVVTARFIANLPTLPAPDLV
                     SWLLHPFTSPYADQPTAMALTPDGHLLAILTYSAVYYFYRRAKEDWPTALQKPFASVS
                     LPSIEQWEGASFSADGKKLVIVHEGRGENTVTILQAPWALKN"
     gene            complement(233428..233628)
                     /locus_tag="HNEAP_RS01085"
                     /old_locus_tag="Hneap_0222"
     CDS             complement(233428..233628)
                     /locus_tag="HNEAP_RS01085"
                     /old_locus_tag="Hneap_0222"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014597035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012823121.1"
                     /translation="MKTNVGSIDKILRIVVGLALIALSVFKPEVVGYWGYIGIIPLLT
                     GLFNFCPAYTLLGLNTKGKSAE"
     gene            complement(233704..234051)
                     /locus_tag="HNEAP_RS01090"
                     /old_locus_tag="Hneap_0223"
     CDS             complement(233704..234051)
                     /locus_tag="HNEAP_RS01090"
                     /old_locus_tag="Hneap_0223"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823122.1"
                     /translation="MDQRTSPFFSRFARNLSAIGIGVALVMGAQVASADELVMRPDIN
                     QAKPGSTYYVHGLSMNQITKKFGQPSRKLAPDPAKGTKYQPPITRWVYPEFTVYFEHG
                     HAIHLVKHHKRPK"
     gene            234504..235751
                     /locus_tag="HNEAP_RS01095"
                     /old_locus_tag="Hneap_0224"
     CDS             234504..235751
                     /locus_tag="HNEAP_RS01095"
                     /old_locus_tag="Hneap_0224"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012637933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein-releasing system transmembrane
                     subunit LolC"
                     /protein_id="WP_012823123.1"
                     /translation="MFRSFEWLIGLRYTRAKRRNRFVSFISATSIIGITLGVTALIVV
                     ISVMNGFQDELRHRILGMTAHATISENGQALQDWRSLAKKVQNEPDVMASAPYVQAEA
                     MLSAQPNVSGAIIRGIEPKYEDAVTDIGKHMVAGSLSDLKPGGFGIVLGEALAQSLGV
                     AVGDKLMLITANVAVTPVGGLLRQRQFTVVGIFKVGMYEYDRGSAFIDLKDAQALFRM
                     GDGVTGLRLKLDDMFRAPWVARDLNLKLGNPYWTTDWTQANGNFFRAVQTERTVMFII
                     LSLIVAVAAFNIVSTLVMVVTDKRGDIAILRTLGASPGSIMRIFLISGTVIGLIGTLI
                     GVGFGVLIASNVETIVPWIEHLTGTQFMPADVYYISEVPSRLDWNDVWHVGLMAFGLS
                     FLATIYPAWSASRVQPAEALRYE"
     gene            235744..236451
                     /locus_tag="HNEAP_RS01100"
                     /old_locus_tag="Hneap_0225"
     CDS             235744..236451
                     /locus_tag="HNEAP_RS01100"
                     /old_locus_tag="Hneap_0225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012823124.1"
                     /translation="MNKPSQAAPTPDIVLETRHLHRTYREGDLVVPVLKGIDLAVKKG
                     EMLAIVGASGSGKSSLLQLMGGLDKPTGGEVWLAGHLLSTQSEAARGTLRNRHLGFVY
                     QAHHLLPEFSALDNVAMPLLIRRLPRVEAHARARGMLEAVGLGARGEHRPGELSGGER
                     QRVAIARALVTEPAVVLADEPTGNLDSHSSDSVFNAMVSLNQRFGTAIVLVTHDNQLA
                     ELMQRVLVMHDGVLKPR"
     gene            236581..238059
                     /locus_tag="HNEAP_RS01105"
                     /old_locus_tag="Hneap_0226"
     CDS             236581..238059
                     /locus_tag="HNEAP_RS01105"
                     /old_locus_tag="Hneap_0226"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline invertase"
                     /protein_id="WP_012823125.1"
                     /translation="MAQKNPDSCFQNPKYAGFSPALDDAYRLIDSALIYYQGQIVGTV
                     ASTDHTAPAVNYSDCFVRDFFSAGLIMLLEGRADIVRAFLHVIMQLRGQQEALEGQQI
                     APGVLPASFRVHRDADGEETIIADFGDRAIGRVAPVDSMMWWAALLRAYVRYTGDEAF
                     AHTPEIQRMLRMILSLCLQSRFEVFPTLLVPDGSFMIDRRMGVNGHPLEIQALFDMTL
                     CCADLLVPEEGSQWLIDLAHRRRVVLRQYLQRYYWLDMDVLNRIYRFSTEMFGEDVEN
                     LFNIYPESIPEWLPEWLPDGAGYFVGNLGPGRVDFRFFSQGNLLMLVSDLALPEQVKG
                     LMNLIDLRWNDLIGRMPMKLVYPAIKTHEWRLITGSDPKNIPLSYHNGGNWPVLIWPF
                     VAAAIKAGRYDMASRAWAEAEERLLKDNWPEYYDGRTGRLVGRRSNVRQVWSATGLLL
                     ARHFLDEPDVLNRLGFAPQPPDDPELMGAQWTPQGTQHGGPR"
     gene            238056..240410
                     /locus_tag="HNEAP_RS01110"
                     /old_locus_tag="Hneap_0227"
     CDS             238056..240410
                     /locus_tag="HNEAP_RS01110"
                     /old_locus_tag="Hneap_0227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose-phosphate synthase"
                     /protein_id="WP_012823126.1"
                     /translation="MNDTPAHAKERPAETRPEPMIEPKIESTVESSAEGRKPGLYIVL
                     ISVHGLIRGSELELGRDADTGGQTLYVVELARALAKHPVVSRVDLFTRLVRDDRVSAD
                     YAQPEESLADAPNARIVRVPAGPDEYLPKEQLWDHLDSLSDHALDYIRQTGLKPALVH
                     SHYADAGYVGMRLSLQLGVPLAHTGHSLGRVKRQRLLASGESAKVIEQKYALSRRIRV
                     EEEVLAASSLVVVSTQDEIETQYGLYDWADPSRMEVIPPGVDLTRFDPKITGPMPIAD
                     ELARFLREPDKPAILALSRPDERKNIATLVHAYGRNPALQDVANLVIVAGNRDDIRDM
                     DPGSRQVLTEILLLIDRYDLYGKVAYPRHHQSQDVPDFYRWTAQTRGVFINPALTEPF
                     GLTLIEAAACGLPILATEDGGPRDIIRACKNGELINPLDAEGMGEQLLALLTDTARWD
                     SYARNGIKGVRHHYTWPAHAEQYFETLASMPLHQQTSAPAGASETAAHAASTPMTADR
                     MILIDDRILNTDIDVAALRELIGLLRRHRRQVAYGLVSDRPRHDILALLKKQGLVVPD
                     VLITRGGTQIHYGARLSRDKGWSRHISYSWQGDRVYELLAETPGVRLSGRSHQGLYAV
                     HAYIDDPDVFAGLNELADAFHQADISARLTALNEREFLVTPQRASKGFAIRYLAAQHD
                     IALMNMLVVGSAEADSDLLGGNVLSAQLCAEPDEECVVQGADNSIYCPSASGVAGIRA
                     AMDFYDFLGECRAPSTDPEAGGANDEPKPATAASGPASSKEDEV"
     gene            240407..241288
                     /locus_tag="HNEAP_RS01115"
                     /old_locus_tag="Hneap_0228"
     CDS             240407..241288
                     /locus_tag="HNEAP_RS01115"
                     /old_locus_tag="Hneap_0228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_012823127.1"
                     /translation="MTSTDITPSAILLCCDLDRTLIPNGAQPESPEARARLRALCAHP
                     DIHLVMVSGRHIELVLEAIDQWDLPQPDYIIGDVGTTIYTHPEPEEGPPDSWAMWRSW
                     AAELGPDWGGMTHNDITDLFRDIEAIKPQPIDRQGVFKASYFVDIDANSEILEAELVR
                     RLWQLGVNARLIWSVDEAAHTGLLDVLPASASKLHAIEFLSATQKYPMAHTVFAGDSG
                     NDLEVLGSHIQSVLVANAPEDVRARALALAESADVAHSLYLARGGLFGMNGNYSAGVL
                     EGLAHFLPETLPWMELE"
     gene            241531..242199
                     /locus_tag="HNEAP_RS01120"
     CDS             241531..242199
                     /locus_tag="HNEAP_RS01120"
                     /inference="COORDINATES: protein motif:HMM:PF00924.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Small-conductance mechanosensitive channel-like
                     protein"
                     /protein_id="WP_012823128.1"
                     /translation="MSGLDQFFLALGQWLKEWQALVPFFLLLIFGGGSVLLAQRFLRR
                     HFNRMVSHAPISPGTLLILRRAISLSLWAVLALLLLRQAGVNVDGIWTMLASMLAVIG
                     VGLLAVWTMVSNITASLFIWIWRPYELGETIEMLPNNVKGRAVDRSLMFTTLREADGT
                     LLMIPNNQFFQNVTRRWPNRTRVTDYEAWEAERNLGAAEYASHPASPNPAVPDSSPKD
                     DVVT"
     gene            242272..242757
                     /locus_tag="HNEAP_RS01125"
                     /old_locus_tag="Hneap_0230"
     CDS             242272..242757
                     /locus_tag="HNEAP_RS01125"
                     /old_locus_tag="Hneap_0230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007082292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein pilin"
                     /protein_id="WP_012823129.1"
                     /translation="MLTVSGHKVIPAHHERGFTLIELMITIAIIGILASIALFAYQDY
                     IIRAQVSEGVTLVSGPELALAEWTGGHPNFPNSGNPGNNTSLGLAAPGSISGSYVQSV
                     AVINGGKIELTYGNKANAAIAGAAKKCTLSPLTSAPGAIRWQVDSCGFNSRYLPQAWR
                     P"
     gene            243322..244044
                     /locus_tag="HNEAP_RS01130"
     CDS             243322..244044
                     /locus_tag="HNEAP_RS01130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020167495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monofunctional biosynthetic peptidoglycan
                     transglycosylase"
                     /protein_id="WP_081441172.1"
                     /translation="MPSTKKSRRPIRRLIFLLFALALLVFVLVQAWFYVQVWQLRTHN
                     PQTTAFMRERLALIQAVNPKAKLDYHWVNYAAIAPIAKRAVVASEDDRFMEHYGFDWT
                     GIQDAFEKNLAEGEFAAGGSTISQQLARNLFLSPSKNLWRKGEEAIITLMLETTLGKR
                     RILELYLNVVEWGNLLYGIDAASHYYFHKSPAALTPHEAAFLAAMLPNPRFYQDNPGS
                     RGLQKRIRAVEGRMNYSRIPPQ"
     gene            244073..245356
                     /locus_tag="HNEAP_RS01135"
                     /old_locus_tag="Hneap_0232"
     CDS             244073..245356
                     /locus_tag="HNEAP_RS01135"
                     /old_locus_tag="Hneap_0232"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide sugar dehydrogenase"
                     /protein_id="WP_012823131.1"
                     /translation="MKSKEAAEPIIAVIGLGYVGLPLAVEFGKIRPVIGFDVDATRID
                     QLKSGHDRTREVEPDELQNARHLSYTVDPADLRKASLFIVTVPTPIDAHKRPDLSPLI
                     KASETVGRALKRGDIVIYESTVYPGATEEDCVPVLEQYSGLRFNHDFYCGYSPERINP
                     GDKTHRLPAIKKVTAGSTPAVAEAVDALYRQIITAGTHPAPSIRVAEAAKVIENTQRD
                     VNIALINELAILFGKLGLDTQAVLEAAGSKWNFLPFRPGLVGGHCIGVDPYYLTHKAQ
                     QVGHHPEMILAGRRINDGMGAYVAGQLIKAMLKKGITVQGARVLVLGLTFKENCPDLR
                     NTRVIDVITELKDYGLTVDVHDPWADAACARHEYGLELTATPPSNTYEAIVLAVAHRE
                     FRTLGAPAIHALGKEQHVLYDLKHLFHADEADIRL"
     gene            245635..245952
                     /locus_tag="HNEAP_RS01140"
                     /old_locus_tag="Hneap_0233"
     CDS             245635..245952
                     /locus_tag="HNEAP_RS01140"
                     /old_locus_tag="Hneap_0233"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823132.1"
                     /translation="MIEPHIMRLTPAVQHTIKTTAAEVFGAEAKISLFGSRTDDTRKG
                     GDIDLLVELPSPQSEVQRKRLSFVARLQQRLGDQPIDVLIVQPNTQKQAIHEVAQATS
                     IPL"
     gene            245949..246482
                     /locus_tag="HNEAP_RS01145"
                     /old_locus_tag="Hneap_0234"
     CDS             245949..246482
                     /locus_tag="HNEAP_RS01145"
                     /old_locus_tag="Hneap_0234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823133.1"
                     /translation="MNTNQLSDRARFLATLRIVAKESAHLEWSQQRLFSQPITPAWVE
                     ALDTHPELAERLEAFVSRYGRLQDTIADKLLPRWLRALAERPGSQIEVLNRAEQLGVL
                     EDVSQWLEARQLRNTLIHEYMEDSATFAENIQLAEQYSHLLLATYQRIHNDAATRLNI
                     APHELPEHTGYPQHDRP"
     gene            246436..247197
                     /locus_tag="HNEAP_RS12100"
                     /old_locus_tag="Hneap_0235"
     CDS             246436..247197
                     /locus_tag="HNEAP_RS12100"
                     /old_locus_tag="Hneap_0235"
                     /inference="COORDINATES: protein motif:HMM:PF13489.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441075.1"
                     /translation="MNCRNTQDTPSMIAPKLRRLLGGLRQTPLHPQWLVFKDTRQQKQ
                     RIAKRIQGRLLDIGCGEKPLTPFLSAGVNYIGLDYPPTVAKGYSGKADVFGDGQRLPF
                     ADASFDCITILDVMEHLPNPEAAFGEMLRVLKPGGILISQTPFLYPLHDLPHDFQRWT
                     GEGLSQFTQRHPADLIERHHHSKPLETAAILTNLALAKGMLDSLHAKHPGLLLLPLVI
                     LLVPIINLAGWAFARLLPDEGFMPLGYTAVFKKRA"
     gene            247194..248333
                     /locus_tag="HNEAP_RS01155"
                     /old_locus_tag="Hneap_0236"
     CDS             247194..248333
                     /locus_tag="HNEAP_RS01155"
                     /old_locus_tag="Hneap_0236"
                     /inference="COORDINATES: protein motif:HMM:PF13477.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="WP_012823135.1"
                     /translation="MKLLIVTTSYPDDSDGAAAAGVFVRDFALALVEQGHQVSVIAPS
                     QTSRITDENNVRVQRFAVPKLPLSLLKPHDPRDWTAIIHTLRQGQHHVNHICATYRPD
                     YIFALWALPSGAWARQASRRYGVPYGTWALGSDIWSLGKIPLIRQGLRHVLRHAAHRY
                     ADGLQLAQDVTDISGLNCDFLPSARRLLVTNPRTIASTPPYRLAFLGRWHPNKGIDLL
                     LEVLEQLTDNDWQRIEHLRIFGGGAMHAQVHQHCARLIALGRPIEIGGFLDQSAASEL
                     LNWTDFVLIPSRIESIPVIFSDAMQARRPVIAMPTGDLPALLNEHGCGEVAADISAAA
                     FAFALRKALQSNASEYASGTQSACARFDIAESARRFTRNIELRSQ"
     gene            248330..249076
                     /locus_tag="HNEAP_RS12105"
                     /old_locus_tag="Hneap_0237"
     CDS             248330..249076
                     /locus_tag="HNEAP_RS12105"
                     /old_locus_tag="Hneap_0237"
                     /inference="COORDINATES: protein motif:HMM:PF05401.9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="WP_012823136.1"
                     /translation="MSEFTTPTTDPRWGADKRNIKAEQIAHILENLGRVKLEQSNVLD
                     IGCGSGGIAAHLAPRVQSMTGMDPEPWPRWDIWLEAHPNLKFMQGSVESNSLEPHSFD
                     VIICNQVYEHVPDPQALIQLIARLIKPEGIVYFAGPNLLFPIEPHVFWPFVHWIPREL
                     AIKIMKAFRAKYIDYLDAYSTHYWKLKSWLSPQFEIKNAIPFLIRETHPVIKDKKTLT
                     SHIPSSVLSILTPLTPGFVFLLKPRENVMK"
     gene            249073..249999
                     /locus_tag="HNEAP_RS01165"
                     /old_locus_tag="Hneap_0238"
     CDS             249073..249999
                     /locus_tag="HNEAP_RS01165"
                     /old_locus_tag="Hneap_0238"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823137.1"
                     /translation="MSWRKKPIWLILAALITLGSFIWLVLLLKDGFIQIMEQGMSLNT
                     PALALSWILAVAATFITSQIFFNIMQASGARFSSFHEACELNFTAQVMRHLPGRFFGV
                     AYQVVKAKHVANTAEWICGNIAIILLSTWLALVFSSIILIALEKNMALAFMILISTLS
                     APFIIYGINLLLGHFSSKNQKIEKFIKIFHAVPKALFSAKGRRALAWGTISWCVYAMA
                     WAAFGEALPLESWHDGLILGALYTLAWAIGFFSLITPSGLGVRELAFALLASSYPPEI
                     LLFVSVAARLGLMLADFVLGIVFLVTAKREIL"
     gene            249996..250550
                     /locus_tag="HNEAP_RS12430"
                     /old_locus_tag="Hneap_0239"
     CDS             249996..250550
                     /locus_tag="HNEAP_RS12430"
                     /old_locus_tag="Hneap_0239"
                     /inference="COORDINATES: protein motif:HMM:PF00132.22"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase (isoleucine patch
                     superfamily)-like protein"
                     /protein_id="WP_012823138.1"
                     /translation="MTLKAVEMTLNTLGCIAIRNAMHPKLRSWLLRLFGANVGINVRI
                     HSCRFMNFELGFKNLKFDDGVYIGTDVLIDCACTLNIGKNTTISARSALITHSDPGTR
                     QGNAIAKIYPARKTGVFIGNDCWIGVGAIVLDGSVINDRCLVAAGSVVTGSTLDKESL
                     YAGSPAVFKKKLNFNSEKSSSHSL"
     gene            complement(250516..251679)
                     /locus_tag="HNEAP_RS01170"
                     /old_locus_tag="Hneap_0240"
     CDS             complement(250516..251679)
                     /locus_tag="HNEAP_RS01170"
                     /old_locus_tag="Hneap_0240"
                     /EC_number="2.6.1.50"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spore coat protein"
                     /protein_id="WP_012823139.1"
                     /translation="MPEKQPFIVFGAPQIEQDEIDEVVDSMRASWLGTGPKVARFERE
                     FAAYKGMQPDHVAATNSCTAALHISMLAAGLKPGDEVITTALTFCATVNAIIHTGATP
                     VLVDVDPLTMNIDPQAVEAAITPRTRAILPVHFAGRSCDMDTLMRIARKHDLKVIEDC
                     AHAIETEYHGQKAGTFGDFGCFSFYATKNITTGEGGMVLAQDEHDIARIKVLALHGMS
                     KDAWHRFGDAGYKHYLVTEAGFKYNMMDIQAAIGIHQLARIEHNWKKRQALWTNYQSA
                     FADLPVTRPQDAETDTRHAYHLYTLLIDEQRAGISRDAFLEHMTHAGIGVGVHYLSIP
                     EHPYYQQHFGWRPEDYPNAMRIGRQTVSLPLSAKIDDAIAERVIKSVMTTFQN"
     gene            complement(251829..252146)
                     /locus_tag="HNEAP_RS01175"
                     /old_locus_tag="Hneap_0241"
     CDS             complement(251829..252146)
                     /locus_tag="HNEAP_RS01175"
                     /old_locus_tag="Hneap_0241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018284580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600537.1"
                     /translation="MFRFSKLQDSMGQKLFKSILMFLEEDVEDKPFIDILNQLEKLHL
                     IESANDWRTLREDRNELAHQYENEPEPMSAAINRVYERRELLVAIYHRLKSAYSKANG
                     VDS"
     gene            complement(252310..252606)
                     /locus_tag="HNEAP_RS01180"
                     /old_locus_tag="Hneap_0242"
     CDS             complement(252310..252606)
                     /locus_tag="HNEAP_RS01180"
                     /old_locus_tag="Hneap_0242"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase subunit beta"
                     /protein_id="WP_012823141.1"
                     /translation="MRFTHKEASSIKEAFQDVFQEGTILLFGSRVDDNKKGGDIDLYI
                     QLSHPLSPREQLERKAQFKLKLYEALGEQKIDIVIAKDQQRSIEKSALKTGVPL"
     gene            complement(252850..253179)
                     /locus_tag="HNEAP_RS01185"
                     /old_locus_tag="Hneap_0244"
     CDS             complement(252850..253179)
                     /locus_tag="HNEAP_RS01185"
                     /old_locus_tag="Hneap_0244"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_012823143.1"
                     /translation="MTKSDASPSATRYRLKFLPEALDEWNALDGSIKELLRKLLKKRL
                     NEPHTPGAQLHGDLRGCYKIKLRKQGYRLVYSVEDNVLVVLVLAIDKREDMAAYHSAL
                     DRLISGQ"
     gene            complement(253166..253417)
                     /locus_tag="HNEAP_RS01190"
                     /old_locus_tag="Hneap_0245"
     CDS             complement(253166..253417)
                     /locus_tag="HNEAP_RS01190"
                     /old_locus_tag="Hneap_0245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012585652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="WP_012823144.1"
                     /translation="MDAIYADYSISMTEFKKNPAHVLRTAGEKPVAVLNHNRPAFYMV
                     SPKLFEAIAEELSDKNLLELARQRLMRKDSAIEVDIDQI"
     gene            complement(253598..253858)
                     /locus_tag="HNEAP_RS01195"
                     /old_locus_tag="Hneap_0246"
     CDS             complement(253598..253858)
                     /locus_tag="HNEAP_RS01195"
                     /old_locus_tag="Hneap_0246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Txe/YoeB family addiction module toxin"
                     /protein_id="WP_012823145.1"
                     /translation="MKLTFSSKAWDDYLYWQQTDKTILKRINTLIKEIQRDPFDGIGK
                     PEPLKYSLTGYWSRRINDEHRLVYKISNDYLFIAQLCYQYEY"
     gene            complement(253855..254106)
                     /locus_tag="HNEAP_RS01200"
                     /old_locus_tag="Hneap_0247"
     CDS             complement(253855..254106)
                     /locus_tag="HNEAP_RS01200"
                     /old_locus_tag="Hneap_0247"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="WP_012823146.1"
                     /translation="MNAISYTAARANFAKTMEKVCNDHHPIIITRKQEAPVVMISLED
                     YQAMEETAYLLRAPANARRLLESMAELEAGKGTERELIE"
     gene            complement(254253..254816)
                     /locus_tag="HNEAP_RS01205"
                     /old_locus_tag="Hneap_0248"
     CDS             complement(254253..254816)
                     /locus_tag="HNEAP_RS01205"
                     /old_locus_tag="Hneap_0248"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823147.1"
                     /translation="MSTPAAHLPTISVTDYLNGEEHSEIRHEYIDGQVYAMSGASRRH
                     GLIATSLSLLLGPKAREKKCQLFIADMKVRLTISGKDIFYYPDLALNCDPDDRESHYS
                     RTPCLIIEVLSETTERIDRREKMLAYQTLPSLQEYVLVAQDYMQIEIYRRRADWLPEV
                     HTEGTFTIECLDLNTSVAEVYQDIEGF"
     gene            complement(255234..256067)
                     /locus_tag="HNEAP_RS01210"
                     /old_locus_tag="Hneap_0250"
     CDS             complement(255234..256067)
                     /locus_tag="HNEAP_RS01210"
                     /old_locus_tag="Hneap_0250"
                     /EC_number="2.3.1.117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase"
                     /protein_id="WP_012823149.1"
                     /translation="MTDLNALKNTIETAFEDRASITPAEAPQAVRDAVNTVLGMLDAG
                     QLRVAERRGVGDWVVNEWLKKAVLLSFRLNPNEVVQGGDLRYFDKVPTKFANWNQAQF
                     EEAGIRVVPNAVARRGSFIAKGAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNV
                     HLSGGVGIGGVLEPLQASPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTKI
                     YDRETGEVSYGRIPAGSVVVSGNLPSKCGKYSLYCAVIVKKVDAKTLSKVGINALLRD
                     I"
     gene            complement(256158..257315)
                     /locus_tag="HNEAP_RS01215"
                     /old_locus_tag="Hneap_0251"
     CDS             complement(256158..257315)
                     /locus_tag="HNEAP_RS01215"
                     /old_locus_tag="Hneap_0251"
                     /inference="COORDINATES: protein motif:HMM:PF04966.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate porin"
                     /protein_id="WP_012823150.1"
                     /translation="MSRLPSYVTILLIVLVIPPILGSGAWATEFILNRPAPTAASHPL
                     PLDESQIFSLHGHWDTDWVNNLSGGIRRGNALDSVAVGGFTLKGDRLGLPNSVFNFSL
                     MATRVGDANAELIGADTNPSNIEGNRNRLVLNTAFWQQDWLNSPHIGLNTRLGVFDLS
                     AEFDSTDGAAQLLNSSFGLDPTITDNFAASTFPKNGTGLVTSIASAIDPDTAPFALKV
                     GLIQGDVNQQTHPFTQGVLNIAEGQWRPSKGTAIKLGGWQKRGNGLHDLRGGYLSAET
                     PLSSEQHQHISGFIRASFASGMGAQTNGANRYLGAGLNWQAPFAHRPDDYLTLGAATL
                     HLNHGGDHERLLEAAYIMQITPRIFLQPDVQYIQQNNQPDTWVAIVRLHLE"
     gene            complement(257371..258576)
                     /locus_tag="HNEAP_RS01220"
                     /old_locus_tag="Hneap_0252"
     CDS             complement(257371..258576)
                     /locus_tag="HNEAP_RS01220"
                     /old_locus_tag="Hneap_0252"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyldiaminopimelate transaminase"
                     /protein_id="WP_012823151.1"
                     /translation="MNPDLTRLHPYPFEKLAELKAGISPATSDKPIALSIGEPQHAPP
                     AVAMRAMADSLGGLSRYPLTKGERSLRETIGHWLTRRFALEPGLVDPDRHVLPVAGTR
                     EALFSFAQAVVARPEDPAAPRPVVLMPNPFYQIYEGAALLAGAEPYYYPTTSDTDFLP
                     DFAAIPAEIWARAQLIYVCSPGNPSGAVIDRARIKTLFDLADRHDVIIAADECYSEIY
                     FDEDAPPVGFIQAAHELGRSDFNRLVIFHSLSKRSNLPGLRSGFVAGDAEILARYLKY
                     RTYHGCALSLPVQMTSIAAWNDEVHVHENRQHYREKFDAVLDILAPVLPVQRPDAGFY
                     LWTDVGGDERSFARDLFAEQAVTVLPGRFLSRPVESNDPGVGFVRMALVAELIDCVDA
                     AQRIRAFLS"
     gene            258617..259018
                     /locus_tag="HNEAP_RS01225"
                     /old_locus_tag="Hneap_0253"
     CDS             258617..259018
                     /locus_tag="HNEAP_RS01225"
                     /old_locus_tag="Hneap_0253"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005959102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_041600319.1"
                     /translation="MGDGMNQTAAIELLGVDHVSVVVADVNAALPFYRQVLGLRLIDR
                     PELGFPGAWLKLSNGVDLHLLQLPNPDPVANRPAHGGRDRHVALQVRATEPFAQRLAA
                     LNWPFTRSHSGRDALFCRDADGNAWELVARN"
     gene            complement(258946..259941)
                     /locus_tag="HNEAP_RS12110"
                     /old_locus_tag="Hneap_0254"
     CDS             complement(258946..259941)
                     /locus_tag="HNEAP_RS12110"
                     /old_locus_tag="Hneap_0254"
                     /inference="COORDINATES: protein motif:HMM:PF03724.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441076.1"
                     /translation="MRPIASTCPNYSTPTFRMPQSSNRWARIRHPSYSAMPATPRHRR
                     FSSSGNKSIMFWLNFNFSGANMQNKKYLNISAVLVLAVGMFAGLTACSASKPVPPDNH
                     TSQIALDWAGGYYSALAKESNGQPDGAVSLWLAPNGGYRLDLENIKGIPRQSYTGKVK
                     WIEGKEVDLRGAPPEYARWLVQENQLRNATKGWAAKHVPALVAALALPDQWTLTELAG
                     DQSDLTQKPPELTFNMAQRVFGFDGCNRLMGRYQLDADGKLSFKPLAGTRMACMQPTP
                     ERAFLAMLEKVADAKIQGETLEFFAADGKKLAQFRATSSQALPSASRQNNASRPE"
     gene            complement(259763..260527)
                     /locus_tag="HNEAP_RS01235"
                     /old_locus_tag="Hneap_0255"
     CDS             complement(259763..260527)
                     /locus_tag="HNEAP_RS01235"
                     /old_locus_tag="Hneap_0255"
                     /inference="COORDINATES: protein motif:HMM:PF13614.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049772434.1"
                     /translation="MQTAFMAQIIALYSVKGGVGKTASVVNLAALSAMQGRKVLLWDL
                     DPQGSASWYLQAEPESAPKLQQLLKVKSIAEGIRPTLHRNLSVLPSDQRYHDIEHALA
                     EKKDAGFRIAKLLDGLSEYFDEIWIDTPPGITLLGDNVLRAADLVLVPVVPTHLSERT
                     WFQLKSHLASEKIKPGRLAGFLSMVDRRRSLHRDFYAAHRIDMPELFDADIPYAAIIE
                     QMGEDQTPVVFSHARHPAAQAFFKLWKQIDHVLAKF"
     gene            complement(260589..262061)
                     /locus_tag="HNEAP_RS01240"
                     /old_locus_tag="Hneap_0256"
     CDS             complement(260589..262061)
                     /locus_tag="HNEAP_RS01240"
                     /old_locus_tag="Hneap_0256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(I)"
                     /protein_id="WP_012823155.1"
                     /translation="MMTLNPSQQSSKNAAKIWVVDDDHSIRWVLERALKSAGFTVESF
                     ESAAMLRARLRTSTPDVLFSDIRMPGEDGLSLLSSLQNSHPELPIIIITAHSDLDSAV
                     GAFEGGAFDYLPKPFDIDDAVRLAQRALSSRQPQAAETTAEASTTADAQTDLIGNAPA
                     MQEIFRAIGRLARSNVTVLINGESGTGKELVARALHQHSLRRQGPFVALNTAAIPKDL
                     LESELFGHEKGAFTGAAGQRVGRFEQAHGGTLFLDEIGDMPMDLQTRLLRVLADGQFY
                     RVGGTQLIRTDVRIVAATHQRLEDRVASGQFREDLFHRLNVIRLKLPALRERREDIPQ
                     LLRFFLQRAAQELGVPIKSIHQQALAQLARYDWPGNVRELENTARWLTVMAPGHEIGI
                     EDLPDNLHQSSTPGAALGDDALLTQWTGDLKRWADARLAAGDQDLLAIAGPAFERTLL
                     KAALHFTGGHKQQAAALIGWGRNTVTRKLKELADIDDDTE"
     gene            complement(262058..263335)
                     /locus_tag="HNEAP_RS01245"
                     /old_locus_tag="Hneap_0257"
     CDS             complement(262058..263335)
                     /locus_tag="HNEAP_RS01245"
                     /old_locus_tag="Hneap_0257"
                     /inference="COORDINATES: protein motif:HMM:PF02518.24"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441077.1"
                     /translation="MPIKKPNDLKRISKVFYTNSAVSACSLRYAFSLNQQWARARGVD
                     VTKPEIKMPIRTARLADALTTAIVVLDAQDKLLYINSAGEQFWDVSYGVLLKQGFAPF
                     FEQNPILAKAVAEARLTEQVVTLREAELVSIHGQTHIADCAITPSPDISGADILLELA
                     DIERHMRITRDAQLHAMQISTRQLVRGLAHELKNPLGGLQGAAQLLERELPNADLREF
                     TQIILNESSRLKNLIDRMLGPNNRPQMQRINIHEPLEQVRRLLSIEAEETLLQEPLQW
                     HFDFDPSIPDVLADRDQLIQVLLNLSRNALQAMSENDTNNPTLRFKTRVLRRFTIHQT
                     LHRLVLRIDVENNGPPVPDTLVESLFLPMVSGRAHGSGLGLSIAQTIAEQHQGLIEFK
                     QKPGAVRFSLILPLSQSLPGQDTQGQHHQETPP"
     gene            complement(263446..264177)
                     /locus_tag="HNEAP_RS01250"
                     /old_locus_tag="Hneap_0258"
     CDS             complement(263446..264177)
                     /locus_tag="HNEAP_RS01250"
                     /old_locus_tag="Hneap_0258"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4124 domain-containing protein"
                     /protein_id="WP_041600321.1"
                     /translation="MAAEAETIYKYTNSKGEVVFTDQPTKGAQKLNIIPPPVIPLTPI
                     NLPPTTTPATESVKPATNTEASKSPAPLIPSLQMQPPGSSSTADTNPSKPAAANPPEY
                     NQITPAPAKTTTNAPQIIRQSLPETQPSSPAIPPQERNGHYQSLIITEPKAGPVTARD
                     GGTIFVQTKLSPVLDQSVGDRMRIVIDGNIRVDDSTGQRFMISDLTPGTHAIIAIVMR
                     KGKNIFQSNPVVIDLKQGTDGNAQK"
     gene            complement(264454..265569)
                     /locus_tag="HNEAP_RS01255"
                     /old_locus_tag="Hneap_0259"
     CDS             complement(264454..265569)
                     /locus_tag="HNEAP_RS01255"
                     /old_locus_tag="Hneap_0259"
                     /EC_number="4.1.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide
                     synthase"
                     /protein_id="WP_012823158.1"
                     /translation="MRTPSPDPTPDQAHIGVIGAGQLGQMLALSGISLGLSFTFLDPS
                     AQAPAGRLGRHIQAEYDDELALEQLAVECDAITLEFENVPVSAVASIARHNQIHPGER
                     PLSIAQDRVHEKRFFESLGIPVAKYHAIDSFEDLKSAVADLGYPCILKTRRLGYDGKG
                     QVVVRHSDDLEPAWASIRGNPSILEQMIPFTREVSIISVRSTRGECAFYPVSENQHRS
                     GILHRTEIHMDDPAQERAEEYARHVLDGLDYVGVLAIEFFEHQGRLVANEMAPRVHNS
                     GHWSQNGAVTSQFENHLRAILGWPLGSTACTGHSIMINLVGIIPPRAPILALPGVHLH
                     DYGKEPRTGRKLGHINIVADTKESCRKYATLIEQMIG"
     gene            complement(265585..266127)
                     /locus_tag="HNEAP_RS01260"
                     /old_locus_tag="Hneap_0260"
     CDS             complement(265585..266127)
                     /locus_tag="HNEAP_RS01260"
                     /old_locus_tag="Hneap_0260"
                     /EC_number="4.1.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide mutase"
                     /protein_id="WP_012823159.1"
                     /translation="MSEQPLAPIAPNHPSPLVGVVMGSRSDWETMQHACATLTTLQIP
                     FEAEVVSAHRTPDRLFQYAETAIERGLRVIIGGAGGAAHLPGMLAAKTRLPVLGVPVQ
                     SKSLSGWDSMLSIVQMPAGIPVGTLAIGRAGAVNAALLAAAQLAVHDADLAQRLDAYR
                     HAQTKTVLAGTDPRTPPPSF"
     gene            complement(266124..266582)
                     /locus_tag="HNEAP_RS01265"
                     /old_locus_tag="Hneap_0261"
     CDS             complement(266124..266582)
                     /locus_tag="HNEAP_RS01265"
                     /old_locus_tag="Hneap_0261"
                     /inference="COORDINATES: protein motif:HMM:PF04247.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441078.1"
                     /translation="MVCLFSRTAGARMTIAQISVHIHGLAVVLSLIGFILRGIWMLKD
                     SPRLKARWVKITPHIVDTVLLVSALIASYLMFWRYGVNPDYVTVMIVGLIVYIVLGLF
                     ALRLGKTKAIRASAWVLAIAVFLYISAAGTLKTATPFLSAPTTTASVSAR"
     gene            complement(266669..267649)
                     /locus_tag="HNEAP_RS01270"
                     /old_locus_tag="Hneap_0262"
     CDS             complement(266669..267649)
                     /locus_tag="HNEAP_RS01270"
                     /old_locus_tag="Hneap_0262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_012823161.1"
                     /translation="MSESSTADNAHSRLAHMPISMFGMVMGMAGFAIAMHKGEQLVQW
                     SHATSTIFTYVTFGLFGILALAYLAKFVKYPGEVRAEFNHVVRLSFFPAISINLILLS
                     IIALSFNKTLALWLWSIGTPLQLLFTLIILSNWIHHEKFQIHHSNPAWFIPIVGNILV
                     PITGAALGYIQISWFFFSIGVIFWIVLLTILMNRYFFHAPTPSKLMPTLFIMIAPPAV
                     GFISWHALHPSGLDDMGHILYNFALFITLLLFFQAKRFVTIPFGLPFWAYTFPIAAMT
                     IATLIMHQITGLIFYAYLGGFLFVFLTLLIAYLLVKTARAMWAGEICVPE"
     gene            267796..268461
                     /locus_tag="HNEAP_RS01275"
                     /old_locus_tag="Hneap_0263"
     CDS             267796..268461
                     /locus_tag="HNEAP_RS01275"
                     /old_locus_tag="Hneap_0263"
                     /inference="COORDINATES: protein motif:HMM:PF01891.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein"
                     /protein_id="WP_012823162.1"
                     /translation="MNVPDGLISSDLLWLNWLLFIALMGLGVYRSPWRALLHAPQRLN
                     LIAASVVFLAMLWLFSSSALPGLSLHFLGLTVVTLVVGWPLALVVGGVTLLLLSLAGQ
                     MAFSGIGLDMLGMVVPPVLVTALINAGAQKLLPANYFIYLFVNSFLSAILGAMAAALA
                     SASLMLVFGIYTWDVLTSSYFPLLPIQWVPEAMINTMIILGLTLLRPDWVITFDDQRY
                     FKN"
     gene            268701..269039
                     /locus_tag="HNEAP_RS01280"
                     /old_locus_tag="Hneap_0264"
     CDS             268701..269039
                     /locus_tag="HNEAP_RS01280"
                     /old_locus_tag="Hneap_0264"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018232685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c554"
                     /protein_id="WP_012823163.1"
                     /translation="MKKLTVLMLAAGLMTSGAAMAAGDAAAGKTLYDASCASCHGMQA
                     QGQGMFPKLAGLTSERIKTTLVAFKSGDTATLKKEGLGGPNSAIMAPNAAGLSEQDMD
                     NLSAYIATLK"
     gene            complement(269152..270015)
                     /locus_tag="HNEAP_RS01285"
                     /old_locus_tag="Hneap_0265"
     CDS             complement(269152..270015)
                     /locus_tag="HNEAP_RS01285"
                     /old_locus_tag="Hneap_0265"
                     /inference="COORDINATES: protein motif:HMM:TIGR02135"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transport system regulatory protein
                     PhoU"
                     /protein_id="WP_081441079.1"
                     /translation="MLIADGRGQNTNSSTVLPTCVIMTVIGDISVKCSLRQTFSYILM
                     FFWRVFMDSYNGTPHTLTRYDEDINALRTMLMNMGGVAEQHFADALAYLLDGDAERGA
                     RALKQDYEINRMESSIDELAIQIIARYSPMANDLRTIMSVVKAITDLERIGDKSEKMA
                     RIAEEIGPILRHTDFIGHLRVMGRIVGGMMHDALDAFIRLDAIAAEEIIRRDTHVNEE
                     YNAVHRVLLKYMNENPNSADVGLRILSCMRAIERVGDHCTNIAEYVIFQQKGDDVRHS
                     NISKEKQRTQI"
     gene            270053..272128
                     /locus_tag="HNEAP_RS01290"
                     /old_locus_tag="Hneap_0266"
     CDS             270053..272128
                     /locus_tag="HNEAP_RS01290"
                     /old_locus_tag="Hneap_0266"
                     /EC_number="2.7.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA degradosome polyphosphate kinase"
                     /protein_id="WP_012823165.1"
                     /translation="MTETSLTPVAPVFINRELSLIAFNRRVLELAQDVSLPLLERLKF
                     LCISSSNLDELFEVRIGSLTQQIRVGLNRPDDSGLTPGEQLDQVYTAAHSLVADQYHT
                     LNDEVIPALAEEGIHFLRRTHWNEAQSLWVKQFFRRELLPLLTPLGLDPSHPFPRILN
                     KSLNFVVSLEGTDDYGREAWMAIVQAPRALPRIIRMDEEASGTSSSFVFLSSIIHAHV
                     HELFPGMTVTGCYQFRVTRNSDLAVAVDDDDDLLKTLQGGLFERNYGDAVRLEVADNC
                     PQEMIDFLCDRFKLNNQAVFQVHGPVNLNRLMALYGLVNRPDLKDEPFTPKLKKEFSS
                     EANIFETIEQRGAVLLHHPYESFMPVVEFVRQAASDPKVVAIKMTLYRTGRDSAIVDA
                     LEAAARAGKEVTAVVELRARFDEEANIDITTRLQKAGAYVAYGIVGYKTHAKMTLVLR
                     RDGSRLKRFVHMGTGNYHPGTARIYTDFGLLTDDRFLGDDVNKLFMQLTGLGRGMRLK
                     RILQSPFTLHSGMLDRIEREIEHAQAGRKALIRAKMNALIDRQIIEALYRASQAGVQI
                     DLIIRGVCCIQPGIAGLSENIRVRSVMGRFLEHPRVFYFLNDGDDELFLSSADWMPRN
                     FFVRVETCFPIDAPEIKARVINEAFERYLADNTGAWSLEADGQYHRVKRHHNAKPRSA
                     QQSLLDDLT"
     gene            complement(272175..273347)
                     /locus_tag="HNEAP_RS01295"
                     /old_locus_tag="Hneap_0267"
     CDS             complement(272175..273347)
                     /locus_tag="HNEAP_RS01295"
                     /old_locus_tag="Hneap_0267"
                     /EC_number="2.7.2.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate 5-kinase"
                     /protein_id="WP_012823166.1"
                     /translation="MVERDANPAMGVDTGVDLRAHLKTDRRWVIKIGSAMVTGNGAGL
                     DLSAIDRWAEQIAAMRAEGREVVIVTSGAVAEGMARLGWPERPSALPELQAAAAVGQM
                     GLVQAYADVLLRHGIHTAQILLTHDDLSNRQRYLNARSTLRTLLDLGVVPVVNENDTV
                     ATDEIRFGDNDTLAALVANLVEADVLVILTDQLGLFDADPRKNPSARLLTEVTAGDPA
                     LETMASPEGGRLGRGGMYTKVMAAKRAAQSGAATVVASGATPHVLLQLAAGTSGVGTV
                     FQPAQTRLAARKQWLAGQLRARGTVRVDTGAAAALRQGGRSLLPIGVLEVTGEFTRGD
                     LVRIVDEAGTDLGRGLINYGSTHAKRLCRQPSNAIAELLGFAEEDELIHRDNLILL"
     gene            complement(273354..274481)
                     /gene="obgE"
                     /locus_tag="HNEAP_RS01300"
                     /old_locus_tag="Hneap_0268"
     CDS             complement(273354..274481)
                     /gene="obgE"
                     /locus_tag="HNEAP_RS01300"
                     /old_locus_tag="Hneap_0268"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823167.1"
                     /note="ObgE; essential GTPase; exhibits high exchange rate
                     for GTP/GDP; associates with 50S ribosomal subunit;
                     involved in regulation of chromosomal replication; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase Obg"
                     /protein_id="WP_012823167.1"
                     /translation="MKFVDEAKVKVKAGDGGNGVIGFRREKYVPYGGPDGGDGGDGGS
                     VYFLGDANLNTLADFRFVRHYEAQRGENGSGSNMTGAKGADLWVRVPLGTVVHDIDTG
                     EILGEVLDPAQPLLVAQGGWHGLGNARFKSSTNRAPRQKTEGTPGDERRLLLELRVLA
                     DVGLLGMPNAGKSTLIRAISQAKPKVADYPFTTLHPNLGVVAPEPHRSFVVADIPGLI
                     EGAAEGAGLGHQFLRHLARTNLLLHIVDVAPLDEADPIESVAIIEEELVRYDESHQTH
                     SAERPRWLILNKIDQWLEEERSEQINLLTQRFRHELDFKGPIFAISALEKQGTTALVW
                     AIMEFMEAARAADQAAAAEAAKAPVVPPAKFDNPDLEWTEE"
     gene            complement(274634..274891)
                     /locus_tag="HNEAP_RS01305"
                     /old_locus_tag="Hneap_0269"
     CDS             complement(274634..274891)
                     /locus_tag="HNEAP_RS01305"
                     /old_locus_tag="Hneap_0269"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="WP_012823168.1"
                     /translation="MAHKKAAGSTRNGRDSESKRLGVKRYGGQVISAGSIIVRQRGTQ
                     FHPGANVGCGRDYTLFALTDGAVKFEVKGDKSRRFVSIVPV"
     gene            complement(274945..275256)
                     /locus_tag="HNEAP_RS01310"
                     /old_locus_tag="Hneap_0270"
     CDS             complement(274945..275256)
                     /locus_tag="HNEAP_RS01310"
                     /old_locus_tag="Hneap_0270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008940795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="WP_012823169.1"
                     /translation="MYAVVVTGGKQYRVEPGEWLRVEKLEGEEGSAVTLDRVLMIADG
                     DAIKVGAPALAGASVTAEIIGQGRGKKVDIIKFRRRKHHRKHQGHRQAYTEIKITSIN
                     G"
     gene            275500..275892
                     /locus_tag="HNEAP_RS01315"
                     /old_locus_tag="Hneap_0271"
     CDS             275500..275892
                     /locus_tag="HNEAP_RS01315"
                     /old_locus_tag="Hneap_0271"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600322.1"
                     /translation="MLLLAVWLPLDNALAGAVVQGCPMMSHAFERGLHTTFMPNADQS
                     TSDGATDAPHCPMMHMATDNTSSSSGHDQCSNGCTHCGLCLLLGGVALQLNAPAIPVT
                     PVLPHKIISSLPATHTSVSAPLFRPPIA"
     gene            276080..278050
                     /locus_tag="HNEAP_RS01320"
                     /old_locus_tag="Hneap_0272"
     CDS             276080..278050
                     /locus_tag="HNEAP_RS01320"
                     /old_locus_tag="Hneap_0272"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper oxidase"
                     /protein_id="WP_012823171.1"
                     /translation="MPIKSAFQANTRPINSSRRIFIQGLVAGGVMAALGLNPAEAATI
                     NGRRQPPSLRGTEFDLVIDERPVNFTGQPRTAMTINGSIPGPTLRWREGDVVTLRVTN
                     RLKVSTSLHWHGIILPFEMDGVPGLTYEGIAPGTTFTYRFRVAQSGTYWYHSHTGFQE
                     QNAVYGAIVIDPAQSDRVAYDQDHVVMLNDWTDASPDFIFNRLKTADGYYNYVKPDLM
                     DLIRQSEKMGFGKAVEDRLMWDKMRMSPRDLLDVTGATYTYLMNGNTPAGDWTALFRP
                     GERIRLRFINGSSMSYFDVRIPGLKMTVVAADGQDVHPVTVDEFRIGVAEIYDVIVEP
                     VADQAYCIFAQSLDRSGYARGTLTPHVDLRAPIPPMDPVPTLSMADMGMAMSGMDMGD
                     TDMSAMHMGNHAKDNSGVGSMGGMDMSQQKPMAGMTHDQTSQHGTSGMKMDNHAMKGM
                     ADRQPDGAAHGAMSHNPMDLPGLHNRNLKDGTLKIDWHPKTEHGVGVGMRAQQVSMSL
                     SDPGAGLRNNGRKVLTYGDLRGIDGPISQQEPARGIELHLTGNMDRYIWGFNGVSYRD
                     AAPIELKYGETVRIVLINDTMMNHPIHLHGMWSELENDRGEYLARKHTLSVAPGHAIS
                     YRVNANAIGRWAYHCHLLYHMNAGMFREVRVV"
     gene            278073..278897
                     /locus_tag="HNEAP_RS01325"
     CDS             278073..278897
                     /locus_tag="HNEAP_RS01325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance protein B"
                     /protein_id="WP_012823172.1"
                     /translation="MKTIPTFLPPVATLLLAVTTSLAQAAGYETSANNSGHYQAPSLA
                     QQRADVAAMVAQSARHETHSPLIYKVMIDRLERDFGNKGNYSQFEGQAYIGTDTNKLW
                     LKGEGKRLGGKTEDADIEAYYSHAIAAFWDAQIGMRHDFSAGSIPSRNWLGFGVQGLA
                     PYKFDTSATAYVGNEGRTALRLSSEYDFFITQRLIFWPGVELNLYGKNDPERNIGRGL
                     ADSRLVLRLRYEIRREIAPYVGIQWTNKYGQTASYARTNGEATSDMQLIAGLRLWW"
     gene            279022..279285
                     /locus_tag="HNEAP_RS01330"
                     /old_locus_tag="Hneap_0274"
     CDS             279022..279285
                     /locus_tag="HNEAP_RS01330"
                     /old_locus_tag="Hneap_0274"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006091357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823173.1"
                     /translation="MPFFNEHWGMGAGFGGFGLIFMLLGVVVMALVVFAILRLLTGSN
                     RPGPTDREDRRALSILEKRFANGEIDEAEYNERRRILEGRDRS"
     gene            279331..281040
                     /locus_tag="HNEAP_RS01335"
                     /old_locus_tag="Hneap_0275"
     CDS             279331..281040
                     /locus_tag="HNEAP_RS01335"
                     /old_locus_tag="Hneap_0275"
                     /EC_number="1.3.3.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bilirubin oxidase"
                     /protein_id="WP_012823174.1"
                     /translation="MSHDFSNKYPNKPVPAAQQDMAIDSPKRRHALKTLVQGAATVLT
                     GVALTEQITTSAQAQAMGMMGGMMGGMPGQNQSASISSGLFTHPMPIPPQLKGEADSS
                     GVRTYALNVMAGQHSELVPGLKTATWGYNGAILGPTIRVPQGKPVRFDISNGLDQSTT
                     VHWHGAHVPGHADGGPHNLIAAGKQTSVSFSLNQPAATLWYHPHPDGRTGPQVYAGLA
                     GFLLVDDGLDARLGMPHTYGVDDFPVVIQDRRITETGQLDYMDSMMDIMGMKGDRFLV
                     NGVEQPFVAVPGQWIRLRLLNGSNARIYNLCFADERPFHVVASDAGLLEQPVKRTELV
                     LAPAERAEIMVDLNDMQGKKLVLRSDSAKVIPGLNRMPMATDGYDKGRFDLLEFRVGA
                     PTAKTGHLPERMASIPTLKADAPIRKFTLQDMNMGKMRRMMMGGGLQSDNKSTGPGGM
                     SMGIGGRHLFSINDQYMNPKVINERVKLGSTEIWHVANDGMMAHPFHIHGISFQVLSR
                     DGAQPPAYERGWKDVVLVHSGQTVQLIARFDQPAGDDHPFMYHCHILEHEDNGMMGQF
                     TVS"
     gene            281191..282558
                     /locus_tag="HNEAP_RS01340"
                     /old_locus_tag="Hneap_0276"
     CDS             281191..282558
                     /locus_tag="HNEAP_RS01340"
                     /old_locus_tag="Hneap_0276"
                     /inference="COORDINATES: protein motif:HMM:PF02321.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441080.1"
                     /translation="MLGVLIMPFLSPSPWCLTRWVLTRSLMPIQHSLRTLGMLLIVIL
                     ALSGLAQAGQNTSGRSEQPVFSISPDATLSLQEAEQLAVQNDQGLAAAVATESAETSS
                     AKAADQLPDPEISLGVSSLPLDTFSFTQTPMTTTEVSISQSLPPGDTLAQRALAADAK
                     IQAATANIAVQQQILRREVGRFWLTVYRDQQTLALLAQEKSLYQRLLRSAQTAYSTGR
                     ARATDLVRLQVRLAELDDRIDRQRGSTAATKARLARWIGARAQQDWPTALPSALTTLP
                     EGSVEHQPEIKALQANLAEARAQTGEARAAFKPKFGVSLGYGIKAGNQPDTVSVGVSM
                     SLPLFTGERQAPLLAAAQKRQQARQLALESRAADFHAEAQSLNADVDSLTSRIDRYDR
                     QILPKLRQVATLAQNQFGSGSGDFTAIIDAEQAEITGRQQRLDLTIDRAQRLIDLRYL
                     LENPA"
     gene            282555..284438
                     /locus_tag="HNEAP_RS12115"
                     /old_locus_tag="Hneap_0277"
     CDS             282555..284438
                     /locus_tag="HNEAP_RS12115"
                     /old_locus_tag="Hneap_0277"
                     /inference="COORDINATES: protein motif:HMM:PF16576.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="WP_012823176.1"
                     /translation="MKSSKNKIRLIAVVSTGMAAGAGALIWAHTPINFIRPVLAEATQ
                     SPSASSSQGDQTHKATTAGTDAKFVTKYTCPMHPQIIEDHPGTCPICGMDLVAKQFPA
                     KSSDQSAAPASADTSHDHAGHAAATAAPSSSGPKAEKSTSDAKFVTKYTCPMHPQIIE
                     DHPGTCPICGMDLVAKQFPAKSSDQSAAPASADASHDHAGHTETAATAAPSSSGPKAE
                     KSASDAKFVTKYTCPMHPQIIEDHPGNCPICGMTLVPKLFPAGTKDNTGSAAAKTEQT
                     APAPVASNSAPLPEVAVPQRTLRDMNVVMARAQWRNLTRQIHSVGLVALDENRLSHVH
                     PRASGWVETLNVRALGDTVKKGETLLTVYSPDILSAEKDFLVAQKSGMSEMRDAARDR
                     LRLLNVPESVIEQIARTGKVARTIPVLAPQSGYISVINLRDGMYVTPNLDMFTIADAS
                     KIWVQVEVLPRDMEQVAVGQPAEMTVDGVPGRVWKGTVDFIYPELDPKSRTLKVRLVF
                     DNPDGVLKPNQFAEVGIRGVAQADVLTVPTTAVIPTPQGARVVRKNADGSFQPVRVEV
                     GQSADGWTQITAGLSPDDTVVASGQFLIDSESAIQASFARMTGTAQPADDAAPAASGH
                     HNH"
     gene            284451..287723
                     /locus_tag="HNEAP_RS01350"
                     /old_locus_tag="Hneap_0278"
     CDS             284451..287723
                     /locus_tag="HNEAP_RS01350"
                     /old_locus_tag="Hneap_0278"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_012823177.1"
                     /translation="MLKAVIDASINNRVLVLLLAAILAVVGWYSWKATPLDAIPDLSD
                     TQVIIKTTYPGQSPQVVQDQVTYPLTTALLAVPGSTAVRGYSFYGDSYIYVTFKDGTN
                     LYWARSRVLEYLNQARSSLPAGVEPQLGPDATGVGWVYEYALTDPSGQMNLSQLTTLQ
                     NWFLKFQLQTVSGVSEVATVGGMVREYQIVVDPDRLRAFGVSLATLRKAVADANKEVG
                     GGVLELGGAEYMVTSRGYLKSVADIERIPVGVTQSGTPILVRDLGTVRLGPAPRRGVA
                     DLDGKGEVVGGIIVMRSGENARQVIDAVKTKIEHLKPSLPKGVEIVPVYDRSGVINRA
                     VDTLSSKLVEEFLVVALVCAIFLWHLRSALVAIIGLPLGVLMAFIVMHAQGINANIMS
                     LGGIAIAIGAMVDAAIVMIENAHRHLVAWRETHGSPPKGDDHWRLIAQSAGEVGPALF
                     FSLLIITLSFIPVFTLQAQEGRMFAPLAFTKTYAMAAAAGLAITLIPVLMGYFIRGRI
                     PREEANPLNRFLIALYRPVLHTVLRFPKTLMAISLIFVLSAVLPLAGVGGYLAPLKWV
                     GSSAWQLHVSDWQNDWAKRWASTFSFAPKIAELGRGLGSEFMPTLDEGDLLYMPTTAP
                     GLSIGDARLLLQQVDALIAEEPVVKSVFGKIGRADTATDPAPLTMIETTIQFKPKSEW
                     PAGMTLQKVIDNLNQKIQFPGLNNAWVMPIKTRIDMQTTGIQTPVGVKITGPDLHQID
                     RIGKQVEAVLQTVPGTQTAYADRTNGGRYIEITPDRIKAARFGLNIGEIQDVISSAVG
                     GVEVTQTVEGLERFPVSIRYPRADRDSVSKLKDLPIVTPTGATVALGQIATVQVTDGP
                     PMIRSEDSRPAGFVFVTTQGVDLGSYVNNARRIVDAKVKLPPGYAISWTGQYQYLQRA
                     TERLKQVVPLTLAIIFVLLFLIFRHGGKASLIMVTLPFALVGGFWLLWALGFELSIAV
                     AVGFIALAGVAAEFGVVMLIYLDHAIEDRRRAGRLNTRTDLRDAIMEGAVLRVRPKAM
                     TVAVILAGLIPILVGHGTGSEVMSRIAAPMIGGMITAPLLSMLLLPAVYWLWQRRHLP
                     AG"
     gene            287821..288228
                     /locus_tag="HNEAP_RS01355"
                     /old_locus_tag="Hneap_0279"
     CDS             287821..288228
                     /locus_tag="HNEAP_RS01355"
                     /old_locus_tag="Hneap_0279"
                     /inference="COORDINATES: protein motif:HMM:PF14229.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823178.1"
                     /translation="MATAINGLRGMTDAMLQECKAQGIKDVDQLTDALASPAARKQWA
                     DKLGETTQDVLAIANRADLSRINGVGGVFSDLLEASGVDTVKELAHRRPDNLHEKMAQ
                     VNADKTLATRTPTEAECAEWVEQAKALGGKITY"
     gene            complement(288319..288597)
                     /locus_tag="HNEAP_RS01360"
                     /old_locus_tag="Hneap_0280"
     CDS             complement(288319..288597)
                     /locus_tag="HNEAP_RS01360"
                     /old_locus_tag="Hneap_0280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823179.1"
                     /translation="MSFALKQTRRFARAYKKLHDQVAADVDIAAAVVAANPSVGERKK
                     GDLADLFVYKFHSHNQLYLLGYTLDEAVRLIYLEAIGPHENFYRDIKR"
     gene            complement(288597..288824)
                     /locus_tag="HNEAP_RS01365"
                     /old_locus_tag="Hneap_0281"
     CDS             complement(288597..288824)
                     /locus_tag="HNEAP_RS01365"
                     /old_locus_tag="Hneap_0281"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823180.1"
                     /translation="MTSTSIRIDQTLYEQARSEALTEHRSIAGQVEYWAKVGRAALDN
                     PDLPVSFIAESLVSLAEPREEATAFIPRKSC"
     gene            complement(288905..289603)
                     /locus_tag="HNEAP_RS01370"
                     /old_locus_tag="Hneap_0282"
     CDS             complement(288905..289603)
                     /locus_tag="HNEAP_RS01370"
                     /old_locus_tag="Hneap_0282"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012823181.1"
                     /translation="MPADMTFWAALLVGFFGGVHCIGMCGGIVGALTFGLPPEKRATP
                     GQLLPYLLAYNLARISSYVIAGAIAGLIGAFGLSLIPMQHAQLYLLMVAGGFMVLMGL
                     YVGGWWFGLTRIERVGSRLWRYIEPLGRRLMPVKTPKQALLLGFVWGWLPCGLVYSVL
                     IWALSAGSATQGALLMLGFGLGTLPNLLLMGAFAAQLSALTRKKWVRWIAGGAVLGFG
                     LYTIGSAIWNIQVS"
     gene            289695..293879
                     /locus_tag="HNEAP_RS01375"
                     /old_locus_tag="Hneap_0283"
     CDS             289695..293879
                     /locus_tag="HNEAP_RS01375"
                     /old_locus_tag="Hneap_0283"
                     /inference="COORDINATES: protein motif:HMM:TIGR01967"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_012823182.1"
                     /translation="MNSTLNEPQDAAAPQSAPLSTEPADIIDFLRANLAELPLVDQPA
                     LSRRLAGAERALQQNRLDAGRLAELVTAFEASAALLTERRSAELNIDYPAELPVSGQR
                     EAIMDLIRAHPVVIVAGETGSGKTTQLPKMLLELGFGVKGQIGHTQPRRIAARNVASR
                     LAEELGVTGAGVVGYKVRFSDQTRASSRVAVMTDGILLAEIHSDPDLLRYDALIIDEA
                     HERSLNIDFLLGIVRRLLDRRPDFRLVITSATIDTARFARHFAGTDASGEPQPAPVIT
                     VAGRSFPVEYRYRSLTAPQNDNDTETEEERDLPAAVVAAVDELHAEAQTTGGGDILVF
                     LPGEREIRECAHRLGRHGLRHTEILPLFARLSAAEQQRIFAQHTGRRIVLTTNVAETS
                     LTVPGILYVIDSGLARIARYSPRSRVQKLAVEAISQASANQRAGRCGRIAPGVCIRLF
                     DEADYAGRPAFTDPEILRTNLASVVLRMIELRLGEPEHFPFIEPPDSRQLAGARRLLF
                     ELGALDERQRITPLGRQLARLPVDPTLGRMVLSNLSKADATSVDILIVVAFLSIQDPR
                     ERPADHAQAADQAQQAFRLADSDFAGILALWDQWHTVVRHENQRKRRDWAKKHFLSYN
                     RLLEWHDLFGQLREQADEIGRVKLPDPLPLPVMTDGDEAPLRARLDALHQAMLPGLLA
                     QIGLRDEATRTDKNTPKDSRDQRGKKQRTPTIYIGANNRRFQIFPGSQLAKTQPKWLM
                     SAEIVETTRVYARMNATINPRWIEDMAAHLTTREYSEPRWDQRGGRVAAFETVKLFGL
                     PIVTKRRIDFGRIDPLGARAIFIRAALVEGEFDSGLKFWRHNQALIDEIREIEARNRR
                     PDLLIDDQTLFDFYETHLPAEVYDAHTLVRWLKTITPKQPDVLCMTRDDLLAREPVEL
                     DPAGFPDRLSMGAFSLPLAYHFAPGSADDGVTLRLPLAALKQIDADRASHLIPGLRRE
                     KIEALIRSLPKADRRHFVPAPEFAASVNERVSVDRGGLPAQVAEQLARMTGHKITADA
                     FDERRLEPHLRMRFALIDAKQTDPDKQIIDADRDLSALRARHAAAAERALVERTRHRL
                     ERDDLIDWSFGELPESLTVEELGAELTAYPALIDQGDCAEVRLFDAPERAVLAHRSGV
                     VRLMLIALGEQIRHLSQYLKQERSLDPARLQYSQWSNTRPLPAFGLTLPQRRDAAFDQ
                     ALIARSIAKLAVDALPFIRDESTFRARVERLKPQLDDTVRRLAAQIRTIFAQHQALRA
                     KLKGRLPLSQIEAAREIAEQFDLLFYPGMIWNTPQTLLDNLPRYLTAAEKRLEKIDRH
                     PERDRMLRVQFMPVCARVTDKITATAPTPEAFAALNQLHEQLEEWRVATFAQELARKG
                     APGAKEIEQAIKQLSH"
     gene            294221..295990
                     /locus_tag="HNEAP_RS01380"
                     /old_locus_tag="Hneap_0284"
     CDS             294221..295990
                     /locus_tag="HNEAP_RS01380"
                     /old_locus_tag="Hneap_0284"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823183.1"
                     /translation="MNQEWILQTKETRRAFSNATWVPLRASINDEKGNVKNIGYISEY
                     FGCGSAAFPPENRKLVEERLGWSDIGIGHTVAPYAYEDGYYASIDQFQYNDKEPIGVN
                     LVFEHPQPVVGGKQLILNPDLVVALRLIKEGTNWVRPEENFVVVARESFDDKGEHRLI
                     EIKREFLVDYLAARNLSLRLSYYRQRVENVPLLKGSEYANLKEHREERDGGRFELLIR
                     GINDVFGGGWAMFRAWRTDVDEDEDAPVMGPEDDHNTDHESSKGHRGGYEGVRVEGEF
                     WRDEWVEHQSQSIRVRGDTDINLPQFIAETDGKRMSSSELDNEDIGRWLWFRSSVVTD
                     LLGHRGFALKWYTAETGAICSTSGYATHFGINSADLLTVYAYDIARLPAWEQHIWAAH
                     NVAPDGKVSGELLSAQVKTEPASTHAVEEMLFGSMRLLEQGFRDKFGIDLFSHDIDDE
                     SAMQQISRFHSRDQASLLRLAKELVRVFSDRLNISDLRKLSTHAEKERLGSNKLLQDV
                     LSQKVGADKARQVFAEIAGAYDMRVGDAHPTGSKVADAIKLAGIDQSRSHLRQGEQLI
                     HNFGRAVWFIGKCLFGQPEPRES"
     gene            296366..296713
                     /locus_tag="HNEAP_RS01385"
                     /old_locus_tag="Hneap_0285"
     CDS             296366..296713
                     /locus_tag="HNEAP_RS01385"
                     /old_locus_tag="Hneap_0285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009705214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823184.1"
                     /translation="MAFSEFELKKHEKMLKAYIEKHRPPAHIRNEIDLGYRQAGQSVE
                     IFEIRSRWDNPKEKMENPVAKATYVKTQDIWKIYWQRADQKWHSYVPHPTVKSLEAFL
                     KVVEDDECACFYG"
     gene            complement(296954..297256)
                     /locus_tag="HNEAP_RS01390"
                     /old_locus_tag="Hneap_0286"
     CDS             complement(296954..297256)
                     /locus_tag="HNEAP_RS01390"
                     /old_locus_tag="Hneap_0286"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein ParE"
                     /protein_id="WP_012823185.1"
                     /translation="MGKFSLSHSAKADLRGIARFTEKHWGRAQRLHYLKGLDETFKIL
                     ADSPTLGNACDYIETGVRKYPFQSHVVFYECLSNEEILVVRMLHKNMDVHQAVFPA"
     gene            complement(297256..297495)
                     /locus_tag="HNEAP_RS01395"
                     /old_locus_tag="Hneap_0287"
     CDS             complement(297256..297495)
                     /locus_tag="HNEAP_RS01395"
                     /old_locus_tag="Hneap_0287"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin"
                     /protein_id="WP_012823186.1"
                     /translation="MAKNTSVSLGNHFDQFIAAQLSKGRYGSATEVVRAGLRLLENEE
                     QKLETLRQLIAEGRASGTAEYNYEKFMAELDNELS"
     gene            complement(297650..298324)
                     /locus_tag="HNEAP_RS01400"
                     /old_locus_tag="Hneap_0288"
     CDS             complement(297650..298324)
                     /locus_tag="HNEAP_RS01400"
                     /old_locus_tag="Hneap_0288"
                     /inference="COORDINATES: protein motif:HMM:PF10099.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma-K factor RskA"
                     /protein_id="WP_012823187.1"
                     /translation="MNESTEHIEYVLGLLDEPTDRLTERAIKASPEQRRAVTNWSLII
                     SDHLLSQCESRPLLGWVWSRIERQLDHQAQDVGSALLRWRMAAAIVAMIGIGLLVGVF
                     VPNKPTMQADSIAMMPMAQGQSAMWEAKADTTTQQLQVTCLTNADQEINKQAVLWLIT
                     PQGQTVAVGSLPMKKGESVTVRPALWSNTIAQTKLAISLEPTGKPIGNKPVGPVVWQG
                     DWSKAS"
     gene            complement(298326..299120)
                     /locus_tag="HNEAP_RS01405"
                     /old_locus_tag="Hneap_0289"
     CDS             complement(298326..299120)
                     /locus_tag="HNEAP_RS01405"
                     /old_locus_tag="Hneap_0289"
                     /inference="COORDINATES: protein motif:HMM:TIGR02937"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441081.1"
                     /translation="MRVCTQLDTGRMHAMMSMPSDLPRTSPGIITTDNGQRSVSSDGM
                     NHPSKRIKRSRIGMSMKPNRSNKDRNQDDDQLTQWLQATAAGDRSAFQKLYQRTSGPL
                     YGLCLRILKEEGRAQECVQDVFLAVWQQAGRFDSARAQPMTWLAAIAHHRAISLLRRF
                     NREITTADWADFLALADAPLLSPEGHQGGSADGDPHDWQLMDREAMTRCLEALRAEPR
                     QAIHKAFWFGHTYQEIADELSTSLSTVKSWIRRALINLKSCLGLVN"
     gene            299368..299625
                     /locus_tag="HNEAP_RS01415"
                     /old_locus_tag="Hneap_0290"
     CDS             299368..299625
                     /locus_tag="HNEAP_RS01415"
                     /old_locus_tag="Hneap_0290"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823189.1"
                     /translation="MKTRTLKAAVIASTALSAALVAGTALANPFVSQHGASLVKVSDA
                     SCGANMKKSDSSCGANMKKSDSSCGANMKKSDSSCGANMKK"
     gene            299957..300805
                     /locus_tag="HNEAP_RS01420"
                     /old_locus_tag="Hneap_0291"
     CDS             299957..300805
                     /locus_tag="HNEAP_RS01420"
                     /old_locus_tag="Hneap_0291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823190.1"
                     /translation="MITDAKHVLVGVGLRRGSLMQQIETDHPDLDFLEVAPENWMRLG
                     GAVKRQFESLLERYPLYLHGLSLSIGGPAPLDVDFLKSLRAFIDRYQPVLYSEHLSFC
                     TDNAHLYDLMPIPFTRVAMRHVVERIHRAQDILGQRLTLENVSYYTAPDAEMNELEFL
                     TEILQQADCDLLLDVNNVYVNSVNHRYDPVAFLDALPVERVRYLHVAGHLQLSPDLIV
                     DTHGAAVADPVWDLLAHTYTRFGAVPTLLERDFDIPPLADLMQEVAQIRRVAAGAHNK
                     VLEPVA"
     gene            300802..301551
                     /locus_tag="HNEAP_RS12120"
                     /old_locus_tag="Hneap_0292"
     CDS             300802..301551
                     /locus_tag="HNEAP_RS12120"
                     /old_locus_tag="Hneap_0292"
                     /inference="COORDINATES: protein motif:HMM:PF09836.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2063 domain-containing protein"
                     /protein_id="WP_012823191.1"
                     /translation="MNTDFLTLQSQFTAFIRNPEHAPVPEGCDPERMKLYHQLFFNNF
                     DGILENTFDRTRAHLADEQWQVLVKLFFSSVPQHSPYLVDVPARFLEFLQEQNTVPLA
                     EALLELAAFEATLHECRMAEDITLPQAPQTQAEDVFDGAWQPHPQGVLFESAYPVNQA
                     DFPLDEAPAQPTLLWIQRDDAGVVQIYNLSAASARWLVLLDAHAGATPNVSLAQLAQE
                     LNVEPDSLAEFACAQLADWIADGVLIPALSH"
     gene            301556..304075
                     /locus_tag="HNEAP_RS01430"
     CDS             301556..304075
                     /locus_tag="HNEAP_RS01430"
                     /inference="COORDINATES: protein motif:HMM:PF03190.13"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin domain-containing protein"
                     /protein_id="WP_012823192.1"
                     /translation="MQRHRNCWIKVFVRLALASTVLIVPVTVPAANTQPTQAEQQITR
                     PQVDWPVLPTALQKKLNKALADQAQQNGQSTRDYHTRWLNADGLPMFTNRLILSDSPY
                     LLEHAHNPINWYAYGPEALAAAKAQNKPLFISIGYASCHWCHVMARESFESPAVAREL
                     NRHFIAVKVDRQQQPALDHRYQIAVALVNQGQSGWPASVFALPDGRPFFTQLYQPEPS
                     FLATLNNVHHVWQTKRPEVTNDAVKLTALMRQVLDQQAKAAKLDDSVLARTVNALTAQ
                     FDPFQGGFGDGAKFPQATRLLFLLDWLAREQAHLSHPNAAGGVSTAQTKALQSELVLT
                     LNHMARGGLFDQIGGGFFRYSTTPDWQVPHFEKMAYYQAMLAQTYLKAGLVLGNARDW
                     RVAERTLDFVIRDMSAADGGFIAALSADSAVSHRAGAAKEEGYFYTWTPKEIAEALPH
                     YEALLAERYWSITASGTVDGRSVPHQGDAAVQATMAKDEGMSLPALTAKMVAIRAKLE
                     SARKRRPAPGRDDNRILSWNGLLIEALADGGRVLGVPRFIAAAQKAAEFIDTNMRLPD
                     KTLAHSYNRGVASGRANLADHADFALGLVALYDATGKNHWLRAAQKQAQIIMQDFAAA
                     NGGYYDHKALHTKADSDVLNLPSRPIDDGAEPAGNAQALALQLALAARTDDATYQEAA
                     ERMLASFSGLIVRDPTDFTGLLAGLSDLRHGSVGSLAFAGKGNVRIEAARTAKHTAEV
                     RLHYTAPWHSNAHDASPGLIPTAITVSPDAFVRQIDYPQGEKVKLAFSDQPLNLYTGT
                     QVLDIKLNPHVSGPMRIRVQIQACSDATCLAPEDLAIWLPL"
     gene            complement(304266..304814)
                     /locus_tag="HNEAP_RS01435"
                     /old_locus_tag="Hneap_0294"
     CDS             complement(304266..304814)
                     /locus_tag="HNEAP_RS01435"
                     /old_locus_tag="Hneap_0294"
                     /inference="COORDINATES: protein motif:HMM:PF04116.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid hydroxylase"
                     /protein_id="WP_012823193.1"
                     /translation="MSLLSFKLGKVAYTVDLAVYLVAPFLAVASLFYFSEKREAIPIL
                     AAALLGFVGWTLLEYILHRFVLHHLSPFKEWHGEHHHNPTEAMGTPTLLSLLLIVGII
                     FLPSVYLAGWQIGGGFAMGLLLGYSIYTWLHHGEHHWRGHNKWFRNLKRAHAIHHYGH
                     NEHNFGVVTSFWDRVFGTYTRK"
     gene            305082..305684
                     /locus_tag="HNEAP_RS01440"
                     /old_locus_tag="Hneap_0295"
     CDS             305082..305684
                     /locus_tag="HNEAP_RS01440"
                     /old_locus_tag="Hneap_0295"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4124 domain-containing protein"
                     /protein_id="WP_012823194.1"
                     /translation="MKFRQTMIVVIAMAPFFPMTSWAEDATVYQCKDKNGTVIFSGTP
                     CGSDAKERVITAPNAGTGGDTKGIKELASQYDQRQAQERKEAAKIAAARAAAQARAQA
                     EQPLPSNEPEIIGYPVTGYYPGYVPNNGVSWGLNVSGDGWSAGISTRPPHDGHAHHRP
                     PRPHPNPPPIPYVYKNPGISGQFPGGAPGSSGSNFQPVRP"
     gene            complement(305666..306682)
                     /locus_tag="HNEAP_RS01445"
                     /old_locus_tag="Hneap_0296"
     CDS             complement(305666..306682)
                     /locus_tag="HNEAP_RS01445"
                     /old_locus_tag="Hneap_0296"
                     /inference="COORDINATES: protein motif:HMM:PF01636.21"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_012823195.1"
                     /translation="MSQRSPNTADERTLALLVFVRSHFPDAPPPAIASSDASARRYWR
                     LRLTNGDTRIIMDAPPPGEDIRPFIEMQERLTVAGVAVPNIFERDTGQGFLVLEDLGD
                     CTFFQWRHGHSIDAVNARLEEAVRLLAPVAQTQTADLPRFDTATLNREMDLFVDWYSA
                     QYHDTPFNAEQTARWQRLRDEISARLQTMPQGFVHRDYHSRNLMVQDDRLVAIDFQDA
                     VRGPRPYDLVSLLRDSYIDWPEELVSKLQAVFWQQCPPDLREIWPLEQMRNDFAWVAV
                     QRHLKVLGIFARLSIRDVKHGYLKDLPLTWKHLHKALAQLPELSGLAELIAPLGPKDQ
                     GRTG"
     gene            306894..307613
                     /locus_tag="HNEAP_RS01450"
                     /old_locus_tag="Hneap_0297"
     CDS             306894..307613
                     /locus_tag="HNEAP_RS01450"
                     /old_locus_tag="Hneap_0297"
                     /EC_number="3.1.2.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent hydrolase"
                     /protein_id="WP_012823196.1"
                     /translation="MAIFKQLFDEATSTFTYLIADEHTRSALLIDPVHEQYERDRALL
                     DELGLSLKYVLETHVHADHITGGGRLRHETDALFIVGKGTGLDCADRLVADGETIEMD
                     SITIQVIATPGHTDGCTSYRWEDRLFTGDTILIDACGRTDFQQGSPERLYQSIQKLLA
                     FADETLIYPAHDYNGKRVSSVGQEKTINPYIAGLNEAAFVAKMRALNLPKPKRIDVAV
                     PANSLCGGADVPRQPGETEAA"
     gene            307610..308758
                     /locus_tag="HNEAP_RS01455"
                     /old_locus_tag="Hneap_0298"
     CDS             307610..308758
                     /locus_tag="HNEAP_RS01455"
                     /old_locus_tag="Hneap_0298"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="WP_012823197.1"
                     /translation="MNSVANITVIGAGFGAVTAIKTLRKSNPSARITLIAPEPTMQYY
                     PSLIWVPAELRSRDDIMVDLKPLLARLDVIYQPGRVVGVEGSGRRVLVEQGGETIGVD
                     NDGLIVASGGRFIKKLPGIEHAITVCEGIDAAERIRDRLAAMTGGTIAIGFGGNPNEP
                     SAVRGGPMFEMLFGIDRLLRKQGRRDQFKIVFFNPSNRPGNRLGESAVDNLLARMKKF
                     NIEARLGAKMLRFEADKVVTEAGEFAADLILFMPGMTGPTWLEHAPFPKSPGGMIQAE
                     ATTRVVGFEKVYVVGDSGSYPAPDWAPKQAHMADLMAVAAAHNLLAEQAGKPANQTFK
                     WELICVMDMLDRAVLVFRNEKRQFITPPCRLLHYAKRLFEWWYLRSIR"
     gene            complement(308958..310787)
                     /locus_tag="HNEAP_RS01460"
                     /old_locus_tag="Hneap_0299"
     CDS             complement(308958..310787)
                     /locus_tag="HNEAP_RS01460"
                     /old_locus_tag="Hneap_0299"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase RecQ"
                     /protein_id="WP_012823198.1"
                     /translation="MNPNVISSPLHILNTVFGYPAFRGPQAEVIDTVMSGRDALVLMP
                     TGGGKSLCYQVPALALSGTAIVVSPLIALMQDQVAALRQAGVAAAFLNSTQTGEEAQL
                     VRKQLRAGTLDLLYVAPERLLNADTLSLLRDASINLIAIDEAHCVSQWGHDFRPEYIR
                     LGELGQYFPDIPRIALTATADGTTQQEILYRLGLNNARVFISSFDRPNIRYHIAQNHA
                     GSARDALLRFIRDNHANEAGIVYCLSRKRVEEIAAWLSDQGLTALAYHAGLPATQREQ
                     TLRRFLDEDGVIVVATIAFGMGIDKPDVRFVAHLNLPKSIEAYYQETGRAGRDGLPAE
                     AWMRYGLQDVITLRQMMSESNADEAIKRIEQHKLDAMLGLSESTACRRQTLLGYFGEQ
                     STEPCGNCDNCLTPPQMWDATLPARQALSTVHRTGQRFGVNYLIDVLRGKTDERITQL
                     GHDKLSVFGVGHAHTIDIWRGIFRQLIAQGYLSVDTEGFGGLALCERCRPLLRGEESL
                     WLRQITKPVKISRKTRDRPDFVSDEESELWEALRACRKRLATERGVPPYTIFHDASLL
                     DMLHARPTTLDAFTDISGVGAHKRDTYGAAFLSVIAPFVRRTR"
     gene            310900..311427
                     /locus_tag="HNEAP_RS01465"
                     /old_locus_tag="Hneap_0300"
     CDS             310900..311427
                     /locus_tag="HNEAP_RS01465"
                     /old_locus_tag="Hneap_0300"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823199.1"
                     /translation="MAWLSYLQLVIFRVGPEDMPAGWHATTWAFIWFLVTGSMMVFAD
                     RAAGESLQAALGQSFFDNVLNAVLVAGYAWGWLVIRKHPERLAQLLTALYAALGVLSL
                     VLAALWWLMPITPGKAPTNGWWIIVLFVWDVLVVGQIFRRALDWGAALGALISLGYFI
                     LAGVGVVWAHALVFG"
     gene            311494..312861
                     /locus_tag="HNEAP_RS01470"
                     /old_locus_tag="Hneap_0301"
     CDS             311494..312861
                     /locus_tag="HNEAP_RS01470"
                     /old_locus_tag="Hneap_0301"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="WP_012823200.1"
                     /translation="MKKIHILGIAGTFMGSLAQLAKAMGFEVSGRDLAIYPPMSDQLA
                     QAGIPVQTDMNAPLPQDAEIIVGNVMRRDMPVIDELLSGFFRYRSGPQWLGEEVLCDK
                     FVLGVAGTHGKTTTSSMLAWILEQAGMAPGFLIGGVPGNFGVSARLGETPFFVIEADE
                     YDTAFFDKRSKFLHYRPRGVILNNLEFDHADIFPDLAAIERQFAHFLRLVPNKGLVVM
                     ADATPALERVVEQGCWSPIERFGARDSAQPWRLVGEAIWLEGQHLGDMPANIIGRHNR
                     LNALAALALARFAGVPPEQGLNALAGFVGVARRLQNRGTVAGVTVFDDFAHHPTAIIE
                     TIAALREQQSASPHSGRLIAVVDPRSNTMRAGVHQHQLAEALAGADLVVFHSPANLGW
                     SPREALASLGTRIRFSPTVDAVLTDVLALAQPDDKILVMSNGSFDGVHQRLLDALAAR
                     TASIG"
     gene            312896..313486
                     /locus_tag="HNEAP_RS01475"
                     /old_locus_tag="Hneap_0302"
     CDS             312896..313486
                     /locus_tag="HNEAP_RS01475"
                     /old_locus_tag="Hneap_0302"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013436356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S16"
                     /protein_id="WP_012823201.1"
                     /translation="MKDVTLLPLFPLHTVLFPGGHLPLRIFETRYIDMVRTCLREGRP
                     FGVVLLKQGSEVRQSDDDLSEFYDVGAGAVIVDTDLGTDGMLHIETQGQGRFRVLRSW
                     SERDGLFRAEVEWLPEATIVTRSNADERLRDFLLRIMEDAAPPYPNALFDDPVWVVYR
                     LLERLPVKLEDRQRVLGAERLDLTVRHLSAMIAAFE"
     gene            313660..314040
                     /locus_tag="HNEAP_RS01480"
                     /old_locus_tag="Hneap_0303"
     CDS             313660..314040
                     /locus_tag="HNEAP_RS01480"
                     /old_locus_tag="Hneap_0303"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol reductase thioredoxin"
                     /protein_id="WP_012823202.1"
                     /translation="MTIHEATFANIDNLIKENDILIIDFWAPWCGPCRSFAPVFEAAA
                     EANPSVAFAKANTEAEQQLGAYFQIRSIPTLMIFREQILLFNQAGALPASALDELIGK
                     VKELDMDVVRQEIEKAESESQQQQ"
     gene            314071..314985
                     /locus_tag="HNEAP_RS01485"
                     /old_locus_tag="Hneap_0304"
     CDS             314071..314985
                     /locus_tag="HNEAP_RS01485"
                     /old_locus_tag="Hneap_0304"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019023777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823203.1"
                     /translation="MFSVIAQMAFTIGLGVLWRYYPVGGLTADRARIALTTSVYYFFL
                     PALVLDVLWRAPLGVDTFKIMLAAATGVLVSMAAMFLAARFMTLTRGQLGALVLAASF
                     PNATYMGLPLLSSLYGDAGKAIAIQYDLFACTPLLLSVGLLLAARLGQHDEVVHPIKS
                     LLLVPPLWAAIFGAVFNLIGLPQPDWAQGFLGRMGGAVVPIMLLALGMSLRLSTLTPR
                     HLWRVSPALLIQIILMPLVVLAVVTALHLTGDLRVAVVLEAATPVMILGLVLCDRFGL
                     DTEMYATTATASILLVLVTLPLWHYLLV"
     gene            315048..315608
                     /locus_tag="HNEAP_RS01490"
                     /old_locus_tag="Hneap_0305"
     CDS             315048..315608
                     /locus_tag="HNEAP_RS01490"
                     /old_locus_tag="Hneap_0305"
                     /inference="COORDINATES: protein motif:HMM:PF00254.26"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidylprolyl isomerase"
                     /protein_id="WP_012823204.1"
                     /translation="MQIEKNVVARLNYVLKDDDGAIIDATQTRVFEYIHGFGNLIPAL
                     ENQLSGKKEGDRCQITIEPEDAYGLHDETAVIKVPRSRFDPAVELVEGNMVETLGPEG
                     RIEMLILSVDGDEVTVDLNHPLAGLRLHFDVEVGGLRMGHPDEIKHGRVHPGGHHLMV
                     GDSTYMGDWEGGPEVDSTKEQGETRG"
     gene            315601..317409
                     /locus_tag="HNEAP_RS01495"
                     /old_locus_tag="Hneap_0306"
     CDS             315601..317409
                     /locus_tag="HNEAP_RS01495"
                     /old_locus_tag="Hneap_0306"
                     /inference="COORDINATES: protein
                     motif:HMM:PF05299.10,HMM:PF13180.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M61 domain-containing protein"
                     /protein_id="WP_012823205.1"
                     /translation="MVEAVANLPTVHYRLDFSRAHMRYIGVCLSLPSGNAASGAAAWQ
                     LSLPAWIPGSYLIRDFAKNLVGMKARTVTGQPVAITPLDQQTWQLPTCDQAIEVRFEV
                     YCADFSVRTAHVDPDHAFFNGSSVFLRVHGLEQQPHSVCLEGAPAHWRVATTLPEVAV
                     DDLGFGDYRADDYEALIDFPVEMGVFEVVRWVSAGVPHRMVFSHPHPKTDFARIAQDV
                     SRICSTEIDFFGEAPFSRYLFLVALDRQGFGGLEHRDSTALIFPRDDLPLMGETEVTP
                     AYQRFLSLCAHEYFHSWNVKRIRPDAFTQLPLARPAHTRLLWLFEGFTSYLDDWMVRR
                     AGLITESAYLDALAQTINRAVRGKGWSRQTLEESSFYAWTRFYQQDENAVNAIVSYYT
                     RGALVAMMLDLQLRLCGGSLAAVMREIWREFGAKPLPEGAAIERFIERVGELSLGDFF
                     EQALRGTEPLEFAALLARFGVNAEPVAESALSSVDAGAVIGGDDPRVAKVQVVFEDRP
                     AAQAGLVSGDEIIAVDGLATSGADWGNRICRYQAGDAVQLTGFRQGRLHQWTLVLSEP
                     VLNQWRLRLASELTAVEPEALLRRRDWLAASPSARS"
     gene            317310..318233
                     /locus_tag="HNEAP_RS12125"
                     /old_locus_tag="Hneap_0307"
     CDS             317310..318233
                     /locus_tag="HNEAP_RS12125"
                     /old_locus_tag="Hneap_0307"
                     /inference="COORDINATES: protein motif:HMM:TIGR00121"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin--[acetyl-CoA-carboxylase] ligase"
                     /protein_id="WP_081441082.1"
                     /translation="MAPAAGFRADGGRTRGVIASARLACGFALGAFVMVPFDFHALRL
                     RLDERAFVEQAAAVVLPSVDSTSDYLRAHWPDQAEAGASWSICVAQTQTAGRGRHGHH
                     WRSEPGSGLWFSCAVPVVPCTAEVVPPLSLVVASELIRVLNAVGFEIGLKWPNDLWCH
                     DSKVGGLLVEQMGVGVARYWLIGIGINWLAPTHLPQDKTGVVPSVTGLFEEGELSSID
                     REALAEQLIMVAIHAARHPESWSESMRRANHWNALLGRRVQLWHAGEAGETGLAGDIK
                     LNGELGFVSDVGDFRSIGGSISVRLVQDEGC"
     gene            318234..319001
                     /locus_tag="HNEAP_RS01505"
                     /old_locus_tag="Hneap_0308"
     CDS             318234..319001
                     /locus_tag="HNEAP_RS01505"
                     /old_locus_tag="Hneap_0308"
                     /inference="COORDINATES: protein motif:HMM:TIGR00671"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III pantothenate kinase"
                     /protein_id="WP_012823207.1"
                     /translation="MKCYIDAGNTRIKWQIGPKGKAKALAWSEKSQWLEQMSSSSGKK
                     QTISKFVVATVSSESLRQWLAETLAENFANVPVQWLKSRARCCGVKLAYPEVSQFGVD
                     RFCALVATRQRCPDQAVLVINAGTAITVDYIAPTGQHEGGIIMPSLAAMKAGLNALAP
                     NLSDRREPHESGVGAQTAWLATNTADALQLGRQWMLVSALSQTINAMRAHAAPCSLAV
                     VVGGGDAIAVQAMIDPAAHVVENLVLEGVKILARQRE"
     gene            319074..319149
                     /locus_tag="HNEAP_RS01510"
                     /old_locus_tag="Hneap_R0003"
     tRNA            319074..319149
                     /locus_tag="HNEAP_RS01510"
                     /old_locus_tag="Hneap_R0003"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:319107..319109,aa:Thr,seq:tgt)
     gene            319250..319334
                     /locus_tag="HNEAP_RS01515"
                     /old_locus_tag="Hneap_R0004"
     tRNA            319250..319334
                     /locus_tag="HNEAP_RS01515"
                     /old_locus_tag="Hneap_R0004"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:319284..319286,aa:Tyr,seq:gta)
     gene            319388..319461
                     /locus_tag="HNEAP_RS01520"
                     /old_locus_tag="Hneap_R0005"
     tRNA            319388..319461
                     /locus_tag="HNEAP_RS01520"
                     /old_locus_tag="Hneap_R0005"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:319420..319422,aa:Gly,seq:tcc)
     gene            319485..319560
                     /locus_tag="HNEAP_RS01525"
                     /old_locus_tag="Hneap_R0006"
     tRNA            319485..319560
                     /locus_tag="HNEAP_RS01525"
                     /old_locus_tag="Hneap_R0006"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:319518..319520,aa:Thr,seq:ggt)
     gene            319633..320823
                     /locus_tag="HNEAP_RS01530"
                     /old_locus_tag="Hneap_0309"
     CDS             319633..320823
                     /locus_tag="HNEAP_RS01530"
                     /old_locus_tag="Hneap_0309"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002709709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_012823208.1"
                     /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITKVMAEAHGGAS
                     LGYDQIDKAPEEKARGITINTSHVEYESDARHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDPELLELVEMEIRDLLSK
                     YEFPGDDTPIVTGSALKALEGDTSDIGVPSVIKLVKAMDDYFPEPERAVDGTFLMPVE
                     DVFSISGRGTVVTGRIERGIVKVGEEVEIVGIRDTTKTTVTGVEMFRKLLDQGMAGDN
                     VGILLRGTKRDDVERGQVLCKPGSIKPHTKFEAEVYILGKDEGGRHTPFFNGYRPQFY
                     FRTTDVTGSCVLPEGTEMVMPGDNVAMTVSLIAPIAMEDGLRFAIREGGRTVGAGVVS
                     KIIE"
     gene            320906..320981
                     /locus_tag="HNEAP_RS01535"
                     /old_locus_tag="Hneap_R0007"
     tRNA            320906..320981
                     /locus_tag="HNEAP_RS01535"
                     /old_locus_tag="Hneap_R0007"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:320939..320941,aa:Trp,seq:cca)
     gene            321067..321441
                     /locus_tag="HNEAP_RS01540"
                     /old_locus_tag="Hneap_0310"
     CDS             321067..321441
                     /locus_tag="HNEAP_RS01540"
                     /old_locus_tag="Hneap_0310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_012823209.1"
                     /translation="MSEKAVEPARSSGLESAKIGLAIVLLLGGVAAFYWLSKEPLFVR
                     VASLLVPLLLAAAVLYATAVGRSIWRFAFDSRVEVRKMVWPTRQETTQTTLVVVLLIV
                     VISLFLWGVDSLLAWIVRSIAG"
     gene            321454..321987
                     /locus_tag="HNEAP_RS01545"
                     /old_locus_tag="Hneap_0311"
     CDS             321454..321987
                     /locus_tag="HNEAP_RS01545"
                     /old_locus_tag="Hneap_0311"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006747210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination
                     protein NusG"
                     /protein_id="WP_012823210.1"
                     /translation="MAMRWYVVQAFSQFENSVKKALEERIEREGLQSLFGEILVPSEE
                     VVEMRDGVKRRSERKFYPGYVLVQIDMTDEAWHLVNSVPRVLGFVGDSGGKPTPISSK
                     EAEAIMTRVKDSTDKPKPKTLFDVGEMVRVCDGPFNDFTGVVEEVNYEKSRLHVAVSI
                     FGRSTPVELGFDQVAKT"
     gene            322062..322493
                     /locus_tag="HNEAP_RS01550"
                     /old_locus_tag="Hneap_0312"
     CDS             322062..322493
                     /locus_tag="HNEAP_RS01550"
                     /old_locus_tag="Hneap_0312"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012971562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_012823211.1"
                     /translation="MAKKVTGYIKLQVKAGQANPSPPIGPALGQKGVNIMAFCKEFNA
                     ATQTLEQGSPIPVVITVYADKSFTFIMKTPPVSFLLKKTAGIKAGSAVPNKTKVGTLT
                     RQQIEDIAKIKQPDLTAKDMEAMVRTIAGSARSMGLNVEGL"
     gene            322493..323188
                     /locus_tag="HNEAP_RS01555"
                     /old_locus_tag="Hneap_0313"
     CDS             322493..323188
                     /locus_tag="HNEAP_RS01555"
                     /old_locus_tag="Hneap_0313"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_012823212.1"
                     /translation="MAKLTKRQKAIAAKVNANQPYAAADAFNLLKEVSTVKFVEAVDV
                     SVHLGVDPRRSDQMVRGATVLPNGTGKSVRVAVFAQGANAEAAKAAGADIVGFEDLAA
                     EIKQGRMDFDVVIATPDAMRVVGQLGQVLGPRGLMPNPKVGTVAVDAAMAVKNAKAGQ
                     VRYRTEKGGIIHCTIGKVNFTPEALTENLNALLADLNKAKPAASKGIYMKRVSVSSTM
                     GPGLLVDLASLAV"
     gene            323424..323951
                     /locus_tag="HNEAP_RS01560"
                     /old_locus_tag="Hneap_0314"
     CDS             323424..323951
                     /locus_tag="HNEAP_RS01560"
                     /old_locus_tag="Hneap_0314"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007040442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_012823213.1"
                     /translation="MALTIDQKQLIVAEVTEVAGKALSAIGAEYSGLTVSQMTQMRVK
                     ARESGVYLRVIKNTLARRAMADTPFSCMSEALTGPLVLAFSMEDPGAAARLMKDYAKD
                     FAKLEIKVVALGGQLLSVADVDRVASLPTRDEALSQLLAVMKAPIGKLARTLNEVPGK
                     LVRTVAAVRDQKQAA"
     gene            323983..324360
                     /locus_tag="HNEAP_RS01565"
                     /old_locus_tag="Hneap_0315"
     CDS             323983..324360
                     /locus_tag="HNEAP_RS01565"
                     /old_locus_tag="Hneap_0315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004387079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_012823214.1"
                     /translation="MAISKDDILEAISNMSVMEVVDLISAMEEKFGVSAAAAVAVAGP
                     AAAGPAAAVEEKTEFDVVLKSFGANKVGVIKAVRELTGLGLKEAKDMVEGAPATIKEG
                     ASAADAEAMKAKLTEAGAEVEVK"
     gene            324553..328719
                     /locus_tag="HNEAP_RS01570"
                     /old_locus_tag="Hneap_0316"
     CDS             324553..328719
                     /locus_tag="HNEAP_RS01570"
                     /old_locus_tag="Hneap_0316"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_012823215.1"
                     /translation="MSYSFTEKKRIRKEFGHRADILPVPYLLATQVESYKSFLQSGVP
                     AKGRTNAGLHAALSSVFPIRSHSGNAEIAYVDYYFGEPAFDVRECQIRGLSYGAPLRV
                     KMRLVIYDRDAPAGSKVVKDIREQDVYLGEIPLMTESGTFVINGTERVIVSQLHRSPG
                     VFFDHDKGKTSSSKKILFSARIIPYRGSWLDFEFDQKDILYARIDRRRKIPASIILRA
                     LGYTNQNMLDIFFDHDEFHIDKDGGLALTLVADRLKGTDAAFDIDINGENLIKTGKRI
                     TARHVRELVAAKVTSLPVPVDFVVGRVLASDVIDTSTGEVLAQGNEELTTELVAKLAK
                     AGITQFKTLYFNDVDRGPFMSLTLRADPSTTPLEAMVEIYKMMRPGEPPTKDSAEALF
                     HGLFFTEDRYDLSEVGRMKFNRRIEREGDVGPGVLYDGKYFTTRAAQGDEAAKQLLKE
                     QGGVSDILDVMKELIDIRNGNGKTDDIDHLGNRRIRSVGEMTENVFRIGLVRVERAVK
                     ERLTQAESEGLTPQDLINAKPVAAAIKEFFGSSQLSQFMDQNNPLSEITHKRRISALG
                     PGGLTRERAGFEVRDVHTTHYGRVCPIETPEGPNIGLINSLATYARTNGYGFLETPYR
                     TVKDGVVSKEVDWLSAYEEEKFTIAQANAPLDDNGVLQGNLISVRRAGEFMLASPEEI
                     QYMDVSPKQIVSIAASIIPFLEHDDANRALMGSNMQRQAVPTLRADKPLVGTGMERVV
                     ATDSGSCVVARRGGVVDRVDAARVVVRVNAEEASQGDVGVDIYNLTKYTRSNQNTCIN
                     QTPLVKAGDVIAKGDVLADGPSVDMGELALGQNILCAFMPWNGYNFEDSILLSERVVR
                     EDRLTTIHVEELNCIARDTKLGAEEITADIPNVAESLLNKLDAAGVVHVGAEVRPGDI
                     LVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPPGMEGTVIDVRVFTRDGIE
                     KDSRARAIEEADLEAVRKDLKDRMRIIEGDILARVKSVLVNQVAVGGPGVKAGSKITA
                     AQLEKIEPSKWLEIRVEGEEAAQAMEEYIAQLAQAQVDIDKRFEDKKKKIQQGDDLAP
                     GVLKMVKVYVAVKRRIQPGDKLAGRHGNKGVVSMIVPEEDMPYMENGQPVDICLNPLG
                     VPSRMNIGQILETHLGFAARGLGVKIEEMLKLERAKALIELRAFLDKVYNYKSDKPVD
                     LDALSDDELIELARNLKKGVPMATPVFDGAVEDEIKYMLELAGLPTSGQVQLYDGRSG
                     EPFERTTTVGYMYMLKLNHLVDDKMHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVW
                     ALEAYGAAYTLQEMLTVKSDDVNGRNKMYKNIVDGDLKMDAGMPESFNVLLKEIRSLA
                     INVELEQGKE"
     gene            328797..333002
                     /locus_tag="HNEAP_RS01575"
                     /old_locus_tag="Hneap_0317"
     CDS             328797..333002
                     /locus_tag="HNEAP_RS01575"
                     /old_locus_tag="Hneap_0317"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012699297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_012823216.1"
                     /translation="MKELLNLMSREVTDDDFDGIRISLSSPEMIRSWSYGEVKKPETI
                     NYRTFKPERDGLFCAKIFGPVRDYECLCGKYKRLKHRGVVCEKCGVEVTLSKVRRERM
                     GHIELACPVAHIWYLKSLPSRIGLLLDMTLRDIERVLYFEAFVITDPGMTTLNKGDLL
                     TDEMYIDAIEQFGDEFEADMGAEAIQKLLKDIDLDQQILTLRDELASTGSETKIKRLS
                     KRLKLIEAFKESGNRPEWMVLTQLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLIEINAPDIILRNEKRMLQESVDSLLDNGRRGRAVTGTNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVIVVGPTLRLHQCGLPKKMALELFKPFIFGKLHRRGLAT
                     TIKAAKKLVEREGPEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPILIEGKAIQLH
                     PLVCSAYNADFDGDQMAVHVPLSLEAQAEARALMMSTNNVLSPANGDPVIVPSQDIVL
                     GIYYMTRAKVNGRGEGMVFADLDEVQRAYDNHQVELGAQIKVRVNDWIRYDDGTAESV
                     RHILETTVGRALLYKALPEGVPFEQINKDMGKKAISALLNYVYRQLGLKDTVLFADQL
                     MYTGFRYATRSGISICSDDMLVPPSKPAELAKAEAEVGEIQNQYSQGLVTEKERYNKV
                     VDIWSRANDQISRAMMEQLGTEKVVDREGNTVKQSSFNAIFMMADSGARGSAAQIRQL
                     AGMRGLMTKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDIVITIDDCGTQSPGLKVTAVIEGGDVVQGLGARILGRTTSQDVLMPGSDE
                     VLVPSGTVINEVLVARLEESGVDEVWVRTPIGCESRHGICQKCYGRDLARGNLVNIGE
                     SVGVIAAQSIGEPGTQLTMRTFHIGGAASRSASASSVQNKAAGVVRLHNLKTVKNRDN
                     DLVAVTRSGELGMIDDQGRERERYKIPYGAVIRVKEGEKVAGGTTLATWDPHTHPVVS
                     EMQGQARFSDFVDGQSVKSDTDEITGLSSQVVIDPKHRNSAAKELRPAIALIDDAGEP
                     VCLAGTDIPAFYVLPAGAIIGIEDGAAVQVGDIIARIPQESSKTRDITGGLPRVADLF
                     EARKPKEPAILAEYTGTISFGKETKGKQRLVITDEHGEAHEELIPKYRVINVFEGEHV
                     ARGEVIADGELTPHDILRLRGIPDLAAYIIKEIQDVYRLQGVIISDKHIEVIVRQMLR
                     KVEISEPGDSGYLRGDQVDKARLLEENRMLEQAGKFAAKFDPMLLGITKASLVTESFI
                     SAASFQETTRVLTDSSTRGARDELRGLKENVIVGRLIPAGTGLAHHQERRRRRHLTMD
                     SANALFMDSDSSDARVDEGENVS"
     gene            333122..333499
                     /locus_tag="HNEAP_RS01580"
                     /old_locus_tag="Hneap_0318"
     CDS             333122..333499
                     /locus_tag="HNEAP_RS01580"
                     /old_locus_tag="Hneap_0318"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_012823217.1"
                     /translation="MATVNQLVRKPRKRLVEKTKVPALEGCPQRRGVCTRVYTTTPKK
                     PNSALRKVARVRLTSGFEVTGYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGSL
                     DTQGVDKRRQGRSKYGAKRPKAK"
     gene            333527..333997
                     /locus_tag="HNEAP_RS01585"
                     /old_locus_tag="Hneap_0319"
     CDS             333527..333997
                     /locus_tag="HNEAP_RS01585"
                     /old_locus_tag="Hneap_0319"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007195683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_012823218.1"
                     /translation="MPRRREVPKREILPDPKYGNVTVAKFINMIMLSGKKSVAESILY
                     GAMTIAEAKGKGHPVELVERALENVAPAVEVKSRRVGGANYQVPVEVRAVRRSSLAMR
                     WLIDAARKRGEKTMAAKLAGELMDAAESRGSAVKKREDTHRMAEANKAFAHFRW"
     gene            334015..336114
                     /locus_tag="HNEAP_RS01590"
                     /old_locus_tag="Hneap_0320"
     CDS             334015..336114
                     /locus_tag="HNEAP_RS01590"
                     /old_locus_tag="Hneap_0320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011412092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_012823219.1"
                     /translation="MARTTPLERYRNFGIMAHIDAGKTTTTERILFYTGVSHKIGEVH
                     DGAATMDWMEQEQERGITITSAATTAFWGGMDKQFEPHRFNIIDTPGHVDFTIEVERS
                     LRVLDGAVFVLCAVGGVQPQSETVWRQANKYSVPRLAFVNKMDRSGADFYRVMEQLKK
                     RLGANPLPVVLPIGAEEGFEGVIDLLRMKAIYWNTEDMGLTYDEKEIPAELLEKAKTY
                     RSQMMEAAAEANEEVMEKYLETGDLTDDEIVSGLRQRTLNNEIIPALCGTAFKNKGVQ
                     KMLDAVIDYLPSPTQVPPIKGELPDGTPSVRKTGDNEPFSALAFKIMSDPFVGSLTFF
                     RVYSGVVNAGDGVLNSTKGNKERLGRILQMHANSREEIKEVRAGDIAAAVGLKNVITG
                     DTLCDLANPIILERMIFPEPVISVAVEPKTKGDQEKMGMALGRLAQEDPSFRVFTDEE
                     SGQTIIAGMGELHLEILVDRMRREFKVEANIGKPQVAYRETIRGTVEQDGKFVRQSGG
                     RGQYGHVKIRIEPLEVGGGYEFVNGIVGGVVPREYIPAVDKGIQEQIKNGVIAGYPVV
                     DVKVTLFDGSYHEVDSNEMAFKIAGSMAFKEGAVKANPVLLEPMMKVEVETPEDYMGD
                     VIGDLNRRRGMIQGMEDTVGGGKQVKAEVPLSEMFGYATDLRSATQGRATYSMEFARY
                     GEAPKNVADAVIKGKSA"
     gene            336147..337337
                     /locus_tag="HNEAP_RS01595"
                     /old_locus_tag="Hneap_0321"
     CDS             336147..337337
                     /locus_tag="HNEAP_RS01595"
                     /old_locus_tag="Hneap_0321"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002709709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_012823220.1"
                     /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITKVMAEMHGGAS
                     LGYDQIDKAPEEKARGITINTSHVEYESDTRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDPELLELVEMEIRDLLSK
                     YEFPGDDTPIVTGSALKALEGDTSDIGVPSVIKLVKAMDDYFPEPERAVDGTFLMPVE
                     DVFSISGRGTVVTGRIERGIVKVGEEVEIVGIRDTTKTTVTGVEMFRKLLDQGMAGDN
                     VGILLRGTKRDDVERGQVLCKPGSIKPHTKFEAEVYILGKDEGGRHTPFFNGYRPQFY
                     FRTTDVTGSCVLPEGTEMVMPGDNVAMTVSLIAPIAMEDGLRFAIREGGRTVGAGVVS
                     KIIE"
     gene            337343..337654
                     /locus_tag="HNEAP_RS01600"
                     /old_locus_tag="Hneap_0322"
     CDS             337343..337654
                     /locus_tag="HNEAP_RS01600"
                     /old_locus_tag="Hneap_0322"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012983533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_012823221.1"
                     /translation="MASQTIRIRLKSFDHRLIDRSAAEIVDTARRSGARVKGPIPLPS
                     RKERFTVLVSPHVNKDARDQYELRTHKRVLDIIEPTDRTVDLLMQLDLAAGVDVQIRL
                     N"
     gene            337802..338446
                     /locus_tag="HNEAP_RS01605"
                     /old_locus_tag="Hneap_0323"
     CDS             337802..338446
                     /locus_tag="HNEAP_RS01605"
                     /old_locus_tag="Hneap_0323"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003103877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_012823222.1"
                     /translation="MSLGVVGRKVGMTRVFDDAGVSTPVTVIEVEPNRVTQLKTPEVD
                     GYTAVQVTTGTRRASRVTKAMAGHYAKAETASGRMSTEFRISADELAGFQPGAEITVS
                     IFDGVEKVDVAGQSKGKGFAGTVKRYNFRTQDATHGNSRSHRVPGSIGQNQTPGRVFP
                     GKKMSGHMGDERVSSLGLKVVRVDVERGLILVKGAVPGSTGGDVIVRPSVKIKG"
     gene            338455..339063
                     /locus_tag="HNEAP_RS01610"
                     /old_locus_tag="Hneap_0324"
     CDS             338455..339063
                     /locus_tag="HNEAP_RS01610"
                     /old_locus_tag="Hneap_0324"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009839233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_012823223.1"
                     /translation="MELQVKDGAAISVSEQIFDRSYNEGLIHQAVVAFMAGARSGTKR
                     QLTRSEVSGGGKKPWNQKGSGRARAGTTRSPIWRTGGVTFAARPRNFEQKINRKAYRV
                     AMASIFSELVRQDRLIVVESLTVSSPKTREVLGLVKNLGIQGGRTLFVAEAFDEHFFL
                     GSRNVIELGYLTADMLDPVSLVGAERVVITRAAVKMVEEWLS"
     gene            339060..339353
                     /locus_tag="HNEAP_RS01615"
                     /old_locus_tag="Hneap_0325"
     CDS             339060..339353
                     /locus_tag="HNEAP_RS01615"
                     /old_locus_tag="Hneap_0325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_012823224.1"
                     /translation="MMREKLFDVLRSPLVTEKTARANQENQYAFRVATTATKAEIKAA
                     VEQLFSVNVMAVQTLNVAGKARRFRGVAGRRADWKKAYVTLAEGQAIDLGQAN"
     gene            339383..340207
                     /locus_tag="HNEAP_RS01620"
                     /old_locus_tag="Hneap_0326"
     CDS             339383..340207
                     /locus_tag="HNEAP_RS01620"
                     /old_locus_tag="Hneap_0326"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016915777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_012823225.1"
                     /translation="MALKIAKPTSPGRRSVIEIDRSHLYKGAPYAPLLEKKSNTGGRN
                     NLGRITTRHIGGGHKQHYRLVDFKRVKDGIPATVERIEYDPNRTAHIALIMYADGERA
                     YILAPRGVVPGQVVLSGVEAPIRAGNCLPMRNIPIGSTIHAVELKPGKGAQIARSAGA
                     AVQLVAREGAYVTLRLRSGETRKVLAECRATLGEVSNHEHSLRSLGKAGATRWRGIRP
                     TVRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGVPTKGYKTRTNKRTDKLIVRRRSK"
     gene            340232..340507
                     /locus_tag="HNEAP_RS12435"
                     /old_locus_tag="Hneap_0327"
     CDS             340232..340507
                     /locus_tag="HNEAP_RS12435"
                     /old_locus_tag="Hneap_0327"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013789761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_012823226.1"
                     /translation="MPRSLKKGPFVDHHLLKKVEEAAAANNRRPIKTWSRRSMILPDF
                     IGLTIAVHNGRQHIPVLVNENMVGHKLGEFAPTRTYRGHVADKKAKR"
     gene            340517..340849
                     /locus_tag="HNEAP_RS01630"
                     /old_locus_tag="Hneap_0328"
     CDS             340517..340849
                     /locus_tag="HNEAP_RS01630"
                     /old_locus_tag="Hneap_0328"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018872201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_012823227.1"
                     /translation="MQATALHRYARISPQKARLVADLVRGQGVAQAIETLTFSDKKGA
                     DLIKKVLESAIANAENNEGADVDRLRIATIMVDEGPVLKRFRARAKGRGARILKKTSH
                     ILVTVSER"
     gene            340860..341534
                     /locus_tag="HNEAP_RS01635"
                     /old_locus_tag="Hneap_0329"
     CDS             340860..341534
                     /locus_tag="HNEAP_RS01635"
                     /old_locus_tag="Hneap_0329"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015259322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_012823228.1"
                     /translation="MGQKVHPVGFRLGISSDWTSRWYADSKLFPVQLNQDVRTRAFIK
                     DKLKEASVSRIQIERPARSASVTIHTARPGIVIGRKGEDIERLRGEIAPMLGVDRNAV
                     KLSVEEIRKPELDAQLVAESIAQQLERRIMFRRAMKRAVQTSMRLGAGGIKVNVSGRL
                     GGAEIARNEWYREGRVPLHTLRADIDYGFAEAQTTYGVIGVKVWIFKGEVFGVPGNRD
                     GKAATA"
     gene            341566..341979
                     /locus_tag="HNEAP_RS01640"
                     /old_locus_tag="Hneap_0330"
     CDS             341566..341979
                     /locus_tag="HNEAP_RS01640"
                     /old_locus_tag="Hneap_0330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005495358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_012823229.1"
                     /translation="MLLPKRTKFRKQFRGKNRGIATTGNKVSFGEFGLKSLERGEITS
                     RQIESARRAISRHVKRGGKIWIRIFPDTPITKKPLEVRMGKGKGSVEYWVAKIQPGKM
                     LYEIEGVTEDIARQAFSLASAKLPVKTTFVTRVLM"
     gene            341979..342176
                     /locus_tag="HNEAP_RS01645"
                     /old_locus_tag="Hneap_0331"
     CDS             341979..342176
                     /locus_tag="HNEAP_RS01645"
                     /old_locus_tag="Hneap_0331"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_012823230.1"
                     /translation="MSKITNELREKSPEGLREELLAIKREQFNLRMQKATGQESKSHL
                     IREARKNVARIKTILTEKEQG"
     gene            342178..342447
                     /locus_tag="HNEAP_RS01650"
                     /old_locus_tag="Hneap_0332"
     CDS             342178..342447
                     /locus_tag="HNEAP_RS01650"
                     /old_locus_tag="Hneap_0332"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010318767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_012823231.1"
                     /translation="MSTETNENVIRTRVGRVTSDKMDKSITVAIERRVKHPLYGKFIT
                     KTTKLHVHDEDNQSRVGDSVEIRESRPISKTKSWTLVRVITRAAV"
     gene            342460..342828
                     /locus_tag="HNEAP_RS01655"
                     /old_locus_tag="Hneap_0333"
     CDS             342460..342828
                     /locus_tag="HNEAP_RS01655"
                     /old_locus_tag="Hneap_0333"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012728338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_012823232.1"
                     /translation="MIQMQTILDSADNSGAKKIQCIKVLGGSHRRYAGIGDIIKVSIK
                     DAIPRGRVKKGDVYNAVVVRTAKGVRRADGSLIRFDGNAAVLLNAKLEPIGTRIFGPV
                     TRELRGEKFMKIVSLAPEVI"
     gene            342839..343162
                     /locus_tag="HNEAP_RS01660"
                     /old_locus_tag="Hneap_0334"
     CDS             342839..343162
                     /locus_tag="HNEAP_RS01660"
                     /old_locus_tag="Hneap_0334"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_012823233.1"
                     /translation="MRKIRQGDEVVVIAGKDKGRRGTVLRVINDGARVVVENINKVKK
                     HMKPNPMLGQTGGIIEMEKSIDISNVMLFNPASEKGDRVGFKHLEDGTKVRFFKSNGE
                     VVDTK"
     gene            343174..343713
                     /locus_tag="HNEAP_RS01665"
                     /old_locus_tag="Hneap_0335"
     CDS             343174..343713
                     /locus_tag="HNEAP_RS01665"
                     /old_locus_tag="Hneap_0335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010324092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_012823234.1"
                     /translation="MARLQELYTSTYLPQLKEKLGLDNVMAVPKLTKITLNMGLGDSA
                     RDKKVIDSAVDEMAAISGQKPVVTYARKSIAGFKLREGMPLGVKVTLRGSTMYEFFDR
                     LIQISVPRIRDFRGLNPKSFDGRGNYSMGVKEQIIFPEIDYDKIDQIRGMDITITTTA
                     QNDDQARALLECFGFPFRR"
     gene            343725..344030
                     /locus_tag="HNEAP_RS01670"
                     /old_locus_tag="Hneap_0336"
     CDS             343725..344030
                     /locus_tag="HNEAP_RS01670"
                     /old_locus_tag="Hneap_0336"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017941084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="WP_012823235.1"
                     /translation="MAKKSMLNREEQRQKLSARYQAKRDQLRAVLNDPNADFDAKMQA
                     SAALSKLPRDSSVCRQVRRCAITGRPKGVYRKFALGRNKLRQLAMSGEIPGLRKASW"
     gene            344043..344435
                     /locus_tag="HNEAP_RS01675"
                     /old_locus_tag="Hneap_0337"
     CDS             344043..344435
                     /locus_tag="HNEAP_RS01675"
                     /old_locus_tag="Hneap_0337"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002215438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_012823236.1"
                     /translation="MSMSDPISDMLTRIRNAQNARKPNVSMPSSKFKQAIAKVLKEEG
                     YIGDFQVSGDAKPTLSIALKYFQGKPVIDMIKRVSKPGFRVYKNADELPTVIGGLGVA
                     ILSTSQGVMPDREARRQNIGGEVICLVS"
     gene            344449..344976
                     /locus_tag="HNEAP_RS01680"
                     /old_locus_tag="Hneap_0338"
     CDS             344449..344976
                     /locus_tag="HNEAP_RS01680"
                     /old_locus_tag="Hneap_0338"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003293037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_012823237.1"
                     /translation="MSRVAKKPVAIPKGVEVKLNGQVISFKGPKGQLELTLHKSVSVD
                     MAANELRFEPESDQFIAMAGTMRALANNNIQGVSAGFEMKLQLVGVGYRAQVQGSTLN
                     LALGFSHPINFAIPAGITIETPSQTEIIIRGADRQKVGQVASNIRGYRPPEPYKGKGV
                     KYHDEVIFRKEAKKK"
     gene            344986..345342
                     /locus_tag="HNEAP_RS01685"
                     /old_locus_tag="Hneap_0339"
     CDS             344986..345342
                     /locus_tag="HNEAP_RS01685"
                     /old_locus_tag="Hneap_0339"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008959159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_012823238.1"
                     /translation="MNEKSQNRLRRARRTRAKIVRLGVHRLTVYRTAQHTYAQIFTPD
                     GATVVASSSTLHPGVIEAGKHGGNIDAAKRVGEMVAKAALAKGITNVAFDRSGFIFHG
                     RIKALAESARESGLQF"
     gene            345354..345869
                     /locus_tag="HNEAP_RS01690"
                     /old_locus_tag="Hneap_0340"
     CDS             345354..345869
                     /locus_tag="HNEAP_RS01690"
                     /old_locus_tag="Hneap_0340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_012823239.1"
                     /translation="MSRNSNEVATDGLIEKLVAVNRVAKVVKGGRIFSFTALTVVGDG
                     EGRVGFGYGKAKEVPAAIQKAMDRAKRNMVDVPLRDGTLHYSTVGHHGAAQVFMKPAS
                     EGTGVIAGGAMRAVFEAVGVRNVLAKCIGTRNHMNVIRATVNGLQSISSPEMIASKRG
                     KRVEEIVGSAS"
     gene            345866..346057
                     /locus_tag="HNEAP_RS01695"
                     /old_locus_tag="Hneap_0341"
     CDS             345866..346057
                     /locus_tag="HNEAP_RS01695"
                     /old_locus_tag="Hneap_0341"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_012823240.1"
                     /translation="MSQPAMIRVKLIRSTIGRLASHKACVKGLGLRRMNHEVEVMDTP
                     ENRGMINKIEYLLEVQESK"
     gene            346057..346485
                     /locus_tag="HNEAP_RS01700"
                     /old_locus_tag="Hneap_0342"
     CDS             346057..346485
                     /locus_tag="HNEAP_RS01700"
                     /old_locus_tag="Hneap_0342"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011771736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_012823241.1"
                     /translation="MRLNTLSPADGSRKERTRVGRGVGSGLGKTAGRGHKGQKSRSGG
                     FHKTGFEGGQMPIQRRLPKMGFRSLRALASAEIRTSELNKLDGVVSLETLKAAGLIRN
                     DVRFVKIMLSGEVTKPVQVQGIRVSKGALSAIVAAGGKAE"
     gene            346489..347823
                     /locus_tag="HNEAP_RS01705"
                     /old_locus_tag="Hneap_0343"
     CDS             346489..347823
                     /locus_tag="HNEAP_RS01705"
                     /old_locus_tag="Hneap_0343"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_012823242.1"
                     /translation="MALSNAGVASLAGAGRLTELRQRIFFVIMVLVVYRIGTFIPLPG
                     IDVDVMRTLFTQHSGGILGMMNMFSGGALSRMSLFALGVMPYISASIIVQLLSSVLPS
                     LERIKKEGEAGRRKITQYTRYGTLGLGLVQALGVSIALQGQSVGGQSLVYTPGFGFLF
                     VATMTLLTGTMLLVWLGEQITERGVGNGISLIIFAGIVAGLPTAIGGTAELVRTGELG
                     VITLLILAVLIVAVTAFVVFVERGQRRITVNYARRQQGRGMAGQQSSHLPLKLNMAGV
                     IPPIFASSIILFPATLGNWLGQQENMAWLRSVSTALSPGQPLYVGLYATAIIFFCFFY
                     TALVFNSRETADNLKRSGAFVPGIRPGEHTARYIDKVLTRLTFWGALYITAVCLLPEF
                     LILYWNVPFYFGGTSLLIIVVVLMDFMAQVQSHLVSHQYDSLVRKAHFKSGL"
     gene            347900..348256
                     /locus_tag="HNEAP_RS01710"
                     /old_locus_tag="Hneap_0344"
     CDS             347900..348256
                     /locus_tag="HNEAP_RS01710"
                     /old_locus_tag="Hneap_0344"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004138963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_012823243.1"
                     /translation="MARIAGINIPVQKHVVIALTSIYGIGTTRAQAICQASGVEPSRK
                     VRDLSESEVEALRAEVAKFIVEGDLRRDVSMNIKRLMDLGCYRGLRHRRGLPLRGQRT
                     RTNARTRKGPRRLVKR"
     gene            348299..348688
                     /locus_tag="HNEAP_RS01715"
                     /old_locus_tag="Hneap_0345"
     CDS             348299..348688
                     /locus_tag="HNEAP_RS01715"
                     /old_locus_tag="Hneap_0345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017939146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_012823244.1"
                     /translation="MAKSNAPARKKIKRVVTDAVAHVHASFNNTIVTITDRQGNALSW
                     ATSGGSGFRGSRKSTPFAAQVAAERAGEAAKAYGVKNIDVEIKGPGPGRESTIRALNS
                     VGFKVGVITDVTPIPHNGCRPPKKRRV"
     gene            348702..349325
                     /locus_tag="HNEAP_RS01720"
                     /old_locus_tag="Hneap_0346"
     CDS             348702..349325
                     /locus_tag="HNEAP_RS01720"
                     /old_locus_tag="Hneap_0346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018139892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="WP_012823245.1"
                     /translation="MARYLGPKCKLSRREGTDLFLKSGVRSHEDKCHHDRAPGQHGAA
                     RKQKVSEYGVQLREKQKLRRIYGVLERQFANYFKKAAQLKGSTGENLLQLLECRLDNV
                     VYRMGFGSTRSESRQLVSHRAITVNGEVVNIASYQVAANDVVAVRESSRKQQRIKDSL
                     EIAAQRPDVSWISVDAAKMEGVFKSAPSRDELPAEINESLVVELYSK"
     gene            349342..350337
                     /locus_tag="HNEAP_RS01725"
                     /old_locus_tag="Hneap_0347"
     CDS             349342..350337
                     /locus_tag="HNEAP_RS01725"
                     /old_locus_tag="Hneap_0347"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_012823246.1"
                     /translation="MQLGSTELLKPRLVDVQVLDATRARVVLEPLERGFGYTLGNALR
                     RILLSSIPGVAVTEAEIEGVVHEYTTIEGVHEDVLEILLNLKGLSVMLHGRDEAMLSI
                     KKTGAGAITAADIKADHAVEIINPEHHIATLNDQGSLVMTFKVTRGKGYVPASARREE
                     AGGQIGRLLVDASFSPLRRVSYSVERARVEQRTDLDSLVLDIETNGSISAEDAIRQAA
                     GILVDQLSVFVDLKAEKVEPVVEQAPAVDPVLLRPVDDLELTVRSANCLKAENIYYIG
                     DLIQRTEIELLKTPNLGKKSLTEIKDVLAKQGLSLGQRLENWPPAELLNLAESKI"
     gene            350367..350747
                     /locus_tag="HNEAP_RS01730"
                     /old_locus_tag="Hneap_0348"
     CDS             350367..350747
                     /locus_tag="HNEAP_RS01730"
                     /old_locus_tag="Hneap_0348"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007525756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_012823247.1"
                     /translation="MRHRLSGRQLGRNSAQRNALMRSLTNSLIEHELIKTTLPKAKEL
                     RRFAEPLITLAKDDSVHARRMAFAQTRNKEVVGKLFSDLGPRFKARAGGYVRILKCGN
                     RAGDNAPMAYVEFVQRGDAASVAE"
     gene            350881..351531
                     /locus_tag="HNEAP_RS01735"
                     /old_locus_tag="Hneap_0349"
     CDS             350881..351531
                     /locus_tag="HNEAP_RS01735"
                     /old_locus_tag="Hneap_0349"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823248.1"
                     /translation="MSVSNKIRGIRHSALALGVVLGLMSVGTYAEDAPAAPAAQPAMP
                     TLSPEQMELMKDFQQTRQEIGALEQKLQGIEAEAYKKNPKLGKQRDGLRDSIKNAMSD
                     KNFDAQAEYDELKALVTKIQGMKENDPERAKDIQKFREGQQAFEQRQAKAFQDPKIQK
                     QSEKLRNDVRAAMIKVDPKAKDMFADLDAKEKHMRDLQEKAMKMHGSEQMAPAPSK"
     gene            complement(351594..353633)
                     /locus_tag="HNEAP_RS01740"
                     /old_locus_tag="Hneap_0350"
     CDS             complement(351594..353633)
                     /locus_tag="HNEAP_RS01740"
                     /old_locus_tag="Hneap_0350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit B"
                     /protein_id="WP_012823249.1"
                     /translation="MQDTRFTLVTDYQPAGDQPAAIARLVEGLQDGLAQQTLLGVTGS
                     GKTFTIANVIDRLQRPALVLAPNKTLAAQLYGELKGFFPNNAVEYFVSYYDYYQPEAY
                     VPASDTFIEKDASVNEHIEQMRLSATKALLERRDVIIVATVSSIYGLGDPDAYLKMIL
                     HLVRGEKADQRQILRRLAEMQYTRNDMEFRRGTYRVRGDVIDIHPSESDDEGVRVELF
                     DDEIEQISLFDPLTGAIRRRLPRFTIYPSSHYVTPRERILAAVESIKDELTQQLDHLN
                     AENKLVEAQRLAQRTRFDIEMMYELGYCNGIENYSRYLSGRHPGEPPPCLYDYLPPDA
                     LLIIDESHVTVPQLGAMYKGDRSRKETLVNFGFRLPSALDNRPLKFDEFERMMPQTIH
                     VSATPGPYEGSHSAQVVEQVVRPTGLIDPQIEIRPVASQVDDVLSEIRDRASRRERVL
                     ITTLTKRMAEDLADYLAEHDVRVRYLHSDVDTVERVEIIRDLRLGLFDALIGINLLRE
                     GLDIPEVSLVAIFDADKEGFLRSERSLIQTIGRAARNLHGKAILYADRITDAMRKAID
                     ETDRRRAKQIEHNLEQGITPKGIDKRVDDILQSGDYKIPGSRGASQRSRKMALVAEAA
                     SDFSVTMSSEQILKQIKEREAKMYRLAKDLEFEAAAHIRDEIHRLQEQLIAADAK"
     gene            353784..356195
                     /locus_tag="HNEAP_RS01745"
                     /old_locus_tag="Hneap_0351"
     CDS             353784..356195
                     /locus_tag="HNEAP_RS01745"
                     /old_locus_tag="Hneap_0351"
                     /EC_number="3.1.13.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease R"
                     /protein_id="WP_012823250.1"
                     /translation="MSQETVSDPQAAQEAEKYDNPVASREFILQLLSEQDGPLTLNRL
                     ISHLEYDGDDERIEGLSRRMRAMERDGQVIRNRRGGYVPVTHAELVRGRVLGHRDGFG
                     FLVPDDGGDDVFLSPRVMRALLNGDRAVVQVTGLDRRGRREGNLVEVIERANAEIVGR
                     LVLEAGIAFVVPDHARITQDILVPMTDLMGARDGQIVRVALVEQPTLRHKPVGKVVEV
                     LGDHMSPGMEIDVAINSHGIPHEWPEEVLAAIDGLNPEVEESHKSGRVDLRSMPLVTI
                     DGADSKDFDDAVFCQAAPEGFRLLVAIADVSHYVNVGSALDREGFNRATSVYFPGRVL
                     PMLPEVLSNGLCSLNPAVDRLCLCADMLINNEGHIAKFRFFEGVMKSAARLTYDTVAK
                     VLVDQDAEARAAHAHLLEPLETLHGVYKVLRSARERRGAIDFDTVETKIVFGEGRKIE
                     AIVPYERNDAHKIIEECMIAANVAAGRFVADHKIPALYRVHDRPTAEKITDLRAMLAE
                     KGLSLGGGDQPSPKDFNALLSQVQGRADFLTIQTMILRSLKQAVYSPDNLGHFGLAHE
                     FYAHFTSPIRRYPDLMVHRAIRHLLRTGAPDRFPYNHDEMVIIGEHCSNNERRADEAT
                     RDATDWLKCEFMLDKVGEVFEGRVASVLGFGLFVELKDFFVEGLLHITALTKDYYHFD
                     PVTLSLRGERSGRVYALNDAITVRVARVDLDERKIDFVLPDDDEALSESSGDARSEPR
                     DDQESDEDDAAKKKRKPRRRRRKKPAGDAPAGDDDENADSDDDGSDTSSAPESEPGDA
                     EESRK"
     gene            356195..357001
                     /locus_tag="HNEAP_RS01750"
                     /old_locus_tag="Hneap_0352"
     CDS             356195..357001
                     /locus_tag="HNEAP_RS01750"
                     /old_locus_tag="Hneap_0352"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA
                     (guanosine(2251)-2'-O)-methyltransferase RlmB"
                     /protein_id="WP_012823251.1"
                     /translation="MAERKSASSTQWLSGFHAVEAALQHDPERVLSVIFEQGRQDKRV
                     QQLRVLAESRGVSIEEAPEKVFADRVRADRELARHQGVLARYQPKPAGNEHDLFALLD
                     NLDEPAFLLILDGVTDPHNLGACLRSAEAAGVHAVISPKDRAVGLTPTARKAASGAAE
                     RLPFIQVTNLARTLADLKSRQIWIVGAAGGGMVSLYESDFAAESVALVMGSEGEGLRR
                     LTQEGCDQLIFIPMRPPVESLNVSVAAAVCLFEFRRVRDQVINQARALSQ"
     gene            357115..358290
                     /locus_tag="HNEAP_RS01755"
                     /old_locus_tag="Hneap_0353"
     CDS             357115..358290
                     /locus_tag="HNEAP_RS01755"
                     /old_locus_tag="Hneap_0353"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823252.1"
                     /note="catalyzes the formation of oxalozcetate and
                     L-glutamate from L-aspartate and 2-oxoglutarate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase"
                     /protein_id="WP_012823252.1"
                     /translation="MIFSDRVRRVRPSPTLAVTAKAAELKAQGRDIISLGAGEPDFDT
                     PEPIRAAAIDAINAGFTRYTAVEGILSLRQAIAKRLRDDQGLDYAPNEIIVSTGGKQS
                     IYNLFQALLNPGDEVIIVAPYWVSYPDMVLLAGGEPVIVLAGQNQGFKVSPAQLEAAI
                     TDKTRIVMLNSPSNPTGVAYTRDDWAAMAKVLRAHPKLLIATDDMYEKILWADESFSN
                     IAMVAPDLKARTVVLNGVSKAYAMTGWRIGYAAGPADIIKAMNVIQSQSTSGACSIAQ
                     VAAQAAIEGDQSEIRAMVHSFRTRHDFVVGRLNEMPDVVCLPSQGAFYSFPDVSAVIA
                     RLGLKDDVALSEMLLEKAGVAVVPGTAFGAPGHIRLSYATSMGALDEALRRMADVMG"
     gene            358362..359411
                     /locus_tag="HNEAP_RS01760"
                     /old_locus_tag="Hneap_0354"
     CDS             358362..359411
                     /locus_tag="HNEAP_RS01760"
                     /old_locus_tag="Hneap_0354"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020146520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination/repair protein RecA"
                     /protein_id="WP_012823253.1"
                     /translation="MDENRKKALTAALSQIERQFGKGAVMRMNDTAGVDVPVVSTGSI
                     ALDAALGIGGLPRGRVVEIYGPESSGKTTLTLQVIAQAQKTGGVCAFVDAEHALDPTY
                     AQKLGVNVDDLLVSQPDTGEQALEITDMLVRSGAVDVVVVDSVAALVPKAEIEGEMGD
                     AHVGLQARLMSQALRKLTGNIKRTNCMVIFINQIRMKIGVSYGSPETTTGGNALKFYA
                     SVRLDIRRVGAVKKGEEIIGNQTRIKVVKNKMAPPFKVVDVDILYGEGISRLMELIDM
                     ATTHGLIQKAGAWYSCGDIRLGQGKDNARQYFVEHPELADDIEAKLRASMLASTGKVA
                     VRASEDDESSAVLED"
     gene            359427..359933
                     /locus_tag="HNEAP_RS01765"
                     /old_locus_tag="Hneap_0355"
     CDS             359427..359933
                     /locus_tag="HNEAP_RS01765"
                     /old_locus_tag="Hneap_0355"
                     /inference="COORDINATES: protein motif:HMM:PF02631.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein RecX"
                     /protein_id="WP_012823254.1"
                     /translation="MAWHWQAKAQEDKTDAAKIEKVAVGLLARREHSAFELQRKLSQR
                     GFDSLVIDDVISRLAEQGWQSDARYAEAYVRMRVERGYGRESIRAELGQRGVARAVIQ
                     TALDEADIDWLACAKRQIHRHYHAAPDGHDDQLRRYRHLLSRGFTPEQSRIASGQWRD
                     AEGMDDAF"
     gene            360107..362722
                     /locus_tag="HNEAP_RS01770"
                     /old_locus_tag="Hneap_0357"
     CDS             360107..362722
                     /locus_tag="HNEAP_RS01770"
                     /old_locus_tag="Hneap_0357"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018231021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine--tRNA ligase"
                     /protein_id="WP_041600556.1"
                     /translation="MKTTAELRTAFLEFFNQRGHEIVPSSSLIPAHDPTLLFTNAGMV
                     QFKDAFLGLEHRANPRAVSCQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYF
                     KPEAIRYGWDFLTQVLKLPADRLLVTVYQTDDEAYAIWRDEIGLPEEKVLRIGDKPSG
                     GSDNFWQMGDTGPCGPCTEIFYDHGAHIPGGPPGSADEDGDRFIEIWNIVFMQYDRTV
                     DGQLHPLPKPSVDTGMGIERLAAILQGGHSNYDIDIFRHLITAAQAVTGAADQKSSSL
                     KVLADHIRSCAFLIVDGVRPGNEGRDYVLRRIIRRAARHGHKLGVDEPFFYRLVAPLV
                     EVMGPAYSELANAQAEVARVLRQEEERFLQTLASGMQVLETELADMTPGGTIPGEVVF
                     KLYDTHGFPFDLTADIARERGLVLDESGFEHAMAERRAQSRAASQFAQQTHVLEIETP
                     TCFEGYAQDKAQGALIAIVHDGEQIDVLEAGQSGALVLDHTPFYAESGGQVGDTGVIT
                     TAGGRFVVTDTQKQGANFLHLGEVIEGRVALGDVADAQIDVERRHSIRLNHSATHLLH
                     AALRQVLGTHVHQKGSRVGAESLRFDFSQSEPITDAQLREIERIVNAQIRENHSVETR
                     EMPVDEARAAGAMALFGEKYGDVVRVVTMGPFSMELCGGTHARRGGDIGLIKIVSESG
                     VASGVRRIEAVTGASALAVLEQTDDALAEIASMVRGSRQDAVSRVSQVIERARQLERE
                     LAEIKAKQAAEAGGDLLTTAVAMGDVNYLVAELPDADVNTLRDTVDQLKNKLGTSAVM
                     LASVEDGKVRLIAGVSKDLTGRIKAGDWVNVAAQIVGGKGGGRPDMAQAGGPDSAQLP
                     AAMEAARAWMKKQLS"
     gene            362922..364154
                     /locus_tag="HNEAP_RS01775"
                     /old_locus_tag="Hneap_0358"
     CDS             362922..364154
                     /locus_tag="HNEAP_RS01775"
                     /old_locus_tag="Hneap_0358"
                     /EC_number="2.7.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase"
                     /protein_id="WP_012823257.1"
                     /translation="MALIVQKYGGTSVGSVERIGAVADRVIRTCRAGHDVVVVVSAMS
                     GETNRLLDLAKQLQARPNERELDALVSTGEQVTTALLSMALLQRGQDARSYTGAQVKI
                     TTNSAFNKARIQSIDTQAVMGDLAAGRVVVVAGFQGVNEKGDITTLGRGGSDTSAVAI
                     AAALNADECQIYTDVDGVYTTDPRVEPRARRLDRITFEEMLEMASSGSKVLQIRSVEF
                     AGKYNVPLRVLSSFSDGAGTLITMEDDVVEQAVISGIAFNRDEAQLTVKGVPDSPGIA
                     YAILGPVAEANIEVDMILQNMGADNTTDFTFTVQHVDYEKTLDIVRVQAEALGAREVS
                     GNPKIVKVSVVGVGMRSHAGIAAKMFKVLADEKINIRMISTSEIKISVVVDDKYLELA
                     VRTLHDAFELDAPSALIG"
     gene            364233..364448
                     /locus_tag="HNEAP_RS01780"
                     /old_locus_tag="Hneap_0359"
     CDS             364233..364448
                     /locus_tag="HNEAP_RS01780"
                     /old_locus_tag="Hneap_0359"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon storage regulator"
                     /protein_id="WP_012823258.1"
                     /translation="MLILTRRIGEVLRVGDEVSITVLGIKGNQVRIGIDAPKDVSVHR
                     EEIYQRIKNEGHSQEDGVSGQQSSVEE"
     gene            364525..365724
                     /locus_tag="HNEAP_RS01785"
                     /old_locus_tag="Hneap_0360"
     CDS             364525..365724
                     /locus_tag="HNEAP_RS01785"
                     /old_locus_tag="Hneap_0360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="WP_012823259.1"
                     /translation="METASLVSAVDVLFVLSGAIMVLAMHAGFAFLEVGTVRRKNQVN
                     ALAKIMADFAVSAIAYFFIGYFVAYHIDFWSSASQLTADHGHELVKFFFLLTFAAAIP
                     AIISGGIAERARFYPQLAATFLLVSLVYPFYEGLIWNGNFGFQAWLTHQFGAAFHDYA
                     GSMVVHGMGGWIAIAAVLLLGPRHGRYGKNGEIFAHPPSNIPFLALGSWILAVGWFGF
                     NVMSAQNIAGISGLVAVNSLMAMVGGILSALVVGRNDPGFLHNGPLAGLVAVCAGSDV
                     MHPVGALVTGLIAGGLFVWLFTFVQNRLKIDDVLGVWSLHGVCGLWGALAAGIFGLKA
                     LGGVGGVSFISQFIGSAVAIAVALGAGFVIYGMLKLFIGIRLTEEQEYEGADLTVHRI
                     SATPKYD"
     gene            365792..365881
                     /locus_tag="HNEAP_RS01790"
                     /old_locus_tag="Hneap_R0008"
     tRNA            365792..365881
                     /locus_tag="HNEAP_RS01790"
                     /old_locus_tag="Hneap_R0008"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:365826..365828,aa:Ser,seq:gct)
     gene            366741..366911
                     /locus_tag="HNEAP_RS12440"
     CDS             366741..366911
                     /locus_tag="HNEAP_RS12440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AlpA family transcriptional regulator"
                     /protein_id="WP_081441173.1"
                     /translation="MDSILRLREVLRICGASRSSVYLWVNAGIFPPPIKIGARAVGWR
                     RSAVQKWLDERS"
     gene            complement(367010..369424)
                     /locus_tag="HNEAP_RS12445"
                     /old_locus_tag="Hneap_0361"
     CDS             complement(367010..369424)
                     /locus_tag="HNEAP_RS12445"
                     /old_locus_tag="Hneap_0361"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="relaxase"
                     /protein_id="WP_012823260.1"
                     /translation="MKAKITRGMGFRGVLDYALDTGNQKGKNPEIVGGTLTVGNARAM
                     SAQFAVTRRLRPDIKAPVWHASLALPIGERLSSDKWSSIADEFMQAMGFPSDSLYTVI
                     RHNDTQYDHVHIIASRISLSGALWHGQWEVYRAIKATQTLERIHDLILTPGLGEPKDE
                     KSLTKNEIEMALCTGEEPPRQRLQRLVKEAAQGRPTAVMFAERLALAGVGVRFQIQKT
                     GITGVSYEIDGIAFKGQSLGDAYKWSKFSKKQAVSYEQARDSEGIRQFTTAIADRARG
                     DKLGDSSTHLENDTGIATTNHRGADDPSTGTPDLVEGGSNTSPDRLRHSDSSAAPGTG
                     RADAGDDRQSSAGIRAEGGEAESDHLDFVAASAGTEIKHRQDDENRPPDRIDTPETRR
                     ITSANDYSGRGTDADGTTDAATKVENSTGADSGRDGQRSGSSDWSRRFREASAAKRRT
                     AERGMGGSRLGERNARRASVADEDRQSAREIDPSSYLKTMGFAVKKQGRHVSVSLNGD
                     ETYRGTLKPDGHFVWCDRYENGIGHNIDLVNEIEPGSGYATAVYRLLGAPSVNPNLQR
                     AAPKRQPPRLPEQAVANRLSGRAYLGNERGISKDTLDHAEACGMLRYADGGVLFVGYD
                     AKGTPQSITRRATELADPIQKRDFARSDKSYAPILSGDPSTVWIVEGGVDALALHDLA
                     KRQEQPSPTVIVSGGANVRSFLDNPFIQMIIRAAKRIFIAMEREKDAATQAKTDAAHE
                     QQAQRVEEITGIRPLIWQPKKDKDLADMNHRQQKPQPVRLMRDAIKQSTVKLPSTVMK
                     DDFTQG"
     gene            complement(369414..369818)
                     /locus_tag="HNEAP_RS01810"
                     /old_locus_tag="Hneap_0362"
     CDS             complement(369414..369818)
                     /locus_tag="HNEAP_RS01810"
                     /old_locus_tag="Hneap_0362"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823261.1"
                     /translation="MKPIDQSRTSRRPRRGHALPETERRRHAVMLRVNDAELAEIDAR
                     RGIYDRGEFLRMALFGMTQARPRPAMVIPTLNQSAWLELSRSASNLNQFARHLNEAGI
                     QLGDLPQIIILLNQFRDALIGVRLTEDMDDES"
     gene            complement(370195..371868)
                     /locus_tag="HNEAP_RS01815"
                     /old_locus_tag="Hneap_0363"
     CDS             complement(370195..371868)
                     /locus_tag="HNEAP_RS01815"
                     /old_locus_tag="Hneap_0363"
                     /inference="COORDINATES: protein motif:HMM:PF04830.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823262.1"
                     /translation="MLIEPRIDLLPGLPSEAKPGKPSNRTMGALLTIGLVFAWFSSQG
                     HMTAGHIQANQGDLTLAAVQAKATGTSEPSDGSDGPVHSPGQISLKAAGNINLASVST
                     ESYQRTDEKHKDKAWQETHGEGNYDQQTHYNQLTAGQLDLQAGGSITADMSVRDSAAM
                     LAQSPDMAWLRQLQQNPKLVGKVDWQQIEEAHQHWDYKHQGLTPAASAVVALVVAYFT
                     MGAGSAIVNTAAGSTTAAASGAGAVAAGMTQAAVSTMASQAAVSFINNGGDLSKTLND
                     LGSSQSMRQLATAVVTAGVLSSIGQVTFGEGKNAFRLNDVKVSDGLVPNIGKNLIDGV
                     ARATVNSAITGTDLQTNIRTNVVAGILGAAEQQGANWIGNQTLLGGDFNTNGNVNEFA
                     HEFAHAIVGCAAGVAGASASGSGASTGQGCSAGALGAVVGELSAQFYGGTDPNQTIAF
                     AQMMGGIAAAAAGLGSEGVAIAANTGANAAQNNYMAHYDTYEADLKDCQQNPGGVNCG
                     AILSLTEPTSVQTHQTLSPLAQCAQAHRLSGRHERSDLPSRDFASSFDI"
     gene            complement(372103..372546)
                     /locus_tag="HNEAP_RS01820"
                     /old_locus_tag="Hneap_0364"
     CDS             complement(372103..372546)
                     /locus_tag="HNEAP_RS01820"
                     /old_locus_tag="Hneap_0364"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823263.1"
                     /translation="MSNFSKLQAIVNGFNFKKGDYVGAEDQLSRFAESYAQLSLEDAE
                     LLRSKFDSKDRLGWLRIASTLFVKGFADADSMEKEKLCRIFFALYSFENLEFGFDGAM
                     DVISVSDQRKAMLAWLKGIGSNLANSLVMMPQKTIWKIRYSLPNE"
     gene            complement(372550..372795)
                     /locus_tag="HNEAP_RS01825"
                     /old_locus_tag="Hneap_0365"
     CDS             complement(372550..372795)
                     /locus_tag="HNEAP_RS01825"
                     /old_locus_tag="Hneap_0365"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823264.1"
                     /translation="MKLLELEKYLSKLKLHPDAYSIGIGLPEADETYCIVNEDGLWRI
                     YYAERGQRGDMREYDSEDEACNAFIELLKSDKSVWLR"
     gene            complement(372792..376835)
                     /locus_tag="HNEAP_RS01830"
                     /old_locus_tag="Hneap_0366"
     CDS             complement(372792..376835)
                     /locus_tag="HNEAP_RS01830"
                     /old_locus_tag="Hneap_0366"
                     /inference="COORDINATES: protein
                     motif:HMM:PF04830.11,HMM:PF13332.4,HMM:PF14021.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600329.1"
                     /translation="MGNRGFIGTGRRFLTGYSSDEAQFQALMNAGVAYAKQWHLIPGV
                     ALTAAQVAQLSSDMVWLVAKDVQLPNGKTERVLVPQVYAASNPNDPGSNGSLISANRI
                     QTLGQGTWTNSGTIAGRQLVAVGADDINNLGGRILGQSVSLSARNDINNIGGSIVAGD
                     ALSLNAGRDINIVSTHQHVSNTVGASQFSRDSILQTAQLKVRNTDGMLLASAGRDLVL
                     TAANVDNAGTGTTGSEGPATQLQAGHDIRLTTLTTGQENRVVWDADNHDTHGNQQDVG
                     TRIHSAGDLAMIAGNDIQAKAAGIHSDNGTLNLQAGHDIQLTDGQSSTLWDEAHKLSS
                     SGLFSSSTSISRDNVSDSRSVATKLSGQSVQLSANHDIALQGSQIDANGNIALLAGDN
                     ISLLAGRNQHSESHYREERKSGFTTKGYGKSHTIDTVDMASLLNDGSSLHSTQGNITL
                     AANLAEQNQADQGAVLIEGSQVHADHGRVDVSGKHVILSTSEDQQQYSHSHQSTHSNW
                     AFITGLPDGMRDGLDTQQQTITVNGSTLQGQKGVGAQATGLVDMTAAHLKASQGDIDI
                     SGAQVAIRSGTNQQASSSRETHKKSGISWRDLTGLFTPGKGVGYDATLDKKSSKTTVA
                     HATLEGQNIHIQANQGDLTLAAVQAKATGTSEPSDGSDGPVHSPGQISLKAAGNINLA
                     SVSTESYQRTDEKHKDKAWQETHGEGNYDQQTHYNQLTAGQLDLQAGGSITADMSVRD
                     SAAMLAQSPDMAWLRQLQQNPKLVGKVDWQQIEEAHQHWDYKHQGLTPAASAVVALVV
                     AYFTMGAGSAIVNTAAGSTTAAASGAGAVAAGMTQAAVSTMASQAAVSFINNGGDLSK
                     TLNDLGSSQSMRQLATAVVTAGVLSSIGQVTFGEGKNAFRLNDVKVSDGLVPNIGKNL
                     IDGVARATVNSAITGTDLQTNIRTNVVAGILGAAEQQGANWIGNQTLLGGDFNTNGNV
                     NEFAHEFAHAIVGCAAGVAGASASGSGASTGQGCSAGALGAVVGELSAQFYGGTDPNQ
                     TIAFAQMMGGIAAAAAGLGSEGVAIAANTGANAAQNNYMAHYDTYEADLKDCQQNPGG
                     VNCGAILSLTEGTNARYLGMTQGGYRVAANMGKDGAASYTVVSPNGEMMVMQPTEWAY
                     FSQMTSGQQATIFAGSQWQLDLTSATEYGLAGDTTAAMANYAHMLTQPDYWIGMGAAF
                     LPAGVLGRAATATDEAALLGRGAAGDATRGIPRNKSLVPFNPPNDGFLGAPLDFTLIL
                     GTRIDRIGFDGGRFLSPAGTPIPMRALRPGTETRPLRTFEVIRPLDVRAGEIAPAFGQ
                     PGLGTQFVTDRPVRDLLREGFLRSVDP"
     gene            <376812..377594
                     /locus_tag="HNEAP_RS01835"
                     /pseudo
     CDS             <376812..377594
                     /locus_tag="HNEAP_RS01835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005371083.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family transposase"
     gene            <377632..378186
                     /locus_tag="HNEAP_RS01840"
                     /pseudo
     CDS             <377632..378186
                     /locus_tag="HNEAP_RS01840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013964261.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family transposase"
     gene            complement(378521..378835)
                     /locus_tag="HNEAP_RS01845"
                     /old_locus_tag="Hneap_0369"
     CDS             complement(378521..378835)
                     /locus_tag="HNEAP_RS01845"
                     /old_locus_tag="Hneap_0369"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823266.1"
                     /translation="MVKIDDWNDPKLMEAILIWTGYGDSMSPRRDSSMVVQRFGSEAT
                     KWISLIELLEDEFYESKANFESANMQEMSAMVIADFRKKYPEVPDEITKALAWCYTFD
                     NR"
     gene            complement(378823..386097)
                     /locus_tag="HNEAP_RS01850"
                     /old_locus_tag="Hneap_0370"
     CDS             complement(378823..386097)
                     /locus_tag="HNEAP_RS01850"
                     /old_locus_tag="Hneap_0370"
                     /inference="COORDINATES: protein
                     motif:HMM:PF04830.11,HMM:PF05860.11,HMM:PF13332.4,
                     HMM:TIGR01731"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441083.1"
                     /translation="MHSMKIEQKCNSIARTAQQRQSVPAVAPIGYRVLVFLLSAIIPP
                     SANASGIAADHQAPAYQQPTIQVTANGTPEANIQTPGVDGVSHNVYKQFDVGSKGVIL
                     NNARTNAQTQLGGWIQGNPNLANGSARVILNEVNSSQPSQLNGYVEIGGQRAELVIAN
                     PSGINVDGGGFINASRATLTTGKPVFQNGTLAGYQVSNGSININGAGLDASSTDYTDI
                     LARAINVNAGIWANQLKLVTGSNDISPDGTQITPTSGDANKPGFGIDVAQLGGMYAGK
                     ITLIGTEAGVGVRNAGQIGASDNLVLNANGELTNSGQITSQGTTTAQTNVIDNSGTIY
                     AQDNAQLNANGDITNSGRILAQGNLGLDAATDVVNLDGAILGAGVQPDGSLGGARNLT
                     IASGQNARLQGKNLASGNLTAKGNTVDLSHSQTQADSITLTATHGDIDASSATITAQH
                     QLQANASGSFINDQAQTAAGTLQLKAANLSNLDGLILLGDSSGASDITLSNLFDNRGG
                     LLHTTGEMQITANQVDNRNTTQSAQGIQGNDVTITADRINNGSGHILANQNIQLNSAG
                     QIDNSQGLVSAGGNLSAQDGQATRSLAITNTQGTFVAGQNLAVTSATLSGDGQLYAQQ
                     DIHLLLDGGFDNSGTLIANHDTDLNIGGILTNSGTLQAGNTLTAHAGTIDNQASGQIS
                     AAEDRINATGKLTNRGLIDGGTTRLQANTIDNLGTGRIYGDHIAIGANDLTNENENGT
                     AGTIAARNRLDIGVQTLENKEHALIYSAGDMSIGGALDANDQATGQAVHLTNSSATID
                     ADGQIQLSAQTIDNLNAHLVTSQVDDATVTHEYVQPRGQSQLFDISACSGIGGGQDKN
                     SCNGYPGTFEDYTLFIVHSTPSHTIVVSSDPGKIQAGGDIVINGALNNRDSAVIAGGD
                     LVASQPVSNTATKGQDITRSTGTAELTTVESCGLFGSDHCREWHGQSAYNPAPVYGTP
                     YDLPTLTYQTHTLIGGTAPTIGNRSATGTSQPVSQPINTSGGYAWTQPNITLRSSSLF
                     QVHDDNGNHPLIETDPRFADYRQWLSSDYMISALSLQPDSLLKRLGDGYYEQKLVQDQ
                     VAELTGRRFLTGYSSDEAQFQALMNAGVTYAKQWHLIPGVALTAAQVAQLSSDMVWLV
                     AKDVQLPNGKTERVLVPQVYAASNPNDPGSNGSLISANRIQTLGQGTWTNSGTIAGRQ
                     LVAVGADDINNLGGRILGQSVSLSARNDINNIGGSIVAGDALSLNAGRDINIVSTHQH
                     VSNTVGASQFSRDSILQTAQLKVRNTDGMLLASAGRDLVLTAANVDNAGTGTTGSEGP
                     ATQLQAGHDIRLTTLTTGQENRVVWDADNHDTHGNQQDVGTRIHSAGDLAMIAGNDIQ
                     AKAAGIHSDNGTLNLQAGHDIQLTDGQSSTLWDEAHKLSSSGLFSSSTSISRDNVSDS
                     RSVATKLSGQSVQLSANHDIALQGSQIDANGNIALLAGDNISLLAGRNQHSESHYREE
                     RKSGFTTKGYGKSHTIDTVDMASLLNDGSSLHSTQGNITLAANLAEQNQADQGAVLIE
                     GSQVHADHGRVDVSGKHVILSTSEDQQQYSHSHQSTHSNWAFITGLPDGMRDGLDTQQ
                     QTITVNGSTLQGQNGVGVQATGLVDMTAAHLKASQGDIDISGAQVAIRSGTNQQASSS
                     RETHKKSGISWRDLTGLFTPGKGVGYDATLDKKSSKTTVAHATLEGQNIHIQANQGDL
                     TLAAVQAKATGTSEPSDGSDGPVHSPGQISLKAAGNINLASVSTESYQRTDEKHKDKA
                     WQETHGEGNYDQQTHYNQLTAGQLDLQAGGSITADMSVRDSAAMLAQSPDMAWLRQLQ
                     QNPKLVGKVDWQQIEEAHQHWDYKHQGLTPAASAVVALVVAYFTMGAGSAIVNTAAGS
                     TTAAASGAGAVAAGMTQAAVSTMASQAAVSFINNGGDLSKTLNDLGSSQSMRQLATAV
                     VTAGVLSSIGQVTFGEGKNAFRLNDVKVSDGLVPNIGKNLIDGVARATVNSAITGTDL
                     QTNIRTNVVAGILGAAEQQGANWIGNQTLLGGDFNTNGNVNEFAHEFAHAIVGCAAGV
                     AGASASGSGTSTGQGCSAGALGAVVGELSAQFYGGTDPNQTIAFAQMMGGIAAAAAGL
                     GSEGVAIAANTGANAAQNNYMAHYDTYEADLKDCQQNPGGVNCGAILSLTEGTNARYL
                     GMTQGGYRVAANMGKDGAASYTVVSPNGEMMVMQPTEWAYFSQMTSGQQATIFAGSQW
                     QLDLTSATEYGLAGDTTAAMANYAHMLTQPDYWIGMGAALIPTSVLGRTAGMTNQLAT
                     GTNKAMFWSGLGRGGDKIAARAAAQQGKMTLESTLAARGIKLPKWDPDNPEVVSAWRQ
                     ASHDFAAGARGNVRVLQGDVLRGNSVWAEVEFPALKANPTVKSITSIDAATGKEVLLW
                     SR"
     gene            complement(386116..387873)
                     /locus_tag="HNEAP_RS01855"
                     /old_locus_tag="Hneap_0371"
     CDS             complement(386116..387873)
                     /locus_tag="HNEAP_RS01855"
                     /old_locus_tag="Hneap_0371"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012823268.1"
                     /translation="MFQPTDGLSLHQQSRQPFDVFMRRVFLCALFSLLWGASGAWAQP
                     PVASSSVQQELLQQQRQRALEQGQQATPDVRLQKGLAKLPSTLPKHETPCVFINQVTL
                     GGEGAGQFSWAIKTASRALGGIKGRCIGTNGIQILVKQVQNAILARGFITTRVLVTQQ
                     NLNDHKLTLTIIPGRIGAIRLAKGSNPRGTLWNAFPAKPGDLLNLRDLEQGLENLQRL
                     PTASTHINIKPGEQPGTSDIVTDWQQRFPFRLSMWVDDAGSEATGHYEGTVVLSYDDW
                     FTLNDLFYASFTRDLGLDNGRNKRGTQSYTFHYSVPYGYWLLGFTTNRFRYYQTVAGI
                     NQDYRYSGTGTRQDLKLSRIIHRNAHGKTRVSLDAYLQTYGNAIDDTTIEVQQRRMAG
                     YIFDIHQRQFIGRATLDMDVGYRWGTGALGAEPAPEEAYGGGTSRPHIASASIQFNTP
                     FSALGQSWRYQGELRGQYNYTPLIPQDRFAIGGRYTVRGFSGEQVLSSERGLIFRNDL
                     GIVIAGNNELYLGLDYGQVGGSSAQQLLGTRLAGGVIGIRGAYKLLNYDVFAGHAIAK
                     PDGFPAKGITAGFNIGWTI"
     gene            complement(388197..388487)
                     /locus_tag="HNEAP_RS01860"
                     /old_locus_tag="Hneap_0372"
     CDS             complement(388197..388487)
                     /locus_tag="HNEAP_RS01860"
                     /old_locus_tag="Hneap_0372"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012823269.1"
                     /translation="MTVHNQPHPGAFIRQIYLEPHQLSVRALAESLGVAPSTVTRIIN
                     GHSAISPEMALRLAKALGRSAESWLAMQHNYDLWQAKQITDLIRVKSIEFAA"
     gene            complement(388487..388765)
                     /locus_tag="HNEAP_RS01865"
                     /pseudo
     CDS             complement(388487..388765)
                     /locus_tag="HNEAP_RS01865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009722156.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="Killer protein"
     gene            complement(388762..389103)
                     /locus_tag="HNEAP_RS01870"
     CDS             complement(388762..389103)
                     /locus_tag="HNEAP_RS01870"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049772441.1"
                     /translation="MKAKEEHRIPLIDAAINILKTQPRIVGNDHLFFGQSKQRNGLSN
                     MAMLLLLKDDKASGGLGYPQATVHGFRSAFRDWAGETTQHRRKECLMKSAGKSSMLRA
                     TQRNAVTYSPP"
     gene            complement(389193..389444)
                     /locus_tag="HNEAP_RS01875"
     CDS             complement(389193..389444)
                     /locus_tag="HNEAP_RS01875"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049772442.1"
                     /translation="MTAPARREVVRLMKQSGMSERHALRVVGMSVSALHYEPRPDSES
                     QSQARGAPVRTGESAGAPTPEQEDPTGGSIAAVPACCGQ"
     gene            complement(389710..390156)
                     /locus_tag="HNEAP_RS01885"
                     /old_locus_tag="Hneap_0376"
     CDS             complement(389710..390156)
                     /locus_tag="HNEAP_RS01885"
                     /old_locus_tag="Hneap_0376"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823270.1"
                     /translation="MRAILFIFLFLSFSSSAMADEGMIEQASPYSVTQTMQRLEMAIR
                     KGGLTIFAVIDHAKGAAKVGQKLRPTQLIIFGSPKGGTPLMQCNQTAGIDLPLKILVW
                     ENAQGKVMLGYNDPVWIAKRHNVPDCAVAPKLHKNMAKLVQKALEQ"
     gene            391181..391453
                     /locus_tag="HNEAP_RS12450"
                     /old_locus_tag="Hneap_0378"
     CDS             391181..391453
                     /locus_tag="HNEAP_RS12450"
                     /old_locus_tag="Hneap_0378"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc/iron-chelating domain-containing protein"
                     /protein_id="WP_012823272.1"
                     /translation="MTSPHTFECRAGCGACCIAPSISSPIPDMKRGKPAGVACVQLTD
                     DFRCAIFGKPERPRCCSGLSPNIEMCGVSQAQALEWLTSLEEDTKP"
     gene            complement(391719..393110)
                     /locus_tag="HNEAP_RS01890"
                     /old_locus_tag="Hneap_0379"
     CDS             complement(391719..393110)
                     /locus_tag="HNEAP_RS01890"
                     /old_locus_tag="Hneap_0379"
                     /inference="COORDINATES: protein motif:HMM:PF03349.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic hydrocarbon degradation membrane
                     protein"
                     /protein_id="WP_012823273.1"
                     /translation="MVFKRSLLAASVAATLIASGAAHATNGYFSHGFGVKSIGMGGSG
                     VALPNDSAMIIATNPAGITETGTQINFDISWFHPVRGYDQTGVPASGDSNSNNFYIPE
                     LSASYQLNDNSALGIAIYGNGGLNTDYEPNATSIATGQPAGAFATAPGTGGEGGVNLK
                     QMFIAPTYAHKFMNGKLSVGATLLFARQTMQVKGLDGFGGFSTDPTHLTSNKVSSSTG
                     WGGKIGVLYHATDAISLGGSYQTKMHMSKFDDYSGLFSDGGKFDIPSTWTVGGAFKVA
                     PTWTLTADFQRINYADVAAIGNPSTGYLLGNGMPGNGCAGGDTSKCLGGSNGAGFGWS
                     NVNVIKIGAQWQATPALQLRAGFNHGTNPVGSEDVVFNALAPGVMKNHFTAGFTYAID
                     KHQEISGAFMYAPKVTVTGSNPIPSALTYQGALMSGATQAQAQAAAGNVPATTTSIHM
                     KQYEATIGYAYKF"
     gene            complement(393520..394365)
                     /locus_tag="HNEAP_RS01895"
                     /old_locus_tag="Hneap_0380"
     CDS             complement(393520..394365)
                     /locus_tag="HNEAP_RS01895"
                     /old_locus_tag="Hneap_0380"
                     /EC_number="5.1.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="WP_012823274.1"
                     /translation="MTIHFTKMHGLGNDFMVIDAINQAIELNPEQIRQWANRHFGIGF
                     DQLLIVEPPKTADTLFTYRIFNADGGEVEQCGNGARCFARYVYDKGLTTEKEIPVGTA
                     SGRIVLHINDSGDVTVDMGRPMFTPTNIPFITECEATSYPLTLDDGSEWVIDAVSMGN
                     PHAVLEVENVDTAPVSHLGPMIEHHRQFPNRVNVGFMQIVDRQHIRLRVFERGSGETL
                     ACGTGACAAVVSGIRRNRLDSPCLVDVRGGRLSVAWTGKTQDSVLMTGPAQSVFEGQI
                     TQTIA"
     gene            394554..394997
                     /locus_tag="HNEAP_RS01900"
                     /old_locus_tag="Hneap_0382"
     CDS             394554..394997
                     /locus_tag="HNEAP_RS01900"
                     /old_locus_tag="Hneap_0382"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823275.1"
                     /translation="MIVQAVWVDLAALFDFQPDDKLVLFPDALDAFEQWRALELKVVG
                     ITADVRRYGSRLSSVFDETFVVIDRPLPQWRQMETWLDLAQEMAVSPEQIVFITSTPM
                     LMSFARRTGLRTVGVLRDPHTMAVLDGYWVDSLADIDWQDPRFFE"
     gene            395075..396916
                     /locus_tag="HNEAP_RS01905"
                     /old_locus_tag="Hneap_0383"
     CDS             395075..396916
                     /locus_tag="HNEAP_RS01905"
                     /old_locus_tag="Hneap_0383"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translational GTPase TypA"
                     /protein_id="WP_012823276.1"
                     /translation="MDAPVISHLRNIAIIAHVDHGKTTLVDKLLQQSGTLDARTDTGE
                     RMMDSNAIEKERGITILAKNTAIRWTSPSGEEYRINIVDTPGHADFGGEVERVLSMVD
                     SVLLLVDAVDGPMPQTRFVTQKAFEHGLKPIVVINKIDRPGSRPQWVVDQVFDLFDRL
                     GASDEQLDFPIVYASALNGYAGLEDSVREGDMTPLYQTIVDSVAPPDVDAEGPLQMQV
                     SSLDYNPYMGVMGIAKIQRGRIKTNTQVKVVDREGAIRSGRILQIMGFHGLERIEVPS
                     AQAGDIIVFSGLDPLFISDTICDPEHVEMLPPLTVDEPTVSMSFNVNTSPFAGKEGKF
                     ITSRQIRDRLHKELLHNVALRVEDTEEGDKFRVSGRGELHLSVLIENMRREGFEMGVG
                     RPEVIIREVDGVKQEPYEQLVVDIEEQNQGAVMEKLGTRRAELRNMEPDGKGRVRLEY
                     IIPSRGLIGFRTEFMTATQGTGLLFSVFDHYGEYKPGNVGQRINGVLIANETGKALSY
                     ALYNLQDRGKMMIGHGDEVYEGQVVGIHSRDNDLTVNVLKGKKLTNMRASGTDEALTL
                     VPPIRFTLEQALEFIDDDELVEVTPASIRIRKKWLTELDRKRYGRGD"
     gene            396964..398319
                     /locus_tag="HNEAP_RS01910"
                     /old_locus_tag="Hneap_0384"
     CDS             396964..398319
                     /locus_tag="HNEAP_RS01910"
                     /old_locus_tag="Hneap_0384"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007636101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle protein"
                     /protein_id="WP_012823277.1"
                     /translation="MFENLSQRLGGLFDGLRGQGRLTEDNIKDALREVRMALLEADVA
                     LPVVRDFVNQVKERAVGAEVIKSLKPGQVFIKVVSDELTALMGAENSALNLAAQPPAV
                     VLMAGLQGAGKTTTVGKLGRLLRTREQKKVLVVSADVYRPAAIKQLETVAKQVGVDFF
                     PSDAGQKPLDIVQSALKQARVGFYDVLIVDTAGRLHVDAEMMDEVRQLHAALNPVETL
                     FVVDAMTGQDAANTAKAFNEVLPLTGVVLTKADGDARGGAALSVRAITGKPIKFIGMG
                     EKLDALEPFHPDRIASRILGMGDVVSLVEEAQRTLDTSKAQALAEKVRTGKGFTLVDM
                     RDQFEQMLNMGGIHGLMDKLPGMGKLTADAKANIEDRDVHRMIAIINSMTIQERLHPE
                     LIKGSRKRRIALGSGMQVHDVNRLLKQHRDMSDMMKKFSGGGMKKMMRALKGRIPGMP
                     M"
     gene            398461..398544
                     /locus_tag="HNEAP_RS01915"
                     /old_locus_tag="Hneap_R0009"
     tRNA            398461..398544
                     /locus_tag="HNEAP_RS01915"
                     /old_locus_tag="Hneap_R0009"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:398495..398497,aa:Leu,seq:tag)
     gene            398612..399910
                     /locus_tag="HNEAP_RS01920"
                     /old_locus_tag="Hneap_0385"
     CDS             398612..399910
                     /locus_tag="HNEAP_RS01920"
                     /old_locus_tag="Hneap_0385"
                     /inference="COORDINATES: protein motif:HMM:PRK01490.1-1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="WP_012823278.1"
                     /translation="MQVELQSSEGLIRRLAIEVPASEIDVEVDRRIKDMSRRVRLDGF
                     RPGKAPLPVVRQRYEGQVREEVVGDVMGRNYQAAIAEQQLRPAGNPVIESVDAQPGTN
                     LKFVAAIEVYPEFEIGDLSVIEIETTTAEVTDADVADMLSTLREQHADWQNVDRAAKD
                     GDRVTVNFAGKVDGEAFQGGSGEGMQVVLGEKRMLADFEKGLAGIAVGEPERVFDVAF
                     PEDYPVENLQGKTAQFTVTATAVEEKVLPELNDEFAARFGSATVAELESDVRKNMERE
                     LKQALKRHTKDVVLTAVTDSLTFDVPKALVDEEAVVMRDGFVRQQMPHADASALDAGL
                     FSEQAAKRVKMGLVIMEIVKSADLQVDDALVDEFINDIAAAYDEPDQVVATYKGDREM
                     MSNARTVVLEQQAVDHVLSKAKVTQKSQDFKSVMNPAPQA"
     gene            400076..400708
                     /locus_tag="HNEAP_RS01925"
                     /old_locus_tag="Hneap_0386"
     CDS             400076..400708
                     /locus_tag="HNEAP_RS01925"
                     /old_locus_tag="Hneap_0386"
                     /EC_number="3.4.21.92"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="WP_012823279.1"
                     /translation="MIFGSQTTAGLSSPELAALVPMVVEQTSRGERAYDIYSRLLKER
                     VVFVVGPIEDHMANLIVAQLLFLESENPDKDIHLYINSPGGVVTAGMSIYDTMQFIKP
                     HVSTLCIGQAASMGSILLSGGEPGKRFALPNSRVMIHQPLGGFQGQASDIKIHAEEII
                     KLRHSLNGVLAKHCNQPMEVIERDTDRDKFLSASEAVEYGLIDAVLDKRA"
     gene            400769..402073
                     /locus_tag="HNEAP_RS01930"
                     /old_locus_tag="Hneap_0387"
     CDS             400769..402073
                     /locus_tag="HNEAP_RS01930"
                     /old_locus_tag="Hneap_0387"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpX"
                     /protein_id="WP_012823280.1"
                     /translation="MAKSTQSEQDLSCSFCGKPQAEVRKLIAGPSVYICDECVELCND
                     ILREEISAAKDESPARLPTPKELVEALDEYVIGQQRAKRALAVAVYNHYKRLNLFGST
                     RKVAEKDKDSDSEPVELSKSNILLIGPTGSGKTLLAQTLARVLDVPFAIADATTLTEA
                     GYVGEDVENILQKLLQRCDYDVEKAQHGIVYIDEIDKITRKSENPSITRDVSGEGVQQ
                     ALLKLIEGTQASVPPQGGRKHPQQEFVQLDTTNILFICGGAFSGLDSIIRQRIEKGGI
                     GFSAEVKSKDDKRAADELLTQIESEDLTRYGLIPEFIGRLPVIATLNELDEAALVKIL
                     VEPKNALTKQYMRLFEMEGVELDLREDALREVARQAIKRKTGARGLRTIVEHVLLDTM
                     FDVPSTENVQKVVVDASVVRGENAPYLLFDQAESLPKAASDK"
     gene            402313..404745
                     /locus_tag="HNEAP_RS01935"
                     /old_locus_tag="Hneap_0389"
     CDS             402313..404745
                     /locus_tag="HNEAP_RS01935"
                     /old_locus_tag="Hneap_0389"
                     /EC_number="3.4.21.53"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endopeptidase La"
                     /protein_id="WP_012823282.1"
                     /translation="MPHNDTTSEVIAGTPRTVPVLPLRDVVVYPHMVIPLFVGREKSV
                     SALEEAIKGSKQLLLVAQKDADLDDPGRKDLHAVGTLASILQLHKLPDGTIKVLVEGV
                     ERVRCVQVHEVDQYLVAEVHAIEEPKEQPDRELEVEARTLLNQFDGYVKLNKKTPPEV
                     LTSLAGIDDVSRLADTIAAHMALGLDEKQKILETIDLHARIEQLMVLIESEIDTLQVE
                     KRIRGRVKQQMEKSQREYYLNEQMKAIQKELGDLEEGGSDLDELERKILTAGMPKEAL
                     EKAKSELNKLKMMSPMSAEASVVRNYLDWIVAVPWKKRTKIKHDLGVAEQVLEADHFG
                     LEKVKERILEYLAVQQRVRKMNGPILCLVGPPGVGKTSLGQSIAKATNRKFGRIALGG
                     VRDDAEIRGHRRTYVGALPGRIVQTLSKIGSRNPLILLDEIDKMASDFRGDPASALLE
                     VLDPEQNKAFADHYMDMDIDLSEVMFVCTANSLNIPGPLLDRMEVIRIAGYTEDEKTE
                     IAERYLLPKQLEKNGLKDKELSIDTSAVRDVIRYYTREAGVRNLERELAKVSRKVVRK
                     LVTNEEKAPITVDSSSLDQYLGVHRFDFGKVEHPDQVGQVTGLAWTEVGGDLLTIEAA
                     TMPGKGNLKYTGQLGEVMQESIQAAMTVVRSRAVSLGIDPDFSQKTDIHVHVPEGATP
                     KDGPSAGGAMCTTIVSALTGIPVKSTVAMTGEITLRGEVLPIGGLKEKLLAAQRGGIK
                     LVLIPEGNRKDLAEIPEKIKASLDIRPVRWIDEVLDVALVTPPTPKPVALQDAVPSAE
                     VKRADDQSAHAH"
     gene            405027..405299
                     /locus_tag="HNEAP_RS01940"
                     /old_locus_tag="Hneap_0390"
     CDS             405027..405299
                     /locus_tag="HNEAP_RS01940"
                     /old_locus_tag="Hneap_0390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012981989.1"
                     /note="histone-like DNA-binding protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012823283.1"
                     /translation="MNKSELIDAMAAKSGMKKTESAAALDAFIEAVGDALKKGDQVTL
                     VGFGTFLVREREARTGRNPRSGETIEIAASRLPSFKAGKGLKDAVN"
     gene            405502..407439
                     /locus_tag="HNEAP_RS01945"
                     /old_locus_tag="Hneap_0391"
     CDS             405502..407439
                     /locus_tag="HNEAP_RS01945"
                     /old_locus_tag="Hneap_0391"
                     /inference="COORDINATES: protein motif:HMM:PF13624.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_012823284.1"
                     /translation="MLMDLRERIQGWIAYAIIGLISIPFVLWGVGEYFSGGKNQPVAE
                     VDGLPISQQAFEQAVSQQRQAIIQKLGGSVSAEMLQSLNLDQQVLDQMINERVLRVFV
                     QKAGFRAPDAVVADLIRSEPAFKTDGAFDVKKYEAFVAARGTTVANFEAGLKQDIVMQ
                     TLENAISESTIVTAPELDQIVKLRDQTREIGMVRLDRARVIDTVAAPTDGAIEAYYAA
                     HKGEFIRPERVKLRYIELSPKTLAPSVKVTDAQVEQAYANYVKKQEAQVVRTVRHILI
                     SVPKNADGAAIEAAKNKALAARAAIVSGKTSFADEARAVSDDPGSKNKGGDLGEVAPG
                     QMVKPFEEAMDALKVGEVSEPVRTQFGWHLIEVTKESHPDIKPLADMRDKMVAEVQEQ
                     QVEKIYYNEGEKLSDQSYEHPDSLIPSAEALGLKVQASDWLDRNSGTGIAANEKVRQA
                     AFSKEVLKQKLNSNLIELGVNHAVVIRVDQHEPATQLTLAEVKDQIATTLKDQAIDKA
                     LADAAKNIGKKLTADADPQAVATAAGATWVAPVWLKRTARDAPIPAEAIQAAFALAPA
                     PDGQLASKALALSDGNEALVVVEAIKDGDPATISEQDKEALSAQIQQAQAQQTLGVLL
                     KALRDEAKITINQKAEKTATP"
     gene            complement(407619..408407)
                     /locus_tag="HNEAP_RS01950"
                     /old_locus_tag="Hneap_0392"
     CDS             complement(407619..408407)
                     /locus_tag="HNEAP_RS01950"
                     /old_locus_tag="Hneap_0392"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823285.1"
                     /note="Catalyzes a key regulatory step in fatty acid
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-ACP reductase"
                     /protein_id="WP_012823285.1"
                     /translation="MGFLSGKRVLIVGIANNRSIASGIAEAMQREGAELAFTYLNDRF
                     KEKVEKATAELGSNIYLPLDATSDEQIDALFPALAEHWPEGFDILVHSIAFAPREALD
                     GDYLDGMSREAFRVAHDVSAYSLAALAKAGRSTMRDNGAIVTLSYLGAERVMPNYNVM
                     GVAKAALEANVRYLAGSLGGRGIRVNSISAGPIKTLAASGIGEFKSFLDYVALNSPLK
                     RNVTIEQVGNTAAFLCSDLASGITGENVYVDSGYFITGMGQCPK"
     gene            408537..410513
                     /locus_tag="HNEAP_RS01955"
                     /old_locus_tag="Hneap_0393"
     CDS             408537..410513
                     /locus_tag="HNEAP_RS01955"
                     /old_locus_tag="Hneap_0393"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012823286.1"
                     /translation="MKNEHPSRHDQFTDDQRSRRDFLRYLLATGALAAGAGAFSRVGH
                     AAGFADALGYSPKYPANFNAFNYVNPDAPKGGRLSLSVFGNFDSLNPFVLKGLAASGL
                     NELCFESLTARAWDEPFSAYGLLADRADLAADGLSITFRINAKARFYDGSPVTARDVL
                     FSFNTLMSKQAHPRYRIYWADIAGTELTDARHVRFSFKRVNPELHLIIGELPVFSERW
                     LAGRDFASLSREAFLTSGPYRVGRVDYGNTITYERNPDYWAKDLDVRRGQFNFDQIVF
                     KYYKDETVSLEAFKAGEFDVFYETNSKRWARDYTGANFDDGRIIRREIPHKNNAGMQG
                     FGMNTRQALFSDRRVRRALDLALDFGWSNTHLFYGQYTRCDSYFSNSELACRGLPQGD
                     ELALLEPFKAQLPPELFREPYQVPVANNPAEQRANLLKARDLLAEAGWRVEEGVLKNA
                     EGQPFSFEITLAMRGFERIVAPYAYNLKRLGIEVSYRTIDVSLYQRKMDRFEFDMAVV
                     AYGESQSPGNELRDRFGSAAAHTDGSSNYMGIDSPVVDALIDRVIYAKSRAELVTACR
                     ALDRVLLWGEYLVPNWYIGAHRLAWWNRFGFHQPLPLYFDAMTWVMQTWWQVYEHPQK
                     QSKGHLEKPTALSDCVVACSFTRSWLKPAPRLST"
     gene            410515..411264
                     /locus_tag="HNEAP_RS01960"
                     /old_locus_tag="Hneap_0394"
     CDS             410515..411264
                     /locus_tag="HNEAP_RS01960"
                     /old_locus_tag="Hneap_0394"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823287.1"
                     /translation="MSRCSLNAKLAQARGSLHSNMLTRSWRQPVTVFRGAPLLLWLKR
                     SLLLAAVAALAGCATPQYATQTSYTPPQTAKGLICVAQCQDSLKQCQNSCSAARQSCI
                     AHIEPAARAAFDSALKTYEVQRRQYETDRQFYELNRSLRMGFFNPVFVPGYGWVMRPG
                     YYDDYYDDAPTPPVAPSLAKERQRMIHEQCDSAPCPCQENFEQCYVGCGGGVKKSVVC
                     IANCKDSDPKPSSGAESSPVVQQQTGSPSAN"
     gene            411276..411950
                     /locus_tag="HNEAP_RS01965"
                     /old_locus_tag="Hneap_0395"
     CDS             411276..411950
                     /locus_tag="HNEAP_RS01965"
                     /old_locus_tag="Hneap_0395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019868232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding negative transcriptional regulator"
                     /protein_id="WP_012823288.1"
                     /translation="MYRPPAFVENDRDTIARMIRAHPFGQLITCDQGRSEVTHLPFML
                     HWDKTIQGQGQGYGNSKGKLISHIARANPQWQHFAHGEEVLVVFQGPHTYISPSWYTN
                     FGVPTWNYAAVHVRGTVRLIEDEARLIAMLTELTETHEAAQPTPWVFDIDRERRAHLM
                     TMLVGFEIDISDIQATFKFNQNRSAEDRAGVIAALSQSPDANDQAVARLMREQMKSQK
                     KAGTNE"
     gene            411947..413011
                     /locus_tag="HNEAP_RS01970"
                     /old_locus_tag="Hneap_0396"
     CDS             411947..413011
                     /locus_tag="HNEAP_RS01970"
                     /old_locus_tag="Hneap_0396"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823289.1"
                     /note="with YejAEF is involved in resistance to microcin
                     C; Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="microcin C ABC transporter permease YejB"
                     /protein_id="WP_012823289.1"
                     /translation="MTGYIFKRLLLMIPTLFGILAISFAVIQFVPGGPVEQLVAQLKS
                     GGAGAAGAESGGGLSGGLYRGDQGLDTRQLDQIKSFYGFDKPAWQRFGDMLGNYLTFN
                     LGTSYFYQRSVTDLILEKLPVSISIGLWTFFLTYLVSIPLGIAKAVRDGSRFDTVTST
                     VILVGYAIPGFVLGLVLIVLFGGGSFWQWFPLRGLTSDNFDQLSIFGKITDYLWHIVL
                     PVTAMMVGNFAVMTMLTKNSFLEEIRKQYVLTARAKGLSERRILYGHVFRNALIPIVT
                     GFPAAFLGAFFTGSLLIETIFSLDGLGLLSYNAVIQRDYPVVLGTLYVFTLIGLIGKL
                     LSDLAYVWVDPRINFQAVNS"
     gene            413008..414048
                     /locus_tag="HNEAP_RS01975"
                     /old_locus_tag="Hneap_0397"
     CDS             413008..414048
                     /locus_tag="HNEAP_RS01975"
                     /old_locus_tag="Hneap_0397"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_012823290.1"
                     /translation="MSEQAAQVSHQGPWRRVWQRFVRHRRGYLSLWLFSILFVLSLGA
                     ELLANNRPLLVYYQHQLYLPLIHNYPETTFGGDFATNADYTDPYVIGKIREHGWLLRA
                     PIPFSYDTIDYYNPAPNPAPPNARHWLGTDDRGRDVAARLIYGFRLSVLFGFALTAIG
                     MVIGMLAGAVQGYLGGKVDLFFQRFIEVWGSLPELYLLIIFASIFQPSIGLLLILLSL
                     FGWIGLSDYVRAEFLKGRNLEYVRAARALGVSGPRIMFRHLLPNALTPVITFLPFRVS
                     GAILALTSLDFLGLGVPPSTPSLGELLAQGKNNIDAWWLSLTTFGVLVGTLLLLIFIG
                     EALRAAFDTRQK"
     gene            complement(414118..414513)
                     /locus_tag="HNEAP_RS01980"
                     /old_locus_tag="Hneap_0398"
     CDS             complement(414118..414513)
                     /locus_tag="HNEAP_RS01980"
                     /old_locus_tag="Hneap_0398"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc/iron-chelating domain-containing protein"
                     /protein_id="WP_012823291.1"
                     /translation="MGNPCQRCGACCAYFRVSFYWAESVPFLDGQVPPELTEQINPHL
                     VSMKGTLTSPARCVALEGGIGDCVSCSIYPNRPTPCRELEPWDEHGQPDEKCSRARAA
                     HGLPPLEPLYEPTAPHTPEIVDPLRTGTD"
     gene            414775..415542
                     /locus_tag="HNEAP_RS01985"
                     /old_locus_tag="Hneap_0399"
     CDS             414775..415542
                     /locus_tag="HNEAP_RS01985"
                     /old_locus_tag="Hneap_0399"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012823292.1"
                     /translation="MVKRFLGFVGLMALALSNISSAQAQETIYVYGPGGPAPAMKEAA
                     AVFEKETGTKVEVTAGPTPKWIEQAKTKGDIIYSGSENMMTDFTFQLDGQIKSDQVIP
                     LYLRPMAILVRPGNPKKIKGFEDIIKPGVKVLVVQGAGQTGAWEDIAGRLGNIQTVQS
                     LRSNIVDYAKNSALAKKAWIDQPDIDAWLIYNIWQVANPKLADVVEIEPQYAIYRDVG
                     VVLTQRAQANAQSKAFIKFLQSEQGEKIFVKWGWKAN"
     gene            416111..416392
                     /locus_tag="HNEAP_RS01990"
                     /old_locus_tag="Hneap_0400"
     CDS             416111..416392
                     /locus_tag="HNEAP_RS01990"
                     /old_locus_tag="Hneap_0400"
                     /inference="COORDINATES: protein motif:HMM:PF06865.9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823293.1"
                     /translation="MAITHNSYFDGAVQSLAFDFGNAGATVGVLAPGDHVFNLKARET
                     MTVVAGKMFVTINDMAEFPAAAGTTFDAPEGCTLRMRCDVDTAYLCEFH"
     gene            416802..418271
                     /locus_tag="HNEAP_RS01995"
                     /old_locus_tag="Hneap_0401"
     CDS             416802..418271
                     /locus_tag="HNEAP_RS01995"
                     /old_locus_tag="Hneap_0401"
                     /EC_number="3.4.16.4"
                     /inference="COORDINATES: protein motif:HMM:PF02113.13"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine
                     carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
                     /protein_id="WP_012823294.1"
                     /translation="MFLILPRRLRFFLLAAFFLGIGSANIQSATAAGAVGMPPSVLET
                     LKKQKLSLGDLGIWVQAVDSNKPLLTHLPDDLFNPASVMKLVTSVVALDVLGTNFQWT
                     TRVYADALPVNGVVHGNLYIKGEGDPWFRSEDLWDLVRQLSDLGIHEVTGKLVLDNSY
                     FDPGPADPSDFDDHPERVYNALPQALLLDNRATRVLIVPPDRSGAGAVVRAWPPNSNI
                     AINNDVKLVKGACTGQTNQPSIAVLGPDTNTPTLNVSGKISTECQPDQFYLVAGNAND
                     AFYSAFKHLFEGQGGKIDGTWAEGVVPKTAVYLVQHNSENLTQYLYLQNKWSNNLMAR
                     QIFLTMGAEIKGAPGTLLKSKAVIADWLKRQGFNWPGFDIENGSGLSRKARISPKEMG
                     QLLMYAWRSPTMPELMASLPIAGIDGTMRKRMRGEPARGMIHLKTGTLRDVRAGAGYI
                     ITQSGRRYVVVILQNEQNVQNGGGSKVQDAILDWLYDNG"
     gene            complement(418294..419646)
                     /locus_tag="HNEAP_RS02000"
                     /old_locus_tag="Hneap_0402"
     CDS             complement(418294..419646)
                     /locus_tag="HNEAP_RS02000"
                     /old_locus_tag="Hneap_0402"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent phosphohydrolase"
                     /protein_id="WP_012823295.1"
                     /translation="MSIPSLLPETTLRLRQSEIIGALSHALDLTEGLPAGHAQRCCWI
                     GMHIGQELNLNDHDRADLYYALLLKDAGCSSNAARIFNVYGCDDRILKRDFKLIDTHK
                     IDDMAKFAWSHVAPGESWLKRLPMLASLITKGSEIGEDLFLTRCEQGAEIAEQLGFSA
                     QVCDAVRGLDEHWDGRGNPRQLKGEQIPLFARIALLAQVIEIFFAEGGSALAMQTVRA
                     RAGTWFDPTLVHHLEKLAQNDEFWAGLQDPDIAARLVTIEPADYVRTVDDEELDRLAG
                     AFAAVIDAKSPYTFGHSSRVCQYAQRIGGEVGLSEKQLFWLRRAALLHDIGKLGVSNS
                     ILDKPGKLTDEEFAQIKLHPVHSMDILSKVGIFDSLAPVASGHHERLDGCGYPWGLKG
                     DQIDFATRIISVADVFDAVSAERPYRGAMPVAQALSILDDLSGPALDGDLVAALKRTL
                     "
     gene            complement(419701..421428)
                     /locus_tag="HNEAP_RS02005"
                     /old_locus_tag="Hneap_0403"
     CDS             complement(419701..421428)
                     /locus_tag="HNEAP_RS02005"
                     /old_locus_tag="Hneap_0403"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011629557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded-DNA-specific exonuclease RecJ"
                     /protein_id="WP_081441174.1"
                     /translation="MSSIDSRLAAILVNRGIVHPRQINPDLEFLLPPADMPGIDVAAD
                     ILADAVRENARILIIGDFDADGATATALCVRALRAMGAKQVEYTLPDRQRHGYGLSPA
                     LLKDWIAEADAPPDIILTVDNGIAAFAGVAAALTLNATVIITDHHLPGDTLPPAHAIV
                     NPNLNGSDFASKAIAGVGVAFYVMAALRERLSAQDWFAGGIARPNLARWLDLVAVGTV
                     ADVVSLDDNNRRLVAQGLARIQAQQCVPGISALFAVAGKDPRYASSTDLGFVVGPRLN
                     AAGRLEDMRIGVDCLLADDPISARQYAMTLNEINHERRALEQEMLFSLKKQGKSSGLN
                     ELDLDRPIDPADWVIFDDSFHQGVIGIVAGRLKERWQRPVFVFAPENNDAPRAKLKAS
                     GRSIPGVHLRDVLVSMATTAPDLMHAFGGHAMAAGLSLSFDQLDTFRRLFAREMAKHR
                     LHFPDQAIVHTDGPLSANELTLDFAQQLQTCTPWGTDCPEPIFDNRFEVLERTPLKEG
                     RHWRLRLRLLKTEPATPTIGADLTAVWFGIGDHIPAGKYWHLAYRIDINRFRGQQTLQ
                     LMIVSGVAA"
     gene            complement(421502..423019)
                     /locus_tag="HNEAP_RS02010"
                     /old_locus_tag="Hneap_0404"
     CDS             complement(421502..423019)
                     /locus_tag="HNEAP_RS02010"
                     /old_locus_tag="Hneap_0404"
                     /EC_number="3.6.1.40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012639020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolyphosphatase"
                     /protein_id="WP_012823297.1"
                     /translation="MMQNDSLVAAVDLGSNSFHMLIARVSDGQVQVVDRMKEMVRLAG
                     GLQSDGSLAEDAMDRGVACLTRFGQRVSGMPPGSVRIVGTNTLRAAKNGAEFIKRGEK
                     AIGHPIEIIAGREEARLVYLGVSRSEIPIDGDRLVVDIGGGSTELILGKGITPFKMES
                     VPIGCVALMRDFFADGVFDAARMDHAKTRAELELSPYKMAYLKAGWTQAIGSSGTARS
                     LATVIKANDWGEGAITAEGLAKVQSAVLKAGSLSALKLPGLSDDRKPVFVGGLIAMQA
                     VFAALNIRQMFVSDGALREGLVFDWLDRDDHDDIRIATIRRLQRLFTVDVRHADRVAK
                     TAADLLAQVAPNWGLDCHPESIDAPRYAVWLDIAARLHEIGLAVSHSGFHHHGAYILS
                     YADMPGLTRPAQMIIASLVHTHRRKFKLQRFGEVDERLREQIVRLSAVLRLAVLLHRD
                     RSPRPNLSRVRLEAGADNLHVSFPDGWLKTRPLTRVDLELEQSYLAMANIRLSFA"
     gene            complement(423167..424231)
                     /locus_tag="HNEAP_RS02015"
                     /old_locus_tag="Hneap_0405"
     CDS             complement(423167..424231)
                     /locus_tag="HNEAP_RS02015"
                     /old_locus_tag="Hneap_0405"
                     /EC_number="4.1.2.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1,6-bisphosphate aldolase"
                     /protein_id="WP_012823298.1"
                     /translation="MALISLRQLLDHAAEHSYGMPAFNVNNMEQIHAIMQAADAVDSP
                     VILQGSAGARKYAGEPFLRHLVSAAVEMYPHIPVVMHQDHGADPGVCFRAIQSGFSSV
                     MMDGSLMPDMKTPSSFEYNVEVTRKVAEMSHFVGVSVEGELGCLGSLETGKMGEEDGH
                     GAEGELDHSMLLTDPEEAAQFVKMTDVDALAIAIGTSHGAYKFTQKPTGKVLRIDRVK
                     EIHARIPNTHLVMHGSSSVPEDWLEIINNYGGDMGQTYGVPVEEIVEGIKHGVRKVNI
                     DTDLRMASTGAIRKHLHDNPANFDPRKFFAEATKAMKSICQARFEAFGAAGKASLIKP
                     LNLDEMHKRYASGSLKQQIK"
     gene            complement(424313..425788)
                     /locus_tag="HNEAP_RS02020"
                     /old_locus_tag="Hneap_0406"
     CDS             complement(424313..425788)
                     /locus_tag="HNEAP_RS02020"
                     /old_locus_tag="Hneap_0406"
                     /EC_number="2.7.1.40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate kinase"
                     /protein_id="WP_012823299.1"
                     /translation="MHAQNPPGYLSTKRRTKIVATLGPASDNPKVIADLISAGVDVVR
                     LNFSHGKAADHQHRADMVRAAASAQGKFVAILGDLQGPKIRIDRFKNGKVELADGAHF
                     TLDADLDRDSGDETTVGITYKALVTDSKAGDILLLDDGRIVLQVESVSGNKIQTKVVV
                     GGELSNNKGINRQGGGLSAPAITEKDREDIKTAAAIGVDYIAVSFPRSGEDIHEARRL
                     LQEAGCTAHIVAKIERAEAIECIRDIIQASDAIMIARGDLGVEIGDAELPAVQKAFIR
                     MARDMNRPVITATQMMETMITNPIPTRAEVFDVANAVLDGTDAVMLSAETAAGKHPVR
                     VVETMARICHRAEYQIEAKRGQPPLDIPFERIDQAIAYSAIYTANHLSVAAIVALTES
                     GATALWMSRVSTDIPIYAFTRNEVAARRMALYRGVQAVHFPYSSTDHAEVNRLTIEAL
                     TQMECLDDGDVVIITKGDLMGQMGGTNAMKIVRVGQIINAD"
     gene            complement(425798..426997)
                     /locus_tag="HNEAP_RS02025"
                     /old_locus_tag="Hneap_0407"
     CDS             complement(425798..426997)
                     /locus_tag="HNEAP_RS02025"
                     /old_locus_tag="Hneap_0407"
                     /EC_number="2.7.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="WP_012823300.1"
                     /translation="MANFLRMTDLDLAGKRVFIRADLNVPVKNGKVTSDARISASMAT
                     ITHCIKAGAKVMVTSHLGRPEEGIYSEENSLAPVAADMGAKLGKSVRLIKDWVDGGFN
                     VAPGEVVLLENVRFNAGEKKSLDETAKKYAALCDVFVMDAFGTAHRAEASTHGIAKFA
                     PVACAGILLAQELEALDKALANPARPMVAIVGGSKVSTKLTVLEALSEKVDQMVVGGG
                     IANTFIKAVGHNVGKSLCEDDLVPTAQMLMKKMEARGASIPVAVDVVVGTELPFLPGN
                     ENTPATLKPVDSVSDDDMIFDIGPKSAQELADIIMKAGTVVWNGPVGVFEYDQFGEGT
                     KTIAMAIAKTKAFTLAGGGDTIAAIQKYDIYDQVSYISTAGGAFLEYLEGKTLPAVAI
                     LEQRASA"
     gene            complement(427153..428151)
                     /locus_tag="HNEAP_RS02030"
                     /old_locus_tag="Hneap_0408"
     CDS             complement(427153..428151)
                     /locus_tag="HNEAP_RS02030"
                     /old_locus_tag="Hneap_0408"
                     /EC_number="1.2.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013834653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="WP_012823301.1"
                     /translation="MTIKVGINGFGRIGRMVFRAAAKDFPEIEVVAINDLLDADYLAY
                     MLKYDSVHGRFDGDVSVDGNHLVVNGKRIRLTAERDPANLKWNEAGADIVIESTGFFL
                     TKETCQAHINAGAKKVIQSAPSKDDTPMFVYGVNHDKYAGENIVSAASCTTNCLAPVA
                     KVLNDAFGIKRGLMTTVHAATATQKTVDGPSAKDWRGGRGILENIIPSSTGAAKAVGV
                     VLPELNGKLTGMAFRVPTSDVSVVDLTVELNKETTYADICKAMKSASESGSLKGVLGY
                     TDDSVVSTDFRGVAQPSVFDAKAGIQLDPTFVKVVAWYDNEYGYTSNLMRMVKVIG"
     gene            complement(428269..430257)
                     /locus_tag="HNEAP_RS02035"
                     /old_locus_tag="Hneap_0409"
     CDS             complement(428269..430257)
                     /locus_tag="HNEAP_RS02035"
                     /old_locus_tag="Hneap_0409"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_012823302.1"
                     /translation="MSTRRELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNGY
                     LKHNPKNPQWPNRDRFVLSNGHGSMLIYSLLHLSGYELPMEELKNFRQLHSKTPGHPE
                     YGYTPGVETTTGPLGQGITNAVGFAIAEKMLAGQFNKPGHNVVDHYTYCFLGDGCMME
                     GISHEACSLAGTLGLGKLIAFYDDNGISIDGHVEGWFTDDTPARFEAYGWHVVRDVDG
                     HDAEAIDAAIREARSVNDKPTMICTKTVIGFGAPNLCGTHDCHGAALGEAEVKATRDN
                     LGWHHEPFVIPAEIYAGWDATEAGIRNESAWEDAMNAYAKAYPAEAAELKRRLAGDLP
                     ADFTSKMDAFIAEVAAKGETIATRKASQNSITAIAAILPEIVGGSADLAPSNLTTWKG
                     CRALTATESDANYIHYGVREFGMSAIMNGMVLHGGFVPFAATFLMFSEYARNALRMSA
                     LMKIGSIFVYTHDSIGLGEDGPTHQPVEQIATLRMIPRMNTWRPCDAVESAVAWKAAI
                     MRRDSPSTLIFSRQNLAHQNRTPEQIANIARGGYILRDCAGTPDLILIATGSEVALAT
                     AAAEKLAGKKVRVVSMPCTEVFDAQDPAYRESVLPAAVRARVAVEAGVTGFWGKYVGL
                     DGKVVGIDTFGESAPAGDLFKLFGFTVDNVVATAQSVL"
     gene            complement(430447..430998)
                     /locus_tag="HNEAP_RS02040"
                     /old_locus_tag="Hneap_0410"
     CDS             complement(430447..430998)
                     /locus_tag="HNEAP_RS02040"
                     /old_locus_tag="Hneap_0410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin family protein"
                     /protein_id="WP_012823303.1"
                     /translation="MVSTTTPICEFNRPAIDFSLPDTEGRLWTLQDCRGPKGLLVMFI
                     CNHCPYVQAILPKIVRDTAELKRSGINSVAIMSNDIADYPEDSPEHMHRLAREYDFSF
                     PYLYDETQEIAKAYNAVCTPDFFGYNADLKLQFRGRLDASGRQNQPDAPRELFHAMQL
                     IAETGTGPSDQTPSIGCSIKWRP"
     gene            431225..432082
                     /locus_tag="HNEAP_RS02045"
                     /old_locus_tag="Hneap_0411"
     CDS             431225..432082
                     /locus_tag="HNEAP_RS02045"
                     /old_locus_tag="Hneap_0411"
                     /inference="COORDINATES: protein motif:HMM:PF12974.5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823304.1"
                     /translation="MSVQGLTVPLRFRNGGFARKIGRYISGFVALWLCFVMSVSAEAA
                     ALKFAIPPFLPKAELEKSFGPLVQRLSEMTGTPIDLEVFPNYLAFWQETRTGSPFDIA
                     LDAAPTTDFRVARQHWHVIAKLSGTVTQSLVTGPNDAVLDPSELINKKIAVQPSPSVS
                     ALTLYQLFPNPVQQPQLVFVDSNRAAAEAVKAGEVAAAVIPTPIAAGYPSLNMVTTTA
                     PLPFLAVSVSPNVSPELAKSLQSALIRLSETPEGEAMLQQSQLRAFTKATDSDYAGQE
                     KLLEGTFGY"
     gene            432170..433252
                     /locus_tag="HNEAP_RS02050"
                     /old_locus_tag="Hneap_0412"
     CDS             432170..433252
                     /locus_tag="HNEAP_RS02050"
                     /old_locus_tag="Hneap_0412"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011599356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS630 family transposase"
                     /protein_id="WP_041600331.1"
                     /translation="MKSPILLEDEQRDVLERWSRSRTVSLRWRERAQIILAATEKVSD
                     AVIAARLGTTRHRVARWRRRFASGGVEALKKDRPRAGRPPRVDAAKVKQIVRLTTQTQ
                     PTHATQWSTRSMAKRVGVSDTTVLRVWHAHGLKPHRVRTFKLSNDPQFTEKLEDIVGL
                     YLAPPEHALVLCCDEKSQIQALDRTQPGLPIKKGRAQTMTHDYKRNGTTTLFAALNIL
                     DGQVIGHCQSRHTHVEWLKFLKKVDRNTPKGKELHLIVDNYATHKHPEVKAWLALHPR
                     FHIHFTPTSASWLNMVERFFRSITVDRLRCGVFHSVADLEKAISGYINHYNKNPKPFV
                     WTAKANDILEKVVRAQTTLDKMGQTA"
     gene            433325..434497
                     /locus_tag="HNEAP_RS02055"
                     /old_locus_tag="Hneap_0413"
     CDS             433325..434497
                     /locus_tag="HNEAP_RS02055"
                     /old_locus_tag="Hneap_0413"
                     /EC_number="2.5.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine adenosyltransferase"
                     /protein_id="WP_012823306.1"
                     /translation="MTVHREPVHFFTSESVAEGHPDKIADQISDAVLDAILRKDPHAR
                     VACETLVKTGFVVLAGEVTTSAWVDLDELVRKVIVDIGYDSSELGFDGNTCGVLNAIG
                     KQSSDIAQGVDRMVAEEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKS
                     HTLSWLRPDAKSQVTFRYKKGKPVGIDAVVLSTQHGPEVSQKDLREAVMELIIKPTLP
                     ADWLDEKTKYHINPTGNFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKV
                     DRSAAYAGRYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISIDTFGTGKISDQRITDL
                     VRAHFDLRPYGIVRMLDLIRPIYQKTAAYGHFGREDADFTWEKTDKADALRADAGL"
     regulatory      434511..434586
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01057"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="S-adenosyl-L-homocysteine riboswitch; Derived by
                     automated computational analysis using gene prediction
                     method: cmsearch."
                     /bound_moiety="S-adenosyl-L-homocysteine"
                     /db_xref="RFAM:RF01057"
     gene            434628..436040
                     /locus_tag="HNEAP_RS02060"
                     /old_locus_tag="Hneap_0414"
     CDS             434628..436040
                     /locus_tag="HNEAP_RS02060"
                     /old_locus_tag="Hneap_0414"
                     /EC_number="3.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylhomocysteinase"
                     /protein_id="WP_012823307.1"
                     /translation="MQNPNAFKLAIDCKVADITLADYGRKELRIAEREMPALMAIRAK
                     YREAQPLAGARIVGSLHMTVQTAVLIETLVDLGASVRWSSCNIFSTQDHAAAAIAAAG
                     IPVFAWKGETEEEYWWCIEQTITGPNGWTPNLILDDGGDLTGLIHDKHPELLAGIHGV
                     SEETTTGVHRLLDMLKAGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAIKRATDHLL
                     SGKQALVIGYGDVGKGSAASLRQEGMIVKVTEIDPICAMQACMDGYEVVSPYLNGHND
                     GSDTCVDKQLLGKIDLIVTTTGNVNVCDAPMLKALKNGAVVSNIGHFDNEIDTAYMRK
                     NWVWEEIKPQVHKIYRETAPGSEPNLDSDNYLILLSEGRLVNLGNATGHPSRIMDGSF
                     ANQVLAQLHLFANKFADQPAARKAELLRVEVLPKALDEEVARYMVAGFGGVLTKMTDK
                     QASYLGVEVNGPYKPDSYRY"
     gene            436040..436909
                     /locus_tag="HNEAP_RS02065"
                     /old_locus_tag="Hneap_0415"
     CDS             436040..436909
                     /locus_tag="HNEAP_RS02065"
                     /old_locus_tag="Hneap_0415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008931365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylenetetrahydrofolate reductase [NAD(P)H]"
                     /protein_id="WP_041600332.1"
                     /translation="MGSEAIMHTPLSCEFFPPKSDEGALKLRAVTEQLTSALKPEYFS
                     VTYGAGGSTQDRSFATVQAIQTESGVPAAPHLSCIGSTRASIAAILDQYRALGIKRIV
                     ALRGDLPSGMRDPGDFRFASELVAFIREHSGDWFHIEVAAYPEFHPQSANARADLLHF
                     KQKVEAGVDGAITQYFYSIEAYARFLDDCEKLQIMIPIVPGIMPISNYTQLARFSDAS
                     GADLPRWLRKRLEAFGDDMDGLRAFGHDVVTGLTSDLVQAGAPGLHFYTMNQAVPVIN
                     ICRDAGLMPSQPN"
     gene            437084..437998
                     /locus_tag="HNEAP_RS02070"
                     /old_locus_tag="Hneap_0416"
     CDS             437084..437998
                     /locus_tag="HNEAP_RS02070"
                     /old_locus_tag="Hneap_0416"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="paraslipin"
                     /protein_id="WP_012823309.1"
                     /translation="MGTFAIVLLVLAAATIFAGIKQVPQGSMWTVERFGRYTRTLEPG
                     LNLIVPYIDRIGRKINVMEQVLDVSSQEIITRDNAMIKVDGVVFFQVLDPARAAYEVH
                     QLDYAILNLVITNIRNVMGSMDLDEILSRRDDINARLLSVVDEATSPWGTKITRIEIK
                     DITPPQDLVAAMGRQMKAEREKRANILEAEGFRQAAILKAEGEKQSNILQAEGDREAA
                     FRDAEARERLSQAEAFATKTVSEAIAAGNVQAINYFVATKYIEAFQAVATAPNQKVIM
                     LPIEASNMLGSLEGIAELAKEAFKVNPK"
     gene            438038..438391
                     /locus_tag="HNEAP_RS02075"
                     /old_locus_tag="Hneap_0417"
     CDS             438038..438391
                     /locus_tag="HNEAP_RS02075"
                     /old_locus_tag="Hneap_0417"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823310.1"
                     /translation="MNMTRNFFAALSVLVVLALAGCSSGAPSSSDVEQALKSGMAKAM
                     SQASSVEGGQAVSAMMAKVEIKSVKVLECNKDASGTGFDCKVETEVSTPFAGDQKNTR
                     MLHLVKGSDGWVIAR"
     gene            438432..438884
                     /locus_tag="HNEAP_RS02080"
                     /old_locus_tag="Hneap_0418"
     CDS             438432..438884
                     /locus_tag="HNEAP_RS02080"
                     /old_locus_tag="Hneap_0418"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012823311.1"
                     /translation="MPLDTLIWDYWAWFILGVLLVVVEIFAPSSFFLWLGVAAGVVGG
                     ISFFMPDIGWPVQIGLFAVLSIVAVLIGRRVFVPNKQATDHPMLNRRGQQYIGRHFTL
                     EAPIVNGVGWVRIGDSRWRVLGPDMPSGSVVEVTSVDSSNLVVAPVTR"
     gene            438898..440259
                     /locus_tag="HNEAP_RS02085"
                     /old_locus_tag="Hneap_0419"
     CDS             438898..440259
                     /locus_tag="HNEAP_RS02085"
                     /old_locus_tag="Hneap_0419"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017364776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine--8-amino-7-oxononanoate
                     aminotransferase BioA"
                     /protein_id="WP_012823312.1"
                     /translation="MMSSNQSWIDRDLAVLWHPCTQMKEHETLPPIPVARGEGSWLYD
                     FDGRRYLDVISSWWVNLFGHANPVINARLKAQLDQLEHVILAGFSHQPVVELSERLVQ
                     LTPPGLERVFFADNGASGVEVALKMSFHYWRNQGRAEKTRFIALENSYHGETMGALGV
                     GNIPIFTETYAPLIQPAFIAPSPDCQQAEPGESCADVTERALAAMRALLERVASQTCA
                     IIIEPLVQCAAGMRMHEPAYLTGLRALCDEFEVHLIADEIAVGFGRTGTLFACEQGGI
                     TPDILCLSKGITGGYLPLSAVLTTEDIYQAFYCEAPASRAFLHSHSYTGNPLACTAAL
                     ATLDIFEQNNVIERNRQRGAMIDRLTAPLAELPNIAHMRRCGMIVAMDLVDDRAGNRG
                     KPFPRAERRNQKAYRYALDHEVLLRPLGNTIYWMPPYIMDDDQWQMLADVTFDAVRFA
                     VQD"
     gene            440276..441010
                     /locus_tag="HNEAP_RS02090"
                     /old_locus_tag="Hneap_0420"
     CDS             440276..441010
                     /locus_tag="HNEAP_RS02090"
                     /old_locus_tag="Hneap_0420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019471551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (uracil(1498)-N(3))-methyltransferase"
                     /protein_id="WP_012823313.1"
                     /translation="MRIPRIYLDAALAEGATLPLPAERLNYLKNVLRLRDGQALRVFD
                     GQNHEADATLSLGKREGSLAIGRVAAHSVESPLQTHLIQAMGKGEKMDWVIQKAVELG
                     VTRFTPVSTERSVVELKGERADKRHARFIDIAIGACEQSGRNFLPRVDPILSLEEALT
                     QTDAALKWVLHPNPGSGAALPAVAPDSVALLIGPEGGLSDHEVEAAIASGFMPLTLGS
                     RVLRTETAPIVALSVLQMQWGDFFVG"
     gene            441043..442227
                     /locus_tag="HNEAP_RS02095"
     CDS             441043..442227
                     /locus_tag="HNEAP_RS02095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019933119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 2"
                     /protein_id="WP_081441084.1"
                     /translation="MCLCAGRLSASHCVKLFPLFSRIRNETEPCSKLIPSCSKSKICL
                     LVRPRFGGIFDFDVKKERLEEVDRELEVPDVWNDPARAQALGKERASLERVVHTLANM
                     AQGLNDNADLLEMAAEEDDEATVASIEKDVVEFEKQIADLEFRRMFSGEMDESNAYLD
                     IQSGAGGTESQDWASILMRMYLRWGDRRGFKTEVMEMSDGEVAGIKSATIRFEGEYAF
                     GWLRTEIGVHRLVRKSPFDSDNRRHTSFASVFVSPEVDDNIEIEVNPADLRVDVFRAS
                     GAGGQHVNRTESAVRFTHLPTGVVVACQAERSQIQNRERAMKMLKAKLYELEVQKRNA
                     VSQALEDTKSDVSWGNQIRSYVLDQSRIKDLRTGHETGNTQAVLDGDLDPFIEASLKS
                     GL"
     gene            442272..443807
                     /locus_tag="HNEAP_RS02100"
                     /old_locus_tag="Hneap_0422"
     CDS             442272..443807
                     /locus_tag="HNEAP_RS02100"
                     /old_locus_tag="Hneap_0422"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine--tRNA ligase"
                     /protein_id="WP_012823315.1"
                     /translation="MTANEQVNGAAEERSAESLLAEENKLIAERRDKLSRIRAAGNAF
                     PNDFRRDASAAELQAEYAEKEADYFEQNPRRVVVAGRVMAKRLMGKASFLSILDHSGR
                     IQLYVARDALGEATYDDFKTWDIGDIVGGEGALFKTQKGELSVRVDSIRLLTKSLRPL
                     PDKFHGMSDTEQRYRQRYVDLIMNEPVRDTFRKRTQIIQFMRNYLNAKDFLEVETPMM
                     HVIPGGASAKPFTTFHNALDMDLYLRIAPELYLKRLVVGGFERVYEINRNFRNEGLST
                     RHNPEFTMIEFYQAYADYIDLMDMTEDLLRRLSESVCGSTTLTYQGVEFDLAQPFARL
                     SVVNAILEHNPDVTREQLSDIDSARRIAEGLGINIKDSYGLGKIQIEIFEETAEHKLI
                     QPTFITEYPAEVSPLARRSDDNPFVTDRFEFFIGGREIANGFSELNDAEDQAERFMAQ
                     VAEKDAGDDEAMHFDSDYIRALEHGMPPTAGEGIGIDRLVMFLTDSPSIRDVLLFPHM
                     RPE"
     gene            444379..445509
                     /locus_tag="HNEAP_RS02105"
                     /old_locus_tag="Hneap_0423"
     CDS             444379..445509
                     /locus_tag="HNEAP_RS02105"
                     /old_locus_tag="Hneap_0423"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S-binding ATPase"
                     /protein_id="WP_012823316.1"
                     /translation="MFGLFGKKIDTARSEALRNALGSLVDPHAGETLADAHFIERAEV
                     VGDEAQIDVVLDYPAAGFEAELTELLERTALQIEGIKSAKTTIAFVSPLGSSQNGKPL
                     PGVRNIIAVASGKGGVGKSTTSVNLALALAAEGATVGLLDADIYGPSQPLMLGAKETP
                     VVDEQRAMQPVMAHGLQTMSIGYLIDDAQAMVWRGPMVTSALMQLLNDTRWHDLDYLI
                     VDMPPGTGDIQLTLAQKVPVAGSVIVTTPQDIALIDARKAITMFEKVNVPVLGVIENM
                     SVHVCSNCGHVEPIFGSGGGEKLASENHIDLLGQLPLDLAIRTDVDEGWPTVVRDSES
                     VNALIYRQTARKLAAALGRHLRQDHFDGPNISIDEDGGDADG"
     gene            445496..445978
                     /locus_tag="HNEAP_RS02110"
                     /old_locus_tag="Hneap_0424"
     CDS             445496..445978
                     /locus_tag="HNEAP_RS02110"
                     /old_locus_tag="Hneap_0424"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823317.1"
                     /translation="MLTVEVPGDFNGGTPLSLAHLVLDYNGTIAEDGALIAGVPERLA
                     QLAEHLTIHVITADTHGTAAQKLAGLPVSLHILSPGAQSEAKADFVRALGSKQCVAVG
                     NGRNDALMLQTAVVGVAVVQAEAAAQITLAAADVVCASIEHALDLLIYSKRLVATLRN
                     "
     gene            446044..446544
                     /locus_tag="HNEAP_RS02115"
                     /old_locus_tag="Hneap_0425"
     CDS             446044..446544
                     /locus_tag="HNEAP_RS02115"
                     /old_locus_tag="Hneap_0425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-Cys peroxiredoxin"
                     /protein_id="WP_012823318.1"
                     /translation="MSQVTFLGNPVEVAGVMPAVGSPAPAFTLTDGELQEKSLGDFAG
                     KKKILNIFPSLDTPTCAQSVRSFNEKANSHPDTAVLCISADLPFAQGRFCGAEGLDNV
                     ITLSTFRHPEFLRDYGVLLADGALAHLAARAVIVLDEHDQVRYVQLVPEIADEPDYAA
                     ALAALA"
     gene            446561..447502
                     /locus_tag="HNEAP_RS02120"
                     /old_locus_tag="Hneap_0426"
     CDS             446561..447502
                     /locus_tag="HNEAP_RS02120"
                     /old_locus_tag="Hneap_0426"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructokinase"
                     /protein_id="WP_012823319.1"
                     /translation="MTVQATDENTLKPKGRLRLGVDLGGTKVEVAVLDDADEFLFRER
                     LPTPQGDYSGTIETIATLIQKAEQQLGRVHSIGVGTPGTTSPRTGLMKNANSVVLNDQ
                     PLKYDLETRLNRSVSMANDANCLALSEAHGGAADGADSVFGVILGTGVGGALVVNGQL
                     IMGQNAIAGEWGHNPLPWTHEGEYPGPVCWCGHQGCIEQWLSGPAFMRDFQNASGRSL
                     TGAEIIAAVEQGDAEAKAALTRYTDRLARALAHVINIFDPEVIVLGGGLSNVAALYTE
                     VPSRWDEFVFSDPISTKLVAPKFGDSSGVRGAAMLSS"
     gene            447499..448800
                     /locus_tag="HNEAP_RS02125"
                     /old_locus_tag="Hneap_0427"
     CDS             447499..448800
                     /locus_tag="HNEAP_RS02125"
                     /old_locus_tag="Hneap_0427"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenical efflux pump membrane protein ArsB"
                     /protein_id="WP_012823320.1"
                     /translation="MTAAAIFLATLILVLWQPTIGRFQLGIGWSAAAGALVAFAAGVI
                     QPADVPVVWAIVWNATFTFIALIIISLLLDEAGFFNWAALHLARWAGGSGPRLFVVMV
                     LLGGLVAAFFANDGAALILTPIVIGILLALRMPPTATLAFVMAAGFIADTASMPLVVS
                     NLVNIVVADYFKLGFADYAAVMVPVTLVSVLASLGVLWLYFRRSIPKTYACDALDSPS
                     KAIIDRSVFRAGWWALAWLLFGFFVLDSWGVPISLVAAIGAFILWLIARRGAKINTRT
                     VLIHAPWQVVIFSLGMYLVVYGLKNAGLTDVLTYWFDQLAHLGLWGATLGTGFTMAAL
                     SAVLNNMPAVLMGTLAIDGTQASGTTHLAMVYANIIGCDLGPKFTPIGSLATLLWLHV
                     LARKQIVISWGYYFKVGLILTTPVLLLTLLALALRLSVNLP"
     gene            448808..450313
                     /locus_tag="HNEAP_RS02130"
                     /old_locus_tag="Hneap_0428"
     CDS             448808..450313
                     /locus_tag="HNEAP_RS02130"
                     /old_locus_tag="Hneap_0428"
                     /EC_number="3.1.11.6"
                     /inference="COORDINATES: protein motif:HMM:TIGR00237"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII large subunit"
                     /protein_id="WP_012823321.1"
                     /translation="MSTILSVTSLNAMAKQILEANLSGVMVQGEVRSLTRAASGHMYF
                     SLKDQQAEVRCALFRGQAMRVKTAFANGDAVVVRGSVSLYAPRGDYQLIVTGVELAGD
                     GQLAVLFEALKKKLFAEGLFDAARKRAIPTLSRRILVISSAAGAALQDVLSTLTRRLP
                     LVEINLVPVAVQGEAAAAELTAAVRGITSDSEFDVVLLVRGGGSMSDLWAFNDEGLAR
                     AIAACPVPVISGVGHEIDFTISDFVADARAATPTAAAELATPITLGELQAALVLQQEQ
                     LSRLIEDRLNAAGQRLDSSLNRLRQQRQRWLPQGHHQMMLSLRLQRAIRARWQDNLGQ
                     IRALTHRLQQRSPVHWVRQNHSRLEQMRWRLQQAIDQRLAAQRQNNLRLAAGLRPLIV
                     LRQIELRQQNSQRITAHLHAAARQRLVRQQQRLEQAFGVLSALSPQRVLERGYSLVEA
                     ESGLLWHAAALQSALAESDRPLPLRLHFGDGVVPIEARSAQSGSIETGATE"
     gene            complement(450375..450752)
                     /locus_tag="HNEAP_RS02135"
     CDS             complement(450375..450752)
                     /locus_tag="HNEAP_RS02135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015751098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytoplasmic domain of flagellar protein
                     FhlB-like protein"
                     /protein_id="WP_012823322.1"
                     /translation="MSRNIPKPKSEKHPISRAVALKYEGTELPQVVATGQHLVAEQIV
                     ARAKAADVPLVEDPALADMLASLDIGDHIPNNLFRAVAEVLSYALYVSGKHEEVLKRA
                     QQTRDEAQNYRSNNGEKKDEPPE"
     gene            complement(450780..452120)
                     /locus_tag="HNEAP_RS02140"
                     /old_locus_tag="Hneap_0430"
     CDS             complement(450780..452120)
                     /locus_tag="HNEAP_RS02140"
                     /old_locus_tag="Hneap_0430"
                     /inference="COORDINATES: protein motif:HMM:PF02120.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-length control protein FliK"
                     /protein_id="WP_012823323.1"
                     /translation="MKIDSTLTASTTTELRGLPLRTGQTLAAIVLQANQGTGKALLSL
                     AGGQVAVTTQLPLTTGSAIQLKVKDAGPPVVMGLLSSAQETMTTKTTVQSAVQTLLTL
                     LMTRLSANTNAATASAPLKSEIGPAQGSQTQTTTTANATPTTQAGNMTAAVASPPIKL
                     DLPLNVRTALLNLDEVLSALRTGQPVAKQTLAQNLTQLIAANSLPPAPSNSSLDQATS
                     DIKSQLKLAAQQLKMQASLESMGNNQMATARGARSAASASQAQTHTATQTAAQTAAQT
                     AAQTVAQNPGQTASLQLSIEQWIGRLDVSQLRTALLQIQGQPTWVVDVPMMLAEQPRR
                     VQIAIQEQAQNTNPPTESTWQLDFAIDLPALGPLHGSLSLQSTNLTVRLYADKPEARM
                     QLDASLDQLAEHLRAASLTPKELRIYPGPPPKAVQERLSPAPFLDEHATFRCQV"
     gene            452328..453797
                     /locus_tag="HNEAP_RS02145"
                     /old_locus_tag="Hneap_0431"
     CDS             452328..453797
                     /locus_tag="HNEAP_RS02145"
                     /old_locus_tag="Hneap_0431"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005349870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_012823324.1"
                     /translation="MSDQLPRIWIDAPAEIGADLTQWLTLLGVQAESVSHSIHAVTDD
                     VIGGICFADACETHLDRPQTLPWIALDADPARWLGAVQTPFATLTWPCTLSGLQGIVQ
                     RLISRWRGEQLVAAGRGLVGQTPVMRQLRAEIEQVAPSDATVLILGESGTGKEVVARM
                     IHRLSNRADKPFVPVNCGAIPAELLESELFGHEKGAFTGAISARAGRFELAEGGTLFL
                     DEIGDMPLPMQVKILRVLQERTFERVGGRHTFTADVRIVAATHRDLEVHIQEGSFRQD
                     LYYRLNVFPLETQPLRVLCEDIPEIVRALTQRFALAGRPVAQLTDGALTALSALPWPG
                     NVRELGNVIERLGILYPDQVVDIAQLPEKIRMQLPADWQMPEMPAPTVTKPPEPLSHH
                     GATPEDVDPRDMFAAGRASVDQSADIRLPVDEQELAQCQCVLPEMDFDLKNQLEAIER
                     AWIEQALINNDGVVAQAARQLGIRRTTLVEKLRKYQMSA"
     gene            453896..454237
                     /locus_tag="HNEAP_RS02150"
                     /old_locus_tag="Hneap_0432"
     CDS             453896..454237
                     /locus_tag="HNEAP_RS02150"
                     /old_locus_tag="Hneap_0432"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003199082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body complex protein FliE"
                     /protein_id="WP_012823325.1"
                     /translation="MSSGMSVDQILSQMRVMRQEATQRLAQPASVPPTVSPAGGDSFS
                     SLLTKAIGQVNDLQQNSSQLKTRFELGDPNVDLTQVMLASQKASLGFNATLQVRNRLV
                     QAYQDIMNMPV"
     gene            454266..456038
                     /locus_tag="HNEAP_RS02155"
                     /old_locus_tag="Hneap_0433"
     CDS             454266..456038
                     /locus_tag="HNEAP_RS02155"
                     /old_locus_tag="Hneap_0433"
                     /inference="COORDINATES: protein motif:HMM:TIGR00206"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar M-ring protein FliF"
                     /protein_id="WP_012823326.1"
                     /translation="MAQNSMAPLSAAHQPATGTPAWIRQIDGFTQSSSFRQLLILVAL
                     AATLSFMVGFFLWGQKPSLVPLYTNLGPKESAAVVEALRAAKKNYQLSADGAILVDPA
                     QLPAVRMLLAGEGLPSGNGVGLEMLDKDQSLGTSQFVEQARYQHAIEIELARSIETIQ
                     GVSAARVHLATPKQSVFVREQQKPTASVVVELSPGQSLTADQVRAIVHLVASSVAGMK
                     PENVSVIDQRGELLSQNSDDASGMGLTDKQFAYRQRVERAYARQIEALLTPIVGANQV
                     RAQVSADIDFSRQEGTSETYGPKTGVVLSEQTNDTTRALGDQGINGGVPGALSNQPPG
                     GGTVTPQTSGGLQPPANLDVQQYQQIIQTPISTQKNETRNYNVDKDIRHTQYASGAVD
                     KLNVAVLLDEKTVTDKDGKTKTEPMSDAELARIKDLVSQAVGLDEQRGDKLTLASIPF
                     VEQKIEKVSVPLWQQEWFMPLLKNLGLGVAMLLIFLMVVRPLLKMLADKSRPEALPHQ
                     PGAALPNGTEDNGMNEEGVSFTRQASEGGQIPGPDDEDNLEGVPQLVGAASYADKLRQ
                     LKQSINHDPKAVAAVIKQWTHSEN"
     gene            456040..457080
                     /locus_tag="HNEAP_RS02160"
                     /old_locus_tag="Hneap_0434"
     CDS             456040..457080
                     /locus_tag="HNEAP_RS02160"
                     /old_locus_tag="Hneap_0434"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliG"
                     /protein_id="WP_012823327.1"
                     /translation="MAEALTNADQNPSDLIAGLKGPERAAILMMALGEESAAQLFTKL
                     DPREVQKIGQAMAVLPNVTRSQIQAVLDQFVLDLGDQTGLALGTTDYIRNVLNRALGE
                     DKAAGLLERISSGGNRRNLEFLKWLDPRSIAEIIRYEHPQIIAIVLSHLESDQGAEIL
                     QMLPENMRADIVLRIAHLDGVSPQALMELDDIMERQVSGAGGGKSSKVGGVKIAAGIM
                     NFLEGNVEEVVMNAVKSTDAELGTQIEDLMFVFANLIDVDDRGIQTILREVPSDRLLM
                     AMKGADNDLKEKFFKNMSKRASEMMRDDLESLGPTRLSDVEAAQKEILQAARKLADEG
                     KISLGGGGEEFV"
     gene            457064..457846
                     /locus_tag="HNEAP_RS02165"
                     /old_locus_tag="Hneap_0435"
     CDS             457064..457846
                     /locus_tag="HNEAP_RS02165"
                     /old_locus_tag="Hneap_0435"
                     /inference="COORDINATES: protein motif:HMM:PF02108.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar assembly protein FliH"
                     /protein_id="WP_012823328.1"
                     /translation="MKSSSDPVQSATVDEVPLVRPLTAGADASAISAWALPDFDVPEA
                     PSEVLSEPLDPHAEELARARQVAEQAGFAAGHAQGEKAGFAAGHAEGLAAALAEQTHI
                     QQRFQGWLQSLTQPLADLDAEVSLQMARLAAQMARAIIYRELTIEPEHLDVVARTAIE
                     ALPVAVRAVTLVCHPDDADALQAAVDQDTIQSQHAQTVTVRRDATVTPGGLMVESNTV
                     GVESLVDASLEARWAALCLRVLDEQVAGPADPIETEMNEAAE"
     gene            457843..459240
                     /locus_tag="HNEAP_RS02170"
                     /old_locus_tag="Hneap_0436"
     CDS             457843..459240
                     /locus_tag="HNEAP_RS02170"
                     /old_locus_tag="Hneap_0436"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein export ATPase FliI"
                     /protein_id="WP_012823329.1"
                     /translation="MTAGRNPAVFDPPSMRVGGVGLDWARHLMGLQARVQRPPLQAEG
                     RIVRVVGLALEASGLTAAIGDQCRIFLDDDPAGRFVDAEVVGFAERNTYLMPLEALRG
                     IAPGCRVQNQGASIRMPLGPELLGRVLDARGQPLDDGPAIFGDIPVDLQGRSNNPLKR
                     RPIREPLDVGVRAINALLTVGRGQRMGIFAGSGVGKSVLLGMMTRYTTAEIIVVGLIG
                     ERGREVREFVAEILDDEARSRAIVIAAPADASPLMRLHGASLATAIAEYFREQGHDVL
                     LLMDSLTRYAQAQREIGLAIGEPPATKGYPPSVFARLPALVERAGNGESARGSMTAFY
                     TVLVEGDDQNDPIADAARAILDGHIVLSRAIAERGRYPAIDIEASISRLMPALVSPEH
                     LDLMQRFKQLMSTYNQSRDLLAVGAYRRGHDVRLDRAIDAQPDLEAFISQSIHESADL
                     DSSFAALESLMHSAA"
     gene            459237..459713
                     /locus_tag="HNEAP_RS02175"
                     /old_locus_tag="Hneap_0437"
     CDS             459237..459713
                     /locus_tag="HNEAP_RS02175"
                     /old_locus_tag="Hneap_0437"
                     /inference="COORDINATES: protein motif:HMM:PF02050.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441085.1"
                     /translation="MIEPGVTIVNQQRIERVKGVEKITERGANIAKESQIQCQRRLDE
                     QRARLQQLTEYLQEYAAGIGFASGGQAKAFALQNYRAFMGRIEETIAHQKEVVAQVEA
                     ELLACKQAAAEANSQHRSVEKLRGRFENERNRMQNKQEQAVNDAHAAQHRHNPLDV"
     gene            459731..461245
                     /locus_tag="HNEAP_RS02180"
                     /old_locus_tag="Hneap_0438"
     CDS             459731..461245
                     /locus_tag="HNEAP_RS02180"
                     /old_locus_tag="Hneap_0438"
                     /inference="COORDINATES: protein motif:HMM:PF02120.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-length control protein"
                     /protein_id="WP_012823331.1"
                     /translation="MAQLNSPALSALNAAIGGRSDPASGNAANAPGEQKGFAEMMAGA
                     IQNQSKNAQGQGVAGRSQVAADSKAAIINQAVGSGAGQSDVQTVDQSSAQQMRLTLQQ
                     QITSLQEKIQALSTQNPPLSDKAQAALGKLMQQLASLKSQLEKGVGSTALDASGLSKW
                     MAQLDKVQALLQQGDVNAASWTGQLQAMVQHLAQTIQQTHVAVGRAGQSVEDMRSSHS
                     VGGRDGQQAGAIKEPSAANAQAMDSSKKDNHTVNNQGQFQNNPIVSGAGNTAAVISGQ
                     MQSLSGAIDSALAAQTVNAASTLSSLSKGAPKADLVMQLVDPPGDNAPGAFNLSASGF
                     GAAANTNPIVALPGALALNQPRLAADLGQNIQFMVGKNISRATLDVNPAHLGPMKITI
                     DQQNNQTNIQIMASHHLAKDMLDQNMPRLREWLQEAGLGNAQITVTSSGQDGSGNQGM
                     NQGGEQNFGASNGRHGASTNDSLAHAAQPDVMHSGVSGNQAQTVNGRLRLDTFA"
     gene            461578..461901
                     /locus_tag="HNEAP_RS02185"
                     /old_locus_tag="Hneap_0439"
     CDS             461578..461901
                     /locus_tag="HNEAP_RS02185"
                     /old_locus_tag="Hneap_0439"
                     /inference="COORDINATES: protein motif:HMM:PF00816.19"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone family protein nucleoid-structuring
                     protein H-NS"
                     /protein_id="WP_012823332.1"
                     /translation="MSTIDLNSLSAEDLRQLMANAERTLRDRHQQRVHSLRKEAEELA
                     ASLNMSVAELFGLEKSSKLANKKLPAKYINPANPAQTWTGRGKRPHWLADALARGESL
                     EKFAV"
     gene            complement(462170..463372)
                     /locus_tag="HNEAP_RS02190"
                     /old_locus_tag="Hneap_0440"
     CDS             complement(462170..463372)
                     /locus_tag="HNEAP_RS02190"
                     /old_locus_tag="Hneap_0440"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823333.1"
                     /translation="MTPITPPAELPDSLKASFSLMNTTKPAREQLDSKSIQSVTEWFY
                     SERWHQERADTTELMWLLHWLPAEQSERIAEIADAICISQLEAGDIDSAIALAEDTLA
                     KHDDFCLRHTLALAQSAKGDLNQAIGTLEQALGNSELIESNTPAEQRIQAWLDLARLL
                     QNAKALFKAMRPARAAIALAAQYHDEELLVEALTLLVRQLIEQGGSDEAWEALKPHLS
                     DTYSTGQSALWTLAFSELSNELSEADRNRGALFFLDANEPDALIRLWVKRAETAKEQD
                     DVLIAYILCLLFRAPIDAAAPLAAKLLLRDKDRQTERAPLIAASAMALAEIPDDRSIK
                     RAHWYRDAMIQLISVARHQGVPEAAVKQWAEDQKLLLEHGVIERASEQLINELATPPA
                     WLQHAIRK"
     gene            463555..463908
                     /gene="rnpB"
                     /locus_tag="HNEAP_RS12415"
     ncRNA           463555..463908
                     /ncRNA_class="RNase_P_RNA"
                     /gene="rnpB"
                     /locus_tag="HNEAP_RS12415"
                     /product="RNase P RNA component class A"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00010"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00010"
     gene            464290..464739
                     /locus_tag="HNEAP_RS02195"
                     /old_locus_tag="Hneap_0441"
     CDS             464290..464739
                     /locus_tag="HNEAP_RS02195"
                     /old_locus_tag="Hneap_0441"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="division/cell wall cluster transcriptional
                     repressor MraZ"
                     /protein_id="WP_012823334.1"
                     /translation="MFKGITNLNLDGKGRLAMPTRHRAAFAAEEGQMVMTIDAQERCL
                     LIYPLATWLIIEPQIDALPSFNAQANRVKRMLIGHATELTLDSAGRILVPTELRNHAE
                     LDKEVVLVGQGKKLELWSQPNWAAQTEVFFSESNDKNLPAALEAISL"
     gene            464736..465689
                     /locus_tag="HNEAP_RS02200"
                     /old_locus_tag="Hneap_0442"
     CDS             464736..465689
                     /locus_tag="HNEAP_RS02200"
                     /old_locus_tag="Hneap_0442"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA
                     (cytosine(1402)-N(4))-methyltransferase"
                     /protein_id="WP_012823335.1"
                     /translation="MNALAVSTQEKSEALTHETVLLNEAVEALAVRADGVYLDATFGR
                     GGHSAAILAKLNNHGRLFATDRDLRALAAGEALASKDARFQIHHAAFSTAAQWLASMG
                     LQGKVDGVLFDLGVSSPQIDEAERGFSFQQNGPLDMRMNQHAGETAAEWLAEAEEEEI
                     ANVLYRLGDEKFSRRIARRIVETRAAQPLATTFDLVRCIVEATPRRDPRKHPATRSFQ
                     AIRLHINRELDEISAALSQVVDLLSIGGRLVVISFHSLEDRIVKNFIRDESTTDKDFF
                     GQPVGTARLSRVGGSIRASAEEIVRNPRSRSAIMRVAERVA"
     gene            465686..465946
                     /locus_tag="HNEAP_RS02205"
                     /old_locus_tag="Hneap_0443"
     CDS             465686..465946
                     /locus_tag="HNEAP_RS02205"
                     /old_locus_tag="Hneap_0443"
                     /inference="COORDINATES: protein motif:HMM:TIGR02209"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsL"
                     /protein_id="WP_012823336.1"
                     /translation="MKFLFGILALAVFASALAVVDTAQQDRDVTRALSTHRQAIEKLN
                     VTYAELQLEQGALAAQGRVDQIAQTRLNMHVPSADQITMVFR"
     gene            465988..467802
                     /locus_tag="HNEAP_RS02210"
                     /old_locus_tag="Hneap_0444"
     CDS             465988..467802
                     /locus_tag="HNEAP_RS02210"
                     /old_locus_tag="Hneap_0444"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011912263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441175.1"
                     /translation="MEKGALGRFFAWVGGCWRTVMVLGLFGVLALILVGRAVQLQVSE
                     QGFYVQQGGDRQQRAQVIPAHRGMITDRNGDPLAISVPMDAVWVNPTELTRFYAARTQ
                     GSARKYVDQDPIKTLASLLKIPDANLRSLVANNRSKQFIYVQRQVRPSVAAVIRAARL
                     PGVGLQREYQRFYPTGDVTASLVGFTNIDDHGQAGLEASYNNYLAGVAGRRLILKDAY
                     GHEVDDLGVQKEAQPGHDLVLSIDKRLQYLTYSELARGVAAHHAEYGSAVLMNVTTGE
                     VLAMATVPSFNPNNRATMKPALTRNRALVDQFEPGSSMKPFTITAALESGRWQPDSTV
                     NTAPGWVRIGGYTIRDHRNYGVLDLRGILEKSSNVGASHIGEDLGAEVLWKNMRAFGF
                     GQDTGVGFPGEVAGRLENWRQWSVSGTAAHSYGYGLSVTTLQLAAAYAALANHGRYIH
                     PSLLKRDAPPSYVQVAPAKDCDEVVSMLQAVVSPEGTAPKAQIAGFQIAGKTGTSRMI
                     GPDGTYSKDNYNTVFAGIAPASDPRLVLVVVVTDPQQGSYYAGDVAAPIFHGIMSGAL
                     RMLNIRPDNLPNEPAEVTAASVPPPSTAVAGKKQAGGA"
     gene            467799..469358
                     /locus_tag="HNEAP_RS02215"
                     /old_locus_tag="Hneap_0445"
     CDS             467799..469358
                     /locus_tag="HNEAP_RS02215"
                     /old_locus_tag="Hneap_0445"
                     /inference="COORDINATES: protein motif:HMM:PRK00139.1-3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,
                     6-diaminopimelate ligase"
                     /protein_id="WP_012823338.1"
                     /translation="MSMLAFSPRPIGEILSALNLLVADNVGSVVARVITDDSREVVPG
                     AVFFARSGIQPNIKPFISQALAAGAVLVVTEADYADPRVIRVEAVHSLVLQMVGHVCA
                     VNFDDLTIIGITGTNGKTSVAQFIAGALSRSGAPHTASIGMIGTLGAGMWSSGLENLQ
                     PTANTTPGLLETLRYAVDFIRQGARYVVMEVSSHALEQNRLQGLPIRLAVFTNLSRDH
                     LDYHGTMAEYFAAKTKLFAWPGLRAGIINFDEAQADVLFEALGATADCWAYGLGDPDW
                     RVADCQHVRVTSITALPNGIDIQVRTPLGEARLQPSLVGLFNGANIMAALAAVLALGM
                     PLETAIKALDQSTPPPGRMQMITLPSGARALVDYAHTPDALDQVLRALRDHRDAAGKI
                     ICVFGCGGDRDRGKRPLMAATAERLADQIVMTADNPRSEAPQAIIADMRGGLASPDTA
                     SVELDRRAAIESALMQAKAGDWVLIAGKGHETTQEIQGQRLPFDDAAVVRDWIAQQTD
                     VRAKRSVGGAA"
     gene            469355..470779
                     /locus_tag="HNEAP_RS02220"
                     /old_locus_tag="Hneap_0446"
     CDS             469355..470779
                     /locus_tag="HNEAP_RS02220"
                     /old_locus_tag="Hneap_0446"
                     /inference="COORDINATES: protein motif:HMM:TIGR01143"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
                     6-diaminopimelate--D-alanyl-D-alanine ligase"
                     /protein_id="WP_012823339.1"
                     /translation="MMRASLQQVATWLNQLSVQQPDITIQGVSTDTRTLVPGNLFVAL
                     KGERFDGHDHLADARLAGAAAAIVSHLNPDIDLPQIEVEDTLTALQTLGQCWRGQVDP
                     FVIAITGSAGKTTVKQLLASICAQAGPTLATLGNLNNDIGVPLTLLSLSDIDQFAVIE
                     MGANHLGEIARLTALARPDVGLITMAGTAHVGEFGSVDAIVQGKGELFVGLVPEAQAV
                     INLDSYGADRWWAMGSAQRNGFTLNNDPRARWTGEYNATTERLTIFENGQLLIESQPL
                     PLPGAHNATNLLAAVAVARTAGFSKEIILAGLNSFTPPAGRMSLVACSEQLTVINDTY
                     NANPESMCAALDYLVGRPGLHLAVLGDMGELGDLSAALHEEVIAYARGLAIDGLFTLG
                     AAMDVAMKPNAVSSNVSIEYSAKDHADLALALVRALDQLASRSASGTPITILLKGSRF
                     MRMERILNQLLPTDGPSPAESEAH"
     gene            470781..471863
                     /locus_tag="HNEAP_RS02225"
                     /old_locus_tag="Hneap_0447"
     CDS             470781..471863
                     /locus_tag="HNEAP_RS02225"
                     /old_locus_tag="Hneap_0447"
                     /EC_number="2.7.8.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008045924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="WP_012823340.1"
                     /translation="MLLILFDWLAKFYSPFGVFHYLTLRTMLGVLTALIVALWIGPPM
                     IRWLQSIKAGQPIRSDGPQSHLSKAGTPTMGGALILVAIGVAVLLWGDLTNRYVWIAL
                     LTTFGFGLIGGVDDYLKLSKRNSKGLASRYKYFWQSVIALIVAVVLFNMAKTPQETGL
                     IIPLFKDVLIPLGFGYILLTYFVIVGSSNAVNLTDGLDGLAIMPTVLVAGGLSVFAYV
                     TGNVKFAVYLGIPFVPGAGELAVFCAAIVGAGLGFLWFNSYPAQVFMGDIGALALGAA
                     LGVVAVMVRQEIVLFIMGGIFVLETVSVMLQVASFKLTGKRIFRMAPIHHHFELKGWP
                     EPKVIVRFWIITVILVLIGLATLKVR"
     gene            471863..473278
                     /locus_tag="HNEAP_RS02230"
                     /old_locus_tag="Hneap_0448"
     CDS             471863..473278
                     /locus_tag="HNEAP_RS02230"
                     /old_locus_tag="Hneap_0448"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019589138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoyl-L-alanine--D-glutamate
                     ligase"
                     /protein_id="WP_012823341.1"
                     /translation="MEKHSLILGMGKSGLSVARHLSRLGLPFAAADTRDDAVLRAEWV
                     AQYPDISITMGALHESLLDNVAELIVSPGIALDLPLIMSARVKQIPVRGDIDLALHAS
                     DVPVVLITGSNGKSTVTALVGELLNAAGVSAVVGGNFGTPALDLLTTDADVLVLEVSS
                     FQLESTDFSGLAPAQMPRAATVLNISQDHLDRHGTLAHYAAIKETALHQARRAVLNRD
                     DPMVAAMAERASGDVIWFGTAMPTQPSDFGLMTIAGESWLIQAQANATALSILPVQAL
                     GLTGRHNQMNVLAALALIQAVVPDVALNDDRLLNVLRQFTGLPHRAQSVGVINGVRFI
                     DDSKATNVGAAVAAILGMPAPLVLIAGGQGKGQDFAPLAESLVGRCAGLILMGQDQAV
                     IAEALQNEPGATWPVRRVHSMIEAVQAAADIAPPQSTVLLAPACASLDMFVSYVDRGN
                     QFAAAVASLSAKKTNGTEFTS"
     gene            473275..474522
                     /locus_tag="HNEAP_RS02235"
                     /old_locus_tag="Hneap_0449"
     CDS             473275..474522
                     /locus_tag="HNEAP_RS02235"
                     /old_locus_tag="Hneap_0449"
                     /inference="COORDINATES: protein motif:HMM:TIGR02614"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsW"
                     /protein_id="WP_012823342.1"
                     /translation="MNRTVQKLLPWLTASAQDVEKVRNESIRLDPILMVAVLALLAWG
                     LVMVTSASMELGERFGNPFFFVIRQTIAVVIGASITVWLVLRQPIALWVEYKLWILIA
                     SLLLLLVVLLPGIGHSVNGANRWIPLGPVNIQVSEFARLGLIIWMAGYIATHTIKLQN
                     RITGMLGPGVVIFAASLLLLLQPDFGTTAVLAATLFAMAWLARAQWQMMVGSTLVMGV
                     LGVFVVLSEQYRIERLLSFSNPFADPFGHGYQLANALIAIGTGGVWGRGLGESIQKLS
                     YLPEAHTDFIFAVLAEELGLIGVIALIGLYGLIVWRGFVIANMAWKENQIAGAALAWG
                     ISVWIGMQALINMGVNMGVLPTKGLTLPLMSYGGSAMIVALISLGFLMRVHHEAAMVA
                     ELREAQMTKRQQDASIRTKEVLS"
     gene            474519..475643
                     /locus_tag="HNEAP_RS02240"
                     /old_locus_tag="Hneap_0450"
     CDS             474519..475643
                     /locus_tag="HNEAP_RS02240"
                     /old_locus_tag="Hneap_0450"
                     /EC_number="2.4.1.227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyldiphospho-muramoylpentapeptide
                     beta-N- acetylglucosaminyltransferase"
                     /protein_id="WP_012823343.1"
                     /translation="MTSQEKPLVYVMAGGTGGHVIPALAVARGLAEKGYAIRWLGTTA
                     GIEARLVPEAGFPIDWLTIGGLRGKNLLTRLLTPLRLIRAVFAARKYFARNKPALVLG
                     LGGYASGPGGLAARWLGLPLVIHEQNAIAGLTNRVLARIANQTLAAYLNAFPRVPQAF
                     TVVGNPVRADIVGMPGVVQRQIGHRGPVRVLVLGGSLGAKALNDTVPSALSRVSPQLP
                     ISVWHQTGIKNIESTQTNYKQCKWADGSDYRVVPFIDDMAQAYAWADFVIARAGALTV
                     AEISVAGIGALFVPFPHAVDDHQTHNAEPLVQSGAALLMQQRDMTVERLVDSLVPVLS
                     DPDRLREMALAARERALPKATETMVRICIETMKKQHKAAT"
     gene            475640..477115
                     /locus_tag="HNEAP_RS02245"
                     /old_locus_tag="Hneap_0451"
     CDS             475640..477115
                     /locus_tag="HNEAP_RS02245"
                     /old_locus_tag="Hneap_0451"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate--L-alanine ligase"
                     /protein_id="WP_012823344.1"
                     /translation="MINPAMINSVGGTHRPVADIRMRQVRHLHFVGIGGAGMSGIAEV
                     MKTLGFTVTGSDVAESAAVIRLRQLGIPVQIGHAAAHVCDADVIVISTAVKADNPELA
                     AAQAKRLPIVRRAEMLAELMRFRIGLAVAGTHGKTTTTSLLAAILAEAGWDPTYVIGG
                     KLLSSSSNARLGRGEYLVAEADESDASFLHLQPHVAIVTNIDADHLETYDGNFERLVD
                     HFIEFLHNLPFYGLAVLCADDPVAAGITARVGRQVLTYGIDQPADVRATDVYSDGFGS
                     RFVVNLPNQTQFDCRLAMPGRHNVLNALAAITVAQDLGVPVAAIQQALTSFQGVGRRL
                     ERRGALAIKGKKLPLIDDYGHHPREVEATLQAVRAAWPDVRLVVIFQPHRFSRTRDLF
                     EDFVRVLSTVDHLILLDVYAAGEAPIAGADGRSLARAIRNRGQVDPVFVVGADEAAAV
                     LPDIIPENELDQPMLVLTLGAGNVGSLPALLLNRYGEQSHA"
     gene            477108..478082
                     /locus_tag="HNEAP_RS02250"
                     /old_locus_tag="Hneap_0452"
     CDS             477108..478082
                     /locus_tag="HNEAP_RS02250"
                     /old_locus_tag="Hneap_0452"
                     /EC_number="6.3.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--D-alanine ligase"
                     /protein_id="WP_012823345.1"
                     /translation="MRDPAVFGRVLLLLGGWSSERVISLKSGETVLGALQRAGIDVTA
                     MDVRRDFLPELLAAHQAKPFDRAFIILHGRGGEDGQIQAVLELLGIPYTGTSMGGSAI
                     GMDKLACKRIWRGEGLPTPPWAVVATEIEAHRALDSLGLPVMVKPVAEGSSVGVAKVD
                     QPDQLAAAFREAARYGQVMMERYIRGGEYTVSLLGGRALPVIRLSTPHDFYDFDAKYL
                     ANDTEYTIPSGLSAEEESAMQAIALKAFEQIGGSGWGRVDFMRDEHGQNWLIEVNTVP
                     GMTDHSLVPMAARAVGIEIEELCLGILAQTLPDESKSTEGSANGREHD"
     gene            478085..478900
                     /locus_tag="HNEAP_RS02255"
                     /old_locus_tag="Hneap_0453"
     CDS             478085..478900
                     /locus_tag="HNEAP_RS02255"
                     /old_locus_tag="Hneap_0453"
                     /inference="COORDINATES: protein motif:HMM:PF08478.8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsQ"
                     /protein_id="WP_012823346.1"
                     /translation="MAAASRPVQARPKSPSLREQWDAFAQMAIRLLTVLFNWAITFAL
                     LGMLGLAGWAFWQKLQVPVAHVVVQGATPEASADWVRRDLSAVIGQDIWQVDLNAVQA
                     QLLKNTWLTRADVRRVWPDTLVVQIAIHHPIARWQGDQLLDSDGSVFQPNGMSRGLAN
                     TEALPNLSGPDGRQWAVWERYLSLKPALAAEGLEMTGLIENSRGSLDVMVQGGTKIRL
                     GTEQIESRLQRLLDVYQKTLVGKLDQIAVIDLRYTNGFAVQWRNPPAAPKKKK"
     gene            478931..480181
                     /locus_tag="HNEAP_RS02260"
                     /old_locus_tag="Hneap_0454"
     CDS             478931..480181
                     /locus_tag="HNEAP_RS02260"
                     /old_locus_tag="Hneap_0454"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="WP_012823347.1"
                     /translation="MAIAVRKGERDLVVGLDVGTSKVAALVGEYDADGNLSLIGFGQS
                     PTNKGLRRGSVVDIESTSFAIQRAIDAAGAMSNCEIGSVWVGVAGDHVISMDSKGMTG
                     TAGREITAADIHQVVQSAKAVKIPDGQQILYSEPQEFRIDGQDGIRKPQGMTGHRLEA
                     DVHIVTTATNNVQNIVKCVERCGLAVTGTVLDPIAAATAVLNDDEKELGVALIDIGGG
                     TTDIAIYTRGALRYTTVLPIAGEQITNDLAYGLTTPPAQAEEIKRKFASLHPLDDRAQ
                     DEEIEVPGVSGRQPRRISRDTMMRICRPRVEEILGYIQEAIRRSGYHEMINAGVVLTG
                     GTAAMPGLVELCEDFLQMPTRLGLPQGISGNHDALKNPANATGVGLILHGRRLEAQGG
                     IPAPVGVQAEPPLDRLKRWFKEHF"
     gene            480248..481393
                     /locus_tag="HNEAP_RS02265"
                     /old_locus_tag="Hneap_0455"
     CDS             480248..481393
                     /locus_tag="HNEAP_RS02265"
                     /old_locus_tag="Hneap_0455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019626873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="WP_012823348.1"
                     /translation="MTWNMVEVQHEGAKIKVIGVGGGGGNAVAHMLTKELEGIDYICA
                     NTDSQALRKSQAHSQLQIGSNITKGLGAGADPELGRQAALEDREQIQEAIKDANMLFI
                     TTGMGGGTGTGAAPVIAQIAKDMNILTVAVVTRPFSFEGKKRTKTALEGIAELEKQVD
                     SLIVIPNDKLTAVMGKSASLKDAFASANEVLFTAVSGISELITRPGEINLDFADVRAI
                     MTEKGTAMMGTGIGHGDNRAAEAAEAAIHSPLLDDINLTGADGILVNVSSNGDLSIGE
                     FMEIGELVQALAGDEALVKVGTAIDESLEGSLRVTLVATGLVRNTVIAEERKPRVVVH
                     NESPRAAVSEQESQSAPMRHAVAQVRGNTAINMDVIDIPSFLRQQAD"
     gene            481756..482256
                     /locus_tag="HNEAP_RS02270"
                     /old_locus_tag="Hneap_0457"
     CDS             481756..482256
                     /locus_tag="HNEAP_RS02270"
                     /old_locus_tag="Hneap_0457"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019656783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600583.1"
                     /translation="MNVRLLTAMACVIALSGCAQVAHLTEGSQTDQEQKSAGVKPQEA
                     APAISSTAKDKPAAQGSHTEATEAESKRGIYGNPPRHSPFAKLKLGMSSKQVTDLIGE
                     PTDQKSYMTGKIWIPFYFGSDRARLEYRYKGQGVLTFVGGGGFVSSNFTLYRVIYNPK
                     EEGYEH"
     gene            complement(482560..483021)
                     /locus_tag="HNEAP_RS02275"
                     /old_locus_tag="Hneap_0458"
     CDS             complement(482560..483021)
                     /locus_tag="HNEAP_RS02275"
                     /old_locus_tag="Hneap_0458"
                     /inference="COORDINATES: protein motif:HMM:PF08808.9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RES domain-containing protein"
                     /protein_id="WP_012823351.1"
                     /translation="MKVYRIIKTKYVNDAWLGKGAAIAGGRWNSKDVAMVYASDSLAL
                     AQLEILVHLQDSPHLTDFSYFVVDIPESDLRRLEPQDLPNDWDSEPSGMETRHIGDEW
                     VQSESSIGLIVPSATSPESYNVLLNPGMDRFKELVLDTQPTSFAFDKRLNR"
     gene            complement(483018..483551)
                     /locus_tag="HNEAP_RS12130"
                     /old_locus_tag="Hneap_0459"
     CDS             complement(483018..483551)
                     /locus_tag="HNEAP_RS12130"
                     /old_locus_tag="Hneap_0459"
                     /inference="COORDINATES: protein motif:HMM:TIGR02293"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441086.1"
                     /translation="MLPFPPARRGEYMSTTADITDNGPSKVERFRPSRTRQSGPTRVT
                     DVVELYVPHAHGAELVRFIHQGLDLRIVKDASASINVPQTVFLHWSGIKPHNLKRRAK
                     SGTLSAAEGESALRVMRVYEAAVNLFEGDTDAAKSWLETPAPALGGTKPGDLLHSETG
                     AVEVMDLITRIEYGVYS"
     gene            complement(483774..484823)
                     /locus_tag="HNEAP_RS02285"
                     /pseudo
     CDS             complement(483774..484823)
                     /locus_tag="HNEAP_RS02285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006215922.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
     gene            complement(484996..485072)
                     /locus_tag="HNEAP_RS02290"
                     /old_locus_tag="Hneap_R0011"
     tRNA            complement(484996..485072)
                     /locus_tag="HNEAP_RS02290"
                     /old_locus_tag="Hneap_R0011"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(485036..485038),aa:Met,seq:cat)
     gene            complement(485265..487091)
                     /locus_tag="HNEAP_RS02295"
                     /old_locus_tag="Hneap_0461"
     CDS             complement(485265..487091)
                     /locus_tag="HNEAP_RS02295"
                     /old_locus_tag="Hneap_0461"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="WP_012823353.1"
                     /translation="MYEDQQASIKSLIARGREQGYLTYAEISDHLPEALVDADQIEDI
                     IGMIQEMGISVSEVAPDGDDLGLADESRAASDEDATEEAVAVLASQVDAEFGRTTDPV
                     RMYMREMGTVDLLNRQGEIEIAKRIEEGLIDVTRALAFYPPTIETLLEHYARIEAGDL
                     RMQDVIVGIIEPEVEIPEDAEEKPLDVAEGKASNTDDEDEDEEDDTEEEAVVDNTLDP
                     ELVRTHLMEIKRLAENLDERSPEYLASLADQLVQLKLNPAFNEKLLEQIRQAIARIRL
                     LEKQIMHQAVDKGGLKRETFIEAFRSNESDIGWVKVATKGKPTAKFSQVQPEIERLQK
                     RLNTVARDSKLTVAQTREVHRLITLGEAKARRAKKEMIEANLRLVISIAKKYTNRGLQ
                     FLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIE
                     TINKLNRISRQMLQEMGREATPEELAERMDLPEDKIRKVLKIAKEPISMETPIGEDDD
                     SNLGDFIEDQSAISPMDSATNASLSEIVREILASLTPREAKVLMMRFGIGMNTDHTLE
                     EVGKQFDVTRERIRQIEAKALRKLRHPSRSERLRSFIEMNID"
     gene            complement(487230..488909)
                     /locus_tag="HNEAP_RS02300"
     CDS             complement(487230..488909)
                     /locus_tag="HNEAP_RS02300"
                     /inference="COORDINATES: protein motif:HMM:PRK05667.1-4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_012823354.1"
                     /translation="MPDMSFIPESFIDDVLARTDLVELIHAQVPLKKKGKEYAACCPF
                     HQEKTPSFYVNPDKQFYHCFGCGAHGNAVSFLMDYEHRDFRGAIEELATRAGMTLPVS
                     EVDHKALEEQAAMLDSMSFANAHFKRQLRAHQEAIDYLKQRGVNGTTAALFDLGFAPN
                     GNLLLGHCESPPKMRDELLELGLIVQKDDGEQYDRFRRRIMFPIRDKRGQIIGFGGRI
                     LGPGEPKYLNSPESRLFHKGQNLYGLYEARLDDARPARVIIVEGYMDVVMLAQHGVRN
                     VVATMGTATTDEQTQSLYRFSPSLVFCFDGDAAGRRAATKALHAALPHLTDGRDLRFL
                     FLPDGEDPDSFIQAKGKSAFIEQIEHHSLSFDNFILQLLDQMEPGQDTAAMAKKSKLG
                     NDWIRTLPDGALKRITQRRINEHTGVWRAAYKKNTGPTEPTLPRNKPQSYAKQTLILS
                     IVLKHPDLLQRVLEPQAWFNSRVPEGFQLLATQPRARWAQSASELWGAEETKTALAIE
                     FQGIERAETAQNILEDTLIQLHRSESDSASKQASRQALARFMAEQEKNPKS"
     gene            489265..490032
                     /locus_tag="HNEAP_RS02305"
     CDS             489265..490032
                     /locus_tag="HNEAP_RS02305"
                     /inference="COORDINATES: protein motif:HMM:PF08238.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1 domain-containing protein repeat-containing
                     protein"
                     /protein_id="WP_012823355.1"
                     /translation="MQWAKWVKWGVVGTMLVTPLWAQASEKPTAKHSAVPIPEAKTED
                     LYAGNSLNRWMPKAERGDIFAQYVLGHMYCVGQGVPKDMVKGLSWYQRAADQGFAPGQ
                     LALGTMYYNGEGVKQDYTVAAKWFRLAAERGYDRAQSNLAAMYMNGTGVPQDYTLAIK
                     WFRAAANQGYATAQYTLSRMYSDGTGMSKPDMVAAYGLLRPLVEKGNAAAVTAMKELL
                     PKMNPDQIKQGQELAERIRGKNRLNKALDAYEKIALR"
     gene            complement(490109..491554)
                     /locus_tag="HNEAP_RS02310"
                     /old_locus_tag="Hneap_0464"
     CDS             complement(490109..491554)
                     /locus_tag="HNEAP_RS02310"
                     /old_locus_tag="Hneap_0464"
                     /inference="COORDINATES: protein motif:HMM:TIGR04265"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cardiolipin synthase"
                     /protein_id="WP_012823356.1"
                     /translation="MLELFDLQNAHWAALYVLVEWLVRLFALIVVPMRRPPVTATAWL
                     LLIFFQPLIGGIIYLFVGRPRVSSARQQKIDDLEKALAPNLNHLQKQQSLHHRTTLPD
                     QWRPIAQLARHWRIFPEFGGNAVAVIEQLPELVRQLVADIDNANHSVHLLFYIAARDD
                     LTEPVFTAMLRAVKRGVEVRLLVDDYGSKKFMAPLLALEAEGIRVARAFPRSKLPRQS
                     ARFDLRNHRKLVVIDGLIGYAGSMNLIRPDFKPNIIYEDIMLRLRGPIALELQTIFAG
                     DWYIERNAMLTGVQYFPTPEAAGDEICLGLPSGPEYPDPVQQQLLLSLIHVSTESIRL
                     VTPYFVPDDAMLLALKTAAQRGVEVELILSERLDQRLVQWAQESYYAELLDEGIIIRR
                     YPRYFLHTKFALFDDRISLIGSANLDVRSSLINAELGLLFYAPQTAQTLNRLLARYRD
                     SARILSIEAWALRSRREVIIQNLARLTTPLL"
     gene            complement(491554..492396)
                     /locus_tag="HNEAP_RS02315"
                     /old_locus_tag="Hneap_0465"
     CDS             complement(491554..492396)
                     /locus_tag="HNEAP_RS02315"
                     /old_locus_tag="Hneap_0465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013964549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase"
                     /protein_id="WP_041600587.1"
                     /translation="MPRSILITGCSSGIGQCVARGLADRGHRVVASVRQKKDLDTWPH
                     ADIPVVLLDLTDDQSIESGLNAALAHTDGSFDALFNNGAFGLPGAVEDLSREALRAQF
                     ETNLFGWQVLTNRVIPLMRAQGFGRIIQNSSVLGIAALPFRGAYVASKFALEGLSDTL
                     RMELNGTGIDVSLIEPGPIASRFRANAQAVFLRYIPIESSIHADAYRKQLERLNKPGP
                     AAPFTLPPEAVLDRVIHALESRRPKARYPVTVPTYLFSVLRRLLPSRWMDRVLLAASG
                     GGRR"
     gene            492545..493210
                     /locus_tag="HNEAP_RS02320"
                     /old_locus_tag="Hneap_0466"
     CDS             492545..493210
                     /locus_tag="HNEAP_RS02320"
                     /old_locus_tag="Hneap_0466"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BAX inhibitor protein"
                     /protein_id="WP_012823358.1"
                     /translation="MSLQNSTVSPRRESLLATNQLIRNTYLMLSMTLVFSAVMAGVSM
                     WMNLPPMISLIAMFGSMALIWFVLPRTARSGAGLVTVFAITGLMGLGLGPTINYYLHL
                     EGGDQIVMTALGGTGAIFLALSAYALISRRDFSFMGGFLMVGMIVVLLAMLGNLFFHL
                     PALSMALSGAVILLMSGFILFDTSRMVNSGEDNYLMMTVSLYLSIFNIFVSLLNILGA
                     SRD"
     gene            493301..493495
                     /locus_tag="HNEAP_RS02325"
                     /old_locus_tag="Hneap_0467"
     CDS             493301..493495
                     /locus_tag="HNEAP_RS02325"
                     /old_locus_tag="Hneap_0467"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823359.1"
                     /translation="MDWIKILSAVFIVAMLVFLWPRAGQMIRESRKGTINEWLWVGLL
                     LLAVAAFVVFLMQSMHSTVV"
     gene            493567..494154
                     /locus_tag="HNEAP_RS02330"
                     /old_locus_tag="Hneap_0468"
     CDS             493567..494154
                     /locus_tag="HNEAP_RS02330"
                     /old_locus_tag="Hneap_0468"
                     /inference="COORDINATES: protein motif:HMM:PF00571.26"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CBS domain-containing protein"
                     /protein_id="WP_012823360.1"
                     /translation="MTERTPNRLPDEDIQAAMRAMSGYIDITTDDFREIFELAHEHAI
                     RRLFCCMDVPHLMRRDFSALKPDQTLTEAAEQMALMHAHTLPVVDENGLVLGDVSEWN
                     FLQGYGADTFFSLIFRLMAHDQRFIDYCERTLVREIMTQPAVTLPEQGTFADIARAFH
                     QVEEKRLPVVDAQNHLVGVVMRRDFLERFHWEEWL"
     gene            494145..494774
                     /locus_tag="HNEAP_RS02335"
                     /old_locus_tag="Hneap_0469"
     CDS             494145..494774
                     /locus_tag="HNEAP_RS02335"
                     /old_locus_tag="Hneap_0469"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HPP family protein"
                     /protein_id="WP_041600334.1"
                     /translation="MAVSRETDETAQPVGWVKFWRKWRGRGHGSPPRVSWAEVFWSGL
                     GGVLGLMAVGVCALAFTGLDRILIIGSIGASAVLLFGAIRSPLAQPRNLIGGHALSAL
                     IGVSLHLLLVRETGDPGILSGIQPFIASVLTPALAVGLSIAVMHATRTLHPPGGATAL
                     VAVIGSQQIHAMGYWFVLFPGILAPLILLFIALVFNNLVPKRVYPEFWW"
     gene            494874..496880
                     /locus_tag="HNEAP_RS02340"
                     /old_locus_tag="Hneap_0470"
     CDS             494874..496880
                     /locus_tag="HNEAP_RS02340"
                     /old_locus_tag="Hneap_0470"
                     /inference="COORDINATES: protein motif:HMM:PF00672.23"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="WP_012823362.1"
                     /translation="MNRWISRFSIAQKNLFSYGLILVLMCSMAILTYFNMNRIQGMTK
                     EVIAQRQPAAFAADGIRVQLERAMASVGLYLQSKSPADKKRFDEAISGISQEQAALKQ
                     HSDESLDGLDAGLKTFVTDANEVMKISADDKLNMPGMDYANQNVNPLSIQISGLMGTL
                     ISAEADADAGVLPRRALVLELARLRGEWGDVLAGLRGFMAFRSPALEKNFNLYTAEVL
                     KRTQEINTNYGNLLTFEQQDAVDQLLKLLPQFIDQAGKAFAIHKSDKWRMDAYLVRTK
                     LTPAFADVESSVNEIVKHEQSLIHGQSKVMDQTISNIAFGQVGLVLLGILVIVASALL
                     SMVTISSPLRLVAERMRDIAEGDGDLTRRLPVNGKDEIADVSRAFNTFAETAHKLVSQ
                     VVMTTRSLSDSADRLNDSSARAQQGAARQARDTEALVTGMSQTLEAAEDVARSAETAS
                     ASVQEANDKLSEGLAKVDVSTHSAEQLDSVLLRAEQKIHELSNQSQTIGKVLDVIRAI
                     ADQTNLLALNAAIEAARAGEHGRGFAVVAEEVRSLATRTQESTREISGIISQLQSGAQ
                     EAVSAMGEGREVSHESLDAITQANQMLINIAQAFGHLSDMSVRIAAAAEEQTAVASGM
                     KQNIESINSTAADAAKQGEEISSSGTDVSQQARTLAELVRQFKI"
     gene            496904..497485
                     /locus_tag="HNEAP_RS02345"
                     /old_locus_tag="Hneap_0471"
     CDS             496904..497485
                     /locus_tag="HNEAP_RS02345"
                     /old_locus_tag="Hneap_0471"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_012823363.1"
                     /translation="MSAKPPLIDEVRACRICQDNLPFPPRPILQFSPSARLLIAGQAP
                     GKKAHQSGVPFDDASGDRLRGWLGLSRAQFYDEQTVALLPMGFCFPGTGTSGDLPPRP
                     ECAPAWRSALLDALTHLEFTIVIGRYAQAYHFGTRRQSLTEQVQAWREHWPEKVLLPH
                     PSPRNQLWLKRNPWFERDLVPVLQARVADVIGP"
     gene            497833..498273
                     /locus_tag="HNEAP_RS02350"
                     /old_locus_tag="Hneap_0473"
     CDS             497833..498273
                     /locus_tag="HNEAP_RS02350"
                     /old_locus_tag="Hneap_0473"
                     /inference="COORDINATES: protein motif:HMM:PF11911.6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3429 domain-containing protein"
                     /protein_id="WP_012823364.1"
                     /translation="MRLLAWVLGLGGVIPFAGLAMAAWWGPLDWHSTVIRVLSVYAAV
                     IVSFLGGVHWGAALNQSVAARRHLLWGVSLSLLAWVAALLPWGIMRLSVFILLLLTAL
                     RVDRVWFGGIGASLNFGVLRTVLTALASLSLLLAIGSYARAGLI"
     gene            498270..498947
                     /locus_tag="HNEAP_RS02355"
                     /old_locus_tag="Hneap_0474"
     CDS             498270..498947
                     /locus_tag="HNEAP_RS02355"
                     /old_locus_tag="Hneap_0474"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012823365.1"
                     /translation="MSEVGSKVSTLRKWLVAGILVWAPLAITYWVINAVIGFMDKTIL
                     LLPPSYRPEAVFGFNIPGVGAVLAIIVVLLTGALVANFLGRKLIAMGESVLERIPLVR
                     SVYSAVKQVIETFVSQDSRSFRKVVMVEYPRKNCWSLAFLAGDPVGEVQDKTAQKVIT
                     VFVPTAPNPTSGFVIMVPEDEIIALDMSVEEGFRMVISLGVVTPKSQAAKPVLAVPEL
                     EKPPSSG"
     gene            498991..500775
                     /locus_tag="HNEAP_RS02360"
                     /old_locus_tag="Hneap_0475"
     CDS             498991..500775
                     /locus_tag="HNEAP_RS02360"
                     /old_locus_tag="Hneap_0475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008291974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate--tRNA ligase"
                     /protein_id="WP_041600588.1"
                     /translation="MRSHTAGQVDLAVLDQEVTLVGWVNRRRDHGGVIFVDLRDRDGM
                     VQIVFDPDDLDVFAKAESLRSEFVIRVRGKVRRRPAGTENPNIVSGQIEVLGLGLEIL
                     NRSEPLPFQLDDERVSEEHRLRYRYLDLRRPEMLARLKLRHQVTRALREHLDNAGFMD
                     VETPVLTRATPEGARDYLVPSRTHPGEFFALPQSPQIFKQLLMVAGIERYYQIVKCFR
                     DEDLRADRQPEFTQLDIETSFLDEEEVMALIEDMMRHLFAQTIELALPNPLPRLTWAE
                     AMRRFGSDKPDLRIPLELVDVGDLLVAVDFKVFSGPANDPRGRIAALRVPNGNSLPRS
                     AIDDYTKFVSIYGAKGLAYIKVNDAAAGREGLQSPILKFLTDDAIDGIMTRTGAQTGD
                     VVFFGADKAKIVNESLGALRVRIGQDMGLVEQGFRALWVTEFPMFEYDEKEGRYYALH
                     HPFTAPNLDDLHLLETDPEAVRSRAYDFVLNGFELGGGSVRIHDQTMQKRVFELLGIS
                     AEQASEKFGFLLDALKFGAPPMAGLAFGVDRIVMLMSGATSIREVIAFPKTQSAACLL
                     TNAPGEVDEAQLRELSIRVRKPVVEKAE"
     gene            500852..501937
                     /locus_tag="HNEAP_RS02365"
                     /old_locus_tag="Hneap_0476"
     CDS             500852..501937
                     /locus_tag="HNEAP_RS02365"
                     /old_locus_tag="Hneap_0476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823367.1"
                     /note="3 different subfamilies; catalyzes the formation of
                     quinolinate from iminoaspartate and dihydroxyacetone
                     phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinolinate synthetase"
                     /protein_id="WP_012823367.1"
                     /translation="MSTTRDAATQIPAVLAARIQALASHSVPAPKLSHVQEHELIERI
                     KAELVRQNAVMVVHYYVDAALQKLADETGGRVSDSLDMAAFGAAHSAETLVVCGVRFM
                     GETAKILSPEKRVLMPTLNAECSLDLGCPADEFTAFCDAHPDRTVVVYANTSAAVKAR
                     ADWVVTSSNALQIVGHLKEQGEKIIWAPDRHLGRYIQEKTGADMLLWQADCVVHNEFA
                     GEALIDLKRQHPDAAVLVHPESPKAVVDLADVVGSTSQLIRAAHDLPQSEMIVATDNG
                     IFYKMQQAVPSKTLIEAPTGDGSHCVSCAHCPWMAMNGLQAVYDALVSPDGHEIFVPE
                     AVRVNAVKSLDRMLAFSKAQGLVTARK"
     gene            502064..503914
                     /locus_tag="HNEAP_RS02370"
                     /old_locus_tag="Hneap_0477"
     CDS             502064..503914
                     /locus_tag="HNEAP_RS02370"
                     /old_locus_tag="Hneap_0477"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/hydrogen exchanger"
                     /protein_id="WP_012823368.1"
                     /translation="MDQTILITLTGIIVTGIGAQWLAWRLKVPAILFLLGIGLFLGPV
                     TGLLNPNALLGDLLFPFVSLAVAVILFEGALTLQFKELKGVGSAVWLLVTLGAFVTWV
                     IASYAAHYFVGLEPLMAALFGAIVIVTGPTVIVPLLRIVRPNNKVSTILRWEGIIIDP
                     IGAVVAVLVFEYILMSATPAHANANLTAVIIPFLELIGVGMVLGLVGGYLLGLILRRH
                     LLPEYLVNVVVLATVLAVFTTSNLMADESGLIAVTVMGVLLANMRAVPLAEILHFKES
                     LTILFISGLFILLAARIEPAMFSAIGFSALLVLFTVQFIAQPVKVWLSTIGAGLSWRE
                     KLMISWIGPRGIVAAAISGLFALKLNQQGIAGSDVLVPLTFIIIFGTVVTASLTARPL
                     ANYLGVAQPEDKGVLMVGINVFSCMLAHALKKHGYRVILTDSNFADIRTARMEGLETF
                     YGNAVSQAAERRLDLVGIGRLFAVSGVPEMNNLAAIRYRHEFGAENVYVLQTPQEKSG
                     SDQQRLSHVFTGRKLFGTGVSLGDLMLLIEQKAEIKSTRLTEEFNWEKYQQTYDKRGI
                     LLLMISPKGILHVQSDGPMPTPSEGWIIIGLYRAQTEVEAKPDAVEASAA"
     gene            503998..504073
                     /locus_tag="HNEAP_RS02375"
                     /old_locus_tag="Hneap_R0012"
     tRNA            503998..504073
                     /locus_tag="HNEAP_RS02375"
                     /old_locus_tag="Hneap_R0012"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:504031..504033,aa:Gly,seq:gcc)
     gene            504075..504150
                     /locus_tag="HNEAP_RS02380"
                     /old_locus_tag="Hneap_R0013"
     tRNA            504075..504150
                     /locus_tag="HNEAP_RS02380"
                     /old_locus_tag="Hneap_R0013"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:504108..504110,aa:Val,seq:tac)
     gene            504161..504237
                     /locus_tag="HNEAP_RS02385"
                     /old_locus_tag="Hneap_R0014"
     tRNA            504161..504237
                     /locus_tag="HNEAP_RS02385"
                     /old_locus_tag="Hneap_R0014"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:504195..504197,aa:Asp,seq:gtc)
     gene            504434..505717
                     /locus_tag="HNEAP_RS02390"
                     /old_locus_tag="Hneap_0478"
     CDS             504434..505717
                     /locus_tag="HNEAP_RS02390"
                     /old_locus_tag="Hneap_0478"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_012823369.1"
                     /translation="MALTDTAIKALKPESKPYKVTDEKGLYLFVTPAGGKLWRLDYRF
                     EGKRKTLALGGYPDVNLKQARVYRDEARQLIANGTDPAELRKAEKTTITESRREEAEA
                     VKIEAMIQAGEALPGSFEEIGDEWVNMYLADKSEKYRNKVINRLKAEVYPYLGRAPVA
                     DVTAPMVLKVLQRIEARGIIESAHRVKQNIGQILRYAIATGRRELFDVTMALNKAIAP
                     MPKDKNHAAPTEPKDIAPLLRIMAGYRGSPITRAALTIAPCVFVRIGELRHMQWADID
                     FETFEWRYTASKTGQEHIVPLARQVVAALIELQPLTGHSRYVFTGARSDTRPMSENTV
                     NGALKRLGIDTQTELTGHGFRAMARTVLEEVHNFRPEVIELQLAHAVRDPLGRAYNRT
                     KHLETRRKMMQVWADYLDELRDSKNVIQGNFGMVG"
     gene            505838..506875
                     /locus_tag="HNEAP_RS02395"
                     /old_locus_tag="Hneap_0479"
     CDS             505838..506875
                     /locus_tag="HNEAP_RS02395"
                     /old_locus_tag="Hneap_0479"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS5/IS1182 family transposase"
                     /protein_id="WP_012823370.1"
                     /translation="MKKRSAIKTDLFADTHHRDKLDTLGDPLAEIEACIDFAALAAEV
                     DRIAPRPVSVQGGRPPYPTETMVRILVLKRLYNLSDEQMEYQLLDRMSYKRFCGLSQA
                     TNIPDRTTVWTFENRIGEVGAQVIFDGVTTQLLKKGFIARGGQIIDATLVPAPKQSFS
                     KEDKEQLKADAMPADWQPGKRRQKDLDATWTKKHGKSQHGYKLSVNVDKKHKFIRKIV
                     TDTASTHDSQHFDAVIDPANTSRDVYADRGYPSEEREQWLKANGYRNRIQRKGKRNKP
                     LSEAQQGRNHRIAKTRARVEHVFGAIEQMGGKLLRTIGQARANFAMTMMAACYNLKRL
                     AYFQRVGITAF"
     gene            507500..507904
                     /locus_tag="HNEAP_RS02400"
                     /old_locus_tag="Hneap_0480"
     CDS             507500..507904
                     /locus_tag="HNEAP_RS02400"
                     /old_locus_tag="Hneap_0480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823371.1"
                     /translation="MMTIDQTKTSRRPRRGHVLAESDRRRHKVMTRVNDAELAEIDAR
                     RGLYDRGEFLRMSLFGMKQARPRPTIIIPALNQTAWLVLSRSASNLNQLSRHLNEAGL
                     QVADLPQIIIMLTQYRDALIGARLPEDQDDES"
     gene            507894..510317
                     /locus_tag="HNEAP_RS12455"
                     /old_locus_tag="Hneap_0481"
     CDS             507894..510317
                     /locus_tag="HNEAP_RS12455"
                     /old_locus_tag="Hneap_0481"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="relaxase"
                     /protein_id="WP_012823372.1"
                     /translation="MKAKVTRGTGFRGVLDYALDTGNQKGKNPEIVGGTLTSGSARAM
                     SDQFAVTRRLRPDIKSPVWHASLALPEGERLSSERWSSIADDFMQEMGFPSESLYTVI
                     RHNDTKHDHIHIIASRVSLSGGLWHGQWEVYRAIRATQVLERIHGLTLTPGLGEPKDE
                     KTLTKGEIEQALRTGAEAPRQRLQRLVKEAAQGKPTAVMFAERLELAGVGVRFQIQKT
                     GITGVNYELDGLAFKGQSLGDSYKWSKFSKKYGVSYEQARDSESLERYTTAIADRTGR
                     DELGNAGRSLEVDAGFVTPSSSRADSRSTGAVGEAEGGGHSSSDRLRQSDRSTAPDTG
                     GIDSADEYQRSGSIRAEGREAGQNNLRPVTESVGAEIEHRHDGEDRTEHRDDPGSTQE
                     ISASHDNHGERTERGGEIDTTEDLASDTGTDLSQRNRWDSGAHWASRFKQASAAKRRA
                     TGGGLGKRAIKQSDARRTRVTEQDRQSARELDPTAYLGANGYDVKHEGRHRSVRLHGD
                     EVYRVTQRQDGHWVWCDLYGNNGGDNIDLVREIEPGTGFAEAVFRLAGAPTVGPKRRP
                     PAEPKRPPPRLPKQEVASRALGRDYLINDRGISMDTIEHAEQCGMLRYANGGVLFVGY
                     DQASTPQNITRRAIESADPMQKRDLRGSDKRYPPILPGDPSTVWIVEGGSDALALHDI
                     AKRQGRPQPTVIVSGGANVRSFLEQVEVQAILKQAERVTIAGENERDEATQKRTDEAH
                     QKQVQRVKEITGRAVKSWTPKQYLGKDLAEMNYRQQPELMPVQLINLDQRAETKPSQV
                     IEGDLILGQ"
     gene            complement(510414..510584)
                     /locus_tag="HNEAP_RS02425"
                     /old_locus_tag="Hneap_0482"
     CDS             complement(510414..510584)
                     /locus_tag="HNEAP_RS02425"
                     /old_locus_tag="Hneap_0482"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AlpA family transcriptional regulator"
                     /protein_id="WP_012823373.1"
                     /translation="MDSILRLHDVLRITGASRSSIYLWVSAGIFPQPVKLGVRAVGWR
                     RSEVQQWLDDRR"
     gene            511384..512184
                     /locus_tag="HNEAP_RS02430"
                     /old_locus_tag="Hneap_0484"
     CDS             511384..512184
                     /locus_tag="HNEAP_RS02430"
                     /old_locus_tag="Hneap_0484"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_012823375.1"
                     /translation="MSQQNTSTQGVSEDSSRFSRVAIVTGATSGIGEATVRKFVQSGY
                     GVIGNARSADKLEALAVELGDAFFGVAGDAGDASVIDQLLDAAQAYFARPADIVVVNA
                     GRGLGGLMTEVDLAEYEQVLKLNVLGAALLMQKAAQALVEKQAADFPRQAADIVVIGS
                     VVGRNISPFSAVYGSTKFAVQSLAEGLRREVGKKGVRVTVIEPGIVVSGFQDAAGYDD
                     HLVDKFNTDFGPLLYGADIANAIDFVVAQPSHIHINELMIRPTRQDYP"
     gene            512390..515425
                     /locus_tag="HNEAP_RS12135"
                     /old_locus_tag="Hneap_0485"
     CDS             512390..515425
                     /locus_tag="HNEAP_RS12135"
                     /old_locus_tag="Hneap_0485"
                     /inference="COORDINATES: protein
                     motif:HMM:PF13185.4,HMM:TIGR00229,HMM:TIGR00254"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase with PAS/PAC and GAF
                     sensors"
                     /protein_id="WP_012823376.1"
                     /translation="MTSPADTFLDLSTSVLRDLVAGQSPKDLAARICLRIEQMRPGRI
                     ASVMWAGDGDERLHVFAAPSAPQGLIDQLDGLTPGAHAGSCGSAAHSGVPALVSDIET
                     DSRWDDLRPLAQQWHLRSCWSLPLFHNDRLLGTFALSGMVSDVPTDDDILLLQFAATL
                     VSALLHHEYQMMQRQRLTDQKSRLIDFNHMLAKVNQKIVSVESERELLQPLCDLAVRY
                     AHLKLVLLARPDETLRFRFLAASGATGYTDGLYISADPDLPEGQGTMGRTWRSEQAYF
                     NTSFEHSEFLQPWQSRARQFGLKATATLPVLRGGKMFAVLAVYHAEPDVFDGPLQDVL
                     RELALSISRGLDRLDARKLQNALFNNAFVGVFLVQGRVIKSCNPQAAHMFGYSLDDMV
                     GMPVRDFFASDIEYARLDKAFSKMSKSQVVQRQSMVCVRRDRKLLQCDVSGRMFIDNE
                     GEHSVWTVLDATERETQAQRLHRIAGFRELLSELNQFSADPANMQQVKDHDLYDFVCQ
                     VLSQNNALKLVWIGSPLPGGGGFDVLASSGELNWHSDCLPMQSEQPLSSGKLMREHTA
                     QRCWHENQTILLTYEIPSTDGRGGQSVARSTVSLPIHIDGTLTAVLTICGHSEDILDQ
                     DAISFFDNLVLNIERGLQNIRQRNQIMRLQGLYRALMQQADVVLRAQTVPDMLFGTCE
                     KLVQETPFNAIYLRKPNADGVMDVLASTGSGAAALQNVISVVAEDARDQLIVRAWLTQ
                     KTAIENDLLGNARLAEYHPFLRAHRWHSALVTPVRRGGELWSVMGFVCEDHDVFDPQT
                     VELCERVAELLGRGLDELDNKQRLVSLQSEEAYRARHDRLTDLPNRFALEQYLPQALA
                     RSKKNGRMLALGMMDLDDFKPVNDQFGHETGDRLLRELAGRLRARLRAQDFLVRLGGD
                     EFVVVIGDIDPDHAIAHLQLALSRLHEAVEEGFEEGFEVAPDRFATVGLSGGFALYPK
                     DGEDGDTLLRKADATMYQSKTRKNTRAQWWQLFDQEGIV"
     gene            515917..516708
                     /locus_tag="HNEAP_RS02440"
                     /old_locus_tag="Hneap_0486"
     CDS             515917..516708
                     /locus_tag="HNEAP_RS02440"
                     /old_locus_tag="Hneap_0486"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012823377.1"
                     /translation="MNSRSGDTRSDIVRALANMPAALFLSWSDTKARYKRSMLGPFWL
                     TLGTAIGVGGLGFVWSTLFKMDKAQFIPLLTVGLILWGFIAGIITESSQVFVQNAQLI
                     RNVQLPMFFHPLKLILRHLINLAHNAVVIVIVFLIYPPEWHWSAWLALPAFLLTVLNL
                     SWMSLFVGMFAARYRDTETAITNFMPLLFFMSPVLFKAEQLGVGSWIVWLNPFSYFIS
                     TVRDPLLGHPSPWFVWPVLLGMTVIGWLVTLWLFHTRRTRIPYWI"
     gene            516712..517440
                     /locus_tag="HNEAP_RS02445"
                     /old_locus_tag="Hneap_0487"
     CDS             516712..517440
                     /locus_tag="HNEAP_RS02445"
                     /old_locus_tag="Hneap_0487"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_012823378.1"
                     /translation="MAHLIFEHVSIRYPIYNARAQSLRHQFMRIATGGKIAAEAGQTV
                     AVTALDDVSFELKSGDSIGLIGHNGAGKSTLLRTMAGIYTPDSGRVIREGRTATVLEI
                     GSGMDPELSGYENILRMGMLMGIPLKEMRTKIPDIEEFTELGDFLSLPVRTYSSGMTM
                     RLMFAVATSGQPEILLVDEMFGTGDAGFQEKAKARMRDLIANAEIFVFASHDHKLLGE
                     LCDRVFELSHGKVIVATDFNKKEN"
     gene            517445..518881
                     /locus_tag="HNEAP_RS02450"
                     /old_locus_tag="Hneap_0488"
     CDS             517445..518881
                     /locus_tag="HNEAP_RS02450"
                     /old_locus_tag="Hneap_0488"
                     /EC_number="2.7.7.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate
                     guanylyltransferase/mannose-6-phosphate isomerase"
                     /protein_id="WP_012823379.1"
                     /translation="MIYPFILSGGAGTRLWPASRKAFPKPFMPLVDGQTLFDKTIERI
                     KQLPSAGPLTVITNESLRFLTADALRGSVAKQPRLLLEPTGKNTAAAIALAALDLQIR
                     AGSDALMLILPADHLIAEVGAFSEAVQVAENVANQDWLVTFGITPQSPETGFGYIERD
                     AQPLALEEGVAYRVRKFVEKPDRETAQAYIDSGRYSWNGGMFCFKVSTILAEFERHAP
                     ELLAACQVAVEHANQIHVAGMDMVEFKADDFERMADISIDYAIMERSERVAVVAADMG
                     WSDIGSWTAFADASPSNAEGNVFDGEVIAINTNNCLVRSPHRLVATVGVENLIVVDTP
                     DALLIAHKDHAQDVRDVVAELKARGHESHLLHQTVHRPWGTYTVLEEGERFKMKRIEV
                     KPGATLSLQMHHHRSEHWIVVNGMARVTNGDKVFLLNTNESTFIPAGHMHRLENPGVI
                     NLVMIEVQSGDYLGEDDIVRAQDNYGRS"
     gene            518883..520364
                     /locus_tag="HNEAP_RS02455"
                     /old_locus_tag="Hneap_0489"
     CDS             518883..520364
                     /locus_tag="HNEAP_RS02455"
                     /old_locus_tag="Hneap_0489"
                     /EC_number="5.4.2.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase/phosphoglucomutase"
                     /protein_id="WP_012823380.1"
                     /translation="MDLTCFKAYDIRGQVPAQLDAELAYRIGRAFVDEINPGTVVVGY
                     DVRLESPMLAEALMRGITEAGADVIDIGLCGTEEVYFQTFHREAQGVGGGIMVTASHN
                     PKGYNGMKLVREGARPVSGDTGLFAIRDSIANPPSSLAGEGGLRQLRVGGDEWRHDAR
                     ADSTPSPLVGEGWGEGENTPKPHGKITTDTNKAAYIQHLLGYIDHRALKPLKIVADPG
                     NGGAGPVMRLLEKHLPFDIHYIHEQPDGNFPNGVPNPLLPEMRDATSQAVIEQGADLG
                     IAWDGDFDRCFLFDAKGRFIEGYYLVGLLAETLLAKHPGGKIIHDPRLTWNTIEQVEQ
                     AGGIPIQSKTGHAFIKQIMREQDAIYGGEMSAHHYFRDFGYCDSGMIPWLLITELMSK
                     TGKTLAELVDERMAAYPCSGEINYRIDDVQGTIDRVLAHFSPMNPKIDRTDGVSVEFD
                     DWRFNLRGSNTEPLLRLNVETRSDSLLLERQISVVENLIGKDF"
     gene            520364..521584
                     /locus_tag="HNEAP_RS02460"
                     /old_locus_tag="Hneap_0490"
     CDS             520364..521584
                     /locus_tag="HNEAP_RS02460"
                     /old_locus_tag="Hneap_0490"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823381.1"
                     /translation="MQESQEPIFIHSLFRSGSTWIFDRFRRAGTNYWCYQEPFNEILS
                     QLKDSPETVLEIHESTSSVLRHTKLDKPYFYEFHAIREHIGDSFQKCISYDSFFDTTI
                     CSQFDEYTDILICHAKGRPVLQCCRSFGRLPHLKRKFGGVHIYLWRNPWDQWWSYQVN
                     GYFDTVNLAIINAINPPPIIALLRSELCLEEVRNSRFDQEFQCFQQVALDAKSRYLIF
                     YVLWFYSLIENKQLSDFDINIDRLSVDPDYLQSISDVLLGFGIHGVDLSDCHIPMAVY
                     TEEDRAFFEPIEDLAHQLFARVYDSGTLSQALHWQHEYRPKGIVEEGKLIRDASKARM
                     VALRFADTASQVNKRANHQEAGAVYNLTSCREALLRAEQVSSFAVDCNDELYRVYQSN
                     SWKITKPLRWINRK"
     gene            521678..524281
                     /locus_tag="HNEAP_RS12140"
                     /old_locus_tag="Hneap_0491"
     CDS             521678..524281
                     /locus_tag="HNEAP_RS12140"
                     /old_locus_tag="Hneap_0491"
                     /inference="COORDINATES: protein motif:HMM:PF00534.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="WP_012823382.1"
                     /translation="MTTTAIFTVVSNNYLHFARTLLKSVAEQHPEAKRYCVIVDRDLS
                     HAHELSDEFETIPMSAINLPDGDSFFYQYTVLELNTAVKPWAMQHLLKAGHDEVIYID
                     PDIRLYRPLNEVTGLLRSGSDIVLTPHLLEPIQDDFRPTELDIRRAGTYNLGFCAVRN
                     SGNTHRMLEWWQGKLHHDCVVDVDKGIFVDQSWMDLVPGMFDNVAILRHQGYNVAYWN
                     VGERILSGEGDSISANGDPLVFFHFSGLNPENTHSVSKHQNRFTFKNLNTVARFLFEN
                     YAKDVIANGIGHYKGLPYGFACYDDGTAIEGRERARFRKDPELQAECDGKPFAHPELL
                     SFELLPELNAAGMMGIVDPAYEHRVQTLYESLLGRAADPAGVAYFGPRMGSKFGMARS
                     VLAVGISSEARRMPGWPARLLRFANEVQYTPRRVRTLATEPLSRLFDKLGRHWSFFAY
                     RPPHAVSQRRAKGAASQRNDDDDSGPVVSRRVTDQPLFTIRKLPCPTGMNLVGYVKAE
                     SGVGEAVRSLARACEASSINFSLFDVGYQNSNRQSDSSVENKAASRHFKIDMLYVNAD
                     QTAATARHLKSARRERADYTIGFWHWEQPELPIRYMSAFAHVDEVWAPTSFVQDALAS
                     VSPVPVYKVPHSLQLQVSAGVRRSDFGLPDDRQLALVMYDFHSYQYRKNPQAAVEAFR
                     IAAKQNPNLGLVLKTINSEHHKEAYAELKESVADLPHVYFIDEFFSRQKTWDLQSCCD
                     ILLSLHRAEGFGLAPAEMMYLGKPVIATGWSGNMDFMTHENSMPVKYELKPLDVDLGA
                     YPAGPLWAEADVEHAAWCLSQLVTQPDLMEQMGRRAAKDIQAQLSPTAVGELVRHRLQ
                     VLGHWYPNLLD"
     gene            524409..525443
                     /locus_tag="HNEAP_RS02470"
                     /old_locus_tag="Hneap_0492"
     CDS             524409..525443
                     /locus_tag="HNEAP_RS02470"
                     /old_locus_tag="Hneap_0492"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020682488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-mannose 4,6-dehydratase"
                     /protein_id="WP_012823383.1"
                     /translation="MKTVIITGITGQDGAYLAQLLLEKGNVVYGTYRRTSSVNFWRIE
                     ELGIDKHPNLHLVEFDLTDMSSAIRLLQTTEATEVYNLAAQSFVGVSFDQPVTTAEIT
                     GIGPLNLLEAIRIVNPKIRFYQASTSEMFGKVQAIPQIESTPFYPRSPYGVAKLYAHW
                     MTINYRESYGIFGSSGILFNHESPLRGREFVTRKITDNIAKIKLGKQNVLELGNLDAK
                     RDWGYAKDYVEGMWRMLQADKPDTYVLATNRTETVRDFVTMACKAADISIVWEGKNEQ
                     ERGIDSATGKTIVAINPKFYRPAEVELLIGNPEKAKRELGWEPKTTLEELCRMMVEAD
                     LRRNEIGFSF"
     gene            525494..526405
                     /locus_tag="HNEAP_RS02475"
                     /old_locus_tag="Hneap_0493"
     CDS             525494..526405
                     /locus_tag="HNEAP_RS02475"
                     /old_locus_tag="Hneap_0493"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-6-deoxy-D-lyxo-4-hexulose reductase"
                     /protein_id="WP_012823384.1"
                     /translation="MNNALVTGASGFTGRYMVSALKTRGYRVVGLGNPDCGADSCIPV
                     DLTDAEAVRIAIHQVQPTHVVHLAGIAFVGHGKPDDFYQVNLFGTLNLLSALVELPQP
                     PRVLIASSANIYGTPNIEVIDESVCPAPVNHYATSKLAMEHMVHTYFDRCSIVIARPF
                     NYTGVGQTEQFLIPKIVGHFKRKAPVIELGNLDVSRDFSDVRDTVDAYVALLESDAHS
                     LAVNVCSSRAIALRTVLSEVGRLAGYEIEVRVNPAFVRANEIPVLRGSRARLESLVGH
                     SVPRPLEVTLQWMFIESSDSPGSGSAL"
     gene            526402..527598
                     /locus_tag="HNEAP_RS02480"
     CDS             526402..527598
                     /locus_tag="HNEAP_RS02480"
                     /inference="COORDINATES: protein motif:HMM:PF00534.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="WP_012823385.1"
                     /translation="MKILLNLHPLARAGAGIAVYTQRLLMELVHFRDLDEVAGFLGTR
                     VLSGDELRLWLSGFDNQTEKRVKEGVKSSPLMIDAVRRAARSIPGMYELRYQLRNIAS
                     QFALNKFAQAGFIYHEPNYIPTRYSGKQVIAVHDLSHIRYPDFHPAERVAFLNRHLKR
                     AIGLADFVLTDSVFVKDEILDVFPVSGEKIVVTHLGVDEAFHPRPEVETLNTLRQFNL
                     SYRGFVLSVGTLEPRKNLERLLNAYGALPEGVRRDYPLVLAGGGGWNDSDLQRQIQQM
                     ERRGEVIRTGYLPRSQLLDLYASAAVFAYPSIYEGFGLPVLEGFASGTPVLTSNVTSM
                     PEVSGGAALEVNPLSVDEIRHGLFSLLDDSSLRSRYMQLGLERVQAFTWAKCAEQTMA
                     VYKQLG"
     gene            527608..528759
                     /locus_tag="HNEAP_RS02485"
     CDS             527608..528759
                     /locus_tag="HNEAP_RS02485"
                     /inference="COORDINATES: protein motif:HMM:PF13439.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="WP_012823386.1"
                     /translation="MTIRVLHFGKFAFERAGGIERHVEVLARAQAAQGADVIVLAYTL
                     DADANSRRVDGVQIEPVFVRARFSSQPLALGLILRARQLAREKPFDIVHQHWPDPFAH
                     LVASLIPGSPAWVVSWHSDIVKQRFLGPIYRALAPIFFCKPDAVIGATKTHMASAQID
                     IFADTAHRHVIPYGIDPAPFELAPSVSNSVAALRTRYAGRPIVFALGRHVYYKGFDVL
                     IRAMSRVPAVLLLGGGGPLTPELTQLAERLSTESAGQVVFVGSIPDAELPVYYHACDI
                     FCLPSVATTEAFGIVQTEAMLCGKPIVNTNLGTGVNEVAPQGVCALTVQPEDDEALAQ
                     ALNLLIESPEYAQALGDVGRERALDHYNVERMAVDTLALYASLTGNRDH"
     gene            528849..530252
                     /locus_tag="HNEAP_RS02490"
                     /old_locus_tag="Hneap_0496"
     CDS             528849..530252
                     /locus_tag="HNEAP_RS02490"
                     /old_locus_tag="Hneap_0496"
                     /EC_number="2.7.8.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011802545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl-phosphate glucose
                     phosphotransferase"
                     /protein_id="WP_012823387.1"
                     /translation="MSTALLRSRSALISAVTRTLDVLLVGLGGLFAFWLRFGGEVSHL
                     PATYGTLMVIGGLLVALVFPLLGVYDSWRARGLASPALRVVGVWSLVLMILMISLVLV
                     KEAETFSRLWLAQWWLVSGLALAIERVAVYFVLRGLRQRGLNHRKAVVVGCGPQALNL
                     INRAEKEGWAGFDVVRVFGERPDDTGIAGHEIHPLNELFDYVSSHQIDEVWIAVPLDQ
                     SQQLKSVLENLRFSTANVRFVPDLFGLFLINHGVSEIMDVPMIDLSASPMTGANRLVK
                     GVEDRVFSLLILLLISPLFLVIALGVKLSSKGPVLYKQKRHGWDGQPFNIYKFRSMKD
                     GADEEGDVPQAVKGDGRVTRFGAFLRRTSLDELPQFINVLQGRMSIVGPRPHAVEHNE
                     LYKSQIAGYMLRHKVKPGITGWAQVNGWRGETDTLDKMQKRIEYDLYYIEHWSLAFDL
                     KIIFLTVFRGFVHKNAY"
     gene            complement(530296..530964)
                     /locus_tag="HNEAP_RS02495"
                     /old_locus_tag="Hneap_0497"
     CDS             complement(530296..530964)
                     /locus_tag="HNEAP_RS02495"
                     /old_locus_tag="Hneap_0497"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009025351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441176.1"
                     /translation="MILAAGRGERLRPLTDHTPKPLIPVQGKPLIVHHIERLVAAGIT
                     DIVINLNHLAEQIPAALGDGDRWNVRLHFSWENHLSENLETAGGIRHALPLLSDTFIL
                     VNGDIFTDFPFEELLNHTLSPEIDFRLLMVTNPEHHPKGDFALNQQRLELCEAHTTET
                     GECLTYAGIGLYKKSMFSGLPEGRRALGTLLKEKIAARRGQGLLFTGAWIDVGTLERL
                     QQAE"
     gene            complement(531017..532501)
                     /locus_tag="HNEAP_RS02500"
                     /old_locus_tag="Hneap_0498"
     CDS             complement(531017..532501)
                     /locus_tag="HNEAP_RS02500"
                     /old_locus_tag="Hneap_0498"
                     /inference="COORDINATES: protein motif:HMM:TIGR01844"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TolC family type I secretion outer membrane
                     protein"
                     /protein_id="WP_012823389.1"
                     /translation="MKSHPQSQRLKQTVLAMLMVVGAYGTPALSANLMEIVTLAEQND
                     QTLLAAQQKRLSIQENTPIARSNLLPQIGASAGLDYKRTEIKSNGIPNAPTVIEGSGR
                     TLGLSLNQVIYNRIDNLNLGIADLQAKQADLDFAAAQQDLLLRASTAYFAVLQANASL
                     QLAIASQTAFKNQLAQAQKRYEVGLVAVTDVANAQANYDKANADIITARNALENAQSA
                     LATITGKEPTELDDVRTNLSTPRPDPANSNDWVTLAAKQNISLQSAQIGGQISQENIA
                     INRAARMPTVDLTGQYGYNSTPSQFNGSESSNVAASIGLQVSVPLYNGGRINAKSRQA
                     AYQYQQAQNEIENLRRTVQQGTANDYRGVITSISEITAYGQSVESARTSLAATEAGYQ
                     VGTRTIVDVLNAQIQVFSAMANFLNARYSYLTNYLKLKGDTGQLSLDDIKAVNAQLVP
                     GKINALIAPLMNSGNESSKSQQQMIERVIQRAAKTVESKAADQH"
     gene            complement(532762..533427)
                     /locus_tag="HNEAP_RS02505"
                     /old_locus_tag="Hneap_0499"
     CDS             complement(532762..533427)
                     /locus_tag="HNEAP_RS02505"
                     /old_locus_tag="Hneap_0499"
                     /EC_number="2.1.1.77"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="WP_012823390.1"
                     /translation="MMAFDTERARFNMVEQQIRPWDVLDKRVLDTLFKIPREQFVPAE
                     QRQFAFSDTALPIGHGETMLPPVVEGRILQSLAVAPNERVLEIGTGSGFFTACLAHLG
                     QSVHSVDIHPDFTQSAAEKLAELNIDRVVLETGDAVNGWASNERFDVIVLTGAVQRIP
                     ESYRQQLNVGGRLFAIVGSEQNMSGIMITRQANDQFDTQNLFETHTRYLKGAEPKPQF
                     SFA"
     regulatory      533716..533822
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00059"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="TPP riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="thiamine pyrophosphate"
                     /db_xref="RFAM:RF00059"
     gene            533871..535760
                     /locus_tag="HNEAP_RS02510"
                     /old_locus_tag="Hneap_0500"
     CDS             533871..535760
                     /locus_tag="HNEAP_RS02510"
                     /old_locus_tag="Hneap_0500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823391.1"
                     /note="catalyzes the formation of
                     4-amino-2-methyl-5-phosphomethylpyrimidine from
                     5-amino-1-(5-phospho-D-ribosyl)imidazole and
                     S-adenosyl-L-methionine in thiamine biosynthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine synthase ThiC"
                     /protein_id="WP_012823391.1"
                     /translation="MSAVPNDFLAKTAGLSESVIAPFPASAKIYQTGSRPDIRVPMRE
                     VTLTPTRSDRGVEINPPITIYDTSGPYTDPAVKIDLLKGLEPLRESWIAERADTETLS
                     GPSSDYGLARLNDPKTAGLRFGHIRTPIKAKAGKNVSQMHYARQGIITPEMEFVAIRE
                     NNRLQEMRADPRYKALLRQHKGESFGASIPDVITPEFVRDEIARGRAIIPANINHPEI
                     EPMIIGRNFRTKINGNLGNSATTSGIAEEVEKMVWGIRWGADTIMDLSTGKNIHETRE
                     WILRNAPVPIGTVPIYQALEKVNGKAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVLLR
                     YVPLTAERVTGIVSRGGSIMAKWCLAHHQESFLYTHFEEICEIMKAYDVSFSLGDGLR
                     PGCLADANDAAQFGELQTLGELTKIAWEHDVQVMIEGPGHVPLQMIKENMDKELADCY
                     EAPFYTLGPLVTDIAPGYDHITSGIGAANIGWYGTAMLCYVTPKEHLGLPDKDDVREG
                     VITYKIAAHASDLAKGFPGAQVRDNALSKARFEFRWADQFNLGLDPERAREYHDETLP
                     AEAHKVAHFCSMCGPHFCSMKITQDVRDYAETLGVDEIEAIKKGMEEKSIEFVKKGAE
                     VYGRI"
     gene            535846..536322
                     /locus_tag="HNEAP_RS02515"
                     /old_locus_tag="Hneap_0501"
     CDS             535846..536322
                     /locus_tag="HNEAP_RS02515"
                     /old_locus_tag="Hneap_0501"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_012823392.1"
                     /translation="MIEVGQKLPEATLYHRGEQGLNGCSVTEMTAAQRIVLFAVPGAF
                     TPTCSDAHVPGFMVLNDAIRAKGIDNIFCVAVNDPFVMKFWGEHLNVGDAIRMISDGN
                     GMFTRALGMERDMSNGAMGIRSKRYAMILNNGVVEWLGVDESGLANSSAEAVLGAL"
     gene            complement(536333..537073)
                     /locus_tag="HNEAP_RS12145"
                     /old_locus_tag="Hneap_0502"
     CDS             complement(536333..537073)
                     /locus_tag="HNEAP_RS12145"
                     /old_locus_tag="Hneap_0502"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049772446.1"
                     /translation="MRDAWGLIEVIESEGEITLHFGNHTAQSGWHPAQPAKLAFGYYR
                     ALLMGLVLHPDPRRLNLYGLGGGALARYLLEYTDISVHAHDLRPSLAPIAQQYFGLDL
                     EHPRLQLQFGDICASDELADVPAADIIWVDIFDEQGMVPIPTRSLAQMARQLGQIGVL
                     CINVWRNDLRSLGDLTRALERFFDPDPLVLRVPERYNSVLCYRAEPWQPHDILQAHRR
                     ITHFSSPVQETLREAIGWLEALPRKQLG"
     gene            537148..538068
                     /locus_tag="HNEAP_RS02525"
                     /old_locus_tag="Hneap_0503"
     CDS             537148..538068
                     /locus_tag="HNEAP_RS02525"
                     /old_locus_tag="Hneap_0503"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823394.1"
                     /translation="MRNSRFIPFVVGICLSLMTVGTSFAASFKVGDRVFIPLYSENLL
                     DDGYADGIIQRINADGTVNIKLSDVVNGEDKTMYGTCSPSGASEQIMTAPTARAKEVV
                     NDVPTDKILPWTIGQFQYVERENLSTTLQRWLGSGMAITPNSLDIADRRARELDLPRL
                     RVVVAMAKAQVESTGGNGFPVPASRALHGAAKMLDDVAALVQSHPNAVSDAAAILAKT
                     APPHSKDLLVEAIVHIAELTQKQLAQLAGDNPDPTKVDGYTPAQLIAIYTGYYRMMTA
                     NDTQPYENAKVAYFSDKVAQAILGGHWPEL"
     gene            complement(538079..538684)
                     /locus_tag="HNEAP_RS02530"
                     /old_locus_tag="Hneap_0504"
     CDS             complement(538079..538684)
                     /locus_tag="HNEAP_RS02530"
                     /old_locus_tag="Hneap_0504"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013895714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt transporter"
                     /protein_id="WP_012823395.1"
                     /translation="MTELDGHGPLRRAVLWVALLNFGYFWVEFTVAQSIGSVSLFADS
                     IDFLEDTAINLLILIGIGLSLVYRARLGMLLAGVLLIPGIATLWMAWNKVMSQAPPDA
                     FDLSLTGLGALFVNLACAFLLVRFRHHQGSLTRAAFLFARNDALANVAIIAAGLITLL
                     WHSALPDLIVGLGIFLMNLDAAREVYQAARREHAETRQLQP"
     gene            complement(538677..539000)
                     /locus_tag="HNEAP_RS02535"
                     /old_locus_tag="Hneap_0505"
     CDS             complement(538677..539000)
                     /locus_tag="HNEAP_RS02535"
                     /old_locus_tag="Hneap_0505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_012823396.1"
                     /translation="MNEHINPTTDAKDKTEWEAAAFRRLVAHLQERTDVQNIDMMNLT
                     GFCRNCLSRWYREAAEERGTKLSDHDARVAIYGMPYDEWKKRHQSEATPTQQEQFKTA
                     IKQHD"
     gene            complement(539041..539262)
                     /locus_tag="HNEAP_RS02540"
                     /old_locus_tag="Hneap_0506"
     CDS             complement(539041..539262)
                     /locus_tag="HNEAP_RS02540"
                     /old_locus_tag="Hneap_0506"
                     /inference="COORDINATES: protein motif:HMM:PF01722.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BolA family transcriptional regulator"
                     /protein_id="WP_012823397.1"
                     /translation="MNSAEIVSMIQNEIPDAEVHPEGEGCNFKITVLSSEFAGKTMLQ
                     QHQRVNKILAPSLASGALHAVTLVTRTPA"
     gene            complement(539350..540474)
                     /locus_tag="HNEAP_RS02545"
                     /old_locus_tag="Hneap_0507"
     CDS             complement(539350..540474)
                     /locus_tag="HNEAP_RS02545"
                     /old_locus_tag="Hneap_0507"
                     /EC_number="3.1.13.5"
                     /inference="COORDINATES: protein motif:HMM:PF01612.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease D"
                     /protein_id="WP_012823398.1"
                     /translation="MTITDGFGLAQQPRLIQSTSALHDVCDQIAESTWATIDTEFMRE
                     STYFPQLCLVQIATPDAIWLIDPLAVPLAPLWHELNRTSSPLVFHAAEQDLELIYLDS
                     GALPQTLRDSQIAAAFLGLGEQIGYANLVNRLLHVELDKSQSRTNWAQRPLTAEQQHY
                     AADDVRFLRSMYPLLREQLATKNRLAWFDEECAALSDPQRFQPQMTGLWRKVRGQQAL
                     RAAQRAVLDAITTWREAWARELNLPRRWVLSDEQALELAGSRQFRPNLLNPKNARHHL
                     SVEQVDELRATIERAKQLPPEAFPQWQAYQRTDPETNAILNRMQALVQERSKLMEISP
                     SLLATTDDMLRLIRAPDALNKLTTGWRCDVIGLPLKSLLD"
     gene            complement(540479..541078)
                     /locus_tag="HNEAP_RS02550"
                     /old_locus_tag="Hneap_0508"
     CDS             complement(540479..541078)
                     /locus_tag="HNEAP_RS02550"
                     /old_locus_tag="Hneap_0508"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_012823399.1"
                     /translation="MNKARRLFSAIAVACLIGSTSSVFATEAPKAKPVLVKIVTNMGA
                     ITVEMDADKAPKTVENFLSYVKSGFYNDTIFHRVIPGFMIQGGGFTPDFRQKPTQAPI
                     ANEANNGLSNRRGTIAMARTSDPNSATAQFFINVADNKFLDYSGPSMRGAGYAVFGHV
                     TSGMDVVDKIVSTPTGAAGPFPQDVPKKTVLIESIKVLP"
     gene            complement(541071..541487)
                     /locus_tag="HNEAP_RS02555"
                     /old_locus_tag="Hneap_0509"
     CDS             complement(541071..541487)
                     /locus_tag="HNEAP_RS02555"
                     /old_locus_tag="Hneap_0509"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007435808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase-binding protein DksA"
                     /protein_id="WP_012823400.1"
                     /translation="MAVTLPPGYKPSESEEYMNPMQLEYFKQKLLTWRDELLEESETT
                     VNHLREENWQEPDINDRASLESDAALELRTRDRYRKLINKIDKALRQIADGNYGFCEE
                     TGDEIGIRRLEARPIATLTIEAQERHERLERVQRDE"
     gene            complement(541662..542414)
                     /locus_tag="HNEAP_RS12150"
                     /old_locus_tag="Hneap_0510"
     CDS             complement(541662..542414)
                     /locus_tag="HNEAP_RS12150"
                     /old_locus_tag="Hneap_0510"
                     /inference="COORDINATES: protein motif:HMM:TIGR01352"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB family protein"
                     /protein_id="WP_012823401.1"
                     /translation="MDHWALDQNFIDSDKRFGAALLVALVVHALFFAIYFTGDKPSPP
                     PPRPIELTLDAPLAAKTNDASPTPSDKINDKVTTQALASAAGEQTNTLQKPKSGKGIT
                     TTGNNGITDTPTTNAAPDAFNRLNEAVSRSLKTGFLTSKTVNGPAGDYLSRWKRQVEA
                     YGNDHYPEDLISQKISGQLILAVTIDKEGHVMDIAIQHSSGNPKIDTAARRLVQLASP
                     YPPFPPALAARFDQIVITRTWQFSSGHGLTTR"
     gene            complement(542470..543570)
                     /locus_tag="HNEAP_RS02565"
                     /old_locus_tag="Hneap_0511"
     CDS             complement(542470..543570)
                     /locus_tag="HNEAP_RS02565"
                     /old_locus_tag="Hneap_0511"
                     /inference="COORDINATES: protein motif:HMM:PF02424.13"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441087.1"
                     /translation="MPMGMSMPTRRQFLTTVAGLTVSPLLLSGCSTHQTQIVEEGFTV
                     FNMPMTLRFANESPKAITQTVNAAAGIVEPLYRRIHPWKPSDLTRLNAQLATHGKATT
                     TPEIIDLINISRTLFEGTDGAFDPTIGALIAAWGFHNSHVTESHPLPTEAFLDAWLEH
                     RPTMNDVHVDGLEVSVTNRRVQFDFNGCAEGYAGHLVIQAAEKAGITNCLFDTGGDLF
                     MIGQAGDKPWHLAIENPLKRGVLASIDLSGHTAPNGHQSLNSSGNYEHRFIYKGEAYS
                     HIINPKTARPVRRIAGSTVWANHYAISDGATKGAMMLEPEQVPDMVRKLKLDGVLFME
                     ETGQLWMNQRMQDKLRLVEPVAGLTATHLITE"
     gene            complement(543609..544574)
                     /locus_tag="HNEAP_RS02570"
                     /old_locus_tag="Hneap_0512"
     CDS             complement(543609..544574)
                     /locus_tag="HNEAP_RS02570"
                     /old_locus_tag="Hneap_0512"
                     /EC_number="6.3.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione synthase"
                     /protein_id="WP_012823403.1"
                     /translation="MKIGILMDPIAGIKPYKDTSFALLLAAQSRGWSVFYLEPDWLYA
                     EQGRPRSRMHAITVFDRNTDWFELGPAQTFDLNELDIIIQRQDPPVTLNYHYVTALLA
                     LAESEGVLVANRPNALRAANEKLLAQHYPDLCPPTLVTRDPAQLRDFLSLHGHIVLKP
                     LDAMGGSSIFQIQAGDLNTAVIIETMLAHGLIMAQKFLPAVREGDRRILLINGEPVDH
                     ALLRVPQADEFRANLAAGGRGQVVPLRARDREIAARVGPDMAAAGFWFVGLDVIGDYL
                     TEVNVTSPTCAREIDAVCHNDPAGQLLDFLASERAAAKKLNNRSM"
     gene            complement(544571..545920)
                     /locus_tag="HNEAP_RS02575"
                     /old_locus_tag="Hneap_0513"
     CDS             complement(544571..545920)
                     /locus_tag="HNEAP_RS02575"
                     /old_locus_tag="Hneap_0513"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_012823404.1"
                     /translation="MPSEALRTAHPELDAHYCGPLLRIESHIIRCHRQIEAWFRAQWL
                     KHPAPFYASVDLRNAGFKLAPVDTNLFPAGFNNLNHIFDPVMVQAIQAAVEHSCPEAK
                     DILIIPERHTRNLFYLESLAALVAFVEMAGFGVRIGSLEPITEPVNFDLPSGRTLTQH
                     PICRVGKRIEVDGFSPCTILLNNDLSGGRLEILDDLEQTVIPPIELGWWKRSKFEHFS
                     IYQDLTRELCATIDLDPWYLSPLMRDCGHIDFLKREGETCLQSQVQELLAEIQAKYDE
                     HQIKEKPFVVIKADAGTYGMGVMTAQSADDVTQLNRKQRTRMSASKEGLGIDRVLIQE
                     GVHSFEKVSIHQDDDRYVAEPVIYMVDHFVVGGFYRVHTEKGVNESLNSPGAAFVPLP
                     FNEACSLPSPDSSPDSERNRLYVYGVVARLALLAAAYEYQMIREADAATEQMAGDVA"
     gene            546235..546670
                     /locus_tag="HNEAP_RS02580"
                     /pseudo
     CDS             546235..546670
                     /locus_tag="HNEAP_RS02580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006786028.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilG"
     gene            546745..547107
                     /locus_tag="HNEAP_RS02585"
                     /old_locus_tag="Hneap_0515"
     CDS             546745..547107
                     /locus_tag="HNEAP_RS02585"
                     /old_locus_tag="Hneap_0515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012983761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_012823405.1"
                     /translation="MAHIVVIDDSPTEVYVLQTMLERNGHQVSVAKNAEEGIALVKQA
                     QPNAVLMDVVMPGMNGFQATRELNKNPETSHIPVIIVTTKDQQTDKIWGMRQGAKDYL
                     VKPVKEADLMGILGTVLN"
     gene            547127..547642
                     /locus_tag="HNEAP_RS12155"
                     /old_locus_tag="Hneap_0516"
     CDS             547127..547642
                     /locus_tag="HNEAP_RS12155"
                     /old_locus_tag="Hneap_0516"
                     /inference="COORDINATES: protein motif:HMM:PF01584.17"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CheW protein"
                     /protein_id="WP_012823406.1"
                     /translation="MNLFEYLCWVETEATAHAVGMPKTDKVESTWQAVLFRAGGRRML
                     VPLVQVRAILPPPRQVHIPGAKPWVVGLANMRGELTGVYDLARLFFDLPSEPGRHSVV
                     LLAKTHRFSAAFIVDRSYGIRQIPFSAERAVKEPHLQGVLREVRMDNDWLPILNLETL
                     VESDQFMNAVA"
     gene            547722..549737
                     /locus_tag="HNEAP_RS02595"
                     /old_locus_tag="Hneap_0517"
     CDS             547722..549737
                     /locus_tag="HNEAP_RS02595"
                     /old_locus_tag="Hneap_0517"
                     /inference="COORDINATES: protein
                     motif:HMM:PF00015.19,HMM:PF13675.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="WP_012823407.1"
                     /translation="MSLGVKLGGLSRQVIVLVVVAAITLLVTVAIFILSAKNDQTLLE
                     RRLVASQLERSSQEMTIETLRAVRGNKASFDTVLALRAQFVSDLSALSGKDPKRPEAG
                     VSNERKAELAKVQKSWDEYNVALAKVLEGQKAILGVGDLASQINQLLPDLLSSSDEVV
                     QTLIAAQASPQVVYLATRQLMLVERIGLTIGEITSGGQNAANASDRFGRDVALFGGVL
                     NGFLNGNRMAPQINDAAARAKLRDVAVLFATINQGGSDLLSEAPTLLAANQAAIKIDK
                     IAGAFTGDVSKLSSSLAQDQVNSGRLAYIGYMTGLITLLLLAWLGYALVRDSKRDQKA
                     TESQNQRNQQAILRLLDEMMTLADGDLSSHTTVTEEITGAIADSVNYSIDALRDLVGT
                     INDTSVRVASAVQRSQANSRALAETSRAQAEKISSVSDAIAQMSDQIEAVSFNAQQSA
                     TIAQSSVDVAHRGGDAVRETIAGMVNIREQIQETAKRIKRLGESSQEIGDIVGLITDI
                     ADQTNILALNAAIQAAMAGEAGRGFAVVADEVQRLAERVGKATRQIELLVNTIQTDTS
                     EAMLAMEQTTTNVVSGATLAENAGKALREIETVSLNLSEQISEIAKVTEQEALVATNL
                     RETVNNIRTETQETTDKATRAADEIGALGSLSKELNNSVAGFKMPDR"
     gene            549930..556457
                     /locus_tag="HNEAP_RS02600"
                     /old_locus_tag="Hneap_0518"
     CDS             549930..556457
                     /locus_tag="HNEAP_RS02600"
                     /old_locus_tag="Hneap_0518"
                     /inference="COORDINATES: protein
                     motif:HMM:PF00072.22,HMM:PF01627.21,HMM:PF02518.24,
                     HMM:PF02895.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="WP_012823408.1"
                     /translation="MRTESKVDSIVLDRLKEGLNEKIDQLLRALEDLSSGAGGNELVF
                     ESLDAVKAIDAVLAVSDYQLLRVMLKEQMSALTQLETNPEKAAVLVTTVTEAAWMLRA
                     LLDRLSVGATVNAMSLLPMINRLRQSQGLSEVDTENVLARSTVLWSESRVFVNPYVGQ
                     IAAKSEEKTKSNQLLASMEQQILLLMRGDVTAIPGLIETFDRIIEREVNRAVVVATRS
                     FEELLGAVHQDQERYLPLAKRMIGRVLRLFRMEIQGRDSLHIRFEAIEFATDMLLELV
                     RVLPDDSELCGERVSNWHELLSTDGERVRFLGLETSALTQVAQVLSEELNAAQDVLDL
                     FVRGAKSDLEPLVRIQPRLEQIVGVLAALNYEHESGLIQGALEQLIQVTRGSVLFDDD
                     FLMQLAVAIMTTEQVVSQIGHLIVDDSKSLTSVDRVVSEALIPLATACYEDVIASKEA
                     VNMALRPTGQPVAPDTLTNAARLIAGVRNVLEMAELRAAMPLINGLHRWLFLHVNNLQ
                     LVRSETISALAEVSAAVEFYLENLRDHQKEMVQFLDGALQMLPVLNGGTEAHEGEQPR
                     ETLEPQNHNLDVQTSIDEEPQQPVDESLASMDELIAQLSMPNSDEFVEEAEVATALHG
                     EETAVDAMPLETLDPPEDSDTAPIEAGELQAPELVLDENFVLDVSEETHSGEDADVLS
                     QSAREPETAFLAPDTIEAIPAEEPSTEPMVESVEDNAHLGNFDLIEHQHEAASGEEPA
                     GEASQVKADAEFDLPAAWAAELSLDLEQDEPVFEQKSAETPVAEDEPLPDFETLDLSL
                     PPSEKEPVESTTEWSFLQNASDSDIDLTLPPSDPQSPEHPSFLEEPFNSDLSLDALSL
                     PDIEQAPGRAPESETGMVSDAEVGESSAPSATPEFEETLDELAIEMREVFAEEMQEEL
                     PALLEAARTWSNQGGRDHLVTLRRGFHTIKGSSRMVGLTAIGDWGWSYEHLLNQVLDD
                     RVTSTPALRADVLSAVSLMNEALPVLSQGQCPPVSYWQESLGWAEAWSNDQSKDGAAS
                     ESAITESAPEAETLVAEADVPTVESHEWVQDAPSEVDENILEKFAPSEEILQESEASV
                     TETSYEQEVSSDTDADGEVWHVEMSSMDDDTDTEHPDRSPTVVDETTVLPATEPVSEP
                     EEATAQELTPEPAPVIEDPVLREIFDQESSGYIHQLRQQVDHALINWVSLPCDKELVR
                     LVHTLLGSARTAGVQPIARISNRLEEWIRLLEEHNHSLEHEDLAVFQRSLLMMDRLRQ
                     WAIEPAFDQPDEEPIEVEIAARIDQLLVEILSAEPETEESVDEYAEFALPEVVDSAEE
                     ETSETIQAVPEASTPLFERSADIGMSVRPDDMPGDQDPDILQIFLEEAEELLEKADGY
                     IAHWRQHPHDLDSIRLLHRNLHTLKGGARMAGLLNLADVTHLLEDRLDRARDRGGEQA
                     DVLIALVQHTYDALGKMLDLVRRQAPIPAQINLLAQIANEGSAHAIEALVSDDEALRE
                     PVTAQIEEPFAESVFEQSVEAPADGSAVTGSVEMTESAESTAPHAAAVANEVRREQIR
                     VDADRIDDLVNQVGENVLLQARVDRQVNGFERQLFELQQTLTRLRGQLRRLEIQTESQ
                     MKAELMAETGLSAEEFDPLEFDRFTQVQELSRGIMESLGDISSIEEAMSDITEQSQLL
                     LLQQSRLGRKLQDGMLALRMVRFNDVVGRLRRIVRQVGDEMGRNAELIIHNGETELDR
                     VTIVGLLPSLEHMIRNSLAHGIESPDERRVLGKPEVGQIEITIESAGGNVTLEMKDDG
                     RGLDLDAIRRKAVERKLIPADIDLSDDEARALIFLPGFSTAGNVSQVAGRGVGMDVVA
                     GSVREMGGFVDLQSEFGKFTRIQLNLPLTQAMTRGILISVGDNQFAIPYKGVVSVTRM
                     TSIQLAEQYASPKPAVTLNGEQYPLFYLGELLRHEPFNANAQEVGVRAVFLFKLGERR
                     FAVQVDHQLGGIQLFVKSLGPQLGRIPGLSGATISDEGNVILVLELFELVRQFQRRDD
                     RHLDLTAQVSVRRRPVVLVVDDSLTVRKVTARTLERNNLDVILARDGVEALGFLHEQK
                     PDVVLTDIEMPRMDGFELLGAIRNDEQTRNVPVIMISSRTGQKHRSRAEALGVSAYLG
                     KPYAEADLIGRIESFITDVRDRTRGSGSALEEGRSIQNNEEQG"
     gene            556454..557026
                     /locus_tag="HNEAP_RS02605"
                     /old_locus_tag="Hneap_0519"
     CDS             556454..557026
                     /locus_tag="HNEAP_RS02605"
                     /old_locus_tag="Hneap_0519"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823409.1"
                     /translation="MSNSNESTFLAGAAGTHEVGVGPGPAETKKVRIVRLPTQVSDME
                     VIVPYAMVAEITEVMLPEGGTHLSRLDAAMVDWRAQRIPLVSLEAMLNEPLPTIGQRV
                     RCAVMYGSNPDIALPYYAVLLSGVPRSEEVNMHSFSEEASSEGGFWRLSAEMGGRRVG
                     VPDIRWLESQIDEMRMRFDRDSTTALNETL"
     gene            complement(557126..557770)
                     /locus_tag="HNEAP_RS02610"
                     /old_locus_tag="Hneap_0520"
     CDS             complement(557126..557770)
                     /locus_tag="HNEAP_RS02610"
                     /old_locus_tag="Hneap_0520"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823410.1"
                     /translation="MKTIADHSELKTSSHATFLDKPTPSAQLLLFAVLVLSMAATRYH
                     HFSAVLHIADTSWAAFFLAGLYLRARWMFVALMGLAVVIDLAAVWTDGLGMTGCFSPA
                     YPGLLLAYGALWGAGRLSRHSMREDEPALATILAVIGWLALGVIAAFALSNLSFWAWS
                     GHFVDLTLGDYLQRVMGYLGRYMASTNLYVGLGLGVMIVAQTLTIRLSNPKAAH"
     gene            complement(557967..559820)
                     /locus_tag="HNEAP_RS02615"
                     /old_locus_tag="Hneap_0521"
     CDS             complement(557967..559820)
                     /locus_tag="HNEAP_RS02615"
                     /old_locus_tag="Hneap_0521"
                     /inference="COORDINATES: protein motif:HMM:PF00593.22"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_012823411.1"
                     /translation="MYKFPMSGRHRTGRTTLACAYLTACSFPLSALAGSPSTLPDLNI
                     TASHGAPVAFAGVPETVITRAEIERLQATSVLSLLENRAGINMVNQGGPGKITTASIW
                     GMSGSQTLVLIDGVRIGSLTAGAAYLENLPVALIDHIDIIKGPRSGQYGADAMGGVIQ
                     IFTRKGKKGIQPSFSIAGGSNKTFETSANVSGGNGPFDYSIGASHQGTGGFNAYTDTT
                     GSPFAVNQPDNDGYRNNSASGRLNYTGDNGARLGVHWLGTNAFTDYDGSSFAGNQQRS
                     RQQNFGLDGALMKIGIWQLRASAGRNIERQTQYYDGKYVSEYNSRQDSFSLANDFSIG
                     QGLLTLGADRLNDHVSSSVNYDVTSRHNNGVFAQYATQIADLSIQTALRHDSNSQFGS
                     ANTGSVDLSWQLNPSLALTGGYGTGFHVPSFNFLYYPGGYANPDLRPEHSRTARLGFN
                     WQNNNGWTSSLTAFRTRTRDLIASSASTNFVPYNINQAQSIGAEWQLGWHNADWALNS
                     SATWISAVDRETGVSIPRQPKWSGRVDVDRKLGAWRMGVTVRGQTATHESTFSQINNG
                     FATADLRLSYAYSQNWHIEAKLSNVLDKQYQTAYDYHQAGRTVLFTLRYGL"
     regulatory      complement(559859..560011)
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00174"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
                     /db_xref="RFAM:RF00174"
     gene            560457..561035
                     /locus_tag="HNEAP_RS02620"
                     /old_locus_tag="Hneap_0524"
     CDS             560457..561035
                     /locus_tag="HNEAP_RS02620"
                     /old_locus_tag="Hneap_0524"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP compounds hydrolase NudE"
                     /protein_id="WP_012823414.1"
                     /translation="MPVEQPPKMCAVRPLVETRLFAVEAVDLKFANGVEVTFERLAAK
                     GRGAVLVVPILDDGRIVLIREYACGTERYELGLPKGRIDGDEPILEAANRELMEEAGF
                     TAAQLTLLREVTSSPAYSAQRTHIVLATGLSPRRLPGDEPEPLEVVTWPLDDLDRLAF
                     EGQCSEARSIAAMYLARTYLAHSPANDQKNPA"
     gene            561069..561890
                     /locus_tag="HNEAP_RS02625"
                     /old_locus_tag="Hneap_0525"
     CDS             561069..561890
                     /locus_tag="HNEAP_RS02625"
                     /old_locus_tag="Hneap_0525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016354046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'(2'),5'-bisphosphate nucleotidase CysQ"
                     /protein_id="WP_012823415.1"
                     /translation="MNDWLSLRDPVRSIAAQAGEAIMRVYAEDFDIMHKSDDSPVTEA
                     DLSAHRVIKAGLQALTPHLPVLTEEGGLPDWSVRQQWSDYWLVDPLDGTREFVKRNGE
                     FSVNIALIHQHQPVLGVVYAPATGAEFAGVQGVGSWRFTAQGAQPLKVRPLPNPTITL
                     ALSRSHGSRREQALIDALTERAGEPQVIRCGSALKTCLVAEGLADLYPRFGPTSEWDT
                     AASQCVLEAAGGQLVDLNGQRLTYNRRAVVLNPSFLAYGERLPLPLAQLARISAD"
     gene            561948..562556
                     /locus_tag="HNEAP_RS02630"
                     /old_locus_tag="Hneap_0526"
     CDS             561948..562556
                     /locus_tag="HNEAP_RS02630"
                     /old_locus_tag="Hneap_0526"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823416.1"
                     /note="TrpG; with TrpE catalyzes the formation of
                     anthranilate and glutamate from chorismate and glutamine;
                     TrpG provides the glutamine amidotransferase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_012823416.1"
                     /translation="MVLMLDNYDSFTFNLVQYLGELGVEVWVARNDQVTVEEIAARAP
                     SHIVISPGPCSPSEAGISIDVIHAFAGKTPIFGVCLGHQAIGQAFGGKVIRAKEVMHG
                     KVSPIHHSGEGVFAGLPNPFDATRYHSLVVEQASLPDVLEVTAWTQYPDGSFDEIMGL
                     RHKTFVVEGVQFHPESILTEHGHQQLKTFLGYQSAVREPAYA"
     gene            562553..563812
                     /locus_tag="HNEAP_RS02635"
                     /old_locus_tag="Hneap_0527"
     CDS             562553..563812
                     /locus_tag="HNEAP_RS02635"
                     /old_locus_tag="Hneap_0527"
                     /inference="COORDINATES: protein motif:HMM:TIGR00710"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012823417.1"
                     /translation="MSSPAARLAPKAFLIVPLVASLLMIAPFTVDAYLPSFPAIGHEF
                     GVDQATMQLTLSLYLWFFGGMMLVHGPLSDTFGRRRMVLISLTVYALASVGAAMAGNI
                     NELIAARVIQGIAAGAGVVIGRALVRDLFEGATAQRVMSNITLVFAIAPAIAPIIGGV
                     LDTWLGWRSVFWFLALFAALSMAGVFAFMPETVGAHNRQSIAPLFILKSYGRALSHAP
                     FMGLTLVFALLFSGMFLYIAAAPMVLVGHLQQTPTDFWKFFVPLVTGLILGSRISNVL
                     ASRFAPMTTVSIGIGIVTLAVIFNVVQSFWFAHHSFGLGEWRVWLTVSPIMIYAMGMA
                     TAMPSLNLMGLDYIPAQRGLASALQGFTQMILAGIVSGLAVAHLAQNLLWLAWGMAAL
                     WLLAALIWIAWYRRAPRLGFASETRHA"
     gene            563956..564696
                     /locus_tag="HNEAP_RS02640"
                     /old_locus_tag="Hneap_0528"
     CDS             563956..564696
                     /locus_tag="HNEAP_RS02640"
                     /old_locus_tag="Hneap_0528"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YebC/PmpR family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_012823418.1"
                     /translation="MAGHSKWANIKHRKARQDNKRGKVWTKIIREITAAVRVGKSADP
                     SVNPRLRLAWDKALSSNMSKDTVERAAKRGVGAGDGEHYEEMLYEGYGPGGVAVLVYC
                     MTDNHNRTVSDVRHAFTKFGGNLGTDGSVGYLFNKQGVLYYPPGVDEDALMEAALDAG
                     AQDVQVGEDGAVEVITTPEDYVSIKDALKVAGFSPEESELAMRAAVTAPVEGDQAVKL
                     VKMIDMLEDLDDVQEVFHNADIPEEAYA"
     gene            564707..565264
                     /locus_tag="HNEAP_RS02645"
                     /old_locus_tag="Hneap_0529"
     CDS             564707..565264
                     /locus_tag="HNEAP_RS02645"
                     /old_locus_tag="Hneap_0529"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012638792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="crossover junction endodeoxyribonuclease RuvC"
                     /protein_id="WP_041600606.1"
                     /translation="MRVMGIDPGSVTMGVAVLDFERGSATQIHLQSVSLKPHGSFTAR
                     LGAIYAEVDRLIDTHAPDEFAIEQIFMYRSPESSLKLAQARGVAIAAAVGHGLTVHEY
                     MPAVVKQAVVGTGRADKLQVQHMIKRLLSLSESPPADGADAAAVALCHCYRRTSLAGI
                     SADEVGVEKTAMQLLAQSRYRRRSR"
     gene            565261..565881
                     /locus_tag="HNEAP_RS02650"
                     /old_locus_tag="Hneap_0530"
     CDS             565261..565881
                     /locus_tag="HNEAP_RS02650"
                     /old_locus_tag="Hneap_0530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction branch migration protein RuvA"
                     /protein_id="WP_012823420.1"
                     /translation="MIGRLKGILVNKQPPWILLDVQGVGYEVEVPLSTLFDLPANGQE
                     ATLLIHTVVREDAFLLYGFSREVERKLFRHLLKVTGVGAKLALGVLSGMNAEEFAGAI
                     ARNDIAALIRLPGVGRKTAERLVIEMRDRLAEGFFDGATLATAAGKMGDVVPLAGADQ
                     EAMSALEALGYKPAESQRMVKAVPGAETLPVEQIIRLALKPFAGKA"
     gene            565881..566927
                     /locus_tag="HNEAP_RS02655"
                     /old_locus_tag="Hneap_0531"
     CDS             565881..566927
                     /locus_tag="HNEAP_RS02655"
                     /old_locus_tag="Hneap_0531"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction branch migration DNA helicase
                     RuvB"
                     /protein_id="WP_012823421.1"
                     /translation="MTDRVITAESVTEDEAIERALRPKRLVDYVGQPAVVEQMEIFIP
                     AARQRGEALDHVLIFGPPGLGKTTLANIIAHEMGVGLKQTSGPVLERPGDLAALLTNL
                     EPNDVLFIDEIHRLSAVVEEILYPAMEDHQIDIMIGEGPAARSIKLDLPPFTLVGATT
                     RAGMLTGPLRDRFGIIQRLEFYSVADLTRIVSRSAQLMGVSIDAGGAQEIAARARGTP
                     RIANRLLRRVRDFAEVRGNGTVDQPMANAALDLLQVDARGFDQQDRRLLEALIHKFDG
                     GPVGLDNIAAAIGEARDTIEDVLEPFLIQQGFLVRTARGRMATRQTYAHFGFRPPSAF
                     ESQQGTLLPEEEPQ"
     gene            566924..567334
                     /locus_tag="HNEAP_RS02660"
                     /old_locus_tag="Hneap_0532"
     CDS             566924..567334
                     /locus_tag="HNEAP_RS02660"
                     /old_locus_tag="Hneap_0532"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tol-pal system-associated acyl-CoA thioesterase"
                     /protein_id="WP_012823422.1"
                     /translation="MTTTDIFYWPVRVYYEDTDAAGVVYYANYLKFFERARTEWLRAR
                     GFEQDMMREEHGVVFVVSRLQVDYQRPAKFNDALRVSCEMRKCGAASMSFHQVAERTS
                     DQIPLSQATVQIVCVDADSFKPTPIPNAMRSYFL"
     gene            567331..568008
                     /locus_tag="HNEAP_RS02665"
                     /old_locus_tag="Hneap_0533"
     CDS             567331..568008
                     /locus_tag="HNEAP_RS02665"
                     /old_locus_tag="Hneap_0533"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein TolQ"
                     /protein_id="WP_012823423.1"
                     /translation="MSTEPSVMHLVLGASLPVQLVLLILLLASVASWALIFHKSSLLR
                     RARAQAKRFEESFWSGGSLNDFYDRISRDPRPREGQEAIFEAGFREFKRLRQIEGRSS
                     SELLEGVERAMRVTLHRQIDKFEEGLSVLATIGSVSPYVGLFGTVWGIMSAFMNLGNA
                     QNATLATVAPPIAEALIATAMGLFAAIPAVVAYNRYSTQIDELFGRYDRFTDEFLGLL
                     QRQIGGQ"
     gene            568012..568467
                     /locus_tag="HNEAP_RS02670"
                     /old_locus_tag="Hneap_0534"
     CDS             568012..568467
                     /locus_tag="HNEAP_RS02670"
                     /old_locus_tag="Hneap_0534"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein TolR"
                     /protein_id="WP_012823424.1"
                     /translation="MDRRGRRTRRVVAEINVVPYIDVMLVLLVIFMVTAPMLQQGVEV
                     TPPSAASKALPQSDDVPIVITVDKTGQYAVSGQDAPSGQVPLDTIQAYVLAARKLNPK
                     IPVLVKGDKDASYQFVMGAMVAMQKAGVDKVGLVTDQPRSNSNSPSGGK"
     gene            568470..569507
                     /locus_tag="HNEAP_RS02675"
     CDS             568470..569507
                     /locus_tag="HNEAP_RS02675"
                     /inference="COORDINATES: protein motif:HMM:TIGR02794"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein TolA"
                     /protein_id="WP_012823425.1"
                     /translation="MFRWFTRMPLSILLAIALHLLIILSVLIAWKFNAFSAASQSSST
                     SNEPVIQAQSVSQAAIDQQVNRLKQADQQREKSLKQQQTEAQQAAAARRAEQARLQQL
                     EAMREAKQKAAAAQEQQLKALQDEQKKAQESVQAQKQALAKMQEEAAKAAAEKQAAQA
                     AAAKERATAAAAKQAAAEAAAQAEQAKKQAAAEKAAAEKAAKEQAAKEKAAKAAADKA
                     AKEKAANLAAQKAAQARKAALQQQLQDELSASQAQGILAAYAAAIQQKVTAQWFKPPG
                     WQPDWTCDVRISQAKDGTVLNVKILQCDGDQLFQRSVQQAVERASPLPLPSDMSLFQS
                     TINFKFRANTQ"
     gene            569547..570884
                     /locus_tag="HNEAP_RS02680"
                     /old_locus_tag="Hneap_0536"
     CDS             569547..570884
                     /locus_tag="HNEAP_RS02680"
                     /old_locus_tag="Hneap_0536"
                     /inference="COORDINATES: protein motif:HMM:TIGR02800"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tol-Pal system beta propeller repeat protein
                     TolB"
                     /protein_id="WP_081441088.1"
                     /translation="MKNERHKVKSMKARIQRWGLWILSGLLFLAPAVSQAELNIVISG
                     GQESGVPIAVVPFSTTTNTDFASIIDADLARSGQFAPLTTDQMPSQPSAPEQVQFDQW
                     RTGKAQYLVVGKVVQQGGNYQATFYLLNVTNGQQMTGRVISAPVSAARSIAHRIADII
                     FKQITGVRGAFDTKIAYVTETDGPGKKRRYTLEVADSDGANPQTVLSSNFPLMSPTWS
                     PDGSKLAYVSFEGRRSGIWVQDLRTGQRYQLTKFPGINGAPSWSPKGNKIAITLSKYH
                     SPNIYVVDLDTRNLTQVTNDGSINTEACWLPDNQTLVFTSDRSGSPQLFEKTVGTSSA
                     QRLTFGLSYAAGGAISPDGKTLALLAGGNGGFRVAVQSLSGGGSDLRYISNGGSEERP
                     SFAPNGSMLIYASQVGGSSVLKVSPVSGGESQTLRFARGKVRDPAWGPFQGDE"
     gene            570959..571924
                     /locus_tag="HNEAP_RS02685"
                     /old_locus_tag="Hneap_0537"
     CDS             570959..571924
                     /locus_tag="HNEAP_RS02685"
                     /old_locus_tag="Hneap_0537"
                     /inference="COORDINATES: protein motif:HMM:PF16331.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tol-pal system protein YbgF"
                     /protein_id="WP_012823427.1"
                     /translation="MNRLKIKRNAKKITVLAVFGMVMTQPTWAQTPPGWLNWSDKSDA
                     APAATTQAPETDAQSATPQPLSSQPLGTGETGVNTASGQTVIIQNLLDSVSRLQEQVR
                     DLRGQNEVQENQIQRLQKAQQSAFSSFDDRLSKLEQTGGSTLAPSAPVPPSVPATKEP
                     AASVPTAPAPASSASAAPAASPAPATSQDAAATAKQQALYNAAFAQLKDGQYDQAITG
                     FQAAIDADPQGQWTPSALFWQGETYYVEQKRDKSEAAYQKILTQFPNSDRVPDALLKT
                     GYIAYDANKNKQARDIFQQVISKYPQSQAANLAKQRLARMDAEKR"
     gene            571921..572604
                     /locus_tag="HNEAP_RS02690"
                     /old_locus_tag="Hneap_0538"
     CDS             571921..572604
                     /locus_tag="HNEAP_RS02690"
                     /old_locus_tag="Hneap_0538"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-carboxy-7-deazaguanine synthase QueE"
                     /protein_id="WP_012823428.1"
                     /translation="MISALDDIAIQEKAPLQLRITEIFRSLQGESESAGWPTVFVRLT
                     GCPLRCVYCDTAYAFTGGERLSLLSILDQVAAYHTQDVCVTGGEPLAQPACLPLLTSL
                     CDAGHLVSLETSGALSIEGVDPRVRVVMDLKTPSSGEAEKNRFENIDLLKTSDEIKFV
                     IGSAEDFKWAVQHVRQFQMDKRFNVLISPVFGQVTPLALADWILESGLRLRFQQQLHK
                     LIWGNEPGH"
     gene            572588..573295
                     /locus_tag="HNEAP_RS02695"
                     /old_locus_tag="Hneap_0539"
     CDS             572588..573295
                     /locus_tag="HNEAP_RS02695"
                     /old_locus_tag="Hneap_0539"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-cyano-7-deazaguanine synthase"
                     /protein_id="WP_012823429.1"
                     /translation="MSLDTENTQPKAVVLLSGGLDSATVAAIAKSDGYQVHAVSFDYG
                     QRHKVELKAAYRVALQLGIQHHKMISINLNDVGGSALTDSALAVPDYDAQSAEHIPIT
                     YVPARNLTFLSLALGWAEILGARRIYIGVNAVDYSGYPDCRPEFIKQFEVTANLATAA
                     GLTGEPFKIIAPLQTLTKAEIIQWGTRFGVDYAQTISCYNPDEQGRACGRCDACHYRK
                     QGFMDAGIPDVTIYAPE"
     gene            573351..573426
                     /locus_tag="HNEAP_RS02700"
                     /old_locus_tag="Hneap_R0015"
     tRNA            573351..573426
                     /locus_tag="HNEAP_RS02700"
                     /old_locus_tag="Hneap_R0015"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:573384..573386,aa:Lys,seq:ttt)
     gene            573784..575321
                     /locus_tag="HNEAP_RS02705"
                     /old_locus_tag="Hneap_R0016"
     rRNA            573784..575321
                     /locus_tag="HNEAP_RS02705"
                     /old_locus_tag="Hneap_R0016"
                     /product="16S ribosomal RNA"
     gene            575391..575467
                     /locus_tag="HNEAP_RS02710"
                     /old_locus_tag="Hneap_R0017"
     tRNA            575391..575467
                     /locus_tag="HNEAP_RS02710"
                     /old_locus_tag="Hneap_R0017"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:575425..575427,aa:Ile,seq:gat)
     gene            575749..575824
                     /locus_tag="HNEAP_RS02715"
                     /old_locus_tag="Hneap_R0018"
     tRNA            575749..575824
                     /locus_tag="HNEAP_RS02715"
                     /old_locus_tag="Hneap_R0018"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:575782..575784,aa:Ala,seq:tgc)
     gene            576038..578936
                     /locus_tag="HNEAP_RS02720"
                     /old_locus_tag="Hneap_R0019"
     rRNA            576038..578936
                     /locus_tag="HNEAP_RS02720"
                     /old_locus_tag="Hneap_R0019"
                     /product="23S ribosomal RNA"
     gene            579028..579143
                     /gene="rrf"
                     /locus_tag="HNEAP_RS02725"
                     /old_locus_tag="Hneap_R0020"
     rRNA            579028..579143
                     /gene="rrf"
                     /locus_tag="HNEAP_RS02725"
                     /old_locus_tag="Hneap_R0020"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            579270..579479
                     /locus_tag="HNEAP_RS02730"
                     /old_locus_tag="Hneap_0540"
     CDS             579270..579479
                     /locus_tag="HNEAP_RS02730"
                     /old_locus_tag="Hneap_0540"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823430.1"
                     /translation="MSRKARRETGLRQLRVNGYSIRERRNTAGLRQFNAKQAQARVKS
                     PSKARPMRVAAQKTQHFVIGLGIVA"
     gene            579584..580069
                     /locus_tag="HNEAP_RS02735"
                     /old_locus_tag="Hneap_0541"
     CDS             579584..580069
                     /locus_tag="HNEAP_RS02735"
                     /old_locus_tag="Hneap_0541"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600339.1"
                     /translation="MNQARWLVATFVALAVLSFIWGHNPAEVRPKDTASGPVIPVVIP
                     NDCTMKGTGCDLALGHIGHVLVRAPIVIKPLEKFSLVVEPQGEASKSMGAVSVDFQMV
                     GMDMGINRYPLTRTNNGNYAQNIILPVCTTTRTDWVADLSFTTTAGTFVAKIPFVVDH
                     R"
     gene            complement(580090..580716)
                     /locus_tag="HNEAP_RS02740"
                     /old_locus_tag="Hneap_0542"
     CDS             complement(580090..580716)
                     /locus_tag="HNEAP_RS02740"
                     /old_locus_tag="Hneap_0542"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c"
                     /protein_id="WP_012823432.1"
                     /translation="MNNRKWVIAALFMLSAAPLAIAGTSTNTIGEKIARKGTGDVPAC
                     AICHGDHGEGNLKAGYPRLAGMNAEYLDQQMTLYAQEERTNRIMQEYAQKLSIAQRRA
                     VSEYYANQTAHSPHIDLQSLPPQAAKLLQVGAPNRGIPSCFSCHGDNGQGDADGIAPI
                     AGQPAIYFIHQMNAWRFNARPVTEGNPMGVIAKSLTVQEISLLAHALQ"
     gene            complement(580753..581355)
                     /locus_tag="HNEAP_RS02745"
                     /old_locus_tag="Hneap_0543"
     CDS             complement(580753..581355)
                     /locus_tag="HNEAP_RS02745"
                     /old_locus_tag="Hneap_0543"
                     /inference="COORDINATES: protein motif:HMM:PF01048.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine or other phosphorylase family 1"
                     /protein_id="WP_012823433.1"
                     /translation="MKKNILLVMALPQENVGNRLDQFGLPILYTGVGKINAAIKLGEI
                     LSTTNEHTIVINLGSAGSHQYPAGETVCITRFFQHDMNATALGFDLGQTPFEKETHLT
                     GSLAIPGMKQATCFTGDSFVSERHPELSFEVIDMEAYSLAKTCLHHNTEFIALKFITD
                     GADGQAARDWPEALNMATDHLSVALGETLKHLERLQLASK"
     gene            complement(581371..581889)
                     /locus_tag="HNEAP_RS02750"
                     /old_locus_tag="Hneap_0544"
     CDS             complement(581371..581889)
                     /locus_tag="HNEAP_RS02750"
                     /old_locus_tag="Hneap_0544"
                     /EC_number="2.4.2.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="WP_012823434.1"
                     /translation="MPITNSLAQAVRAIPDFPKPGVIFRDISPLLNHHFRETIDMLSA
                     QFSPEEWAEIDAIVGIESRGFILASGMSYAQNKGLMIVRKPGKLPPPRHSVRYTLEYG
                     EDELQMATNLNPQRVLIIDDVLATGGTLLGTCELCTQCGHEIKGIGTLINLPGLNQFA
                     WPNTPVRSLFTY"
     gene            complement(582064..582624)
                     /locus_tag="HNEAP_RS02755"
                     /old_locus_tag="Hneap_0545"
     CDS             complement(582064..582624)
                     /locus_tag="HNEAP_RS02755"
                     /old_locus_tag="Hneap_0545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006787475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Smr protein/MutS2"
                     /protein_id="WP_012823435.1"
                     /translation="MAKSSKKTAPLAPEDIALFHEAVGSVEPVSNACVVVDDAPPKPS
                     RRKAIPERLSDYIDQHLSDGFALEEPIEHGETLSYLRPDSPPPLLRKLRRGQFSVAAS
                     LDLHGMSIDEARNSIARFFLEQRRDVRCCVRIVHGKGNRSIGQVPVLKRMVNHWLPQR
                     DDVIAFCSAPPHDGGTGAIYVLLRKS"
     gene            582732..583496
                     /locus_tag="HNEAP_RS02760"
                     /old_locus_tag="Hneap_0546"
     CDS             582732..583496
                     /locus_tag="HNEAP_RS02760"
                     /old_locus_tag="Hneap_0546"
                     /EC_number="3.6.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'/3'-nucleotidase SurE"
                     /protein_id="WP_012823436.1"
                     /translation="MNILVSNDDGYLSPGIRVLAERLKALGHVTIVAPDRDRSGASNS
                     LTLSRPLRPRLVEPDVWAVDGTPTDCVHLAIQGLLSVVPDIVVSGINHGSNLGDDVLY
                     SGTVAAATEGRSLGLPAIAVSNAAHHPEHLGVAADAVVDLVCRLVNHPLPAFTLLNVN
                     VPDLPADRIKPMLATRLGRRHPSSGIVRDRDPRDREIFWIGAAGEGADASEGTDFAAV
                     AAGHISVTPVQFDMTRHSAIHNVADWLAEPVCALPK"
     gene            583658..584272
                     /locus_tag="HNEAP_RS02765"
     CDS             583658..584272
                     /locus_tag="HNEAP_RS02765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012487820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="WP_041600612.1"
                     /translation="MVERLRQQGVSNAKVLAAMNTLAREAFVDEALRMRVYDDCSLPI
                     GQGQTLSQPYIVGRMSELLLGASIPVKRVLEIGTGSGYQAAVLAQCGCAVFTIERIGT
                     FLEVAKARHRRLGLLNIRYLHRDGFKGWPSQAPFDGIIVTAAPSNIPDELKAQLVDGG
                     RLIVPVGSQGEAQRLTVITRTENDFRSQFFDAVSFVPMLPGEQS"
     gene            584269..584856
                     /locus_tag="HNEAP_RS02770"
                     /old_locus_tag="Hneap_0548"
     CDS             584269..584856
                     /locus_tag="HNEAP_RS02770"
                     /old_locus_tag="Hneap_0548"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823438.1"
                     /translation="MRLFGALYDRVLSWSAHRHAPVALGGLSFAEASFFPIPPDVMLL
                     PMAMARPRCWWQFATIATVFSALGGLFGYLIGWLAIDWLMPYIQQWGYGSVFEKAKLW
                     FQEWGFWAIIVAGFSPIPYKAFTITAGALTMNPALFFVASLVGRGGRLYLVAGLIAWA
                     GPKIAPKLRHYIEWLGWLTVALLVIAVILWRWMKH"
     gene            584866..585666
                     /locus_tag="HNEAP_RS02775"
                     /old_locus_tag="Hneap_0549"
     CDS             584866..585666
                     /locus_tag="HNEAP_RS02775"
                     /old_locus_tag="Hneap_0549"
                     /inference="COORDINATES: protein motif:HMM:PF01476.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049772449.1"
                     /translation="MHYPIVNQLSCLAAHVRPLYRLAWVGLLLGVMTLSGCATGSHFD
                     RWAGHDASAIRVRPGDTLYSIAVANDLDWRDVARWNGIRNPRDLRAGQILRLTPPGQT
                     ARAATRVTTRAVPRKPPAAKPASRSASTQSNTTVSAQGVIWKWPVNGRVLSHFIDQSN
                     QQKGLILGGAIGEPVRASAAGEVVYAGNGLPGYGNLLIIKHNSTWLSAYGYNRSLLVK
                     EGQTVRAGQVVATMGRRDGRAKDKTGSLLFQIRRDGKPVDPMAYLPSR"
     gene            complement(585700..586635)
                     /locus_tag="HNEAP_RS02780"
                     /old_locus_tag="Hneap_0550"
     CDS             complement(585700..586635)
                     /locus_tag="HNEAP_RS02780"
                     /old_locus_tag="Hneap_0550"
                     /inference="COORDINATES: protein motif:HMM:PF13280.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441089.1"
                     /translation="MLRLRHNDAQITLRHTHKTMVNHAEIAALKWDVRQRLTLLESTL
                     LLTGWVRTQALVETFSISRAQASKDFAVYMSLRPDNLKYNKSLKYYEAGDAFTPLLLT
                     GSATDVLNALQVVNPQQTPVVTLSAALPAIQVVQPLDRQLDWSVLRVVSQAIYQKRKL
                     KAAYQSMNRNEPTELTLSPHHLVFSGFRWHVRAFSDTHQAYRDFVLARFRGEPPQLLN
                     ETAISGDHDEAWHQTIDVIIEPHPGLPESQRKILAEDYGMIDGTRCEPVRQALLPYFL
                     RLMQIEPERQHPDPKIQQIILKNPEQVQPFLWRNN"
     gene            586732..587064
                     /locus_tag="HNEAP_RS02785"
                     /old_locus_tag="Hneap_0551"
     CDS             586732..587064
                     /locus_tag="HNEAP_RS02785"
                     /old_locus_tag="Hneap_0551"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823441.1"
                     /translation="MNHVLDTTARTTSIDWAAVYEACRLHLVGIPYVHFIEAPEETLN
                     RLGMHDALEIMAAGFLPLLPAQAKVRQEIDAPKPVPKVSMARFDNKKITLRAPGVRGF
                     SKWVPRAS"
     gene            complement(587087..588085)
                     /locus_tag="HNEAP_RS02790"
                     /old_locus_tag="Hneap_0552"
     CDS             complement(587087..588085)
                     /locus_tag="HNEAP_RS02790"
                     /old_locus_tag="Hneap_0552"
                     /inference="COORDINATES: protein motif:HMM:PF01544.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441090.1"
                     /translation="MPFITRLRAFLVTTDFYTWHLQGDGTARLLTLSDETPCAGPVWI
                     HLNYTRPETQEWIRSRIDLDSTVQDTLLAEVTRPRALILDQGLLLTLRSINHNPGQEP
                     DDMIGIRLWITPKLIISTHLRSLRAVNTLQRDMETNNAPKDAGQFVTRLVELLNEDML
                     DTIEEIDELTDNYEKIMLISEDVEPVSDRDLADLRTMILTLRRYLGPQRDALLSVIGS
                     HLIWMKKGPIQRLREAENRLTRYLEVLDASRDQMRIIQEQLQTRSNNELNKQLTFLTA
                     LSAIFLPLTFITGLFGVNIDGIPGNDGHPWAFSIFTLFLVSLAAVLIYLFKRARLF"
     gene            complement(588122..588712)
                     /locus_tag="HNEAP_RS02795"
                     /old_locus_tag="Hneap_0553"
     CDS             complement(588122..588712)
                     /locus_tag="HNEAP_RS02795"
                     /old_locus_tag="Hneap_0553"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_012823443.1"
                     /translation="MLTSQEIAQLRADLVQTTTLMDKSLTLHSTWGLFSPREIDEGTR
                     LLMGFLDAPEPGQTIVDLGCGYGPIGLALAKAQPKADVILLDKDFVACEFAASNAKRN
                     QLNNVVVKPSNGLDALRGQHVDRIVSNVPAKVGKEMWSIMLWDAAEALNPGGDIWFVS
                     INGLRDYFKRTFKEQFGNYEKIKQGQNYTIHRAVKS"
     gene            complement(588783..589244)
                     /locus_tag="HNEAP_RS02800"
                     /old_locus_tag="Hneap_0554"
     CDS             complement(588783..589244)
                     /locus_tag="HNEAP_RS02800"
                     /old_locus_tag="Hneap_0554"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_012823444.1"
                     /translation="MICQNHHVCATSALAHAEAVCLARGARLTPIRRAVLMEIWANHE
                     ATKAYDLIARLSSEGSLIKPPTVYRALDFLLAHGLIHRIESLNAFIGCHHPDTQHQAI
                     LMICDRCGTINEAASEALNGILSALTHAEKFTVTHQSIELHGLCASCQKLA"
     gene            589563..590513
                     /locus_tag="HNEAP_RS02805"
                     /old_locus_tag="Hneap_0555"
     CDS             589563..590513
                     /locus_tag="HNEAP_RS02805"
                     /old_locus_tag="Hneap_0555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_012823445.1"
                     /translation="MLPAAFSARVFAEENLVIAGPKVPDIKPTPLSENVFCIVSPWGF
                     PSVENQGMMSNVTFVNTKKGVVIIDSGASRQIGEMALRQIRQLTEAPVVAVINTHYHG
                     DHWLGNHAFVADNPDVSLYAHEKTISAIKTGQGEFWRNLMERSTDNATIGTAVTPPTL
                     ALSHGDVLDFGDTKIKVHFYGTAHTPSDISLEIVGQNLVHVGDVAMDNRIAFMDDGSF
                     RGTFKNYDALEAAVPDALWIPAHGHPGKQVLEHNRELFEGIYQSAEKAVEQMGGQELA
                     KSLALEDPRVKKYAPVTKGFDENIGKYTSLAYLEAESASF"
     gene            590651..591175
                     /locus_tag="HNEAP_RS02810"
                     /old_locus_tag="Hneap_0556"
     CDS             590651..591175
                     /locus_tag="HNEAP_RS02810"
                     /old_locus_tag="Hneap_0556"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823446.1"
                     /translation="MSDGTLVRPLWPPLVAGLVLGLVLILTFVLVGNGVGASGTFASI
                     AAWLGMQIAPAATESNGYLGGMVANGANPFASWIVVEVVGVAIGALLAAVSAGRFKLK
                     VDTGAGKIGVWPRLALALIGGALAGFGSRLAAGCTSGVGLSGTTMLGIGGFIFLVVFF
                     FVGLGLSALLRRVW"
     gene            591175..591831
                     /locus_tag="HNEAP_RS02815"
     CDS             591175..591831
                     /locus_tag="HNEAP_RS02815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018911671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823447.1"
                     /translation="MDYGVAGTALASGILFGYVLEQAGFGSPCKLTAQFRLTDWSVFK
                     VMFTAIIVASLGILLLQTGNYFGSKGFFVPTTFLWATASGAALIGAGFAIGGYCPGTS
                     VVGFMSGRIDGLVFMAGMVLGIFGFAYVYDSALIQFILHSAQFTAKTLPQYLGVSPWL
                     IWVVMVLVAVGGFALGRVLERRAHGVITAEDIVDGTDPTLSSDEQGSAVQGNLGSRAA
                     "
     gene            591909..>592172
                     /locus_tag="HNEAP_RS12460"
                     /pseudo
     CDS             591909..>592172
                     /locus_tag="HNEAP_RS12460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018911672.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            592488..593195
                     /locus_tag="HNEAP_RS02825"
     CDS             592488..593195
                     /locus_tag="HNEAP_RS02825"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823449.1"
                     /translation="MNSTLSSLDDYQAWMTQLSEPDFDELVSVAQEFFDINRSLSNDH
                     QTILDELLKYEDDSPVIRWQHYPADDVQDPDTGAMYYYHAHAADERPQDEHGHFHLFI
                     RPEPSAQFSHVVGVSIDARGAVRSLFTTNRWVTDEYIRPAVDLVSMLPDAFVVNRARP
                     SWLVSRWLMMLVRLCEPQIRRLLNARDESLGWTGDGELPVDVAEDRSKNVLSEEFIDI
                     YAVLTLVQQVGLQRYSA"
     gene            593331..594320
                     /locus_tag="HNEAP_RS02830"
                     /old_locus_tag="Hneap_0560"
     CDS             593331..594320
                     /locus_tag="HNEAP_RS02830"
                     /old_locus_tag="Hneap_0560"
                     /inference="COORDINATES: protein motif:HMM:PF00581.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese"
                     /protein_id="WP_012823450.1"
                     /translation="MNFKKFVFVPAVIAASFAAQAAYAVTVPGPLVDPAWLNAHLKDV
                     KVLQVSGTMKSFTTAPEMKEIKGKNVAVTVSGHVPGASFVDFKTVRVSRDIDGKMVKG
                     VIPDKAAFEKLVQSWGVNKGQPIVIVPKGLSTPDVDEATRLYWQLKYYGQDNMAILNG
                     GMAQWLADGMPAATDAPAVSAGNWVASAERKNILATYQEVKKAVEHPGAVEFADARPT
                     NQYMGVFTKPKELPGHLPGAKNVPPDLLTTADGASARFLPKASYESMFKTVGLNSGKE
                     IIDYCNTGHLASGLWFVTHEIVGDKKARLYDGSIVEYSMYDGAKMNDPAMLGK"
     gene            complement(594473..595366)
                     /locus_tag="HNEAP_RS02835"
                     /old_locus_tag="Hneap_0561"
     CDS             complement(594473..595366)
                     /locus_tag="HNEAP_RS02835"
                     /old_locus_tag="Hneap_0561"
                     /EC_number="2.7.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribulokinase"
                     /protein_id="WP_012823451.1"
                     /translation="MSVKHPVVAVTGSSGAGTTTVKRAFEHVFRRESLSPVVIEGDSF
                     HSLSRMEFREAVKKAEAAGNFSFSHFGPEANHFDKLGELFKTYGESGTGKKRYYIHSD
                     QEAAEHNARLNTNLKPGEFTPWEDIPAGSDLLFYEGLHGLVKTDSIDASAHVDLGVGV
                     VPIINLEWIQKIFRDNAERGYSAEATVDTILRRMPDYVNHITPQFSRTDINFQRVPTV
                     DTSNPFITRDIPTPDESLVIIHFSNPKKAGADFPYLLSMIPNSFMSRYNTIVVPGGKM
                     SYAMDLILTPIIHNMIERRNA"
     gene            596032..596107
                     /locus_tag="HNEAP_RS02840"
                     /old_locus_tag="Hneap_R0021"
     tRNA            596032..596107
                     /locus_tag="HNEAP_RS02840"
                     /old_locus_tag="Hneap_R0021"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:596065..596067,aa:Ala,seq:ggc)
     gene            complement(596413..596502)
                     /locus_tag="HNEAP_RS02845"
                     /old_locus_tag="Hneap_R0022"
     tRNA            complement(596413..596502)
                     /locus_tag="HNEAP_RS02845"
                     /old_locus_tag="Hneap_R0022"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(596466..596468),aa:Ser,seq:tga)
     gene            596841..597224
                     /locus_tag="HNEAP_RS02850"
     CDS             596841..597224
                     /locus_tag="HNEAP_RS02850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-associated lipoprotein"
                     /protein_id="WP_012823452.1"
                     /translation="MNGSGTDESVLYASAPKGDAATVYFGFDKYNVDPSYRPMLQQNA
                     AFLKENTQRHVLVEGNTDNRGSREYNIALGEKRAVAVRDTLLADGVAPSQVDVVSYGE
                     ERPAVEGNNEAAWAKNRRADLAYGK"
     gene            complement(597323..600874)
                     /locus_tag="HNEAP_RS02855"
                     /old_locus_tag="Hneap_0563"
     CDS             complement(597323..600874)
                     /locus_tag="HNEAP_RS02855"
                     /old_locus_tag="Hneap_0563"
                     /EC_number="3.1.11.5"
                     /inference="COORDINATES: protein motif:HMM:TIGR01450"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit gamma"
                     /protein_id="WP_012823453.1"
                     /translation="MPPTTPITDEITPGFLLIQGNRLELLQQVLIDWLKRHPLAPLEN
                     ETFLVQSNGMAQWLRLGLARPRSAQDGGLGIATGIEMILPARLQWQCYRAVLGTDFVP
                     AEAPLDKDKLVWRLMRLLPNLIHTPSFLPLRHYIVTDQRPDDRRLYQLALRVADQFDQ
                     YQVYRADWLRHWQEGHDDLPAHETRLPDEQRWQPPLWRALLADIRERQDDRDGIEFAA
                     GRADLHTAFRKAASEQKARPEGLPRRIVVFGLSSIAPQVLDVLAVASRWSQVIVCFLN
                     PCEYYWGDIIDGHQLFAQRYQGRRPYKSAPNETAHAHPLLAAWGRQGRDLMRLLDQFE
                     ENAQLAANPLTLTPFESTVVDSAKSSLLTLIQDDILKLRTPDELRALNRRLEPDQDHS
                     LHFHIAHSPLREVEILHDQLLAAFEADTSLKPTDIIVMVPDMSLYAPAISAIFGRFGR
                     DDPQHIPFSISDQAASGQVALINALEQILNLPTSRLLRSELLDLLGSPLLLARFGISE
                     TDLTTLHDWIDSAGIRWGLNAQHREAFGVPPGMEQNTWAFGLNRLLLGYLSGDENAIW
                     DEIEPHPVMDGISAELVGKLAQLVQQLDKYTQRLSEKCTPTEWVARLRRLMTDFFSLS
                     DTQNHLDSPEIQIEMDTLARLHNELERWLADCSVAGFENEIDIETVRHAWLNRLEPHR
                     LHQRFIVGGVNFATLMPMRAIPYRHIYLLGMDDANYPRRQTPNDFDLMNGRYRPGDRA
                     RREDDRYLFLEALLAARERLSISWVGRNINNNKIRPASVLVSQLRDYLDQFWAVPEPH
                     SCSEIQTTEHPLHPFSRRYFSADNTDLFTFANDWRAVHDSTQGTSKTELPIWLPKEPL
                     TLNTLSDFLRTPAHTLLTKRFGVYLRPTATELEDHEPFELDGLQRWQLKKEINDRVRH
                     QLAIQAHATSQMTTPTIEHISALISTQYGQARLGGRLPIVSPAFEYSELLPLIDQWQR
                     WLELNLRFHQTAAKSPVLSIRSDRGIMLEASVPDVYSTESSIPNDTLARLIFIEGKLH
                     RGQDIEWHKCVAQWPAHLLAQLTHGSVETYLIGETGTLCFTPIEKEMAKQHLLTLLDA
                     WFDAVQAPYPLACKTAFCLLAQEMTPENTDSALKKARECFEGNMKVPGEVTNSPALAR
                     LWPDFSTLINGQSFAKKQFTELSQIIYAPIKDAIEAR"
     gene            complement(600968..601996)
                     /locus_tag="HNEAP_RS02860"
                     /old_locus_tag="Hneap_0564"
     CDS             complement(600968..601996)
                     /locus_tag="HNEAP_RS02860"
                     /old_locus_tag="Hneap_0564"
                     /inference="COORDINATES: protein motif:HMM:TIGR00254"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_012823454.1"
                     /translation="MQEPLDLRDSDIVLLSILARETNLPRFFHIAANAAAKIVGADGA
                     GLILPEGEKLKYRFFEGLPPQFVALSQHAFDRSTGVAGAALAQNHPLFIEDYPNSDLA
                     LPHFVESGLKASLSIPIRISDQIEAVLALSWFKPVGQSMSMRQLSLATLFGDFIGTAL
                     YRDKIEQHLNRLAHSDPLTGLPNRAGFYPLLDQAILRAQDGDRHVALAIIDIDHFKTV
                     NDTLGHEFGDRLLMEISSRLAEALHREDKIARLGGDEIAILIESARHLKDLQDIVRRL
                     SQALYLRIGRDGEYVRISGSIGVCEIHPKETRNQNTLMCAADSAMYQAKRAGGNCAVF
                     SAPPQPDF"
     gene            complement(602125..602694)
                     /locus_tag="HNEAP_RS02865"
                     /old_locus_tag="Hneap_0565"
     CDS             complement(602125..602694)
                     /locus_tag="HNEAP_RS02865"
                     /old_locus_tag="Hneap_0565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="WP_012823455.1"
                     /translation="MKTAQEFRAGNVIMVGKDPMVILKAEFNKSGRNSAVVKMKMKNL
                     LTGSSTESVFKADDKFDQVILDKKECTYSYFADPLYVFMDSEFNSYEIEAENMGDTIN
                     YIVDGMTDPCEVVFYNDKPISVELPTIIVREIAYTEPAARGDTSGKVMKDAKLTNGHE
                     IQVASFIEIGENVEIDTRTGEFRRRASAA"
     gene            complement(602767..603915)
                     /locus_tag="HNEAP_RS02870"
                     /old_locus_tag="Hneap_0566"
     CDS             complement(602767..603915)
                     /locus_tag="HNEAP_RS02870"
                     /old_locus_tag="Hneap_0566"
                     /inference="COORDINATES: protein motif:HMM:PF10093.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823456.1"
                     /translation="MLTTERIDWDIFCRVIDNYGDIAVSWRLARILTEDHRQVVRLWV
                     DDLSALVHLIPEIDATEEQQSHHGITIIHWTDASATPRPARFVIEAFGCTLPEGYQQR
                     MHEQTVAWFNLEYFSAESWISDYHGRFSPQPNGLQKQFVFPSTRPDSGGLLREAHLFL
                     ARDRFLHLEQTKWAHDWQIPLPNGLSLLLFGYENRAIGELIDDLAQTTTEAVTIYLPE
                     GRLLSSAREHLRYPELMAGDQFQRGAVTLHVLPFLPQAQFDRLLWMCDILFVRGEDSL
                     VRALWAGKPFIWQIYPTDDQAHWEKLDALLDTCRGDLPAPAFDAWRTLTHDWNRQQLA
                     PESWQNFIEHHALLASAAEKNRLTLASQTELSNWLVKTAYERLQCRTI"
     gene            complement(603916..605412)
                     /locus_tag="HNEAP_RS02875"
                     /old_locus_tag="Hneap_0567"
     CDS             complement(603916..605412)
                     /locus_tag="HNEAP_RS02875"
                     /old_locus_tag="Hneap_0567"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823457.1"
                     /translation="MPRIRPLFLPLLALPVIALMLWFMPPAANASGYPPFPAQTQWFN
                     VSKPLTGAQLQGRVVLLDFFTPGCINCIHMIPIQQQLKQKFGDDLLVVGVTSPKFTAS
                     QQADNMTPFLRRYHVDEPVFIDSGMTWWQHYGVFAWPTMLLLNPEGKVIHSFVGERSY
                     TDMAAVIQSAVESARAANTLTHPKLPLKPLSADNHFMVLPTKIAVNDNRVAISDTGHD
                     QVRIFDHEGKLLATIGDGKAGFADGSFATAEFNRPQGIAWLGNDLYVADTDNQRIRRI
                     DFASQTVSTVVGNGQRVFLNEVTAAAKDTPLNSPWGLEAVDGDLFIAMAGDHAVWRYD
                     PKTRKLDVYAGTGDEGLHDGERLLAQFAQSSGLAYHDHNLYVADPESSSIRQINMQTS
                     LTITLVGKGLFSFGDRDGAADQALLQHPQGLAYLNGALYIADTFNNAIRKLNLDTLQV
                     STVAKNLAQPNGLAVLNDHTLLIADTYRDRIVALNIINGETTAWPPKK"
     gene            605669..607567
                     /locus_tag="HNEAP_RS02880"
                     /old_locus_tag="Hneap_0568"
     CDS             605669..607567
                     /locus_tag="HNEAP_RS02880"
                     /old_locus_tag="Hneap_0568"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823458.1"
                     /note="Uup; in Escherichia coli this cytoplasmic protein
                     was shown to contain ATPase activity; mutations in this
                     gene affect RecA-independent excision of transposons and
                     affects Mu bacteriophage growth; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012823458.1"
                     /translation="MPLLTVDRLHFALGTRVLLDHVGLTVEPGERIALIGRNGMGKST
                     FMKILAGLTRADEGEVRLEPGARIAYLQQDPQMDSTASVYATVAEALGGIEATLTAYH
                     ACIEKLGAGDDSVMDEMARLQQQIEAVDGWSVAQRIDEVITRLDLDPDASVKSLSGGA
                     KRRVLLAQALVVQPDVLLLDEPTNHLDIASIEWLEGLIRGFSGAVIFITHDRSFLQNL
                     ANRILELDRGQLTSWPGDYQNYLRRVEEREHAEQIQNAEFDKFLAEEEVWIRQGVKAR
                     RTRNEGRVRRLEALREERAARVNKQGKVEVAVASSRTSGKIVFDGEHIDKTYNGKTIL
                     KDFALRILRGDRIGLVGPNGVGKSTLIKLILGEIQPDSGTARQGSQLQVAYFDQHRAQ
                     LRPDWTALQNICDGGDRIDVHGQNMHGIGYLQKFLFTPERARTKVESLSGGERNRLLL
                     ARLFAQSANLLVLDEPTNDLDLETLEVLEQVLLDFDGTLLVVSHDRAFLDNVVTSLLV
                     FEGEGRVREVVGTYEDWLAIRDRENAQQSTSTPKPVAKTAPVANSPAKKDSLSFKERH
                     ELAALPEKIAELEDEQAQLTVQMSDPAFYAQPDDKTAPVLSRMAAIDEELLELMARWG
                     DLEARATQ"
     gene            607592..607960
                     /locus_tag="HNEAP_RS02885"
     CDS             607592..607960
                     /locus_tag="HNEAP_RS02885"
                     /inference="COORDINATES: protein motif:HMM:PF02594.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823459.1"
                     /translation="MNDSVESDFFHWQDDRLILKLKVQPRASRTAWGEVIGGRIKLYL
                     TTPPIDGKANQAVIDFIAKTFSVAKNRVEIRRGETSRSKDIALAWLTVPKASSSEAER
                     LLLQALSSKAIADSSEARLR"
     gene            608062..608937
                     /locus_tag="HNEAP_RS02890"
                     /old_locus_tag="Hneap_0570"
     CDS             608062..608937
                     /locus_tag="HNEAP_RS02890"
                     /old_locus_tag="Hneap_0570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823460.1"
                     /note="binds with the catalytic core of RNA polymerase to
                     produce the holoenzyme; this sigma factor is responsible
                     for the expression of heat shock promoters; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoH"
                     /protein_id="WP_012823460.1"
                     /translation="MNTAQHPVMPRTLPVVGDSLQQYLAEVRRIPLLTADEEQKLAEQ
                     LKSTGDIDAAQKLIMSHLRFVVHIARGYRGYGLPLADLIQEGNIGLMKAVKRFEPEQK
                     VRLVTFAVHWIRAEIHEYILKNWRIVKIATTKAQRKLFFKMRQMKSGLGWLTADETRA
                     IAAELNVPEREVVTMESRLYSHDIAIDAPVYDSEQEGSGPSYEQILVDQHQVSVEDMT
                     AQRDEDDRVTAMTHALHDLDARSRDILERRWLQEPKATLQTLADEYQVSAERVRQIEN
                     AALKKLRLALPAPSH"
     gene            complement(608986..609618)
                     /locus_tag="HNEAP_RS02895"
                     /old_locus_tag="Hneap_0571"
     CDS             complement(608986..609618)
                     /locus_tag="HNEAP_RS02895"
                     /old_locus_tag="Hneap_0571"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019439613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041600623.1"
                     /translation="MHHALTAFMAFLAMMNPVANAVIFLGLTADMGLATTRHVAWRAV
                     RTAFFIVLTFALFGPLVFSLFGITLPALRVAGGVLIALVGFRMLHGENSRVSHPKQIP
                     SESGSEVDSSQNDIAITPLAIPVLAGPGTIATAMSYSPSGHWMQTGATILMFTLICAL
                     TFYAFVFSERILARIGRGGVAVITRLMGLILAVIGVQMLLDGLHQSGVFG"
     gene            609765..610328
                     /locus_tag="HNEAP_RS02900"
                     /old_locus_tag="Hneap_0572"
     CDS             609765..610328
                     /locus_tag="HNEAP_RS02900"
                     /old_locus_tag="Hneap_0572"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014002341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylethanolamine N-methyltransferase"
                     /protein_id="WP_012823462.1"
                     /translation="MIRTREWLNFAREFVKNPRHTGALCPSSVYLARQMAALVPDGEG
                     KVIELGPGSGPMTRALLKRGIKPDDLILVERTDSFAQLLRQRFPGLNIIHGDACGLSQ
                     LLSGIEAPIRAIVSSLPLRSMPSSVVQQISQEINQISQPGTRYIQFTYHLHDNKLPFT
                     GPFSGSECHIVWRNFPPARVDAFDWKS"
     gene            complement(610397..610816)
                     /locus_tag="HNEAP_RS02905"
                     /old_locus_tag="Hneap_0573"
     CDS             complement(610397..610816)
                     /locus_tag="HNEAP_RS02905"
                     /old_locus_tag="Hneap_0573"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_012823463.1"
                     /translation="MGFQTAKENSDEMSEINMTPLVDVMLVLLILFMVTMPVLTQEIR
                     VTLPKTTSQTPVTAPKDPIDLAIRADGSLQWNQENLSDEAVTKRLVIAAKEQPQPVIR
                     LYGDAAVPYGKVMNVLASAKEAGITNIGFVTEPMPQK"
     gene            complement(610822..611535)
                     /locus_tag="HNEAP_RS02910"
                     /old_locus_tag="Hneap_0574"
     CDS             complement(610822..611535)
                     /locus_tag="HNEAP_RS02910"
                     /old_locus_tag="Hneap_0574"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MotA/TolQ/ExbB proton channel"
                     /protein_id="WP_012823464.1"
                     /translation="MPHSFDLASLWQQSDLIIRSVALLLLAMSVLTWFYVLQRLSFML
                     RLRGVSRRFEQFWHTQGYSEGLALLGKPGHINPFRTLADSAVEAVEHYYSHSTDLHSQ
                     LPLSEWLSLSLTSKIDDIQEFFRQGMSALASIGAVAPFIGLFGTVWGIYHALENIGQT
                     GSANLATIAGPVGEALVMTAFGLAVAIPAVLAYNAINRQNRQLIARVQRFAQQLHTYH
                     VSGIAPTARAKANVQQWQE"
     gene            complement(611555..612193)
                     /locus_tag="HNEAP_RS12465"
                     /old_locus_tag="Hneap_0575"
     CDS             complement(611555..612193)
                     /locus_tag="HNEAP_RS12465"
                     /old_locus_tag="Hneap_0575"
                     /inference="COORDINATES: protein motif:HMM:PF03544.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441091.1"
                     /translation="MLGTLLTQPSPVIEPEPTPEPTPEPTPEPTPEPAPAPAPEPEPK
                     PAPKPAITEPKAKPEAKPLPRPTVKKSPPQTKARPTNKAVESLATVQHSLSDSSQAEK
                     APTIATNPVPVQTPPPVVQPRLDARAGNNPPPDYPRAARKRGQEGTVVLSLVIGADGS
                     VQDVSVKRSSGYPLLDQSAVKAIRRWHFHPATQGGKAISWNYLQPIKFSLTD"
     gene            612638..614902
                     /locus_tag="HNEAP_RS02920"
                     /old_locus_tag="Hneap_0576"
     CDS             612638..614902
                     /locus_tag="HNEAP_RS02920"
                     /old_locus_tag="Hneap_0576"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823466.1"
                     /note="Fiu; YbiL; porin involved in the uptake of iron
                     complexed with catecholate siderophores (e.g.
                     dihydroxybenzoylserine, dihydroxybenzoate) and beta lactam
                     agents; Fiu interacts with TonB which provides the energy
                     required for transport across the outer membrane; acts as
                     a receptor for iron-siderophores and microcins E492, M,
                     and H47; outer membrane protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catecholate siderophore receptor Fiu"
                     /protein_id="WP_012823466.1"
                     /translation="MIRSKKHEAAVVFLALGSAPLGVAHADNVALPTVNVSGKSERND
                     IKVDQLSSPKFSQPLVDTPQTITIIDQALIKQQGATTLTEALRNTPGVSTFYLGENGN
                     TTTGDSVYMRGYDASSSIYVDGVQDLGAISRDMFNIEQVEVIKGASGTDYGVSSPSGS
                     INLVTKQANMRDSTAGSLELGQSYARATADVNRALDGVKGGAVRINVMGQKADVAGRD
                     SIENNRGGVAASVALGLGTANRLWFDAMYLKQNNVPDGGVPTIGLPGYTSPDSKRPFL
                     ANAPAVDPSNFYGTDSDYQKVTSSRYTLTLEHDFNPNTTLRNVTRWAQTQNDYLLTAF
                     MGSAANWLTPDPSNPSTWTIARSLPTFLNQQNTILTNQTSLKTNLQTGSIQHDALVGV
                     EFTRSKQNNLSYATQGAWPAANLYAPDPDVTGLTWDLNGGHAEGLSNTAAIYAFDTAH
                     LTDRWLVTGGVRLDHYRTSYNSVQACGVGRGAPACTGGAATGTLVNAADLSTSGNAVS
                     WKLGTVYKITPDSSVYVNYANAQLPPGSANFQLSSNANSANNPDYAPQKTKTIEAGAK
                     WDALDGRLGLAAAVYQTEVLNGIVQDPVSLQYYQTGKQRVQGVELSAVGNITPDWQIN
                     AGWTLMDTKVTSGSAVGNDPDDYQLNYTPRTAFTSWTSYRVTPKLTIGGGPRYTSMLQ
                     RGKDGAVGTPQYADSYWVVDAMASYQLTKAMSLQLNVYNLFNKEYVAAINKSGYRYTP
                     GAPRTVRLTAAVKF"
     gene            614994..615671
                     /locus_tag="HNEAP_RS02925"
                     /old_locus_tag="Hneap_0577"
     CDS             614994..615671
                     /locus_tag="HNEAP_RS02925"
                     /old_locus_tag="Hneap_0577"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PKHD-type hydroxylase"
                     /protein_id="WP_012823467.1"
                     /translation="MMMHLAEVLDKATVADFRAQLEAADWVDGRQTVGAQGARVKQNQ
                     QLDVRSPIAMALGQRVLSALAQHPLYFSAALPKRVVPPLFNRYEGGEQYGFHVDGSVR
                     HEADGALLRTDLSCTLFLAEPNEYEGGELVVHDTYGQHEVKLPAGDLILYPSSSVHAV
                     MPVTRGARVASFFWLQSMIRDDARRVQLFELDQTIQRLRTRIGDDAEVLHLTNLYHNL
                     LRQWAEV"
     gene            615656..618205
                     /locus_tag="HNEAP_RS12165"
                     /old_locus_tag="Hneap_0578"
     CDS             615656..618205
                     /locus_tag="HNEAP_RS12165"
                     /old_locus_tag="Hneap_0578"
                     /inference="COORDINATES: protein
                     motif:HMM:PF00175.19,HMM:PF03929.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441092.1"
                     /translation="MGGSMMVSRTRLNPSLFMSPRTLFRWLHRWLGLFAGLILAIVGG
                     TGAIMSFQDDLLRWMNAGIMQVTVPEGATVLPLPDLLARIQAQKASPPIATLRVSTEP
                     GESAWVGFRARGKPAGEFVNPYTGDLLGKARGEAFFHTVENVHRRLLAGNTGKAITGA
                     SALVFLAIMISGVIIRLRRAGLKYWFKPIGHGALAARTQSWHSVVGVWLLVPFLLVTS
                     TGLFWSYDWSRNLWLAATSTPKGKPAPYKMAEVSHSAPDLQAIADRLATLSANRVQIF
                     WPNKPDEAMRVLWQNSATPHQRAFNTLQLQPTTAEILADQPFVSLPFGTQIIRSMFAL
                     HSGEYFGLVGMWMMFLVSLSLPLFFISGLWLYLRRRVRPRSKLVKFSGITPDTAPVLV
                     VYASQTGTAQTLAQMTAQRLEAAAQPVLFRSLDELTHAELSAASMALFIVSTYGDGEA
                     PDQAQGVIKSLLGKQQALPTLSFAILALGDRQYRQFCGFGIELRQSLLAAQATEWFPM
                     LMADQADPVVLDEWVSQLASVWGDETLTAAAPSPAWILSKRQHLNPAGMGFPTFEIEL
                     TATHTMRDEWQAGALIDIVPLQPTERVAQWLHAAGLEGSQRVLLDGVEQPLAEALRHH
                     ELPAISAGKPGHDIPTWINTLRRLGARSYSIASLPTDGVVRLLVRQVQTPAGELGIAS
                     GWLTAHAPLGEKLTAQLRQNPSFLPMVDPTVPCLFIANGTGMAGIRAQLEARIAVGAK
                     RNWVILGERSPQDAYWLAQWHLWESEVFIERLDWVFSQLPTSGAIRYVQHRLGEAHDS
                     LKEYLDENAVVYVCGSATGMAPAVESVLSNLLGTEVWQAFRRSGRYRRDVY"
     gene            complement(618276..620030)
                     /locus_tag="HNEAP_RS02935"
                     /old_locus_tag="Hneap_0579"
     CDS             complement(618276..620030)
                     /locus_tag="HNEAP_RS02935"
                     /old_locus_tag="Hneap_0579"
                     /inference="COORDINATES: protein motif:HMM:PF04349.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucan biosynthesis protein D"
                     /protein_id="WP_012823469.1"
                     /translation="MSKPTKKQTEQQPSEQAPSILTTQEYTRRSFLFTLANISGLVAL
                     GFGNAQAAQESTATPVNEPTTPKTPAPAAVAPENGLKFAAAKPFSYKSLIARAQEMAK
                     NPYQAPPSPAADAIKTINYDASGKIKFNPKDALWGKSGSVYPITFRPLGEYFPKSVAM
                     NVVEGDQARMIEYRPDYFTMPEDSPLRQVPAGQSGISGFWVQRSRRIGDWTKSEPWAT
                     FQGASYFRAISRQGQVGMSARGIAINTGLPQGEEFPDFRAFWFEPAANEGDPVVVYAL
                     LDGPSITGAYRFELRFDGDTEMVIEKHLFIRKTIDQLGIAPLTSMFWYSETPNSHLRG
                     WRPEVHDSDTLVGWRSDNEHFCRPLTNPPSLAYSAFVDEHPRGYGLLQRDRDPSHYLD
                     GVGYEKRPSVWVEPIVDSKGNNNWGKGSVTLIEIPTNDETFDNMVAFWQIKGPALAGT
                     ALQFKYRLYWTEHEPFFPRDQLARAVALRAGPGGNFGGSRPANTVKLVIEWDSQLFQG
                     HQPKDAVFTITSSAGKTDNVQIDWVAGTPRWLTQFDLFVDSDTPVELNGVLTLNGEVI
                     SETWLYQFHRQSFVQMMA"
     gene            complement(620062..622176)
                     /locus_tag="HNEAP_RS02940"
                     /old_locus_tag="Hneap_0580"
     CDS             complement(620062..622176)
                     /locus_tag="HNEAP_RS02940"
                     /old_locus_tag="Hneap_0580"
                     /inference="COORDINATES: protein motif:HMM:PRK05454.2-1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucan biosynthesis glucosyltransferase H"
                     /protein_id="WP_012823470.1"
                     /translation="MTDSAMPSTKDAFRGIALLRRWIFTAFVLLQTALGIWGMILVLP
                     YHGSTAIEKTILITFIPLYAFVAAGSWMALFGFYLRRRYKNRGDAHSLMSRFADRLPT
                     TKLVKTAVALPIYHEDVERVFRGLRASIQSVLATGQGEMFEFFILSDSRDPEIWLEER
                     AAWLALCNDLDLHGRVHYRRRRVNLKAKTGNVSDFLRRWGRNFKYFIVFDADSVMSGE
                     ALVTLVRLMECEPKAGMIQTVPRLFNARSAFARMQQFVTHLYGPLFSEGLAALQLNEA
                     VFWGHNAIIRTEAFMAHCGLKSMRGFGLWRGTVLSHDFVEAAFIRRAGYEVWLETAIE
                     GSFEESPPSLDDELIRDKRWSKGNLQHLRFFGYERGIATAHRMAFMNGIFAYMASPVW
                     FLFLLFSTIEVAQFAAGDINYFPDTRSLYPNWPQWHPQWAIILVTSTLVTLFLPKVLA
                     LFDLLVFDTGRRQGFGSTAKLLQGFFLENLFSILLAPIRMLAHSAYVVQAILNVTVRW
                     AGQNRSSEIGWLQALIRHAPGMILAITWSGIALYLDANFFYWTIPISLSLLLAAPITV
                     WLSRFSLGDHWRTQGIWRTPPEQNLGDQVLVDFAELDMPPLKPQNAPNWLNWTILHPN
                     QARIAAALAPHRSGAAKQASTELKEKLMVEGLHALPSRKAARILDDADAVMQLHQHAW
                     MAPPDDPWGRQVDHLTRLICIK"
     gene            complement(622173..622466)
                     /locus_tag="HNEAP_RS02945"
                     /old_locus_tag="Hneap_0581"
     CDS             complement(622173..622466)
                     /locus_tag="HNEAP_RS02945"
                     /old_locus_tag="Hneap_0581"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823471.1"
                     /translation="MNDTSPEVNPAPGNTQCEYPVAICGQLRWLQRRVFYQFLQTGCP
                     TIDLQANLDISDNQADLQQRLAIPIPQLCAMPPILRGSVKHAQPHAKHNRKPS"
     gene            complement(622463..624070)
                     /locus_tag="HNEAP_RS02950"
                     /old_locus_tag="Hneap_0582"
     CDS             complement(622463..624070)
                     /locus_tag="HNEAP_RS02950"
                     /old_locus_tag="Hneap_0582"
                     /inference="COORDINATES: protein motif:HMM:PF04349.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucan biosynthesis protein G"
                     /protein_id="WP_012823472.1"
                     /translation="MFRRNTVPPVSPFSVRPAPSSTWPLRWKMVLGLFIASLTIATHE
                     ALAFGFQDAVIQAKQLASQSYSPDPQIPEALSQIDQNTFERIAIKPSASLWQTARFGI
                     DPISAGYIYDQPVDLYEVTPDSVAPIVFDKTKFDWPSQAFAQTVPANLGFAGFSVHYP
                     LSGQDARDVMLTFLGGAQFSVVAANQVPGAHARGVAIDTGLPQGEQFPRFTKFWLVRP
                     NPSDLQLTIYALLDGKSLTGAYEFVIRPNGSRVDVHVTASLFPRTGISRLGLAPLSTM
                     YFYGQTGQRPAGQWRPAAYESDGLLMHTGEGDWVFRSLQNPATLRVSEFAADGIRGFG
                     FMQRQTRFCQFEDAISRFERRPSLWVTTEAGFGKGKIVLVQIPTNSDLHENQIAFFQP
                     AEVVDSAHPVSFAYTLTAGNSDVAQEPLAQVRRPLIGTVKLAADDKTEKAYRVNLDFS
                     GGRLSTLADNEPVIANIETKGTATVQEQAVIPLPEAGHWRLSMLLVPTGKSVVTIDAS
                     LALKKKVISETWRYDLPSDLTRFGQMK"
     gene            624563..628069
                     /locus_tag="HNEAP_RS02955"
                     /old_locus_tag="Hneap_0583"
     CDS             624563..628069
                     /locus_tag="HNEAP_RS02955"
                     /old_locus_tag="Hneap_0583"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit alpha"
                     /protein_id="WP_012823473.1"
                     /translation="MSFVHLHLHTEFSLIDGTLRIKPMLAAAKERGLPALALTDQANL
                     FAMVKFYEAARKSGIKPILGADCLVVDEPGSTPYRVVLLAQNNLGFRHLTELLSRGYC
                     EGQIQDRPMLRREWLTQEQCAGLIALSGGHLGEIGQLLLHGKARERKAAIKFWTERFP
                     DRFYLELTRCGRPDEEKYLHAAVELAEQAQLPVVATNDVRFLDQENFEAHEVRVCIQQ
                     GRVLDDPRRPHDYTALQYLRPADEMQALFADIPEAIENSLAVAERCNVTLQLGKNFLP
                     NFPTPNGETEADYLRTLSEQGLAHRFERVPAEQHEAYRERLNIELDVIIQMGFSGYFL
                     IVADFIQWAKRQGIPVGPGRGSGAGSLVAWALLITDIDPIPYDLLFERFLNPERVSMP
                     DFDIDFCMEGRDRVIDYVAERYGRAAVSQIATHGTMAAKAVVRDVGRVMSYPYGFVDR
                     IAKLIPMKPGLDVTLEDALGRTERSQKEQERFSQEFRDLYERDEEVRAIVDMGMALEG
                     LSRNVGKHAGGVVIAPSKLTDFTPMYCESNGASAASQLDKDDVEAVGLVKFDFLGLRN
                     LTIIDWALGSINATRQKVGKEPVDITVIPLDDKPSFNLLKRCETTAVFQLESRGMKDL
                     IRRLQPDTFEDIIALVALFRPGPLQSGMVDDFILRKKGEQKIEYLHPWLTDVLKPTYG
                     VIVYQEQVMQIAQILAGYTLGGADLLRRAMGKKKPEEMAKQREIFLEGAKSKQVDPTQ
                     AGYIFDLMEKFAGYGFNKSHSAAYALVAYQTAWLKAHYPAHFMAAVLSADMDNTDKIV
                     GLIGECQRMGLNVIPPDVNHCAYKFQALDEHTVVYGLGAIKGVGEGVIQKIVEERQAG
                     APFVDMNDFCHRVGSQALNKRVLEAMVLAGALDTLGPNRASLFAHIPDAMKAASQIQA
                     AEAAGMGDLFGGFDAPETAIRVPIPALEPWPDAEQLRKEKDTLGLYLTGHPIHAFRDE
                     LKSLVSDTLSGLLDKLDIPAPGTFPKGVPVTVAGLAIAERIVRQQNGDRQLFLTLDDG
                     EGRCEVRITGDEIDRISAQVERDQLVIVEGDAVFDNFSGGIRVRCKRLLVLEQARLEK
                     ARGIFLEFAADCNAAKAQALIERMRPMRCDGVPLSCRVYSDMAKAVVRLGPEWQIAPT
                     DDNMQAIRSAPGVQSARVLYQR"
     gene            628185..628421
                     /locus_tag="HNEAP_RS02960"
                     /old_locus_tag="Hneap_0584"
     CDS             628185..628421
                     /locus_tag="HNEAP_RS02960"
                     /old_locus_tag="Hneap_0584"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_012823474.1"
                     /translation="MQIDHHDLAHEFPEHKDRIHTLKMENKHFANLFNKYHTINNEIE
                     QAEKNDLPISDEHAETLKKQRLELKDQLYAMLIS"
     gene            complement(628854..629573)
                     /locus_tag="HNEAP_RS02965"
     CDS             complement(628854..629573)
                     /locus_tag="HNEAP_RS02965"
                     /inference="COORDINATES: protein motif:HMM:PF00034.19"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823475.1"
                     /translation="MSKSKTFNWSLGLATTAVALTLSANAFAYDASALKGAPKVEGVG
                     MNITNAAIKPWDISYFYDGTNLPDGKGTVTAGEKIYTEQCAMCHGDFGEGAHGYPKMV
                     GDPVDQFEASAKAGVDAVSNRGINNNWGNAPTLMDMIHRHMPFYAPGTLSVDEAYSVT
                     CYVMNLASIPGVGDDFVCDKTSLPKIKMPGEPLYVTNSGPDTANQRCMKDCYKGTPFV
                     VEKAASIGNVSVGKVKAKDTQ"
     gene            complement(629551..630921)
                     /locus_tag="HNEAP_RS02970"
                     /old_locus_tag="Hneap_0587"
     CDS             complement(629551..630921)
                     /locus_tag="HNEAP_RS02970"
                     /old_locus_tag="Hneap_0587"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019557310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite dehydrogenase"
                     /protein_id="WP_012823476.1"
                     /translation="MSENMINTVPEGTKKAGEASSDRRKFLRKSVALAAGGAAIAATS
                     AANAGDGLKTWTTPLKNEPTRHMLGRGVVSVPYGLPSKYESGVVRRNVGWLTADTIAS
                     ISFTPWQDLHGIITPNGLHFERYHAGAVDVDPSKHHLVVHGMVKQPMIFTVDDLKRLP
                     SHTAIHFLECPANGAMEWRGVQMDSMQFTHGMMSCSEWTGVKLTTLMEMVGVDPKATW
                     FYGEGTDGSALQRSVPMEGAVDQHGRPIPPEYTNHYRDAMVCYAQNGEALRPENGYPI
                     RLFIPGFEANISTKYLRRLMFVDKPLVTYQETKHYIEVLPNGMVRQYDLVNEANSVIN
                     YPCPDFKMNGKGTYEIRGIAWSGYGKIAHVDVSVDGGKNWKQANLVEPVLNKCVTKFT
                     LPFEWDGQEALIMSRATDETGYVQPTLKQLREVRGFNSIYHKNSIQVWKIEKTGEVKN
                     VQIENV"
     gene            631283..631774
                     /locus_tag="HNEAP_RS02975"
                     /old_locus_tag="Hneap_0588"
     CDS             631283..631774
                     /locus_tag="HNEAP_RS02975"
                     /old_locus_tag="Hneap_0588"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein MoaE"
                     /protein_id="WP_012823477.1"
                     /translation="MKISVQTEDFDVNSVLAELRGRCAHVGAVACFLGTVRDMNDARD
                     VAVLTLEHYPGMTERALERVATEAKSRWPVAGVTIVHRYGALFPSDQIVLVAVASAHR
                     HDALDACAFMMDYLKTHAPFWKKETDSSGATCWVDARESDAVARARWFADFDPPAVEP
                     LVE"
     gene            631803..633038
                     /locus_tag="HNEAP_RS02980"
                     /old_locus_tag="Hneap_0589"
     CDS             631803..633038
                     /locus_tag="HNEAP_RS02980"
                     /old_locus_tag="Hneap_0589"
                     /inference="COORDINATES: protein
                     motif:HMM:PF03453.15,HMM:PF03454.13"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441093.1"
                     /translation="MSVFPVRGLILQAIDRTQRQLIEQLAPITESELIPLETALGRFL
                     AEDVYAEQDVPASDISLFDGYALSAPSACGSSRQVAGVTYAGDAPAVLPEGDFVWRIF
                     TGAPLPDGANAVIAQESVTSSDGRAVILHESMSVGAGVRPKGADSRRGQRVLCAGTRL
                     DAAELGLLASIGCAQILVVRKPRVAIFTTGNELVAPGEPLEPGKIYNSNHIILVSALT
                     RLGVEIVDLGVLPDEASAIRTALLAAAKHVDLVLTSGGVSVGDADLVRQVVSEIGTIE
                     SWRVFLKPGKPLAFGRIGSVPFIGLPGNPVSTFVTFFLFVRPALRALAGGDPQIDRPP
                     LNLPLAQDWVAGDRPEFIRVRRERAASGETRLQPFGDQNSGLLSSIAWADGVALIPAD
                     RTLMCGDMVDYFPFEGWYL"
     gene            633026..633514
                     /locus_tag="HNEAP_RS02985"
                     /old_locus_tag="Hneap_0590"
     CDS             633026..633514
                     /locus_tag="HNEAP_RS02985"
                     /old_locus_tag="Hneap_0590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic pyranopterin monophosphate synthase MoaC"
                     /protein_id="WP_041600342.1"
                     /translation="MVSVSNQQLTHIDETGAARMVDVGEKPHTERVALAESFIRMQPA
                     TLALILSGGHKKGDVLAVARVAGIMAAKKTWDLIPMCHPLLLTKVAVTLTPDEQNHGI
                     HILAECRLSGQTGVEMEALTAASVAALTLYDMCKAVDRGMVIEYTRLLEKHGGKTGSW
                     VR"
     gene            634043..635029
                     /locus_tag="HNEAP_RS02990"
                     /old_locus_tag="Hneap_0591"
     CDS             634043..635029
                     /locus_tag="HNEAP_RS02990"
                     /old_locus_tag="Hneap_0591"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018954156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP 3',8-cyclase MoaA"
                     /protein_id="WP_012823480.1"
                     /translation="MSNLVDPFGRTIDYLRLSVTDRCDLRCFYCMPEGFNDFEVPEHW
                     LTADEIERLLGVMAEMGLRRVRITGGEPLVRRGIEDIVRRIDALPGIRDIALSTNATR
                     LGKMAAPLKAAGVDRINVSLDTLDADRFKQITQGKLSKVIDGLMAAKDAGLSPIKLNM
                     VVMKGVNEDDVESVLEFCIEHGFVLRMIETMPMGDTGRDALDHYISLQTIKQRLSERY
                     PLIPVINPVDGAGPARYLQIAGTDTQVGFITPMSEHFCGTCNRVRLSVDGTMYMCLGQ
                     EHNFSFRPLLRNGIPDDELKEAIISAIGLKPERHEFQDKPEKVIRFMSMTGG"
     gene            complement(635192..636610)
                     /locus_tag="HNEAP_RS02995"
                     /old_locus_tag="Hneap_0592"
     CDS             complement(635192..636610)
                     /locus_tag="HNEAP_RS02995"
                     /old_locus_tag="Hneap_0592"
                     /EC_number="1.3.3.4"
                     /inference="COORDINATES: protein motif:HMM:TIGR00562"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="WP_012823481.1"
                     /translation="MNTHSNASEPINCPYLVIGGGISGLATAYHLSRMGKTVTVLEAT
                     SRVGGAVGSIEEDGWLRELGPNSLVQTPEMAALMSALDLVSEIIEANTVAKKRFVAKN
                     GHPVALPGSPLELLTSPLFSMGDLWHLAREAWIKPVNKEETIAEFVRRRLGQGFLDWA
                     VDPFVSGVYAGDPNRLSVQAAIPKIYAFEQESGSLIRGGIAKMKAAKANPAPVTLPAK
                     GKLFSFKRGLQTLTDALATAITSSGRGNIQLDSAITNIQRLPEGGWSVKTVQGKTFHT
                     RQLILSTPAHVSAQLLGEVDGPLAETLAAIEYPPVTSVVMGFDRSEVAHPLDGFGLLL
                     PSKEKKRTLGVLFSSTLFPDRTPAGKVLLSAFIGGRKHPEAAQGDDQELLDRVLGDLS
                     PLLGIKGKPEFLRVKRWQQAIPQYEIGYLELQEKISQRLTALPGLSLNGNWRGGIAVG
                     DCLNNGNKLAERLIENTRTEES"
     gene            636735..637685
                     /locus_tag="HNEAP_RS03000"
                     /old_locus_tag="Hneap_0593"
     CDS             636735..637685
                     /locus_tag="HNEAP_RS03000"
                     /old_locus_tag="Hneap_0593"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019021574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase"
                     /protein_id="WP_012823482.1"
                     /translation="MTTIANRDQSKEVVILGGTGFVGRVLASLLSQQGYSVTIPTRHA
                     ARHRDMALMRGVRLIGGTPAAADMANDRREENWQEVLSEGSILINLIGILNEPRHNGE
                     GFEQAHVHTTQVALKAAAKAGVKRYLHMSALGADANNGGSFYLRSKGKAEDWAHEFGE
                     QQGIAVTSFRPSVIFGPQDSFLNRFAQLARLIPGVFPLACADSRFAPVYVGDVADQFM
                     AAMTDTSTIGKRIDLCGPTEYRLRELVAYAAKTSGHPRLVIGLPDWAARLQARVLEWV
                     PGQPFTRDNYDSLQTPSVCAEGCPHQTTRLERIAPGYLGK"
     gene            637943..638485
                     /locus_tag="HNEAP_RS03005"
                     /old_locus_tag="Hneap_0594"
     CDS             637943..638485
                     /locus_tag="HNEAP_RS03005"
                     /old_locus_tag="Hneap_0594"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012823483.1"
                     /translation="MSNDSVAKPRGAVKHFESGFEHFLFASRWLMAPIYLGLVVAMGV
                     LLMKFGKEIWHLVTHVTSMDEGQVIVGVLTLVDVSLLMNLLIIIMFSGYENFVSKMED
                     LHAHADRPDWMGSIGFSDLKIKLIGSMVAISGIELLKAFMNVDILTDRHLAWLVGIHV
                     TFLLSGLIFAIMEKLQGGEH"
     gene            638544..639821
                     /locus_tag="HNEAP_RS03010"
                     /old_locus_tag="Hneap_0595"
     CDS             638544..639821
                     /locus_tag="HNEAP_RS03010"
                     /old_locus_tag="Hneap_0595"
                     /inference="COORDINATES: protein motif:HMM:PF02308.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012823484.1"
                     /translation="MTLNDPLMLLQSLGVALGIGLLIGLERGWHERSAEDGRRIAGVR
                     TFGLIGLTGGLAGILSTHFGVWVLVAALLGLSAILVASYWAANRQDNGVGITTEVASL
                     LTFILGAAAVAGYTYTAVVSAVVITILLGMKAILHRGLLKLSEAELFAIFKLLLIALV
                     ILPVLPNGDFGPWDALNPFVIGWMILLLAGLSFIGYFAMRILGPQRGLLLTSVFGGLV
                     SSTALTLVFSRLARNGSGVTAVLSIGIVIASVTLFPRVVIEVGLVNQALAIKLIPALG
                     GMLLVGLGGVLLWWRYGIRQQNKGMDVEPVLKNPLELTAALRFGLLLVTIMVFARAMQ
                     QVAGDAGIYVLAAISGLADVDALSLSLAKMAADAQVAPSVATQAIVLAILVNTTVKAA
                     LAYVIGGKVLGLRVASVLLPAVAVGGLLTLFSF"
     gene            complement(639959..641236)
                     /locus_tag="HNEAP_RS03015"
                     /old_locus_tag="Hneap_0596"
     CDS             complement(639959..641236)
                     /locus_tag="HNEAP_RS03015"
                     /old_locus_tag="Hneap_0596"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013722203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="WP_012823485.1"
                     /translation="MAHIVILGAGIGGMPAAYEVRQELGKEHKVTVVTADTYFQFIPS
                     NPWVAVGWRNRDDITFPLAPYLERKGIDLISQRVDKIVPTENRLELANGETVTYDYLI
                     ITTGAKLMFSAIEGSGPHGGYTQSICTVDHAEHCYENFKQLLDKPGPVIVGAMPGASC
                     YGPAYEYVFILDTALRKKKIRNKVPITFVTAEPYIGHLGLGGVGDSNGMLESELRAHD
                     IKWITNAKTTKVEDGKMFVDELDRNGEVIKQHELPFNHSMMLPSFAGVDCVAGVTEMC
                     NPKGFVKIDEYQRNPEYKNIFAAGVCVAIPPVEPTPVPVGAPKTGYMIESMVTAIVHN
                     IKAELTGHGEPDSKGTWQAICLADFGDRGAAFIALPQIPPRNVNWFAAGKWVHLAKIA
                     FEKYFIRKMKKGTSEPLYEKYMMRAIGINRLEK"
     gene            641228..641461
                     /locus_tag="HNEAP_RS03020"
     CDS             641228..641461
                     /locus_tag="HNEAP_RS03020"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600343.1"
                     /translation="MCHGANSFGGALGQSPRPNCQLLQYRGGYWTGNGVSIGCPAFLL
                     FISFERIANQTIVDSCAIASGWQENSGQFFNTT"
     gene            complement(641526..642506)
                     /locus_tag="HNEAP_RS03025"
                     /old_locus_tag="Hneap_0597"
     CDS             complement(641526..642506)
                     /locus_tag="HNEAP_RS03025"
                     /old_locus_tag="Hneap_0597"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011574378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3 N(5)-glutamine
                     methyltransferase"
                     /protein_id="WP_012823486.1"
                     /translation="MTAPQHSEPAGRHAQTDPLYPLIEDTRQLVTILDLVRWATSRMD
                     EQKVFLGHGTQQYWDEAAWLVLDSLHLPLDLDAMHWSAKLTPGEITLVTGLIRRRCLE
                     HIPTAYLLNRAWFMGQPYYVDERVLIPRSPFAELIAQHFEPWYGTDTPPASILDIGTG
                     SGCLAIALAQYFPEAMISACDISMDALSIAARNVRDYQLEDRVELYQSDLLDNLKDET
                     DAPLRFDLIISNPPYVDPAEAEDMPEEYHHEPAMALYAPNQGLALVERMLDTAGEHLS
                     PDGYLFVEVGNGRRLIDQTWPQHRLSWIEMHNQEAALFTIACSDLANWRG"
     gene            642601..643512
                     /locus_tag="HNEAP_RS03030"
                     /old_locus_tag="Hneap_0598"
     CDS             642601..643512
                     /locus_tag="HNEAP_RS03030"
                     /old_locus_tag="Hneap_0598"
                     /EC_number="4.1.1.65"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine decarboxylase"
                     /protein_id="WP_012823487.1"
                     /translation="MTDLNAPPDENKPVSPTFAQSLWTLVQYLLPHHLISRLVFRATR
                     WRTPFTTGVIRWFVRRFGVDLSEAVEPDPAAYATFNQFFTRALKPGIRPMPDDAAAWV
                     SPCDGRVSQLGAIQSGNLLQAKGRDYTVQSLLGGDASLAQRFEQGQFATIYLSPRDYH
                     RIHMPCDGELREMIHVPGRLFSVSPVTVQQVPEIFARNERLVCLFDTAHGPMALVLVG
                     AINVAAIETVWAGIVTPPAGVEVNRWLYGGDTGINISLSRGQEMGRFNMGSTVILLLP
                     EGLALDSRWQPQSVIQLGERLASPQAD"
     gene            643647..645275
                     /locus_tag="HNEAP_RS03035"
                     /old_locus_tag="Hneap_0599"
     CDS             643647..645275
                     /locus_tag="HNEAP_RS03035"
                     /old_locus_tag="Hneap_0599"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823488.1"
                     /translation="MTQSTDLHGLLDQLLMREPLDAVRLLGEEFVNINWQDRDESEIS
                     VIVADFLPFLTRLAGRIRTDLRQSPLPLSDKGRLRIDALLRVYRYAQLMLNLKLNSLT
                     ERVDNDFGSEYLVRAHQERVDWTIRIIMDCYLSYVDVPKSLYVDLHQLVDLARGELQE
                     AHPVGWQSIYQCYVAILTLAVINPYGLTREEMEDSCACLIQVGSAIKLVHDEPTPTSR
                     FIDLTGKIMPHLALRTRTNLTEAGFFLDLGGLYQPEMTAGLSPVCRSQLYHLLDHLKF
                     FFVGRGDRETKSTLPEQSKQHTSLITLGFLSVHHRLERLSQNESHQESTIALAGLDWE
                     GLDQPIRGKVASISGVADFKMDIQTGNSKGQVDWDADVGTGQISNRHHQPMNEPGTWD
                     VVNFSASGFRFHWRLSSNSHAAVDDLLLAEWPEQDKTGSAMAIGIVRWVRHMDAEHKT
                     IDMGVQRFSGTVFASYARDYRAGETRWSKSWPVIVQLDEHAVPIRIILSTALAVEAQE
                     LLVMQEEAEIRLRLGSVCQTGQDFLMMEACRVDA"
     gene            645268..647349
                     /locus_tag="HNEAP_RS03040"
                     /old_locus_tag="Hneap_0600"
     CDS             645268..647349
                     /locus_tag="HNEAP_RS03040"
                     /old_locus_tag="Hneap_0600"
                     /inference="COORDINATES: protein motif:HMM:TIGR00254"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_012823489.1"
                     /translation="MRDVAKQRAFAVLYLSNEINDAVTLRSQLRNHGFAANVLHATSF
                     EEALTQAGKNTLDVVLVDFGSHSGSVLDTMLEDNHRPVFDRLPKLVIADVDDDDQVLP
                     LYELGATAVVTHESRLIPVLVREVAASMTEQERTLFQKKLASAEGRCQKLIDGSGEAL
                     AYIQDGLHIYANHAYLSLMGFNELEELIDEPLLDRAVGDSAARLKSFLKEDEASDEFE
                     LETEGGDRIKVIISSSKATFDGEACLQLFVAPKQQNSAEIEEQLEFLSRRDLLTGLYN
                     RNYFFDQLHERIDLIKQSENEQGVLMMLDITNSEALKKMIGTTGVDSLLTEYGKEVEA
                     LVGGKGLVARHGAYSFLALLGKTDLPHAEQVVNSLLGYTKDYIFTLGTTSVTINISIG
                     YTLLDINAPANVMELVDRAERATNKASEQGVNLAEFYKPDLKTASDAEQEEIWARRIK
                     DALKENRFFLAFQPIVSLQGHRDLNRFEVFLRMIDEQGNPLKPMEFLGKAERGDLMQS
                     IDRWVILSAIKEVHAGLKRAENIKLYLRISEQSLRDEEFAQWLMNRLASVRLPDLLLV
                     IQVRADTAGYLLKHLENLRDTIAPLGCGLLIDGFGEGADSYRLLDHLKTKEIKISRAL
                     LENFSQEAAHQTAVTKLLNEANARDVSVIVPNVEDPATLQLLWPMGVDLVQGDFIQSP
                     RKGLEFDFSQF"
     gene            647365..647769
                     /locus_tag="HNEAP_RS03045"
                     /old_locus_tag="Hneap_0601"
     CDS             647365..647769
                     /locus_tag="HNEAP_RS03045"
                     /old_locus_tag="Hneap_0601"
                     /inference="COORDINATES: protein motif:HMM:TIGR00526"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="WP_012823490.1"
                     /translation="MSAKLSTADDWDWIVIDQLEFDAIIGIYPHEREQVQPLRVDLRL
                     GVEPIHAAVQSDDISTTVDYQRVCETVMALAQSGQFNLVETLAQRCADALFAAFPIQA
                     IQLSVSKPLALPYTRGVGVEIFRRRPVVEFEL"
     gene            647796..648992
                     /locus_tag="HNEAP_RS03050"
                     /old_locus_tag="Hneap_0602"
     CDS             647796..648992
                     /locus_tag="HNEAP_RS03050"
                     /old_locus_tag="Hneap_0602"
                     /inference="COORDINATES: protein motif:HMM:PF02636.15"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_012823491.1"
                     /translation="MMPEPDFSLPVPSSEDQIKSMTLIEHLQGRMIDEPLSFSDYMAE
                     VLYHPDYGYYGSAQVQFGAGGDFVTAPERSPFFAAGLVYEWQQIQRDSPVRQVCELGA
                     GSGQLALDFLRTCDTRGCMPDQYLIWEISPGLRKRQQTRLKDELKPELWSRLTWVEDR
                     EAKDLADIWAGGMVIANEVVDAMPACRFRWRPGQLDTLEELKVGWVGKRFGWVADTAS
                     PELRAALADCAGLWPLDDLAPEPVAAEINLDLSRWLASIRTLFGHPEAASILYLFDYG
                     GHTAEVYRPDRVDGTLRCHYRHRAHDDPFVYPGLQDITTWVDFERLARLAREGGFVVD
                     GERSQAAWLLGTDVPDSFSRQMQAVTDRSASARIAQGFKELVMPTEMGERFRVLRLRT
                     PEPSLR"
     gene            649140..649949
                     /locus_tag="HNEAP_RS03055"
                     /old_locus_tag="Hneap_0604"
     CDS             649140..649949
                     /locus_tag="HNEAP_RS03055"
                     /old_locus_tag="Hneap_0604"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823493.1"
                     /translation="MNLFDSHCHLDKLDLTPFDDSFDQFMMAAFEAGVRRMLCVAIHP
                     DRWSDMAELVAPYAHPCEDRPQVWLSFGIHPTEDPDYDLEAEAIVAYARASPYSGQIV
                     AIGETGLDYFRSGEAERWQHERFRAHIAAALELKKPVIIHTRAAAKDTIDVLRSENAR
                     DCGGVMHCFVEDWDTAKKALDLGFYISFSGILTYKSAADLRETAKKVPQDRILIETDA
                     PYLAPAPHRGKPNTPIYVTHTAQTLADVRGETLSTVAEYTDANTRRWLNLP"
     gene            649968..650939
                     /locus_tag="HNEAP_RS03060"
                     /old_locus_tag="Hneap_0605"
     CDS             649968..650939
                     /locus_tag="HNEAP_RS03060"
                     /old_locus_tag="Hneap_0605"
                     /EC_number="2.7.4.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012655412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate kinase"
                     /protein_id="WP_012823494.1"
                     /translation="MNEFELIARYFSRPCADASVVLGVGDDCAALRVPEGEHLLVSTD
                     LLVEGRHFPESTAAFDVGYKAMAVNLSDLAAMGARPLGVTLGLALPSIEPDWLEAFAK
                     GFYTLAEQHGICLVGGDTVKSPVLSLAVTIMGSAPPDRMLTRSGAQSGDLIAVTGTLG
                     DAGLGLRSIQRPESMPPSLNPEDIDFLQMRLNRPTPRGEEGRRLAEVAHAAIDISDGL
                     LQDLGHILRASHVGAVVEADRLPISPAARAWLAADPTQHNLPLTAGDDYELLFTIAPD
                     QWAMLDVPATVIGRITQDKRLRVLDAQGHDMPVHVQGFDHFAPVNLD"
     gene            650943..651485
                     /locus_tag="HNEAP_RS03065"
                     /old_locus_tag="Hneap_0606"
     CDS             650943..651485
                     /locus_tag="HNEAP_RS03065"
                     /old_locus_tag="Hneap_0606"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylglycerophosphatase A"
                     /protein_id="WP_012823495.1"
                     /translation="MSSHQKNPPIPHLARRVWRDPVLWLAFGFGSGLAPKAPGTFGTL
                     PGIALACGIGVLATSLAVPAGYLMAAAVLLLTPIGVFLCGRASEKLGVHDHGGIVFDE
                     IVGVLIPFILIPVTPLNLLWGFVAFRVFDVLKPWPISWLDRRVSGGLGIMVDDLLAGI
                     FALAALLILSRIFPAAFFAG"
     gene            651557..652030
                     /locus_tag="HNEAP_RS03070"
     CDS             651557..652030
                     /locus_tag="HNEAP_RS03070"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823496.1"
                     /translation="MNMRRLYSLVIAGALISTPMVWAAGPTASEEPAIKSLTPAEVAS
                     GALTPQVQGGVHFVSGGFGVEERAWLAAHAREFNTHLTFAVVPGGEFVADVPVRISDA
                     KGASILEATSDGPQMFVQLPVGKYQVEATHDGQAIKRSFTVANARSVQITIGFKK"
     gene            complement(652259..652585)
                     /locus_tag="HNEAP_RS03075"
                     /old_locus_tag="Hneap_0608"
     CDS             complement(652259..652585)
                     /locus_tag="HNEAP_RS03075"
                     /old_locus_tag="Hneap_0608"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823497.1"
                     /translation="MKKAQKIATAVTAATLFVGISAANAANMADYEKAKTAAMAEVKK
                     VEAEGIAPWNPKAKKPILDHSDQLAKKGDFEGAIKYANYIASLQPIAVKEWKSQPNPG
                     PYKPSR"
     gene            652749..654206
                     /locus_tag="HNEAP_RS03080"
                     /old_locus_tag="Hneap_0609"
     CDS             652749..654206
                     /locus_tag="HNEAP_RS03080"
                     /old_locus_tag="Hneap_0609"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020146386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IMP dehydrogenase"
                     /protein_id="WP_041600636.1"
                     /translation="MRIVDEGLTFDDVLLVPAHSTVLPREVSLKTQLTRNVWLNVPLV
                     SAAMDTVTEARLAIALAQEGGIGIIHKNMSVAMQADHVRQVKKYESGVIKDPITVPPD
                     MSIRDVLKITRDHRISGVPVVDGMDLVGIVTSRDLRFERNLDQPVSKIMTQQDNLVTV
                     KEGASREEVQALLHKFRIEKVLVVNDRFELRGMITVKDIQKSTDYPNASKDSQGRLLA
                     GAAVGTGGDTEERVAALVAAGVDVLVVDTAHGHSQGVLDRVAWVKKTYPHVDVIGGNI
                     ATGAAALDLVAAGADAVKVGIGPGSICTTRIIAGVGVPQITAVSNVAEALKGTGVPLI
                     ADGGIRYSGDFAKAIAAGAHTVMVGSMLAGTEEAPGEVELFQGRSYKSYRGMGSLGAM
                     QQGSSDRYFQGESAVEKLVPEGIEGRVPYKGSLVAIVHQMLGGLRSSMGYVGARDITT
                     MRTVPQFVRITSAGIRESHVHDVAITKESPNYRID"
     gene            654431..656017
                     /locus_tag="HNEAP_RS03085"
                     /old_locus_tag="Hneap_0610"
     CDS             654431..656017
                     /locus_tag="HNEAP_RS03085"
                     /old_locus_tag="Hneap_0610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase (glutamine-hydrolyzing)"
                     /protein_id="WP_012823499.1"
                     /translation="MTSHAADIHAERILILDFGSQYTQLIARRVRECGVYCEIHSWEV
                     DDAFVRSFTPQGIILSGGPESVIEATPPAAPQAVFELGVPVLGICYGMQTMAAQLGGV
                     VENADHREFGYASVRARGHTALLKDIEDSVTPEGFGMLDVWMSHGDHVIELPTGFKLM
                     ASTDNAPIAGMADETRRFYGVQFHPEVTHTRQGHRILERFVRQICQTHGLWKPDNIID
                     DMLARIRDQIGGDEVILGLSGGVDSSVVAALLHKAIGDQLTCIFVDNGLLRLNEGDQV
                     MSTFAQHMGVRVIRVDAEARFLAALEGVADPEDKRKIIGGIFVEIFEEQANLHKNAAW
                     LAQGTIYPDVIESAGSKTGKAHVIKSHHNVGGLPAHMRLKLLEPLRELFKDEVRKIGV
                     ELGLPSEMVYRHPFPGPGLGVRILGEVKKHYADLLRRADAIFIEELRAADLYDKVSQA
                     FVVFLPVKSVGVMGDGRKYDYVVAMRAVETIDFMTARWAHLPYEFLERVSLRIVNEIN
                     GISRVVYDVTGKPPGTIEWE"
     gene            complement(656235..656378)
                     /locus_tag="HNEAP_RS12470"
                     /old_locus_tag="Hneap_0611"
     CDS             complement(656235..656378)
                     /locus_tag="HNEAP_RS12470"
                     /old_locus_tag="Hneap_0611"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3096 domain-containing protein"
                     /protein_id="WP_012823500.1"
                     /translation="MNIHITLAPLISLAAGIAILIFPKLLNYIVAIYLIVLGVLGLLG
                     HGF"
     gene            656645..657106
                     /locus_tag="HNEAP_RS03090"
                     /old_locus_tag="Hneap_0612"
     CDS             656645..657106
                     /locus_tag="HNEAP_RS03090"
                     /old_locus_tag="Hneap_0612"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-specific adenosine deaminase"
                     /protein_id="WP_012823501.1"
                     /translation="MKLPSSVDRQFIQQALDEANLAAADGEVPVGAVVVRQGKVIATG
                     RNAPIRLNDPSAHAEILALRAAGMALANYRLDDCTLYVTLEPCPMCMAAISHARIARV
                     VFAAPDPRAGACGGAIDLNRAPWHHHSVVVDTGPCEQEAAELLRHFFQEKR"
     gene            657394..658848
                     /locus_tag="HNEAP_RS03095"
                     /old_locus_tag="Hneap_0613"
     CDS             657394..658848
                     /locus_tag="HNEAP_RS03095"
                     /old_locus_tag="Hneap_0613"
                     /EC_number="2.1.1.72"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010641654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification protein subunit
                     M"
                     /protein_id="WP_012823502.1"
                     /translation="MFEQAFRNIDNVLWKEAGCTTELDYTEQTSWLLFLKYLDSLERD
                     KAIEAQLEGKTYTPILDEAYRWDAWAAPKDATGVIDPNAAMTGDDLRDFVDRKLFPYL
                     HGFKQRAAGPNTLEYKIGEIFGEIKNKIHSGYNLREIIDHIDELRFGSQIEKHELSHL
                     YEAKIKNMGNAGRNGGEYYTPRPLIRAMVRVVAPQIGERIYDGAVGSAGFLCEAFDYL
                     KSQPNRTTADIKTLQERTFYGKEKKSLAYVIAIMNMILHGIEAPNIVHTNTLAENLAD
                     VQDKDRFDIILANPPFGGKERKEVQQNFPIRTGETAFLFLQHFIKLLKAGGRAAVVIK
                     NTFLSNTDNASVSLRKLLLESCNLHTVLDMPGGTFLGAGVKTVVLFFEKGAPTRQVWY
                     YQLDPGRNMGKTNPLNDADLAEFIELQKTFADSPKSWRVDAATLDTTTYDLSVKNPNG
                     QEEIIHRSPQEIMDEIAALDMESTDVLAKIRALL"
     gene            658845..660050
                     /locus_tag="HNEAP_RS12170"
                     /old_locus_tag="Hneap_0614"
     CDS             658845..660050
                     /locus_tag="HNEAP_RS12170"
                     /old_locus_tag="Hneap_0614"
                     /inference="COORDINATES: protein motif:HMM:PF01420.17"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction modification system DNA specificity
                     domain-containing protein"
                     /protein_id="WP_012823503.1"
                     /translation="MKGKVVPLKDLFQIGSSKRVLKSQWKAEGVPFYRGREVTRLAMD
                     GFVDNELFISEAHYAELANQYGAPRTDDIVITAIGTIGNSYIVQDGDRFYFKDASILW
                     MKRISDVSSKFVNFWLKSTMFLDQLDHGNGATVDTLTIQKLQSVQIWVPPIAEQHRIV
                     SILDEAFEGIAKARAHAEQNRQNARALFESHLQSVFTQRGEGWAEKSLEEVVDAQCTL
                     SYGIVQPGHEYAKGMPIVRPTDLTAKLITLNGLKRIDPKLADGYRRTTLRGGELLLCV
                     RGSTGVLAVTSSELAGANVTRGIVPIMFDPSLLSQDFGYFLMTSEAVQSQIRIKTYGT
                     ALMQINIGDLRKIAVSFPPLKEQERMTAQLEELSAETQRLESIYQQKLAALDELKKSL
                     LHQAFSGSL"
     gene            660063..661481
                     /locus_tag="HNEAP_RS03110"
                     /old_locus_tag="Hneap_0615"
     CDS             660063..661481
                     /locus_tag="HNEAP_RS03110"
                     /old_locus_tag="Hneap_0615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002747775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823504.1"
                     /translation="MITLDTLTRWLSAPTESEHLEFKEAKLQFDTTKLLRYCVALANE
                     GGGHLVLGVSDRLPRRVVGSQAFAVTSNLNDIKARIVDKLHIRVDAVELAHPEGRVLV
                     FDIPTRPVGQPLAFDGAYLMRAGEDLVPMTPDQLRRIFAEGQPDWFSQLARQDASADE
                     VIALLDTQAYFELLQLPYPTNREGVLARLSGEELITQTASGWNISNLAAILLAKKLDA
                     FSLTLARKAPRVVFYEGTDKTQTREDKPGNRGYAVGFENLVDFVHSAAPQNRSIEQVV
                     REEVKMFPKQALRELIANALVHQDFHASGASVMIEMFSDRIEISNPGTPPIKVERFID
                     EYRSRNEHLADLMRRLGICEEKGSGVDKVVKAAEAFQLPAPDFRVGELRTTAVLFAHQ
                     DFSAMSKSDRLRACYQHCCLMYVSNQRMSNQSLRARFGVSESKAATVSLVIGAAKEAG
                     LIKTDESDTSSTRYARYLPFWA"
     gene            661782..664133
                     /locus_tag="HNEAP_RS03115"
                     /old_locus_tag="Hneap_0616"
     CDS             661782..664133
                     /locus_tag="HNEAP_RS03115"
                     /old_locus_tag="Hneap_0616"
                     /EC_number="3.1.21.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit R"
                     /protein_id="WP_012823505.1"
                     /translation="MNEAETRAEHIDPALAAAGWGVVAGSRIRREYPITLGRIEGAGK
                     RGKALTADYVLEYRNTKLAVVEAKAWNKPLTEGVGQAKDYSGKLAIRFAYATNGQGIY
                     GIDMESGVEAELANYPSPDELWARTFASQNIWRDRFAEVPFEDRGGYFQSRYYQDIAI
                     ERVLAAIADHQSRILLTLATGTGKTFIAFQLAWKLFHSRWNLRDWQREAEPSRRPRIL
                     FLADRNILANQAFNAFSAFPEDALVRIDPADIRKQGRVPKNGSLFFTIFQTFMSGQDA
                     EGQPAPYFGDYPPDFFDCIIIDECHRGGANDESNWRGILAYFAPAVQLGLTATPKRKD
                     NVDTYQYFGEPVFVYSLKDGINDGFLTPFRVKQIATTLDEYVYTPDDTLVEGEIEAGK
                     RYEEADFNKIIEIKEREQKRVEIFMAQIDQREKTIVFCATQEHALAVRDLINQIKSSS
                     NPDYCQRVTANDGARGEHYLRDFQDNEKTIPTILTTSQKLSTGVDARNVRNIVLMRPV
                     NSMIEFKQIIGRGTRLYDGKDYFTIYDFVKAHHHFNDPEWDGEPLEPEPTDPRPPQPP
                     SEPTPPDGVREPSSSYERKPKVKVQLSDGKARTIQHMMSTSFWHPDGTPMSAQQFMES
                     LFGRLPEFFKDEDELRALWSDPETRKRLLEGLAEKGFGTDQLREMQKIIDAQNSDLFD
                     VLAYVAYAQTPLSREDRADRAMALISSHFNSKQQVFLDFVLSQYISVGVEELDKTKLG
                     SLLRLKYHDSINDAIADLGKPDEIGQMFSGFQKFLYQPVQAKV"
     gene            complement(664507..664583)
                     /locus_tag="HNEAP_RS03120"
                     /old_locus_tag="Hneap_R0023"
     tRNA            complement(664507..664583)
                     /locus_tag="HNEAP_RS03120"
                     /old_locus_tag="Hneap_R0023"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(664547..664549),aa:Arg,seq:cct)
     gene            complement(664629..664817)
                     /locus_tag="HNEAP_RS12475"
                     /old_locus_tag="Hneap_0617"
     CDS             complement(664629..664817)
                     /locus_tag="HNEAP_RS12475"
                     /old_locus_tag="Hneap_0617"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPXCG motif-containing cysteine-rich protein"
                     /protein_id="WP_012823506.1"
                     /translation="MDLQPEVSVQCPYCWETIDLLLDASAGTQEYIEDCSVCCRPIIV
                     HVSFLYDEPEVWVEPEMD"
     gene            complement(664969..666234)
                     /locus_tag="HNEAP_RS03130"
                     /old_locus_tag="Hneap_0618"
     CDS             complement(664969..666234)
                     /locus_tag="HNEAP_RS03130"
                     /old_locus_tag="Hneap_0618"
                     /EC_number="1.1.1.42"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate dehydrogenase (NADP(+))"
                     /protein_id="WP_012823507.1"
                     /translation="MTNSASQHIKIPQGERIVAHPDGSITVPNTPIIPFIEGDGIGVD
                     ITPVMKKVIDAAVAKAYGDTKKIAWMEVYAGEKATTVYADDKSGLPAETMAAVRDYVV
                     SIKGPLTTPVGGGIRSLNVALRQQLDLYVCLRPVRYFTGTPSPLKHPEKTEMVIFREN
                     SEDIYAGIEWAAGTPEVKKVIDFLQNEMGVTKIRFPESSGIGIKPVSREGTERLVRKA
                     MEYVIDNDRSSLTLVHKGNIMKFTEGGFKQWGYDLVKKEFGAAEIGGGWYQCTNPKTG
                     RKITIKDGIADAFLQQILLKPEDYDVIATLNLNGDYISDALAAQVGGIGIAPGANMSD
                     SIAMFEATHGTAPDIAGKNLANPASLILSAEMMLRHMGWIEAADLVIKGVEGAIANKR
                     VTGDFARLMDDATQIGSDAFGDEMIKYMN"
     gene            666614..666904
                     /locus_tag="HNEAP_RS03135"
                     /old_locus_tag="Hneap_0619"
     CDS             666614..666904
                     /locus_tag="HNEAP_RS03135"
                     /old_locus_tag="Hneap_0619"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="WP_012823508.1"
                     /translation="MKIRPLHDRVLIKRVEEERKTAFGIVLPDSAAEKPNRGEVVAAG
                     PGKSNDKGEVRPMGVKTGDQVLFNQYAGTKVKVDGEELLMMGEDDLLAVIEG"
     gene            666956..668590
                     /locus_tag="HNEAP_RS03140"
                     /old_locus_tag="Hneap_0620"
     CDS             666956..668590
                     /locus_tag="HNEAP_RS03140"
                     /old_locus_tag="Hneap_0620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006786400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_012823509.1"
                     /translation="MAAKEVRFSSSARDRMLRGVNVLADAVKVTLGPKGRNVVIEKSF
                     GAPHVTKDGVTVAREIELEDKFENMGAQMVKEVTSQTADIAGDGTTTATVLAAAIVRE
                     GVKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSRPCSDNKEIAQVATISANADESIGK
                     IIAEAMAKVGKDGVITVEEGSGFENELDVVEGMQFDRGYLSPYFVNNQKTMSAELEDP
                     FILLHDKKITNIRELLPALEGAAKAGKPLLIVAEDIEGEALATLVINSMRGIVKVAAV
                     KAPGFGDRRKAMLQDLAILTGGQVISDEVGLNLEKITLDDLGRAKRIVVSKENTTIIG
                     GAGDKADIDGRVTQIRAQMETTTSDYDKEKLQERIAKLAGGVAVIKVGAATEVEMKEK
                     KDRVDDALHATRAAVEEGVVPGGGVALIRALEAIRGMTGANTDQNTGIAIAMRAMEDP
                     LRQIVFNCGEEPSVVVNQVRSGSGNFGYDASNGTFGDMIEMGILDPTKVTRSALQNAA
                     SVAGLMITTECMIAELPKADAPAAPGGDMGGMGGMM"
     gene            complement(668711..671287)
                     /locus_tag="HNEAP_RS03145"
                     /old_locus_tag="Hneap_0621"
     CDS             complement(668711..671287)
                     /locus_tag="HNEAP_RS03145"
                     /old_locus_tag="Hneap_0621"
                     /EC_number="2.4.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucan phosphorylase"
                     /protein_id="WP_012823510.1"
                     /translation="MTAQIYALEITPRLPARIKRLDDLANNLYYSWTRSIRHLFSQID
                     PVCWQQTDDNPKLFLKRVSQAKMDAAITDPVFLADYDDACRHFDDYLAQPMPESIAKR
                     IQPNDLIAYFCAEYGFHESLPIYSGGLGILAGDHCKAASDIGIPFVAVGLLYRQGYFK
                     QTIDAQGNQIATYQDIDFTTLPIAPATDPKGNAVTIRLDFPGRVIEVKVWLAMIGRIR
                     LFLLDTDLPGNSTDDRQITYRLYGGDRRTRIEQEIVLGIGGVRALRALGLAPTAWHIN
                     EGHAAFQILERLREHVSSGETETVALEMVASTTVFTTHTPVPAGHDVFTDVLMAEYFS
                     SFWPQIKLDQESFLALGREPEGSGFNMTALALRGSRQHNGVSAIHGRVAAEMSRDFWP
                     EVPANENPITHVTNGVHVDTFLAREFSQLFSSLHRDWRWNLREKSYWNFIDDIPEDRF
                     WSVRCALKAELIREIRLRLSRQLSQDGLSDIRTERTLRYLDRPESDVLLVGFARRFAT
                     YKRANLIFRDRERLAKLLSDENRPIVFVFAGKAHPADEPGKGLIREIWQMANEPEFQG
                     RILLLEGYDMALARKLVTGCDVWLNNPEYPLEASGTSGQKAGLNGVLNLSVADGWWGE
                     GYQKQGQIANGWSIKPYNRSFNHDYCDTEEASDLLTLLESDVKPLFYQRDQNGLPNGW
                     IKYAKMAIRTILPQFNSARMVCDYLTQHYLPASVYGRRLRQNNGAEALSLEDFKRRVL
                     AAWPGVTGILISDVPAQIHSGDTLTLNVAVTLNGLNPEDIAVECLFGQDTPSGDWATV
                     ERFSTTVTATTTEHDASDGTQVYSFTLNIQLAGLQKFRFRIVPNHSAQLHPYELGLMK
                     WI"
     gene            671632..672495
                     /locus_tag="HNEAP_RS03150"
                     /old_locus_tag="Hneap_0622"
     CDS             671632..672495
                     /locus_tag="HNEAP_RS03150"
                     /old_locus_tag="Hneap_0622"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin"
                     /protein_id="WP_012823511.1"
                     /translation="MNVINTNILSLQTQNALRANGNAMQTAMQRLSTGLRINSAKDDA
                     AGLAISDRMTTQINGSNVAARNANDGISLAQTAEGAMGALTSTLQRMRDLAVQSANAT
                     NSTSDRQNLQTEFVQLQSELGRIIGNTQFNGKNVLQGGLSGSANAKFQVGANTGATNQ
                     IAFSINNQSARGTASGGIKSALANTVSIGSKATFTKIMSGISLIDKAITSIDTTRAKL
                     GAVQNRFQITIDNLNTFVVNQSQARSRILDTNFAAETSNLSKAQILQQAGNAMLTQAN
                     QAPQAVLSLLR"
     gene            672599..673006
                     /locus_tag="HNEAP_RS03155"
                     /old_locus_tag="Hneap_0623"
     CDS             672599..673006
                     /locus_tag="HNEAP_RS03155"
                     /old_locus_tag="Hneap_0623"
                     /inference="COORDINATES: protein motif:HMM:PF03646.13"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlaG"
                     /protein_id="WP_012823512.1"
                     /translation="MSAINNIVSSSIHPAVAGQDASSFSQASTPTSVVTLPADPRLQA
                     NASAGSANSRKPTKEEVNQVLEGLIKRQQGSPTSVQFSVDEKLDQVVIKVVDPTTQKV
                     IKQIPSEAIMKMREDMLAFESKSSTGLLLSEKT"
     gene            673053..674459
                     /locus_tag="HNEAP_RS03160"
                     /old_locus_tag="Hneap_0624"
     CDS             673053..674459
                     /locus_tag="HNEAP_RS03160"
                     /old_locus_tag="Hneap_0624"
                     /inference="COORDINATES: protein
                     motif:HMM:PF02465.16,HMM:PF07196.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated 2 domain-containing
                     protein"
                     /protein_id="WP_012823513.1"
                     /translation="MSTTVSTTSSTSPSGISFSGLGSGLDIQGIVTQLVNAEGAPQQQ
                     ILTNRQTAFNTTLSALGQLKSSLSSIQTAVDAFQNLDTFRTRTATVSNSSILSASAIP
                     GTALGTYQVEVDQLATAQKMASAGYASATSTVGSGTLNFTVGSGSFSVSVAATDTLTN
                     IRDNINAATGNTGVQASIINVDNGSGGTVSKLVMTALNTGTSNGFTVTAVDSDGNNTD
                     AVGLSALASNNLTQISAAQDSIIKIDGMQVTSASNSVSTAVTGLTLNLTQAQVGTSVA
                     VTVGTDNSPITTALQTLVTNYNKYQSTNASLTSYDQTANQAGALLGDVTATGVNNALR
                     SLMGQNYTTGSTTIQNLADIGIQVDKNGVMSLDTTKLNQALAADPNVVKTLLTDPTNG
                     VSAKVDSVLNPYLQYNGVFDSRTASINSQLKTITTQQADLQARLNQYQTSLMAQFTAM
                     DSYVAQMNQSMSFLSKLN"
     gene            674545..674991
                     /locus_tag="HNEAP_RS03165"
                     /old_locus_tag="Hneap_0625"
     CDS             674545..674991
                     /locus_tag="HNEAP_RS03165"
                     /old_locus_tag="Hneap_0625"
                     /inference="COORDINATES: protein motif:HMM:TIGR00208"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar export chaperone FliS"
                     /protein_id="WP_081441094.1"
                     /translation="MSYWSSNIMYAKAYAQNYRQIDLVAEVEQASPHRLVAMLFEGFL
                     THVAKAKVATQTMDYEAKARNVQLAMDILVGLKGGLSNDASPELAERLFELYDYCERR
                     LLDASARRDISGFEEVDMLIRQIKEAWDAIEPQVATGQAVKMAATA"
     gene            675015..675380
                     /locus_tag="HNEAP_RS03170"
                     /old_locus_tag="Hneap_0626"
     CDS             675015..675380
                     /locus_tag="HNEAP_RS03170"
                     /old_locus_tag="Hneap_0626"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823515.1"
                     /translation="MAAPLPSVLVDRLSLLQRLGSEVDAEAVLWLADRTGAHDETALN
                     SIAEARRMIELTVDMAMAADYAEHPMVLAMRDEWEQRFARIKIEMKDKYKSLADSLQQ
                     QAQQTRAVRAYMSTQGASF"
     gene            complement(675468..678083)
                     /locus_tag="HNEAP_RS03175"
                     /old_locus_tag="Hneap_0627"
     CDS             complement(675468..678083)
                     /locus_tag="HNEAP_RS03175"
                     /old_locus_tag="Hneap_0627"
                     /inference="COORDINATES: protein motif:HMM:PF01973.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823516.1"
                     /translation="MTETTLMPDASEFSPTGWDSDTQRPELVQTISGDWIFPTLNGLH
                     FSAQPNQPASAGTSLAQQVLSAHFKNRLHAQDRLYVIIGSDSGQLIRFVKEKTPLPRG
                     SRWIFIEPTALAEALRQTPAIASLLDDYVHLITPDEWTQTAELLLLNDYFRINGVAFD
                     RSLAALDHPTADYLELVDQFDAELTRRRYVTTANLGTAPFLTAQLANTPSFFANLVPL
                     KGIFKGKKALILAGGPSLDDQIEWIKTHRSQLFLIAVSRISARLLSAGINPDMIATVD
                     PYPVSLTVSRQMFDFGPETILIAGNHAYPGIVNRWPHRMLHTDLLLPWDEPPLAPDLQ
                     ADEQAKPINPTGNLVSVGPTVTHTCVMLATYLGFTQIAFAGLDLCHAPNGQTHAQGSS
                     EAAAGPLLDYTAVKVTTNTGQTAWTTPDYFAGIETLEGMAEHLAPLGVTLINPSPDAA
                     AIKGVVFKPLEQIDWSEEPFDRKPLDKAITTSSQAVVEHLNRVQTAINTMVEDVRKIE
                     HLAQLALESNRAFFNMINPNRQVLHKRRMRAIDRLMRSQLPQAEHLVKTMAHRELVAT
                     DLPNDFFALDAQQAEALANLFYAHIQQAAQKLLPIFKNIIFRLETRLLEQNRQQNPET
                     ILERYVEAGEPERVLWLAANWNLPPEITAKTAEVFDQQLKALLTADQKRNEERRSPKA
                     SLRLAEMHFSQHNKKALNSLVHALTNHPDVQQAQPYAAYLTGLLSELNHELPEAMTAY
                     EQVLNHADSERDSLLLDHCLTRVSAVSLELGDPVQANQALDTAALINPSHWRLSGQLA
                     ALRGDYGHAVEAYSHYLARFPGDTHTIRQLAMIFNTLDIEEGFQQCLALITYCNPSEQ
                     SGLKEELLALREEAP"
     gene            678371..679375
                     /locus_tag="HNEAP_RS03180"
                     /old_locus_tag="Hneap_0628"
     CDS             678371..679375
                     /locus_tag="HNEAP_RS03180"
                     /old_locus_tag="Hneap_0628"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent dehydratase"
                     /protein_id="WP_012823517.1"
                     /translation="MSEPDLLESPRALVTGADGFIGSHLVEMLVSRGYTVRALAQYNS
                     FNHWGWLEDVAYKDAIEVVAGDIRDAHFCRHMMKDVDVVFHLAALIAIPYSYIAPDSY
                     VDTNVRGTLNVCQAALDAGVKRVIHTSTSEVYGTARYVPIDEKHPLQPQSPYSASKIG
                     ADAIAQSFQNSFSLPLTVARPFNTYGPRQSARAVIPTIISQIASGKQRIELGDLSPTR
                     DFNYVEDTCRGFIALAESDATVGEVVNIGSNFEISIGDTLHLIRELMGSDIEVVHDDQ
                     RVRPANSEVFRLWCDNSKIHSLTGFKPEVDIRQGLARTIDWFTNPDNLRRYKTDIYNV
                     "
     gene            679368..680522
                     /locus_tag="HNEAP_RS03185"
                     /old_locus_tag="Hneap_0629"
     CDS             679368..680522
                     /locus_tag="HNEAP_RS03185"
                     /old_locus_tag="Hneap_0629"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase DegT"
                     /protein_id="WP_012823518.1"
                     /translation="MCDEFIQFVRALYEEPSAPIPLHVPVMGTPEKEAVAAAIDSTFV
                     SSVGAFVTEFERDVAEFSGAKYAVATVNGTAALHIALLVAGVQPGDLVITQSLSFIAT
                     CNAIHYCGADPLFIDVDEHTLGLSPSALRSWLERHAECRMEGTFERATGRRIRACVPM
                     HTLGHPTDIKAITTICDEWSLTLVEDAAESLGSYVGNAHTGTFGRMGVFSFNGNKVIT
                     TGGGGMIVTDDEQLAVRAKHLSTTAKKPHPWAFEHDEVGYNYRLPNLNAAFGVAQMSR
                     LPGLLASKREVASRYAQWCEANGWTFVSEPQGARSNYWLNAVRMSDRETRDAFLAATN
                     AAGVMTRPLWTPMHRLPIYASGLRDPLPVTEALAGTLVNIPSSALANGRS"
     gene            680522..681700
                     /locus_tag="HNEAP_RS03190"
                     /old_locus_tag="Hneap_0630"
     CDS             680522..681700
                     /locus_tag="HNEAP_RS03190"
                     /old_locus_tag="Hneap_0630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase
                     (hydrolyzing)"
                     /protein_id="WP_012823519.1"
                     /translation="MRRIAVITGTRADYGLLYWLIHDLHHAEDIELQLIVTGMHLMTE
                     FGHTVDVIERDGFPVAARVDLQLSSDSPQAVARAMGVGMIGFADALSRLAPDMVVILG
                     DRFEMLAAASAAFTLRIPIAHIHGGEVTEGALDEGFRHAITKLSAVHFTAAETYRERV
                     IQMGEQPDRVFNVGAPGLDHLRRTPLLNREDLEAALDFRLGALNFLVTFHPATLDIED
                     AVSQCRQMLAALDALPTAHIVFTLPNADPGGRAIIPELEAYVARHPDRCRLYASLGQL
                     RYLSLMRQVQVVIGNSSSGIIEAPTFGAATVNIGDRQKGRLRARSVIDCAPECLSIEH
                     AISRALEPAFQSLLPTMENPYGAGDASGRMLAVLRSVNLVELGRKPFFDLPDSASRVS
                     "
     gene            681767..682846
                     /locus_tag="HNEAP_RS03195"
                     /old_locus_tag="Hneap_0631"
     CDS             681767..682846
                     /locus_tag="HNEAP_RS03195"
                     /old_locus_tag="Hneap_0631"
                     /EC_number="2.5.1.57"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylneuraminate synthase"
                     /protein_id="WP_012823520.1"
                     /translation="MSQPLIIAEAGVNHNGQTDLAFALVEAAAKAGADVVKFQTFKAE
                     LLVTADAPKAEYQQRATGAGESQYAMLKRLELSPDLHHELKREAERLGLEFLSTAFDS
                     QSLRFLVDEVGLKRLKLPSGELTNAPFVLEHARTGAELIVSTGMANLAEIEQALGVIA
                     FGRIAGADDRPSVDAFKAAYASAEGQAALKSGVTLMHCTSDYPAAPQAINLRAMDTLS
                     AAFGLPVGYSDHTLGTAMSIAAVARGARIVEKHFTLDRTLEGPDHAASLEPDELTQMI
                     RGIRDVSAALGDGIKRPQPAELSTARVARKSLVARVPIRAGEPFTTDNLTVMRPGTGL
                     SPIGYWALLGKTARQDYPAGSLIVD"
     gene            682839..683474
                     /locus_tag="HNEAP_RS03200"
                     /old_locus_tag="Hneap_0632"
     CDS             682839..683474
                     /locus_tag="HNEAP_RS03200"
                     /old_locus_tag="Hneap_0632"
                     /inference="COORDINATES: protein motif:HMM:TIGR03570"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar O-acyltransferase, sialic acid
                     O-acetyltransferase NeuD family"
                     /protein_id="WP_012823521.1"
                     /translation="MTKPFIILGAGGHAAVIRDLIECLGHEVAGVLTPEFSAGSHWQG
                     LPVLGADDFLDQPAAADYVYALGVGLMPNQARLRSTLYAELITKGLEVPTLVHPSAVV
                     ARSVRLGRGVQILAGVVVQAQAVIGDNVLINTRASVDHHCHLGAHSHVAPGAVLCGGV
                     RTGEGVFVGAGATVIQGLEIGSRAEVGAGATVLRSLPADTRFIPERPHQGI"
     gene            683486..684547
                     /locus_tag="HNEAP_RS03205"
                     /old_locus_tag="Hneap_0633"
     CDS             683486..684547
                     /locus_tag="HNEAP_RS03205"
                     /old_locus_tag="Hneap_0633"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_012823522.1"
                     /translation="MSEQWQKIRLRVSDSLHRAIEVIDQGAKQIALVLDDDGRLIGTV
                     TDGDIRRGILRHLSLEAPVSEVMNAKPRSLAAGYSRAEALQLLGSAQVLQVPIVDRDG
                     KLVGLETMTDLMKRPRLENPVFLMAGGFGTRLRPLTDSCPKPMLKVGGKPMLEHILQD
                     LIDYGFYRFYISVHYLREQVIEHFKDGSRFGVSIQYIHEDTPLGTAGCLGLLPRDAVQ
                     RPIIVVNGDIMTRVNYEALLQDHDRHTPAATVCTRQYDFQVPYGVIEHEDQRITNITE
                     KPTQHFFVSAGIYVLAPQVVHSMAADTRVDMPDLLKSEITAGRSVRMFPVHEYWLDIG
                     RMNDFELAQNDAASVLQRV"
     gene            684540..685226
                     /locus_tag="HNEAP_RS03210"
                     /old_locus_tag="Hneap_0634"
     CDS             684540..685226
                     /locus_tag="HNEAP_RS03210"
                     /old_locus_tag="Hneap_0634"
                     /EC_number="2.7.7.43"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823523.1"
                     /translation="MSDIGSVLALIPARGGSKGLPGKNIRPLKGRPLIGWSIEAARTS
                     RYVSRVVVSSDDEEILAVARDQGAETPFRRPASLAGDATPSMDVVLHALDQLAEFEWV
                     VLLQPTSPLRLSADIDAAIEQCLKTNAPACVSVCEAPASPWWMFEVGAECRMRSFLPA
                     EQRPVRRQDLPDLYALNGAVYVAKTEWLRTSRSFLTEETVAYVMPPARSVDIDTLFDF
                     QLAECLLGNH"
     gene            complement(685312..687018)
                     /locus_tag="HNEAP_RS03215"
                     /old_locus_tag="Hneap_0635"
     CDS             complement(685312..687018)
                     /locus_tag="HNEAP_RS03215"
                     /old_locus_tag="Hneap_0635"
                     /EC_number="6.1.1.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018140660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline--tRNA ligase"
                     /protein_id="WP_012823524.1"
                     /translation="MRSSQFPLNTLKETPTEAEIISHQLMLRAGMIRRLASGLYTWSP
                     LGLRVLRKVEAVVREEMEGIGALELLMPAIQPAELWQESGRWQKYGPELLRVKDRHDR
                     EFCVGPTHEEVISDYARRELKSYRQLPICYYQVQTKFRDEIRPRFGVMRAREFIMKDA
                     YSFHADVESLRVTYQAMYDAYTRIFTRLGLKFRAVEADTGSIGGKGSHEFHVLADSGE
                     DAIAYAVNGDYAANVEMAPTFPLKGGRAPATASLTRVATPNAKTIDEVAAFLNAPATK
                     ILKTLLVRGKETPVVAIILRGDHELNDIKATKHPLIADPFEFIPPAEAFTHTGANVGS
                     LGPIGLNIPVIADFAAADCADFICGANEDGWHITGVNWGRDLPEPETADLRNAVEGDP
                     APDGQDKLAIARGIEVGHVFQLGTTYSEKMHCEFLDEHGKPATAIMGCYGIGVSRIVA
                     AAIEQNHDDNGIVWPVPLAPFEVAIVPINGHRAPAVQAEAERLEAELTAQGFNVLLDD
                     RGLRPGVAFADMELIGIPLRIVVSERGLAAGEYETRLRWESENKSIIADQLLAWIGQN
                     LK"
     gene            complement(687242..687709)
                     /locus_tag="HNEAP_RS03220"
                     /old_locus_tag="Hneap_0636"
     CDS             complement(687242..687709)
                     /locus_tag="HNEAP_RS03220"
                     /old_locus_tag="Hneap_0636"
                     /inference="COORDINATES: protein motif:HMM:PF13511.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4124 domain-containing protein"
                     /protein_id="WP_012823525.1"
                     /translation="MRGSRKIALIALTAAATVMFSAASQADGSTQIYKWVDKNGETHF
                     SQLPPKQGEAQIVNPDYATSGNNEDAQAAPAEKTEDETKKPLAPDQPVLAINKKEAAK
                     ACEAANAQIKMLQNTQNQLMTQDADGKYRPLTSEEIASRLKQAQDVANKACVK"
     gene            687958..688896
                     /locus_tag="HNEAP_RS03225"
                     /old_locus_tag="Hneap_0637"
     CDS             687958..688896
                     /locus_tag="HNEAP_RS03225"
                     /old_locus_tag="Hneap_0637"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012823526.1"
                     /translation="MADRRLKVFNTVARLLSFTKAAEALHTTQPAVTFQVRQLEEHFD
                     TRLFDRTHNRVTLTDVGHVVYEISERMFELYDEMDRRVKEMTGEVGGSLNIGASTTIA
                     ENMLPALLGKFRLKHRDLAVRLKVGNTEAIVSMVEHNVVDLAIVEGTVGNKNLLVETC
                     RRDELVVILPPDHQLAGLESVSLDQLMSYDFICREEGSGTREMVLNYLIEHGYSDGWD
                     VCMELGSPEAIKGAVQAGMGLSIMSASGITKELKLGLLKAVPLSPRLFRDFSFVRQRH
                     KFRLPAMEDLLEFSRDYCSNSSPMHDLESIQAKNAT"
     gene            complement(689375..689944)
                     /locus_tag="HNEAP_RS03230"
                     /old_locus_tag="Hneap_0638"
     CDS             complement(689375..689944)
                     /locus_tag="HNEAP_RS03230"
                     /old_locus_tag="Hneap_0638"
                     /inference="COORDINATES: protein motif:HMM:PF03625.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823527.1"
                     /translation="MRNLLKASVLGVAIMSLSGCGFLSIKDKLDPQAMDVYSGMYDRF
                     VSSGGDLGAATVWRMEVDKGLGPDDIKQSIESASVGTGLKNVGEMPLSKQLELETGKK
                     QRYLMIYQYCSPSIARQAVDFSPYFSAYLPCRIAVVEDKEGRYWLYGLNMDMFVHGGK
                     NMPEPFKSNAQHVRDSMMKMMEAGAHGGF"
     gene            690099..690722
                     /locus_tag="HNEAP_RS03235"
                     /old_locus_tag="Hneap_0639"
     CDS             690099..690722
                     /locus_tag="HNEAP_RS03235"
                     /old_locus_tag="Hneap_0639"
                     /inference="COORDINATES: protein motif:HMM:PF13740.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid-binding ACT domain-containing
                     protein"
                     /protein_id="WP_012823528.1"
                     /translation="MQCDGVGFYVPCSGINPLESDPSIHSREGHMQTQLIVNLFGPMG
                     TSHLADLLALIQQQQCHALDSHMLSFEQRMVLALRISGNWDRVTRVESVLREFAQRAG
                     IDMHVHHEQNIAEREAVLPYVVDAIGLASADIAAVITRFFAQQKVDMRELSTRTYRPA
                     RSSERLIQMRAQIDIPARCHLGQFKSDFFDLCDNLNLDAAIEPERSF"
     gene            690756..691232
                     /locus_tag="HNEAP_RS03240"
                     /old_locus_tag="Hneap_0640"
     CDS             690756..691232
                     /locus_tag="HNEAP_RS03240"
                     /old_locus_tag="Hneap_0640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_012823529.1"
                     /translation="MSELIKGSVVPSFTGATTDGGQICETTYSGKWLVLYFYPRDNTP
                     GCTTEAQDFQRLLPSFDEADAVVVGVSNDDQASHARFCAKQGLSFPLIADTEQTVSRA
                     FDVIREKSMYGKTFEGIERSTFLIAPDGQIHTVWRKVKVPGHAEAVLAAIREAGRS"
     gene            691279..692709
                     /locus_tag="HNEAP_RS03245"
                     /old_locus_tag="Hneap_0641"
     CDS             691279..692709
                     /locus_tag="HNEAP_RS03245"
                     /old_locus_tag="Hneap_0641"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007042058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate starvation protein PhoH"
                     /protein_id="WP_012823530.1"
                     /translation="MINNTRQRKCLFVLDTNVLMHDPTSIFRFMEHDIYLPMMVIEEL
                     DNGKKGTSETARNVRQVSRFLDDLLQDADLDNINQGLPIQSPLLSKNNERSSEAGRLF
                     LQTQNESIELPANMPGGRPDNQILGVTLALRHRIKDRDVILVSKDINLRIKATALGLK
                     AEDYHNDQVLDDVSLLHSGIVQLTDDFWDNHGKALESWQEEGRAFYRVHGPQTAEWYV
                     NLCVFIEGATPFSGIVREIAADGSAVVESAVNFQHERQSVWGITARNREQSFALNHLM
                     DPEVDFVTLLGQAGTGKTLLTLAAALALTLEKNRYSEIIMTRVTIPVGEDIGFLPGTE
                     EEKMTPWMGALMDNLEVLSKTDSGNEGGSWERAATNDLLRSRIKIRSLNFMRGRTFQN
                     KFVIIDEAQNLTAKQMRTLITRAGPGTKMVCLGNVAQIDTPYLTETSSGLTFVVDRFK
                     GWPHGAHITLARGERSRLAEHAAEVL"
     gene            complement(692802..695087)
                     /locus_tag="HNEAP_RS03250"
                     /old_locus_tag="Hneap_0642"
     CDS             complement(692802..695087)
                     /locus_tag="HNEAP_RS03250"
                     /old_locus_tag="Hneap_0642"
                     /EC_number="2.1.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine S-methyltransferase"
                     /protein_id="WP_012823531.1"
                     /translation="MSTSSNIITHTLGFPRIGERRALKWALESHWRGESSAQALQATA
                     KSVRAQTFHAHKESGITHPPVGDFSFYDHMADTALLFGQVPHRFGSTANTLDNLFTLG
                     RGKNVAGQNIAPLAMKKWFNSNYHYLVPELEADQPIALDAARYLDLVREALAANPAAK
                     PVLVGPLTFLYLSRGLDEAGRLAKAEALAAGYQLLLNELKALGVAWVQIDEPILTLDL
                     PADWLQAFEPTYHRLKVPGIKLLLTTYFGDLNGNVALAANLPVDGLHIDATMTRDLIA
                     VADRLPDYKVLSVGILDGRSIWRADLAPMLQRLAPVYARLKERLWLAPSCSLLHLPLD
                     AAFETKLPEFLRNNLSYARQKLTELNLLARGLSEGLDSIALELNQAAAARAELDRQPG
                     RNSSTVRAKTETIAATEPNRRGAFAERAAAQQARFNLPLLPTTTIGSFPQTHEIRAAR
                     KAFKNRELSEEQYESSMKDEIRHVIEIQEKIGLDVLVHGEAERNDMVEYFGEQLDGFA
                     FTQEGWVQSYGSRCVKPPIIWGDVQRSRPMTVAWARYAQSLSQRPVKGMLTGPVTILF
                     WSFVRDDLSREAVCYQIAEALRQEINDLAAAGIGMIQVDEPAFREGLPLRRKDWAPYL
                     NWAVRAFKHAVVDAPNDVQIHTHMCYSEFNDIIEAIAALDADVITIETTRSNMKLLDA
                     FSDFHYPNAIGPGIYDIHAPQIPTMEEIEPRVRLALEKIPAERLWINPDCGLKTRGWK
                     EVIPSLEAMVAVARKLRKEHG"
     gene            695263..695613
                     /locus_tag="HNEAP_RS03255"
                     /old_locus_tag="Hneap_0643"
     CDS             695263..695613
                     /locus_tag="HNEAP_RS03255"
                     /old_locus_tag="Hneap_0643"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008570359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823532.1"
                     /translation="MGWLITKYLVTAGVIVLVSEIAKRSDKLGGLLGALPLVTIMALI
                     WLHVGQQSEEKIANHAWYTFWYVLPTLPMFLVFPALLQRIGFWPTLIVCIALTMVIFG
                     MFALVMRRFGVNLL"
     gene            complement(695700..696620)
                     /locus_tag="HNEAP_RS03260"
                     /old_locus_tag="Hneap_0644"
     CDS             complement(695700..696620)
                     /locus_tag="HNEAP_RS03260"
                     /old_locus_tag="Hneap_0644"
                     /inference="COORDINATES: protein motif:HMM:PF00326.19"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_012823533.1"
                     /translation="MKKPWWSVLIILSLSFGLQGCSGVTILNTLSPRDGVQVTRSIVF
                     DREHQLKLDVYRPTNAHAAPVIVFFWGGRWEDGDKSMYRFVGAELASKGFVVVIPNYR
                     LYPNVTFPAFVNDSAKAVAWTHEHISQYGGSPNEIVLMGHSAGAYNAAMLALDPAYLH
                     AVGGSPRQWIRGMIGLGGPYDFLPLVEPDLKAIFGPPSQYPITQPIHWADGTNPPMLL
                     IESRADTIVYPKNTRNLYAKIKKNGGPVEKFMVDDLSHPMLIGVVSNLLSSQSPILEK
                     IVTFADHVTSDKQVGQGGGTPDQHVVTVHP"
     gene            complement(696750..697475)
                     /locus_tag="HNEAP_RS03265"
     CDS             complement(696750..697475)
                     /locus_tag="HNEAP_RS03265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease T"
                     /protein_id="WP_012823534.1"
                     /translation="MSGPNPVQQDTPDFTEIATALTTSKKNDWNIARRFRGFMPVVVD
                     VETGGLNPQTDALLELAAVLLDVDANGKIIPVDRIQIHVQPFEGANLNPVSMKINGID
                     IDHPFRCALDEAEALKQFFQPIRQRVKLNGARRAVLVGHNAAFDLAVINAACERTCNK
                     KNPFHPFSTFDTVTLSALAVGETVLAKALEAIGLEWDSQQAHGALYDAEQTAELFCRI
                     INHFSTSSGRAAMRTPNPVNPTK"
     gene            complement(697487..698347)
                     /locus_tag="HNEAP_RS03270"
                     /old_locus_tag="Hneap_0646"
     CDS             complement(697487..698347)
                     /locus_tag="HNEAP_RS03270"
                     /old_locus_tag="Hneap_0646"
                     /EC_number="1.5.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional methylenetetrahydrofolate
                     dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
                     /protein_id="WP_012823535.1"
                     /translation="MTAQILDGRALSTALQAGFADEITSAVATGLRPPGLAVIQVGED
                     PASSVYVANKRKTCEKIGMYSVSKDLKADISQAELNALVDEYNADPSIDGILVQLPLP
                     AHLSAAEIIERIHPDKDVDGFHPENIGKLAIRQPALRPCTPFGVMKLLQTAKLDLYGM
                     EAVVVGASNIVGRPMALELLLAGATVTITHRFTRDLEAHVRRADLLVVAAGKPGLVRG
                     DWIKPGAIVVDVGIHRQEDGSLCGDVDFAAAAERAAWITPVPGGVGPMTIAMLMHNTV
                     QSWRERVACS"
     gene            complement(698414..699451)
                     /locus_tag="HNEAP_RS03275"
                     /old_locus_tag="Hneap_0647"
     CDS             complement(698414..699451)
                     /locus_tag="HNEAP_RS03275"
                     /old_locus_tag="Hneap_0647"
                     /inference="COORDINATES: protein motif:HMM:TIGR00341"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR00341 family protein"
                     /protein_id="WP_012823536.1"
                     /translation="MGLKVLEIISPKAEIEAIEQVTNSDEVVDWWRSSPFDDERFSTS
                     MMVKPDNVQTVLDALQQILDHCKDARVMIHSVDATLPKIEEEEEPDPQTEEEPGKSNG
                     LTREELFEQVETGSELNQTYLLLTALSAIVAAIGMVENSVAAVIGAMVIAPLLGPNLA
                     LALGSTLGETTLTRKASIANLVGLGLAIGVAFLISFLIDPTSNAQLEARTVVSYGALI
                     LALASGAAAVLSLLAGVATGLVGVMVAVALMPPAVALGLFLGWGQWTQAGQALLLLFI
                     NITAINLSAKLILVFRGVTPRRWPDKSRAKKSSRWAFTFWGLSIGIIIVLIYFAQHGL
                     KDLAPIFEWLR"
     gene            complement(699454..701469)
                     /locus_tag="HNEAP_RS03280"
                     /old_locus_tag="Hneap_0648"
     CDS             complement(699454..701469)
                     /locus_tag="HNEAP_RS03280"
                     /old_locus_tag="Hneap_0648"
                     /inference="COORDINATES: protein motif:HMM:PF13307.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049772456.1"
                     /translation="MHPVNTEAADTLSTAPTPSKPSTLQDVFGESGVLAAAFSGYQPR
                     AGQLQMAEIIRDAITDSRTVVIEAGTGVGKTFGYLAPILLAGRKAIVSTGTKHLQDQI
                     FSRDLPQIKQLMGSTTRTALLKGRSNYLCLHRLERAMTEGRLKSPDWVTALHTIKGWS
                     TRTRDGDIARCDAVSEEHGIWPLVTSTNENCLGKECPVFDECFVVKAREAAHEADLVV
                     INHHLFCADIAIRQSGFAQLLPEADVVVLDEAHQLPEIASLFFGSALSSGQMIDLLRD
                     IVREQQAEAVDMSDLLGVVHQFELAIDPCVLALKNARTDRIAWQELREDKTIQAAFDT
                     LETRLADLTAALELAAPRGKGLASCHERAIQMRQSLSHFRRSEEITTEVRWLERREKS
                     FTLNITPMDAGQTFSDVVESQPRAWVFASATLAAGKDFSHFTRRLNLNLALCQQTPSP
                     FDYPNQAIMYLPPNPPDPKTDPDYTLKILRAVFPVLKASGGRAFLLFTSHRELKKAAD
                     ILEGKLPFPLFVQGTQAKAALLEQFRQSGNGVLLGTQSFWEGVDVRGEALSVVMIDRI
                     PFASPDDPVRRAREAQIKESGHSPFAAMALPEAIITFKQGVGRLIRDVTDRGVLVLCD
                     PRLQRTGFGRQILDALPPMRRSHSIDEIHDFFQYDQATNALKASKAE"
     gene            complement(701519..702229)
                     /locus_tag="HNEAP_RS12175"
                     /old_locus_tag="Hneap_0649"
     CDS             complement(701519..702229)
                     /locus_tag="HNEAP_RS12175"
                     /old_locus_tag="Hneap_0649"
                     /inference="COORDINATES: protein motif:HMM:PF14559.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441095.1"
                     /translation="MSEQIYSKDGINLHLHRKNLPICAHRRLIATTPSRTDPMPNRIQ
                     MKHPTHGLKMGAVAFLAITVAMLAGCAGTPPPRPSMVIKQPPVPPSVQAHPLNIPRLQ
                     EKTLPQSNGNSTSNTPPQAVQTASTPAVLALVSRAETQTQSGDFGGAEATLERAVQIQ
                     PHNTRLWLDFAQLRLAQKQPAQAEQFALRAVQYAQNNREVSAAWQMVAKTRQAQGDTK
                     GAAEARRKAGFVPGQTQG"
     gene            complement(702343..704835)
                     /locus_tag="HNEAP_RS03290"
                     /old_locus_tag="Hneap_0650"
     CDS             complement(702343..704835)
                     /locus_tag="HNEAP_RS03290"
                     /old_locus_tag="Hneap_0650"
                     /EC_number="2.4.1.129"
                     /inference="COORDINATES: protein motif:HMM:TIGR02071"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1B"
                     /protein_id="WP_012823539.1"
                     /translation="MPDAVKLVTNYGSSVSVWVNSVAQTKKTARPAQKPPARKGSNGK
                     KPANNSASKGVRVGRFSLRGLFWRIVIIAVLVLTALMSIWAYFLNQRVVDRFSGTLWK
                     LPATVYAAPQEIYVGQHLSPGELVDELTSLHYRDRDTLTETGTYDRVGNEIRLHRRAF
                     DFPDGNETDRQIRVQFIDNRVKAVNDDKGNSLGIIRLEPMTIGQLYPDINEDRVLLNV
                     EQVQKDAPLLIKTLITVEDRDFYYHHGVVPSAVLRALLVNIVSGHKVQGGSTITQQLA
                     KNLFLTPKRTYKRKLEEMIMALEMEWHYSKDKILEGYLNEVYLGQDGSRAIHGFGLAA
                     RYYFGRPVDELRPEEIALLVGMVKGASYYNPRRNPERAKDRRDTVIDLMANNGLISET
                     EAGELKQKPLGVLKEKGTTSPHPAFLDLVQRQLSQQYNPEDLKTKGLRIFTTMQPRVQ
                     AALEHSVTALNAIEKARHYKPDSLETAGIITSIGTGEVEALIGGRNPTYEGYNRALDA
                     QRQIGSLIKPTIYLTALSDPAKYSLITPLDDSPLTVDQPGSKPWKPENYDRKFLGPTP
                     LYTDLAESRNVPSIRLGLSVGLDNVSAMLHRLGGPDIKPFYPSMLLGSMTMSPFNVAQ
                     IFQTLSSDGFYSPLRAIRSVVDAEGKPLTRYPLTVTKVADPDALYLLQYAMQGVVNNG
                     TARALNRTIPPSVGVAGKTGTTNDSRDAWFAGFTGNRVGVIWVGRDDDKPTSLTGASG
                     ALPLWAAAFKPLYNKPRDMTPPKGIDFVNVDVAQQARVPSQCPGILMPFMSGFEPKTI
                     LDCNGNSTDSGNTDRGGGTNGNPLNPILNFFR"
     gene            704979..706514
                     /locus_tag="HNEAP_RS03295"
                     /old_locus_tag="Hneap_0651"
     CDS             704979..706514
                     /locus_tag="HNEAP_RS03295"
                     /old_locus_tag="Hneap_0651"
                     /inference="COORDINATES: protein motif:HMM:PF01636.21"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441096.1"
                     /translation="MVMNSPVTQALPLEQFKRHLHDQYGEVVHLQTHISHVLLAGPHA
                     YKIKKPMDFGFLNFTDRDQRRFFCHEEIRLNRRLAPDLYLGVVGLDADGRLVETANTQ
                     IEPMVHMRRFDQNDRLDNYAQTQGLDDVLIDDLARQIDQFHQNAAIAPKDSHFGTPET
                     VYFPINQNFEQIRGFLTDDADQTQIDRIETASEAAFLALKPTIAARKSSGHVREGHGD
                     MHLGNIARINGKVMIFDGIEFNEDFRWSDTANDLAFLLMDLTDRQFLGAARRLLSVYL
                     ESSGDYEALPLIRFYAAYRAMVRAKIALFGIRPDMSADEQAGQWAIFRRYADLAEQFL
                     APTEASLWITVGFSGSGKSLASMELVQSLGAVRVRSDAERLRHFPERAMRYTPEATKY
                     VYNHLIDIATIGLNAGWPMIIDATFLRAEHRALFEQLAQTLGFPFHILFIECDAPTLR
                     RYLRERTAQGGDISEANEEVLEAQLQKLQPLTTAEHAYTYRLQCDTSFAGQIADIVWA
                     KTT"
     gene            complement(706695..706901)
                     /locus_tag="HNEAP_RS03300"
                     /old_locus_tag="Hneap_0652"
     CDS             complement(706695..706901)
                     /locus_tag="HNEAP_RS03300"
                     /old_locus_tag="Hneap_0652"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018312952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_012823541.1"
                     /translation="MKSLKTLTVLGLVLVSLSGCANMTPRERNTAIGAGVGAIGGSIL
                     TNGNALGTVGGAAVGGLVGNQVKH"
     gene            complement(707090..709735)
                     /locus_tag="HNEAP_RS03305"
                     /old_locus_tag="Hneap_0653"
     CDS             complement(707090..709735)
                     /locus_tag="HNEAP_RS03305"
                     /old_locus_tag="Hneap_0653"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_012823542.1"
                     /translation="MTESKDLSQHTPMMQQFWTMKQAHPDVLLFYRMGDFYELFYADA
                     ERAARILDLTLTTRGQSAGEPIPMAGVPVHAYESYLARLIRAGESVAICEQIGETKTK
                     GPMERAVVRVVTPGTVTDEALLDQREGNRLAALVPLATTPPEYGLAHLDLAAGDFVLM
                     RLDDAALTAELARIDPRELLLPESLAEAADTAAKIGVDPKRWRTRADWQFDAKRGQAA
                     LLKHWQIHDLKSFGVTEIHQPALGAAAILLTYVAETQRSAVPHIERLRVEHLGDALLI
                     DRNTRRHLELFTSNQEGSHDDGRSAATLINLLDETVTAHGSRLLKHWLGRPLRDQAVL
                     RHRQQAIGELIERGKINALRESLRGINDIERITTRIVMGSARPRDLSGLRDALGVLPA
                     LSAQLNQLDLPLWRDLAVRLTDQPAPRELLNRALVTQPPVWLRDGGVIAAGFDAELDE
                     LRHLSEHADDALNALEAQARLQSGIQSLKIAYNRVQGFYFEVSRLQAEKMPPQFIRRQ
                     TLKSVERYTTEELKTFEDRVLSARDRALAREQGLFTELLQTLATHQSALRRMAEAIAE
                     VDVLHSLARVAECQRWVAPELGSEPGIHIEAGRHPVIEALTKQTLGNQPFTPNDCELT
                     PNRQLLMITGPNMGGKSTYMRQTALIVLLAHIGAFVPATRARIGPIDRIFTRIGAGDD
                     LASGRSTFMVEMTETAEILHTATENSLVLIDEIGRGTSTFDGLALAWAVAEHLIRRNR
                     ALTLFATHYFELTQLTERFDTVRNVHLDAVTHKDDLIFLHSVKDGPASQSYGIKVAAL
                     AGLPREAIRRAQALLKQLEQQHPVGAATPQLDLFAAPEVTDAIEEPEIEPHPLITALE
                     KLDPDILTPKQALDLIYAWRNELKK"
     gene            complement(710076..710870)
                     /locus_tag="HNEAP_RS03310"
     CDS             complement(710076..710870)
                     /locus_tag="HNEAP_RS03310"
                     /inference="COORDINATES: protein motif:HMM:TIGR01222"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein MinC"
                     /protein_id="WP_012823543.1"
                     /translation="MSPSPFTPIEHETFSLHRNPAPVTCLVLRETHLLKLTRAFKDTF
                     GGHGIFSKPEPILIDLSGIENSGKWVDFPALISLLRNYQLEPIAVLGGNAKQREQAAQ
                     AQLPHIEGRPVPEPVAAPPVVKELVAPEPVEPKPAAKEVHAPETERPAHSLEPPMVIR
                     QPVRSGAELYAKQADLIVISMVGAGARVVADGSIYVHGALKGTAAAGVNGMPQARIFC
                     ESFEPEIIAINGIYLDGEQLAKHPAWGKRVLIELDQKGQLDIRVFI"
     gene            complement(710959..711789)
                     /locus_tag="HNEAP_RS03315"
                     /old_locus_tag="Hneap_0656"
     CDS             complement(710959..711789)
                     /locus_tag="HNEAP_RS03315"
                     /old_locus_tag="Hneap_0656"
                     /inference="COORDINATES: protein motif:HMM:PRK05287.1-4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapD"
                     /protein_id="WP_012823544.1"
                     /translation="MVHGGTFDLIKDAMKEQFTGASFLKNFEQPLNERIRACLRLEYL
                     FDRFDQHLADETAEGSLCAMLILIEATDVLGRIDVKRELIKELERQQAKLLQVAHTPQ
                     VNAEMLNQLLDQQAQLLDQLHRMNTQPGAHLKKHELINAIRQRASIPGALCVFDLAAL
                     HYWLAQPYSERREDFLEWLEPLATIRRANELVIDLIRNSVAPEIRTAEDGFFQLNLEL
                     GTPYQLVRVLLDDGSNVYPEISASKHRVIVRFMRLDRQTGHPFQVNHDVAFELAICQL
                     "
     gene            complement(711964..715680)
                     /locus_tag="HNEAP_RS03320"
                     /old_locus_tag="Hneap_0657"
     CDS             complement(711964..715680)
                     /locus_tag="HNEAP_RS03320"
                     /old_locus_tag="Hneap_0657"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="WP_012823545.1"
                     /translation="MTQKIIEQPVFAQLRALMHERILILDGAMGTMIQKRRLSESEFR
                     GERFADWPVDLKGNNDLLVLTQPKVISDIHRAYLDAGADIIEANTFNATRISMADYQM
                     QELAYEINVAAARLARECADAKTLETPEKPRFVAGIIGPTSRTGSISPDVNDPGFRNV
                     TFEELSSAYRESAEGLIEGGVDILLIETIFDTLNAKAAVFALEQLFADRGQRWPVMIS
                     GTITDASGRTLSGQTTEAFYNSLRHAQPLSIGLNCALGPDLLRQYVAELSRVSEFPVS
                     VHPNAGLPNELGEYDLEADPMAQQIGEWARSGLINIVGGCCGTTPEHIAYMAQQVAPH
                     PPRVPPKPEPACRLSGLEPFNITPESLFVNVGERTNVTGSARFRRLIKEGDFTTALDV
                     ARQQVEAGAQIIDINMDEGLIDGEAAMERFLKLIASEPDISRVPIMIDSSKFAVIEKG
                     LQWVQGKPIVNSISMKEGEDIFLEHARLVRRYGAAAVVMAFDEHGQADTVQRRIEICS
                     RAYKLLTEEVGFPAEDIIFDPNIFAIATGIEEHNNYAVDFIEGTRWIKQNLPHALISG
                     GVSNVSFSFRGNEPVREAIHSVFLNHAVAAGMDMGIVNAGQLVIVDDIPAELREAVED
                     IVLNRRDDATDRMLDIAEKYRGSGTGEAKSGADLAWRELPVNKRLSHSLIKGIDQFVI
                     EDTEEARLAAERPLHVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSARVMKKAVAHLLP
                     FMEAEAAAGGCAAETAGKILMATVKGDVHDIGKNIVGVVLQCNGFEIVDLGVMVPTQK
                     ILDTAIAEQCDIIGLSGLITPSLDEMVTVASEMQRQGFTLPLMIGGATTSKLHTALKI
                     APVYEQPVVHVLDASRAVGVAASLLGENKAVYVQGIANEYAELVARRKANQKEAKRAN
                     LAEARANKQVMDYSNYTPVAPKTPGITVFEDYPLEDILPFIDWTPFFQSWQLFGKYPA
                     ILDDEKVGLEARKLFDDAQAMLKTMVEEKWVKASGVIGFWPAASIDDDIRVFTDEKRQ
                     SVLTTLHHIRQQMPRSGGKPNQCLADFVAPTGKKIKDWIGGFAVTTGHGIEPHIERFE
                     KAMDDYHAILLKALADRLAEAFAEHLHYRVRTEFWGYAPDEPMDNDAMIAEQYQGIRP
                     APGYPACPDHTEKGTLWSLLEPETRAGISLTENFAMYPGAAVSGWYFAHPDARYFGTG
                     KIGRDQVHDYAERKGWSLKESERWLAPILGYEPE"
     gene            complement(715754..716293)
                     /locus_tag="HNEAP_RS03325"
                     /old_locus_tag="Hneap_0658"
     CDS             complement(715754..716293)
                     /locus_tag="HNEAP_RS03325"
                     /old_locus_tag="Hneap_0658"
                     /inference="COORDINATES: protein motif:HMM:PF09835.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823546.1"
                     /translation="MPRKFFRKWAPSKDTVLAPAFMRPFAKWLAHPNLWHMNRRSVSG
                     GVAIGLFIAFLPIPFQMLLAAITAVFFRVNVALAVAMPLLSNPFTMVPILWSAYIIGA
                     WLTGGTVALPTSGITFEWVLAQLHVLWLPLLVGLLILATLSAVLGYLIIQFLWRLNVI
                     LHKRRKQKQRANGINQTPS"
     gene            complement(716377..717930)
                     /locus_tag="HNEAP_RS03330"
                     /old_locus_tag="Hneap_0659"
     CDS             complement(716377..717930)
                     /locus_tag="HNEAP_RS03330"
                     /old_locus_tag="Hneap_0659"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012823547.1"
                     /translation="MSQSKPLFDATKLTSFERVMITFAVMTATVMQVLDTTIASVALP
                     YMAGDLGASPDQISWVLTSYLVASAIVMPLTGYFTDKFGQREYLMFSIGLFVVASALC
                     GLSANLPQIVSFRLLQGVAGAALVPLSQAIMVQVFPPDQRGKAMAIWGIGVMVGPILG
                     PTIGGWITEAINWRWTFYVNLPVGLLSFFIVGRFVPRLPRKHGRTMDWWGFTLLGLAI
                     GGLQYVLDRGNQDNWFSSSTIVTAAVVSVIAFIFFVWLSFVPDRKPVFSLEIFKDRNF
                     TLANGVMLLMGLGMFGAIFVQPLMLEQEMNYPVLTTGMVLAPRGIASMIAMMIVGRII
                     GKVDIRAIILMGIVLSLVGSWGMTQYNLEINTWQIVWPLLFQGAGIGMIFVPLSTAAF
                     STLSPQFAAEAAGIYSLVRTVGSSIGISLVATLVSRHAQVAWNQLGGGVTIENPLTWQ
                     YLAPLHLQPDSPQGAAILGNVLREQANMLSYHDAFVMILASFLLMIPVAFALKTKNGK
                     KSKTEIVPE"
     gene            complement(717952..719160)
                     /locus_tag="HNEAP_RS03335"
                     /old_locus_tag="Hneap_0660"
     CDS             complement(717952..719160)
                     /locus_tag="HNEAP_RS03335"
                     /old_locus_tag="Hneap_0660"
                     /inference="COORDINATES: protein motif:HMM:PF16576.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD"
                     /protein_id="WP_012823548.1"
                     /translation="MNQTTKETQSKADTSEPNKDAPTLSASTDASSEAPKSKQQKPAS
                     AKSKSSRQRLVFIIVLLLIATWFGLGYLNYSHQYLSTEDAFISGNQTQIGSQVAGLIQ
                     TTPWQNNKDVQKGDILFTLDPAPFQIAVDEAQAGLATAEREQQTANAAINTAQAELMR
                     QKASAQQAEDHLHRLTNIKNKQFVSEQALSDARSALAVANAAVDQAQAQLAQAKTQAG
                     AEGAENDLIKTAQAKLAQAQYNLSKTVVRAPMSGRLANYNIEPGQTVNANQTVCSIVA
                     TTGLWVDANFKETDLGAVHIGQPAQIESDIYPGHVFKGHVLSIAAGAGNAFSLLPPQN
                     ATGNWVKVTQRVPVRILLDDTDTKHHLPIGTSTTTRIELTKDPHGFWQSMLNVIGLGG
                     HTSPSHKSSL"
     gene            complement(719129..719608)
                     /locus_tag="HNEAP_RS03340"
     CDS             complement(719129..719608)
                     /locus_tag="HNEAP_RS03340"
                     /inference="COORDINATES: protein motif:HMM:PF13463.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_012823549.1"
                     /translation="MLKDYATMSDEQIARLLFDTTRMWRAQLNTVLAQYELTASAWSV
                     IRVLRDEGQGRTQKELASALAIEGPTLVKLLDSLERLNWIERRVAPTDRRAKTIWLID
                     SALPQIKEADEKLGMVRHAILDVLDEQERNDFTKLLSKVKQNLEQMCHESNNQGDPI"
     gene            720189..721838
                     /gene="pyrG"
                     /locus_tag="HNEAP_RS03345"
                     /old_locus_tag="Hneap_0662"
     CDS             720189..721838
                     /gene="pyrG"
                     /locus_tag="HNEAP_RS03345"
                     /old_locus_tag="Hneap_0662"
                     /EC_number="6.3.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823550.1"
                     /note="CTP synthase; cytidine triphosphate synthetase;
                     catalyzes the ATP-dependent amination of UTP to CTP with
                     either L-glutamine or ammonia as the source of nitrogen;
                     in Escherichia coli this enzyme forms a homotetramer;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthetase"
                     /protein_id="WP_012823550.1"
                     /translation="MTKFVFVTGGVVSSLGKGIAAASLGALLESRGLRVTLLKLDPYI
                     NVDPGTMSPFQHGEVFVTEDGAETDLDLGHYERFVRSPVGKRNNFTTGRVYESVIRRE
                     RRGDYLGGTVQVIPHITDEIKRRVLEGSKGYDVALIEIGGTVGDIESLPFLEAIRQMG
                     VELGRERAIYMHLTLVPYIRTAGEVKTKPTQHSVKELRSIGIQPDILLCRSEVSLPDE
                     ERRKIALFTNVDFDAVISSVDADTIYRVPRLLHAQKLDEIVLRKLHIQTGAADLSEWD
                     CVVEAQTKPDRIVDIAMVGKYVELLDAYKSLNEALLHAGIQTRTRVNIHYFDSERFER
                     EPTTVLEAMDAILVPGGFGERGVEGKIAAVRFARESRKPYLGICLGMQVAVIEYARHV
                     AGLSDAHSTEFRKDSAHPVIALITEWRDENGELIVRDEKTDLGGTMRLGAQRCELISG
                     SRAALAYGKTEISERHRHRYEFNNGYQKTLEEAGLVFSGFSAENHLVETIELPEHPFF
                     IASQFHPEFNSTPRDGHPLFTAFIQAALAQRAGGSDEEVAE"
     gene            721835..722677
                     /locus_tag="HNEAP_RS03350"
                     /old_locus_tag="Hneap_0663"
     CDS             721835..722677
                     /locus_tag="HNEAP_RS03350"
                     /old_locus_tag="Hneap_0663"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-8-phosphooctulonate synthase"
                     /protein_id="WP_012823551.1"
                     /translation="MNLLNFKVGLDQPLFLIAGPCVIESEALAQETAGRLKEIAQQLN
                     IPFIYKSSFDKANRSSGASFRGPGLEQGLAILERVKSIIGVPVLTDVHEDTPLDEVAA
                     VVDVLQTPAFLCRQTNFIQNVARQGKPVNIKKGQFLAPWDMGNVVDKARAVGNDQIMV
                     CERGASFGYNNLVSDMRSLAVMRQTGAPVVFDATHSVQLPGGQGASSGGQREFVPVLA
                     RAAVAAGVAGLFMETHPDPAKALSDGPNAWPLDQMAELLHTLVEIDRLVKGAGFPEQA
                     LMTR"
     gene            722758..724038
                     /locus_tag="HNEAP_RS03355"
                     /old_locus_tag="Hneap_0664"
     CDS             722758..724038
                     /locus_tag="HNEAP_RS03355"
                     /old_locus_tag="Hneap_0664"
                     /EC_number="4.2.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopyruvate hydratase"
                     /protein_id="WP_012823552.1"
                     /translation="MTAIEGLRARQVIDSRGNPTVEAEVHVTGGFMGRAIVPSGASTG
                     TREAIELRDGDKSRFGGKGVTRAVANVNGEIAAALKGMNIDDLAAIDAAMIKLDGTEN
                     KSRLGANALLAVSLAAAHAGAAAARKPLFEYLGKGKGVTLPVPMMNIINGGAHADNSV
                     DMQEFMIIPAGAPSFSEALRYGTEVFHTLKKVLHDRGLNTAVGDEGGFAPDLPSNEAA
                     IQIIIEAIELAGFVPGKDVFIGLDAASSEFYKDGKYHLTAEGRAYTSAEMVDLLADWV
                     SKYPILSIEDGMAEQDWDGWALLTERLKSKVQLVGDDIFVTNAKILREGIDKHIGNSI
                     LIKVNQIGTLTETLETMRLAEENGYTNVVSHRSGETEDTTIADLAVATNAGQIKTGSM
                     SRSDRMAKYNQLLRIEEALGSRATFPGVSVFRRA"
     gene            724065..724481
                     /locus_tag="HNEAP_RS03360"
     CDS             724065..724481
                     /locus_tag="HNEAP_RS03360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008485110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation initiator"
                     /protein_id="WP_012823553.1"
                     /translation="MTRTIRLSLLVGLLIILGSLQWRLWFGGSSLRELWQKQARLSEM
                     IQTQDALTERNRRLFAEVDDLKTGLGVVEALARLDLGMIGPNETFYQVIEDAQTDQIT
                     PNAPTAPQTSSVNPEPTPSAISTGSGQGTPQQRSTP"
     gene            724547..725305
                     /locus_tag="HNEAP_RS03365"
                     /old_locus_tag="Hneap_0666"
     CDS             724547..725305
                     /locus_tag="HNEAP_RS03365"
                     /old_locus_tag="Hneap_0666"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002710529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="WP_081441177.1"
                     /translation="MIDDWWLVLPAAGMGRRMGADQPKQHLKVDQRTLVEVTLSRFIG
                     LPGLKGAVLALAPNDELTPKLLASFSAFPLHFTAGGATRSDSVLAALNYLSGQLAVDW
                     QHWVLVHDAARPCVRPADVHKLLEAVRGSNAGGLLAVPVRDTLKQADERNRVSMTVPR
                     DGVFHALTPQAFRLGALADAMDRAHQDGVTLTDESSAMEHVGMKPLLVKGHADNLKIT
                     HPDDLPLARLILQAQSAIQAATQSAWIGDKLTPE"
     gene            725322..725843
                     /locus_tag="HNEAP_RS03370"
                     /old_locus_tag="Hneap_0667"
     CDS             725322..725843
                     /locus_tag="HNEAP_RS03370"
                     /old_locus_tag="Hneap_0667"
                     /EC_number="4.6.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="WP_012823555.1"
                     /translation="MSEQKSSSFQSVPWRVGHGFDVHAFKPGDHLMIGGVRIPFDQAF
                     KAHSDGDVLIHAFCDALLGAAGLGDIGQHFPDTDPAYLGIDSTRLLTHVHALLMSHHW
                     RIGNADLTIIAQAPRMSTHIPAMRTRLADLLQMEVGALNIKATTTERLGFTGRGEGIA
                     AEAVVLIVRTDTA"
     gene            complement(726015..726611)
                     /locus_tag="HNEAP_RS03375"
     CDS             complement(726015..726611)
                     /locus_tag="HNEAP_RS03375"
                     /inference="COORDINATES: protein motif:HMM:TIGR00254"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441097.1"
                     /translation="MRDITALRQLNERLEYQSLHDSLTHLPNRRALEKTLEERVLQAR
                     LTNQPLAVGMIDLDDFKPVNDTYGHEAGDRLLKAVSQRLTGRLREHDVLARIGGDEFV
                     IIIGHLDAAHLDEQLPLILNRLHEATETPFDIAEDQLAWVGMSMGVAIYPDDGIESDL
                     LLRRADAALYRAKTHKQTHGIWWRRWIEETPTVKPQKS"
     gene            complement(726604..728736)
                     /locus_tag="HNEAP_RS03380"
     CDS             complement(726604..728736)
                     /locus_tag="HNEAP_RS03380"
                     /inference="COORDINATES: protein
                     motif:HMM:PF13185.4,HMM:TIGR00229"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600348.1"
                     /translation="MINAATKTKNDRMIRFFTRPLAINLLLGLPALILLIWIVISEHQ
                     QFQQTALSTNQDADRAAAVFASQIQSRLLTQFIELEFIGTSLLDEGTDPTDLSPRTVR
                     SLQRFMDIHPDFYALNILSADGKEILWSTVQQSSEPIFGTEQFTPMDDHPNFLLGESK
                     FAPRFQDHVLSMRYRVENQEGVVRFFLGSPYRLAQLISFDLKNTPFFFRLKDTRSNKI
                     LGEWRDGAILPPHDFASSETQNQTNIIGTPLCVEAYGAVDLAWKRYLAAAWQRWILEF
                     SLMIFLGTVSLLTRRLLHERAHANQHLQRLSQFNRMLAEISQVIAVAEDETQLFNEIC
                     EIGVNEGQLALMWVGRPDEQGVFKFLAAAGRTEFLDGLRLSIDPNHYTGQGFCIQTWN
                     TGRPFFSTDPSISPFPCEWQERARAFDLRAVASLPLRREGEIQALLAIYYPEVRDLTE
                     FQGLFEELAEDISRGLDRLELMKRERLSSAFNRAILDNSSAGIMLLQNRIIKFANQRL
                     ADMIGADGPEALVDHPTREYYYRPEDQAHLLRLIPETFAKGEQIRFEAQFRRLDNAEI
                     RWFSLTGQPFDLPGFDETWMITDITEYHEALSQQRLLASALTSIQEGVVIADNQQQII
                     YVNAAFTTQTGLTLSEVRNTSLVDLLDPQTPNEIKSVVKQIQTDGKGYQGQTPIKKKN
                     GQAFWSLMTINPVVKYSKPTNALCLRSA"
     gene            complement(728934..731243)
                     /locus_tag="HNEAP_RS03385"
                     /old_locus_tag="Hneap_0669"
     CDS             complement(728934..731243)
                     /locus_tag="HNEAP_RS03385"
                     /old_locus_tag="Hneap_0669"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005221806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441098.1"
                     /translation="MSMYKLLKAVLTSLVLFSTVFLNYSARSADLLNPEEAFHASAEL
                     NGASIDLKFHVADGYHLYRDRIAITSQTESLKLGKPVLPEGVIDNDPYFGKLVVYKKD
                     FTVQVPIEASQPGEAKLKLKYQGCSDTQGVCYPPQTQEVTIKLPASATKPASPESSSL
                     SSLSSLGGDGGQQPLDPEQAFKASIQVKNNEIQLHWDIADNYHLYRDRIKVGLDDTDA
                     KITTGSIPNGKVVDDPGFGKVQVFYHTLDAKVGIKPGSSDSAVVVAGSQGCADMGLCY
                     PPIEHAWKVNFKTGSVEPLATAPKATLEKVVSLPSSMNSASTRAPQPAQSEPVQRSQT
                     DAITHELQTGSLWTIILGFLVIGLLLAFTPCVFPMIPILAGIIAGQGDKITTRKAFVL
                     SVVYVLAMAVTYTVAGILAGLFGSNLQAAFQNPWILTAFAGVFIALAFSMFGFFELQL
                     PSSLQSKIMQVQNNQQGGTLVGVAIMGLLSALIVGPCMAPPLAGALIYIGQTGDAVLG
                     GTALFAMSIGMGLPLIIVGTLGGKFLPRAGAWMDAVKNVFGVLMLGVAIWMLERIIPD
                     IVAQALWGILLIGAAVYLSATDPLKEAASGWSRLWKTIGVILLIWGSLILVGVATGGK
                     GSVFTPLAGVGMGTQVGGAQSAAALSFTPVKNLADLNTKLAQAKAEGKPVMLDFYADW
                     CVSCKEMEHNTFSDPTVIAGLKPFVLLQADVTANNADDKALFKRFGVLGPPTIVFFNA
                     KGEEQKAQQVVGYEPPQTFMKHIEAASAP"
     gene            731472..731933
                     /locus_tag="HNEAP_RS03390"
     CDS             731472..731933
                     /locus_tag="HNEAP_RS03390"
                     /inference="COORDINATES: protein motif:HMM:PF04186.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049772460.1"
                     /translation="MIVNPLSLIALLPVIEIILLIGMGSLFGFWFTLLWIIGTAAVGV
                     YLLRRVRGAFQIGRPLDAVGQSTAADSLGIFATWVGAILLILPGPLTDLLGLVLVLPW
                     LRKLTFGIWMAKNLHTIVTRRNARGQVYEGEIVDVHKEHRVIRQVDEDRDK"
     gene            732262..732765
                     /locus_tag="HNEAP_RS03395"
     CDS             732262..732765
                     /locus_tag="HNEAP_RS03395"
                     /inference="COORDINATES: protein motif:HMM:PF01243.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase-like
                     FMN-binding protein"
                     /protein_id="WP_012823558.1"
                     /translation="MSDSSDLPLQPSSDLERLITLRDQARALILATMDEDGFPSLSTL
                     PFVWHEGAFWVLMSDLSPHTRQVRRNPTVELMLLEDESRTHNIYNRVRVTWRSDVTRI
                     ERNDTRVHEMFDALKVRHGKILDVLTQLPDFHLHCIVPGAGRLVNGFGRAFKIDGFEL
                     VAHLRGA"
     gene            complement(732823..733632)
                     /locus_tag="HNEAP_RS03400"
                     /old_locus_tag="Hneap_0672"
     CDS             complement(732823..733632)
                     /locus_tag="HNEAP_RS03400"
                     /old_locus_tag="Hneap_0672"
                     /inference="COORDINATES: protein motif:HMM:PF01578.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c assembly protein"
                     /protein_id="WP_012823559.1"
                     /translation="MTSIALLTILGYVLAAVLLYPGMQPAQTTTKFRKAMLIVSALAM
                     LGNGYLIYQNAYLEHVMGLNMSIFNALSAIFWLSTFITLFTSLRSPVENILLVLLPVT
                     AVSVVLAQFFPDHSIVLHARNPALDAHIFISLIAYALITLGALQALMLSWQHRALHSR
                     NPSGLVSKLPPMESVEELMFRFISVGFLLLTLALATGFIFIENIFALHLVHKTILAVI
                     GWFIFAGLLIGRHVAGWRGKTAVNWTLVGYSTLVLAYFGTKVALEWVFQIR"
     gene            complement(733707..735158)
                     /locus_tag="HNEAP_RS03405"
                     /old_locus_tag="Hneap_0673"
     CDS             complement(733707..735158)
                     /locus_tag="HNEAP_RS03405"
                     /old_locus_tag="Hneap_0673"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylmenaquinone methyltransferase"
                     /protein_id="WP_012823560.1"
                     /translation="MSTEKNLDALLAVDIQPLLRALSAELPADRLSIEPATCWAYGMD
                     NSRLHHAAQLVVFPDRHDEVATLVRLARQHRIPITPRGRGTGTAGGSVPLHGGVVVVM
                     DRMNRVLEFRPEDRLIRVEAGIINAEVQRIVGEAGFFWPPDPTSNALCTIGGNLGCNA
                     AGPHAVKYGTTRENVLGLTAVAGTGDTVKAGTQTTKGVVGYDLTRLFIGSEGTLGIIT
                     EATLKLTPLPDAIRLMRVFFRDMHAASAAVSRLMNQPATPSAIEFIDGNALNLMRQFS
                     DRNSALDIPPEAGALLMIEIDGLAESLDGQIQKIRAAAEGDPGHVMAPISLSVATTKA
                     EIAALWSARKALSPTLRHVAPKKINEDVVVPVSRIPTLIQAIDQSAARHGITIVNFGH
                     AGNGNIHVNLLIDPENPGQMAAAEEALGEIFTTVLALDGTLSGEHGVGAVKRDYVRAE
                     IPPVNLALMHGIKRVFDPEGIMNPGKKLPAPNP"
     gene            complement(735155..735709)
                     /locus_tag="HNEAP_RS03410"
                     /old_locus_tag="Hneap_0674"
     CDS             complement(735155..735709)
                     /locus_tag="HNEAP_RS03410"
                     /old_locus_tag="Hneap_0674"
                     /inference="COORDINATES: protein motif:HMM:PF13580.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoheptose isomerase"
                     /protein_id="WP_012823561.1"
                     /translation="MLKLVHNRLQQTLSQLDAVLSPQSEPLLQAAGAMLHAVLNGQKI
                     LVCGARERSQLAAHFARLMVGQFEHDRPGLPVISLQEFPGGHEPYAKPIRALGTHNDI
                     LFAIARRGTEGLQPALNAARERGMTIVLLTSGVAEQLMPEMQTSDSLLCLASDSERLV
                     HEAQLIILHTLCDLIDRQLLGLTE"
     gene            complement(735787..736212)
                     /locus_tag="HNEAP_RS03415"
     CDS             complement(735787..736212)
                     /locus_tag="HNEAP_RS03415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009617900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YraN family protein"
                     /protein_id="WP_049772461.1"
                     /translation="MRGTDAELPNAKAQTTLARGHRAETMAAEYLSRQGLKLIDRNVR
                     AGRGEIDLIMQDGATLVFVEVRARKAGAWVSAAESVSPAKRKKIIETAERLLNEKPVW
                     RKSPCRFDVVAIGLPSESSSEPAAKQAEVNWIQDAFQAE"
     gene            complement(736259..738523)
                     /locus_tag="HNEAP_RS03420"
                     /old_locus_tag="Hneap_0676"
     CDS             complement(736259..738523)
                     /locus_tag="HNEAP_RS03420"
                     /old_locus_tag="Hneap_0676"
                     /inference="COORDINATES: protein motif:HMM:PF04348.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441099.1"
                     /translation="MGTTGVRRGSVHRHHHDLLLKINLIIIPSIVTLISWQLCHFHHE
                     SHSFAMPATIRDLSAFRRQVASFRHITKAGFAFLLMLGLLSGCAQNPYNSNTSQAPSG
                     PQAALNQALASQDPKQIAAAQMNYAATLKGTTQADMQMRALETAIDAEDFALANTLYA
                     QAHTQALWPAVSARRAQLLTGFEQWQQGSLSNAYDTVNNLPIPLTPDEAKRRLILLAA
                     IDEAEKRPIDAARQRSALNDLLTGAAADQNRATLWNDLSSADINQLSDAAKQATNAHF
                     ADWIGLALAYRTRPGELNTWINNHPDHPAVTSGFTALLLSRSDTATNIPLPTGQGPVI
                     VLVPLSGDYQPVGQAISDGINFAHDRLGMAGDRSVQIQDSGSTLASFTQALTAALATN
                     PSVIIGPLLKEQIPALANLPANAPPVIALNTPTDGTSLPAGVVSYSLSPDADARAAAD
                     QMIRDQKMTALVYCADNSLGHRISDAFTREYTLLGGQILDNAFFEPSATDFSSQLRRL
                     LEVTSSRNGPFQPKIRRDAQGIFLGATSQQMRMIVPQLDYFGADQLPRYSVGMVYNGT
                     PNPLANQDMDGLVIPVEPVLLAANEGPNGTMRPNYERASLSQLPRLFAFGADALMIAA
                     NLQPLLAHQAINGLTGQLSLSLTGEIERKPAWGQFQQGLLQPMDGTDSGYIPSTVVDY
                     SSKQAEGNPTVALPPEDNITPDSGDGTATQPAGSEPTDSGTAKAVPTFTDGGGMAPPP
                     ASVAPTNDTAPMAN"
     gene            738488..739456
                     /locus_tag="HNEAP_RS03425"
                     /old_locus_tag="Hneap_0677"
     CDS             738488..739456
                     /locus_tag="HNEAP_RS03425"
                     /old_locus_tag="Hneap_0677"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008176535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA
                     (cytidine(1402)-2'-O)-methyltransferase"
                     /protein_id="WP_081441178.1"
                     /translation="MDASSADTCCAHAAPTSPVADETEEFDDGLTPTRWVEPGVLYLV
                     ATPIGNLADLSPRAVAVLKGVQVIACEDTRHARKLLDHFGVRQRVVALHEHNEASRVA
                     TVAEWLSEGQSVALISDAGTPAISDPGSLLVRRLVDLGHRVSPIPGACAAIAALSASG
                     LDSTHFWFEGFLPAKTQSRAARLQVLATQPATLIFYEAPHRIRAMLEAAQTHLGEARR
                     AVVGRELTKRFETLVSGDLEYLAAAVQSGQIPERGEFVVLVEGAEPQETSAEASGVAV
                     EQLLTVLLAEKAPASMIARVLTKLTAMKRNEAYAIVQARLGEVSEG"
     gene            739553..740455
                     /locus_tag="HNEAP_RS03430"
                     /old_locus_tag="Hneap_0678"
     CDS             739553..740455
                     /locus_tag="HNEAP_RS03430"
                     /old_locus_tag="Hneap_0678"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-tetrahydrodipicolinate synthase"
                     /protein_id="WP_012823565.1"
                     /translation="MATQQITGSLVALVTPMTDTGAVDYSALAQLVEFHIEQGTDAII
                     SVGTTGESATLDFDEHVAVIEATVRAAADRIPVIAGTGANNTREAIELTEAAKKAGVV
                     AHLSVTPYYNRPTQAGLIAHFTAIADAVDLPMILYNVPGRTAVDMTTQTTLALSAHPR
                     IIGTKEASGSLERIQALIAGAPEGFAIYSGDDGLGCKTILSGGQGTISVTANVAPALM
                     HQMTSAALRGDEDEALAVDARLASLHRELFCQPNPIPVKWAVAAMGLASPALRLPLLP
                     LTPEFIPQVCAALNSAGIATEGCS"
     gene            740592..741719
                     /locus_tag="HNEAP_RS03435"
                     /old_locus_tag="Hneap_0679"
     CDS             740592..741719
                     /locus_tag="HNEAP_RS03435"
                     /old_locus_tag="Hneap_0679"
                     /inference="COORDINATES: protein motif:HMM:PF06804.9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_012823566.1"
                     /translation="MIFNAPSAVRFKLTILAGMVLGASTLAGCSYIPFISSDQPVNRA
                     AKLDVPPAFTPPSPRAELAVPEIASARAAQAAARTEGSGVLVSGTGVKVMGGPDSRYL
                     AVDAKPDAVWPKLQNFLQDEGYIVKKIEPGVGMIETDWTGTQSADQNGFNLMSFLKIA
                     KDTFFKPDHIQKVRIRIENGESKDQTLVFVTSKKMELTGEKPYFPGDDESSFKYANAK
                     ADPALTADMLARLTAYLSGKTEAESRALVAASFAPRSKIIFNKDKDERYLVVSQAYPQ
                     VWNRLGLALDRLGFNPVKSNQKDGEITVTHPYPQSFYADGAIRGAKVDMKQKMSMQLT
                     LKALPQKDGSTRIDVSEISVTGGTLPDDRYAVLSKINEQME"
     gene            741930..743156
                     /locus_tag="HNEAP_RS03440"
                     /old_locus_tag="Hneap_0680"
     CDS             741930..743156
                     /locus_tag="HNEAP_RS03440"
                     /old_locus_tag="Hneap_0680"
                     /EC_number="6.3.4.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate synthase"
                     /protein_id="WP_012823567.1"
                     /translation="MTTQSEFKKVVLAYSGGLDTSVILKWLEDTYGCEVVTFTADLGQ
                     GDELEPARIKAQKMGVKQIFIEDLREEFIRDYVFPMFRANAVYEGEYLLGTSIARPLI
                     AKRLVDIANQTGADAIAHGATGKGNDQVRFELGAYALKPGIKVIAPWREWDLLSREKL
                     MAYAKTHDIPVDFAAAGKKSPYSMDANLLHISYEGGNLEDPWWTPEESMWRWSVSAEA
                     APEQGEEFVLTFVKGDPVAINGEALSPATLWEKLNKLGGAHGVGRLDLVENRYVGMKS
                     RGCYETPGGTIVLKARRALESITLDRGVAHLKDELMPRYAEMIYNGYWWSPERVMLQA
                     AIDASQAYVNGDVRLRLYKGNVQVLGRRSDDTLFDPSIATFEDDAGAYDQRDAAGFIK
                     LNALRMRIAAQAGRHF"
     gene            743246..746044
                     /locus_tag="HNEAP_RS03445"
                     /old_locus_tag="Hneap_0681"
     CDS             743246..746044
                     /locus_tag="HNEAP_RS03445"
                     /old_locus_tag="Hneap_0681"
                     /inference="COORDINATES: protein
                     motif:HMM:PF00563.18,HMM:PF12974.5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_012823568.1"
                     /translation="MTQSVHLETKACYGPRQWVVKVLWCKNIPFFRVLLSLFLFVSSV
                     SGVQAAEPTQTTDKVIQIGVLAYQGKAQTARRWDSTAAYLSEKNPGYSFHIEPMFLSE
                     LAAAVRENRLDFVLTQPLQFVQLAQNDDVWPLATMVVKTPGGTLNRFGSAIIVRADRS
                     DLQHVSDLKNKIVAGASKDALGAWLLGLDTLVRAGIDPKTQIQPLFTGLPMFQIVEAV
                     WQHRADAGVIRAGFLEQLESQGAVKKGEFRVLDPSQYSDYPYLVSTELVPEWPFSATS
                     SVDRVFAEKVARDLMGMTPDNPALISSGISKWALPLDYSTVQQIRDRWLPGDTSLIVL
                     FKSYGWWLLLPIGLMLLVFFLQGKRTQKKIARQEIQLRKTLNALEDSVVVLSLDGRVL
                     FANQPSRQLLRHPVEHTDELSGRHYTVLFDLRWRESDPNFDLRTAIGLLCKRPEQSYS
                     LQLSVGHQIKDIDVHLRLLGSCLDKLSSKIILTLRDVTDYREATALLAYRASHDRLTG
                     LLNLASFADFLETQCNVLEQKKSEGLILWLDVDDFRLINETNSRSAGDQVVARIASFL
                     SFSVPPTGVIARLGVDEFGVWIPDVQSFPYQQWPDELLSGLQDMRFEIGDQRLRVSVS
                     MGACLADYRLGADLLNDAEAACRRAHREGGNRVVWFSRDDQEIESRRHQLATLHQLKQ
                     ALDEEGLMQVIQAIVPLPLPSANQALLPHYEVLLRLRGADGSLQSPVQFIEAAEKYHF
                     MSEIDRWVIRQTFALLTRCGKNPPLLAINLSGATVQDPSMNAFIRSAFREFNLDPALI
                     CFEITETSAITNYELVLELVHSLRQLGCKISLDDFGAGLLSFEFMRRLQPDFVKIDGK
                     LVRDIEHDPVASVIVRAIQQVSEVMGAKTIGEWVENEATLRRLEAIGIDFIQGYYYHA
                     PVPIETLIQEPLIHQLPD"
     gene            complement(746029..746961)
                     /locus_tag="HNEAP_RS03450"
                     /old_locus_tag="Hneap_0682"
     CDS             complement(746029..746961)
                     /locus_tag="HNEAP_RS03450"
                     /old_locus_tag="Hneap_0682"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823569.1"
                     /translation="MLKHPAPIHVTLALACLLALTGCAPGMTAPPGESAQANAQTPAP
                     KTDGALQCAEARFKKTVMLTRVWLPSPPQDVVNLGAALSKTIATDLQNTGHFHVETTE
                     ATQSTGPEPAVDAFKSHGTPYFIRISGHNFGLSGQASMWSFLGPSLNPRGGTLDIRIV
                     DALTTQTIAQTTVSAPSVKAGVYDPVIDALGTDFGASAYGRAMNQLAGEAANWIDRTL
                     GCKPLIGQVLHVDGATITINRGINDGLRSSDRLLILQRTDRVYQPGQDAFTEQYLLQN
                     LGAAEVARLGEHTSRIHYGGQHVVQVGDIVQSGN"
     gene            747063..748466
                     /locus_tag="HNEAP_RS03455"
                     /old_locus_tag="Hneap_0683"
     CDS             747063..748466
                     /locus_tag="HNEAP_RS03455"
                     /old_locus_tag="Hneap_0683"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--tRNA ligase"
                     /protein_id="WP_012823570.1"
                     /translation="MSVRTRFAPSPTGFLHIGGARTALFSYLYARRHGGQFVLRIEDT
                     DLERSTPESVNAILEGMTWLNLDYDEGPFYQTQRMDRYKEVIDQLMASGHAYHCYASR
                     EELDQLREAQMARGEKPRYDRRYRDFTGTPPAGVAPVVRFRNPLDGEVVIEDGVRGRV
                     VFQNSELDDLIIARSDGTPTYNLTVVVDDWDMEITHVIRGDDHLNNTARQINLYHALN
                     VTPPQFAHLPMIHAPDGTKLSKRHGAVGVMQYREEGYLPEALLNYLVRLGWSHGDQEI
                     FDRAEMISFFDIKDINQSASSINPEKLRWLNQQYFKLRPVEETAIELRWHLGRLGVDP
                     SVDGPNPAKIVAAYADRAHTLVEMAEQALPYYRDLTGYDPVALEKLDDDAPGILDALA
                     MALSQPEDWESPAHLDHTVKEVATTLGFKLGKVGPLLRLALLGHGASPSLGVTLDLFG
                     QEKTLHRLRDMHAFLAR"
     gene            748475..750847
                     /locus_tag="HNEAP_RS03460"
                     /old_locus_tag="Hneap_0684"
     CDS             748475..750847
                     /locus_tag="HNEAP_RS03460"
                     /old_locus_tag="Hneap_0684"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="WP_012823571.1"
                     /translation="MVRLPNLMSHSSLRWALAYIVIASLWIALIQWLLSSLGGARWVI
                     SPAGLVVGGVFVLVTAWLLFLLLERNQQGPLAEPNDTHSRGSDPKSWWSALVILIAFT
                     LLAQLFMVSYATREYRPVLLNQAQTELTSQLRLHSKLITDWLTERSQIVDKLAAQSDA
                     LANRIRSSQAQPVPPSGSTFPSFVALIQDGRFHTITLFDPDHVKKLKFGSNLIAKTPD
                     NLFERAAATSKVQFACVFAPGQSGGDCFWVLPVYLSQSEVSGGPWYIVLAAMLNESGL
                     VQSMPAGEPLRLENAVRTLLLLAQGNDSAKSWMTTPLIDDFSQLSEPQMSSRVEPVSK
                     SDLDCFRKSPAFLSLQARLSPYPPDADVLKSTANGQIYCQGHTLLYASTQVPQINGLL
                     WAATTQDIVLDPLRKTRQWLATASLIGVFTLLIALFLFWRIMRLQRAKVLAGLQRERH
                     QLSQLWDSMPAMGLAIVNPTDWHISMVNQRWMQLFHDSQESLLGRSFLDAISPVTGLN
                     TVENLTSGDPKLLEDIHTGLRDEVSLIRRVQTGESSQSWVRFHIRALKSSRHDAEGLI
                     VAAESLGDSIEQANELKAERDFCRLTATFSQPQPKPPVATPMPGSSSDDASEPEIEIA
                     TAVEVSRLTPLAEQVIEQSSLLAICLYTNWPEVWSSSSELTGPQLEQQEHVSFECVGC
                     TAPVREIANQVAQMGLIDRVLVAQTPMFIDDHARNTTISGTLQNELIEQLKQYPVGAL
                     AIVPIPAVNEGDPVRALIVFGEDNLRFTEPVKASLLSLLKALTIRLDEEE"
     gene            751270..751461
                     /locus_tag="HNEAP_RS03465"
                     /old_locus_tag="Hneap_0685"
     CDS             751270..751461
                     /locus_tag="HNEAP_RS03465"
                     /old_locus_tag="Hneap_0685"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600351.1"
                     /translation="MRGLKGSGCILGALFQQGIVVAYKVYNMALNPTHLRGVLFVQNS
                     HKKYTAPPVGLAGRWASKE"
     gene            751458..751793
                     /locus_tag="HNEAP_RS03470"
                     /old_locus_tag="Hneap_0686"
     CDS             751458..751793
                     /locus_tag="HNEAP_RS03470"
                     /old_locus_tag="Hneap_0686"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823573.1"
                     /translation="MNGSHIKYRLGLGSPLLRRSFWETTDRRQLHILIMRFAQKQHLL
                     SGKAKPSFIWRRRRLEAVAVFERRFGPVPAVFRAATLPRKLSLYSTEGRHIWPFAAQP
                     ALQAGSHAA"
     gene            751830..752417
                     /locus_tag="HNEAP_RS03475"
                     /old_locus_tag="Hneap_0687"
     CDS             751830..752417
                     /locus_tag="HNEAP_RS03475"
                     /old_locus_tag="Hneap_0687"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823574.1"
                     /translation="MSTEARLREAIEVGEVLKVVYGGGSQPGAMREVAPISIENGKVR
                     ARCFTSNAVKLFVIEKITILQEANSVSAVEWNPDAEQVPRYQLINDLSEKEIDFLLAL
                     GWHVESDNNCLSLHRRFKNGKPMKGSDVSIDYEEYAYDLVVGLDGELHEENRRKRQRP
                     WSVRGKNQDTRSYGSLDKAAGLFLEWAESLSPSKS"
     gene            752642..752914
                     /locus_tag="HNEAP_RS03480"
                     /old_locus_tag="Hneap_0688"
     CDS             752642..752914
                     /locus_tag="HNEAP_RS03480"
                     /old_locus_tag="Hneap_0688"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823575.1"
                     /translation="MSRLDKEEQEILDAFDTGDLKLSPDSEDRKLRHQQYAEAMFKKD
                     ARINIRLSSKDLRVLQKKALAEGIPYQTLVASILHKYVEGRLHEDR"
     gene            753140..753697
                     /locus_tag="HNEAP_RS03485"
                     /old_locus_tag="Hneap_0689"
     CDS             753140..753697
                     /locus_tag="HNEAP_RS03485"
                     /old_locus_tag="Hneap_0689"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020028056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012823576.1"
                     /translation="MRTVTIKPTDILDYWYSDFMQKHWFASTPALDDVIREKYQSLWE
                     RAAAGELDHWQDSPEGALALVIVLDQFPLNMFRGKPESFRTERKAIDVTLNALKKGFD
                     KQLSKDRLSFLFMPLMHSEILEEQDLSVALFRRYGLTGNIKFAEHHRELVRKYGRFPH
                     RNAILGRESTPAEVAYLASRDAFKG"
     gene            complement(753749..754270)
                     /locus_tag="HNEAP_RS03490"
                     /old_locus_tag="Hneap_0690"
     CDS             complement(753749..754270)
                     /locus_tag="HNEAP_RS03490"
                     /old_locus_tag="Hneap_0690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016239752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_049772560.1"
                     /translation="MISHRKEPRQVDIHKYWSVMNFAERFEQVIATVLGMMIAIIILM
                     ALWELIRDVLTNLFVQHERILSHQVFQSLFGSIMTLLIAMEFQHSIIKVIERREHIIQ
                     TKIVVLIALLALTRKFIILDFTEVQPMMLLALSAGILSLGVVFWFIDKRELGEKEQSS
                     SGELADDITKPHP"
     gene            complement(754804..756048)
                     /locus_tag="HNEAP_RS03495"
                     /old_locus_tag="Hneap_0691"
     CDS             complement(754804..756048)
                     /locus_tag="HNEAP_RS03495"
                     /old_locus_tag="Hneap_0691"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoacetone oxidase family FAD-binding enzyme"
                     /protein_id="WP_012823578.1"
                     /translation="MTEFDVIVIGAGAAGMMCAAQAGQRGRRVLLIDHVTKIGERIRI
                     SGGGRCNFTNKDVKPENFLSQNPHFVRSALAQFSAQDFIRMVERHGIAYHEKTLGQLF
                     CDDSANQIIDMLKAECAQGNVTWAHPCAVTHLTKKTDERFLVETDQGAFTSQSLVIAT
                     GGLAIPKLGATPFGYRVAEQFGLPVIPPHAALVPLALAPTDGEPLQAFTGNSLEVIAE
                     CPSASSGKGQKNTQKAMQNIRFRENLLFTHRGLSGPAILQVSSYWQSQHYSAEKKQPI
                     RLNLLPDLDVSTWLQANRSSKRTLAQCLSDYWPKRIAQDWTAARGWTKPMAEHSNKDI
                     AAMSEMLAAWELMPSGTLGYAKAEVTLGGVDTRALSSSSMEAKDMPGLYFIGEVVDVT
                     GWLGGYNFQWAWSSGWVAGQVV"
     gene            complement(756045..756602)
                     /locus_tag="HNEAP_RS03500"
                     /old_locus_tag="Hneap_0692"
     CDS             complement(756045..756602)
                     /locus_tag="HNEAP_RS03500"
                     /old_locus_tag="Hneap_0692"
                     /inference="COORDINATES: protein motif:HMM:PF07332.9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823579.1"
                     /translation="MPEFVIALLELLEAEGRALKQAIRRVSFGLVFLLTASALILTAL
                     GFLLAAGYLALAAALGSALAALIMGGVSLLLAGTLGFIAYRAPCANRIRLTIMANQSA
                     PRSLDEAKQHFRQSWKDAVNDPLSVVRDTTRRFPWATIAVAGAAGILAERGLPIVFHT
                     LKTTLKTHPEWLLLLAQQLISARKK"
     gene            complement(756609..756965)
                     /locus_tag="HNEAP_RS03505"
                     /old_locus_tag="Hneap_0693"
     CDS             complement(756609..756965)
                     /locus_tag="HNEAP_RS03505"
                     /old_locus_tag="Hneap_0693"
                     /inference="COORDINATES: protein motif:HMM:PF05957.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823580.1"
                     /translation="MATAPKTTEDTSNTTGNDELAAIKQDMHQLKADLADLLVAMKTR
                     GQTKAETLGQDAINTLHDAINALNQRVDAAKEGVSEKTRATVDQAEQVIERHPVASLL
                     TAFGIGFVLAKLFSKH"
     gene            complement(757057..757905)
                     /locus_tag="HNEAP_RS03510"
                     /old_locus_tag="Hneap_0694"
     CDS             complement(757057..757905)
                     /locus_tag="HNEAP_RS03510"
                     /old_locus_tag="Hneap_0694"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase"
                     /protein_id="WP_012823581.1"
                     /translation="MTARYGVIGNPIAHSRSPLIHRAFAEQTSIDLAYTAILAALDGF
                     VATVENFRSEGGLGLNVTVPFKSEAFALCHTLSERAQRAGAVNTLIFPTDPSSSDILG
                     DNTDGVGLLRDLAFHQIPLKGKKILLLGTGGASRGVLAPLLAEIPARLLIANRRVATA
                     EQLATDFQDVSGGHTQLGGCALDALPAEPFDLIINATSASLTGEQLALPDALIGPNTT
                     VYDMAYGREPTVFMQWGAALGAFALDGLGMLVEQAAESFYLWHGIRPQTNHVRDLLKA
                     SLDPAC"
     gene            complement(757914..758576)
                     /locus_tag="HNEAP_RS03515"
                     /old_locus_tag="Hneap_0695"
     CDS             complement(757914..758576)
                     /locus_tag="HNEAP_RS03515"
                     /old_locus_tag="Hneap_0695"
                     /EC_number="5.3.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 5-phosphate isomerase A"
                     /protein_id="WP_012823582.1"
                     /translation="MTPQDQLKQQAAKAALQYVQTGSIVGVGTGSTVNFFIDELATIK
                     HKIEGAVSSSEASTKRLRAHGIEVFDLNGVGDIPVYIDGADETNANLQLIKGGGGALT
                     REKIIAHMAKKFVCVADETKLVPRLGKFPLPIEVIPMARSMVARELVKRGGQPVYRDG
                     FVTDNGNQILDIHNMDIMEPAKLEAELNNIPGIVTVGLFALRPADVLILAAAEGVRTL
                     TI"
     gene            758850..760373
                     /locus_tag="HNEAP_RS03520"
                     /old_locus_tag="Hneap_0696"
     CDS             758850..760373
                     /locus_tag="HNEAP_RS03520"
                     /old_locus_tag="Hneap_0696"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent threonine dehydratase"
                     /protein_id="WP_012823583.1"
                     /translation="MSALLQDYLHRILTARVYDVAKDTPLTPAILLSERLDNRILLKR
                     EDTQPVFSFKLRGAYNMMHRLMSEGRLAHGVITASAGNHAQGVALAAQKLGVAATIVM
                     PLTTPAIKVDAVRRRGAKAVLHGDTFDEAFAHAQQLTQSEGLAFIPPYDHPDIIAGQG
                     TIGAEILRHHPDPIHAIFVPVGGGGLIAGIAVYVKMLRPEIRIIGVEPDDAACLAAAM
                     AAGERVVLDQVGLFADGVAVKQVGEYPFVVAQEAVDEVITVDTDAMTAAIKDMFDDTR
                     SINEAAGALALAGLKKYVKQHDLHGETLIAIASGANMNFDRLRFVAERADIGEQKEAL
                     FAVTIPEKPGSFQVFCELLGRRQITEFNYRYADQDRAHIFVGIRLDTPSDRSAVFNRL
                     VHADYPVIDLTDNEMAKLHARHMVGGHAHGISDERLYRFEFPERPGALLRFLTHLGAR
                     WNISLFHYRNQGADYGRVLVGVQVEQSAMDEFITYLDELSYPYWPETDNPVYNLFLA"
     gene            complement(761369..761836)
                     /locus_tag="HNEAP_RS03525"
                     /old_locus_tag="Hneap_0697"
     CDS             complement(761369..761836)
                     /locus_tag="HNEAP_RS03525"
                     /old_locus_tag="Hneap_0697"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EVE domain-containing protein"
                     /protein_id="WP_012823584.1"
                     /translation="MNHWLMKCEPDVFSIDDLEKQKVEGWYGIRNYQARNMMRDAMKI
                     GDLVFFYHSNVKVPGIVGIMEVISAPYPDPTQFDPKHRYFDPKSTPENPRWVQVDVQY
                     VRHTKRNITLQELKEDETLEDLPLVRRGNRLSIMPISAQSWTRILARENLTAE"
     gene            complement(761854..762438)
                     /locus_tag="HNEAP_RS03530"
                     /old_locus_tag="Hneap_0698"
     CDS             complement(761854..762438)
                     /locus_tag="HNEAP_RS03530"
                     /old_locus_tag="Hneap_0698"
                     /inference="COORDINATES: protein motif:HMM:TIGR02727"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="WP_012823585.1"
                     /translation="MQSSKTSLRRQLRQARKSLTGYRRDRQQQRIRRFLTAIPQVRHA
                     RRIAAYMPFDGEPDLFPFMRRVESKIWLPMIRSDLHLDFRPAFTLNTKAQRPINARRN
                     RFGILESQRLPILRSAQMDVILMPLVGFDRRGNRLGMGAGFYDRSLVGLRRPRPTLIG
                     IAFDCQEMAQVPADPWDVPLDYIVTNRGIIKTNR"
     gene            complement(762464..762648)
                     /gene="ssrS"
                     /locus_tag="HNEAP_RS12040"
     ncRNA           complement(762464..762648)
                     /ncRNA_class="other"
                     /gene="ssrS"
                     /locus_tag="HNEAP_RS12040"
                     /product="6S RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00013"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00013"
     gene            complement(762744..763415)
                     /locus_tag="HNEAP_RS03535"
                     /old_locus_tag="Hneap_0699"
     CDS             complement(762744..763415)
                     /locus_tag="HNEAP_RS03535"
                     /old_locus_tag="Hneap_0699"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine-dependent
                     methyltransferase"
                     /protein_id="WP_012823586.1"
                     /translation="MHSNHTVSGNSRAVISTQTGPHEQLLAQVTKHSRSDWGKPITDY
                     NRAAFDRAQEWLLERTGKLILDSGCGTGDSSRALAEMFPAHQIIGIDRSAHRLSRQRQ
                     HTPDNCLLVRADLLDFWRLAEQAHWRPERHFLLYPNPEPKPKHLTRRFHAHPIFPVLL
                     ALGGAFECRSNWLIYLEEMALALQYHHKTAQIQPIDGNVPPCSPFEHKYRISGQPLWR
                     LQAML"
     gene            complement(763501..765183)
                     /locus_tag="HNEAP_RS03540"
                     /old_locus_tag="Hneap_0700"
     CDS             complement(763501..765183)
                     /locus_tag="HNEAP_RS03540"
                     /old_locus_tag="Hneap_0700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-aspartate oxidase"
                     /protein_id="WP_012823587.1"
                     /translation="MTETPAVDVLIIGSGAAGLTAALRLPTHLKVTLLSKGAINSGST
                     PWAQGGIAAALGGIEDVEQHVHDTCRAGSDLPDVTVVRRVVASGARQIDWLRSLGMPF
                     SSEDAPGETGTEQLHLTREGGHGTRRVAHAADHTGRTLVETLLETVYTRPNITLLEHQ
                     LAVDLITTHRLGLNDQPNRCVGAYVLDLKSDHVHTLRAGHVILATGGAAKAYLYTTNP
                     DSSTGDGIAMGWRAGCRVANMEFMQFHPTCLFEPRAKSFLISEAVRGEGGVLLLPDGT
                     RFMPGYHPDAELAPRDVVARAIDSEMKRTGADCVYLDISFKGKAFIEQHFPMIHARCL
                     QYGYDMTRQPLPVVPAAHYTCGGIVVDEHGCTDIAGLYAIGETSHTGLHGANRLASNS
                     LLECLVYGEAAAADIAQRHETDKSKTQPFPVIPDWDDSQVTDPDEAVIVSHNWDELRR
                     AMWDYVGIVRTTKRLERAAHRIALLRREIQDYYAHFRVSNNLIELRNLVEVADLIVKS
                     ALARRESRGLHFTRDFPERNPELAHINTICNPQSQRPPSATKEVENQVRSSL"
     gene            765357..765983
                     /locus_tag="HNEAP_RS03545"
                     /old_locus_tag="Hneap_0701"
     CDS             765357..765983
                     /locus_tag="HNEAP_RS03545"
                     /old_locus_tag="Hneap_0701"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoE"
                     /protein_id="WP_012823588.1"
                     /translation="MATDTTPSVTEQATDQPTDQQLVLRAQQGDRRAFDLLVLKYQHR
                     VLRLVGRFVRDQDQAFDLAQEAFIKAYRALGNFRGESAFYTWLYRIAVNTAKIQLVAD
                     ARGGYSVSLNSGGGDESDEALPEPEALRDHASPEDMAATQELEAEIRAAIRALPEDLR
                     TALTLREMEGLSYEEIAVVMNCPIGTVRSRIFRARESVEERIKPLLDS"
     gene            766048..766710
                     /locus_tag="HNEAP_RS03550"
                     /old_locus_tag="Hneap_0702"
     CDS             766048..766710
                     /locus_tag="HNEAP_RS03550"
                     /old_locus_tag="Hneap_0702"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823589.1"
                     /translation="MNTQHNAHMPLPSTPEEAISAWWDDECMPHQTDRLMSLAENDVR
                     QSLRCYSLIGAALRLEQLDKRDVSALISARLAQDEGQAQQLAQHLASTSGGRVLPFPQ
                     SQVRRSMNRWRGAIAASFVAGLVGVGIWMMPQNAPENALIQQARNVPASLQQSANGNN
                     AAQALPVVARVTPDTILPGWAQGSARKAPMDPYLMTHFESVSPDLSEVMPSLRMTSFQ
                     TE"
     gene            766714..767007
                     /locus_tag="HNEAP_RS03555"
     CDS             766714..767007
                     /locus_tag="HNEAP_RS03555"
                     /inference="COORDINATES: protein motif:HMM:PF03888.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600352.1"
                     /translation="MIRGISIGLLCSLAVIGSVEANTVESGTFQAHVLLVADSSAQPA
                     SEAGAIQLLNEMTQAMEKTDYAGTYVHLRGDQIDTTKLWHRATADVSRSVCKP"
     gene            766959..767837
                     /locus_tag="HNEAP_RS03560"
     CDS             766959..767837
                     /locus_tag="HNEAP_RS03560"
                     /inference="COORDINATES: protein motif:HMM:PF03888.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441100.1"
                     /translation="MASRDRRCQQERLQTMSGEPREVIRHGNHCECAWPLRKEVVFGD
                     FPGVRSRLSGERFEHPETLNANYHIVNLGSSRVADHACQLVGLVPRDQFRYGYKLCIG
                     NESHLLLRMSIYSDQGRPIEHDFFTELHFRPQGDTTPTEAWPDIPMDTPQTIPPGYKV
                     VERGQAQPAEPLTPEQGWIVSPELPGYSTKSRVWRTNPVTGHRFEHMIVSDGLSTASV
                     FVEDMPQPKALNPDAAKYGMNITVRQVGPVRLTVIGDLPMAAVEQICKHTVPAKDANT
                     ERGERNPMLSPSQEAR"
     gene            767837..768388
                     /locus_tag="HNEAP_RS03565"
     CDS             767837..768388
                     /locus_tag="HNEAP_RS03565"
                     /inference="COORDINATES: protein motif:HMM:PF04246.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="positive regulator of sigma E, RseC/MucC"
                     /protein_id="WP_012823590.1"
                     /translation="MNRQPHDPSRLKQPAIGSVPYAEHRLAGLESSKSDTADIQEEGV
                     VVAVAADGVWIETQRQSGCQSCSSRGGCGVGIMQKALNRRQHRVRVHTDLPVKVGDHV
                     QLLLPAAALVQASVLMYLLPLLGLIVGAMIGQSLLATDAGAIGGAVVGFAAVLLLIAR
                     QQNGLSRNGRYAPRIERVLFKSA"
     gene            768513..769448
                     /locus_tag="HNEAP_RS12180"
                     /old_locus_tag="Hneap_0705"
     CDS             768513..769448
                     /locus_tag="HNEAP_RS12180"
                     /old_locus_tag="Hneap_0705"
                     /inference="COORDINATES: protein motif:HMM:TIGR00254"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_012823591.1"
                     /translation="MAAYRTTIRDTSDMTSYRLPSMVGVAKGRGHLPEETGAFHIDLM
                     LAAQRCMDPLSLLNELYERVSQYLPIEGFLWRQEHDEVSTPFFQGESNGQCVLHNLEL
                     KQADVRLGKLAVCAERSLSEEESAWMLRVAQSIAFALRNTFLFQKALFEANQDPLTGL
                     KNRRVFDTEIAREQARFVRYNIKSSLVVMDLNGLKSINDTWGHDVGDRAIRLFSNGLQ
                     QVLRDTDQAFRFGGDEFCAILPATNLYGAKKMAERMSAWLDAHELSLPSGELINVRTS
                     FGLAEAEKNSDEKEWFRRADQSLYHNKHKFKQTAA"
     gene            769530..770093
                     /locus_tag="HNEAP_RS03575"
                     /old_locus_tag="Hneap_0706"
     CDS             769530..770093
                     /locus_tag="HNEAP_RS03575"
                     /old_locus_tag="Hneap_0706"
                     /inference="COORDINATES: protein motif:HMM:PF03748.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600354.1"
                     /translation="MDMAKAEEAADEAPKAKGGSKLMLILMIVIIVLLLAAVGVGAML
                     LLKKPAAESANAAATTEQTTEGHANGDQKAGDSEKHGAPITVSLGQPITVNLAEPNDA
                     KLLQVELDLITYDPDAEAMVKTNRAEIINNIMLVLSDVNAAKLRTRQGKEDLQKQLKE
                     AVNAVLEKRSGKKDEIDDVYFTKLLMQ"
     gene            770103..771146
                     /locus_tag="HNEAP_RS03580"
                     /old_locus_tag="Hneap_0707"
     CDS             770103..771146
                     /locus_tag="HNEAP_RS03580"
                     /old_locus_tag="Hneap_0707"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliM"
                     /protein_id="WP_012823593.1"
                     /translation="MSSVDVLSQDEIDALLNGVDEGDVATEEGVGDPSEARSYDLTTQ
                     ERIVRGRLPTLEMLNERFARNFRIRLVSMLRRTVDISIEGVRMMKYSEYSHALYVPTS
                     LTLVHVRPLKGTGLFMMESQLVFKLVDNFFGGFGMHAKIEGRDFTPTELRVITRVLEQ
                     AIDEVQRSWTPVYPVNIQTVSHEMNPQLANIVSGTEVVVVNSFRIEVEGGGGKFDIVL
                     PYSMIEPIRDLLDGGMQGDRLEVDERWTQALKRELGRADIELVAQLGEMRMSLADIAH
                     MEVGDVLPFEMPEQVVLTAQGLPLYQGKLGVHRGNKSVRIQSPVKERLERNVRPNELL
                     RNKHKDKSDESTD"
     gene            771187..771606
                     /locus_tag="HNEAP_RS03585"
                     /old_locus_tag="Hneap_0708"
     CDS             771187..771606
                     /locus_tag="HNEAP_RS03585"
                     /old_locus_tag="Hneap_0708"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015819517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliN"
                     /protein_id="WP_012823594.1"
                     /translation="MAENTEQTDDSMDDWAAAMAEQAEVESGQTKSGGTVPPLDQFES
                     AGKSNGTENPINLEVLMDVPVTLSMEIGRTSLNIRSLLQLNQGSIVELDRLAGEPLDV
                     LVNGTLIARGEVVVINEKFGIRLTDVISPAERLRKLR"
     gene            771612..772247
                     /locus_tag="HNEAP_RS12185"
                     /old_locus_tag="Hneap_0709"
     CDS             771612..772247
                     /locus_tag="HNEAP_RS12185"
                     /old_locus_tag="Hneap_0709"
                     /inference="COORDINATES: protein motif:HMM:PF04347.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FliO"
                     /protein_id="WP_012823595.1"
                     /translation="MYEFCLQRAGLMRDDSFAGWLRHYFHAKWRLPLPMIFLGLALVF
                     GNPSAALAADVASATPAQTHAAESVASPTSPKPELFDPLSSGYLLKLVFSLVIVLALM
                     FVVVWLLKRTGRFNGRAGSYPLHVLAQMPVGTRERVLLIAVGDRQMLLGVSQGHIEPL
                     GWVDPPLSPDTISKSNPLEGAFAQLMKNNMSQRPPSGGTVDTSDVKRESSQ"
     gene            772258..773082
                     /locus_tag="HNEAP_RS03595"
                     /old_locus_tag="Hneap_0710"
     CDS             772258..773082
                     /locus_tag="HNEAP_RS03595"
                     /old_locus_tag="Hneap_0710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FliP"
                     /protein_id="WP_012823596.1"
                     /translation="MSNEKMSRLPASRFGWLLLLIAGLFLCTTHLAHAAPAVTQAMAA
                     PGLPAVTLTTDGAQTQYSLTLQILALMTVLTLLPSLLLLMTSFTRIIIVLSLMRQALG
                     LTQTPSNQILIGLALFLTLFIMAPVFQKSYDEGIKPYMDQKITANVAIEKAAEPLRTF
                     MLNQTRQSDIALFQNIGHYPAFETPKDVPYTVLMAAFITSELKTAFEIGFLIFIPFLI
                     IDLVVASVLMSMGMMMLSPMIVSLPFKLMLFVLVDGWTLIMGTLASSFYMGAPLGS"
     gene            773125..773394
                     /locus_tag="HNEAP_RS03600"
                     /old_locus_tag="Hneap_0711"
     CDS             773125..773394
                     /locus_tag="HNEAP_RS03600"
                     /old_locus_tag="Hneap_0711"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009024984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar export apparatus protein FliQ"
                     /protein_id="WP_012823597.1"
                     /translation="MSPDTVLDLTRQAMVIILLLSMPILLTALAVGLLVGMFQAATQI
                     NEMTLSFIPKLFAVVLAILLAGPWMLHLLVDFTTDLFHRIPGLIG"
     gene            773399..774175
                     /locus_tag="HNEAP_RS03605"
                     /old_locus_tag="Hneap_0712"
     CDS             773399..774175
                     /locus_tag="HNEAP_RS03605"
                     /old_locus_tag="Hneap_0712"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FliR"
                     /protein_id="WP_012823598.1"
                     /translation="MILSLAEVMGWVGSYVWVLVRVAALLMVVPIFGARGVPKRWRIL
                     AALVFSLIIAPTLPPVPTIDPLSVAGILLVAQQIIIGVTMGFVLGLIVSSFVVAGESM
                     ALGMGLGFAQTVDPQNGVSVPIVSQFLTVVATLLFISLDGPALIVKMLADSFVWLPIA
                     PVGLSPETFWRVVGFGQSMFINAILIALPVIISLLMVNLAMGVITRAAPQLNIFSIGF
                     PATLLIGFFLILVSSPTWVPILEHFLQQTLQFISDLLRQP"
     gene            774175..775314
                     /locus_tag="HNEAP_RS03610"
                     /old_locus_tag="Hneap_0713"
     CDS             774175..775314
                     /locus_tag="HNEAP_RS03610"
                     /old_locus_tag="Hneap_0713"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="WP_012823599.1"
                     /translation="MAENENGQEKTEEPSEKRLREAREKGQVARSRELGSLALTAGSA
                     IVFLVMGGHMLSRLEQMFRHAFTLSRAEIMDPATMFHRLALSFSEGFLALLPFFLAAV
                     VLAVSSTLLVGGWNFSTQALAPQFNRLNPLSGFKRMFSMKSLVELLKTLAKFFLIAAI
                     AIGLFEAMEKDFVGLGLMGLEAGLARAGTLLSWSFLGLSLGLLVVAMIDVPFQMYEYK
                     KGLRMTRQEMIDEYKEVEGKPEVKQKIRQLQRQMAQRRMMEAVPTADVIITNPTHFSV
                     ALKYQPNSDAAPMVVAKGADEMAMTIRKIANANHVPLFESPQLARSLFAHVEVGDAIP
                     SGLYVAVAQVLAYVFQMKGASAPPERPDPSVPDEFRAGPDGRPSV"
     gene            775348..777476
                     /locus_tag="HNEAP_RS03615"
                     /pseudo
     CDS             775348..777476
                     /locus_tag="HNEAP_RS03615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004999326.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhA"
     gene            777530..778987
                     /locus_tag="HNEAP_RS03620"
                     /old_locus_tag="Hneap_0715"
     CDS             777530..778987
                     /locus_tag="HNEAP_RS03620"
                     /old_locus_tag="Hneap_0715"
                     /inference="COORDINATES: protein motif:HMM:TIGR03499"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhF"
                     /protein_id="WP_012823600.1"
                     /translation="MKIKRIIAGDMREAMRQVRQLFGDDAVILSNRPCPEGVELVAAI
                     DFDEQAIRRDAGRQAPYRVAGSSPVDLAPLSRFPLEKSAVATEPNQVTADLLAARQRR
                     QMQEQLSVAEQAVAQVPAGPSSAAEPIQDPFAEALAEFNDSKQVNSSSKAQSSAARAE
                     PRDLRGHWRETSDTKSPEALNELKAEVGQLRALFERQLDVLEWHRYSAAHPAELETCE
                     RLETLGIPKGLAKKLAQDAARQEPDRALSAALKSLGENISAPAQSAFMQGGMFAFIGP
                     TGVGKTTTLAKIAAQAVLAHGRDSVALITTDRFRIGAQEQLRNYARILNIPLHVARDE
                     QHLAELLPAVSSKRLVLIDTAGMSPRDMHMMDALKKLPVINERLNVLLVLSAQAQYSA
                     MTDAINRFQVLPLAGMILTKLDETILLGSALAALIHGRLPLVCTGVGQRVPEDLWYPS
                     TADLIKQAIELGQGERARADSEYSASQPASWSVGA"
     gene            779042..779872
                     /locus_tag="HNEAP_RS03625"
                     /old_locus_tag="Hneap_0716"
     CDS             779042..779872
                     /locus_tag="HNEAP_RS03625"
                     /old_locus_tag="Hneap_0716"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="WP_012823601.1"
                     /translation="MQNQPVRVIAVTSGKGGVGKTNVSVNLSVALARRGHRVLLMDAD
                     LGLGNVDVLLGLKSNQNLSHVLSGEASLDDILLEGPQGIGVLPASSGIKHMAELSAAE
                     NTGLIHAFAGLQRPTDIMVVDTAAGIADSVIRFAQAANDVVVVVCDEPASITDAYAMI
                     KVLSRDHGVQRFQVVANMVRDTTEGRRLFEKLNAAASRFLDVTLIHLGSVPFDEYLRR
                     AIQRQKPVIEVFGGARSSRAFVEMADQIGRWPEPHGVQGHLQFFIERLIQSELDMEAL
                     "
     gene            779872..780591
                     /gene="fliA"
                     /locus_tag="HNEAP_RS03630"
                     /old_locus_tag="Hneap_0717"
     CDS             779872..780591
                     /gene="fliA"
                     /locus_tag="HNEAP_RS03630"
                     /old_locus_tag="Hneap_0717"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008439151.1"
                     /note="sigma factors are initiation factors that promote
                     the attachment of RNA polymerase to specific initiation
                     sites and are then released; this sigma factor directs
                     late flagellar biosynthesis genes; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor FliA"
                     /protein_id="WP_012823602.1"
                     /translation="MNVRAMYTDVQRGGAEAVVAEHAGLVKRIAFHLMNRLPDHIQAE
                     DLIQAGMIGLLEASNHYDAAQGASFETYAGIRIRGAMLDEVRRNDWAPRSVHRRHREI
                     SQAVHEIETRTGCEAKDADVCALLGISLDDYYEALNDSVQVRLAPLDAGGEDHNETID
                     VADHRDQPDQYLSHERFHEDLAEHISALPERERLVMSLYYVDELNQKEIGAVLGVSES
                     RVCQIQNKAILRLKSSLKDWR"
     gene            780887..781273
                     /locus_tag="HNEAP_RS03635"
                     /old_locus_tag="Hneap_0718"
     CDS             780887..781273
                     /locus_tag="HNEAP_RS03635"
                     /old_locus_tag="Hneap_0718"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015476557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_012823603.1"
                     /translation="MDLNMKILVVDDFSTMRRIIKNLLKELGFSNIEEADDGTTALPM
                     LKQGKFDFLVTDWNMPGMTGIDLLKAVRADPALVNLPVLMVTAEAKREQIIMAAQAGV
                     NGYVVKPFNGPTLKEKIDKIFERVQS"
     gene            781374..782129
                     /locus_tag="HNEAP_RS03640"
                     /old_locus_tag="Hneap_0719"
     CDS             781374..782129
                     /locus_tag="HNEAP_RS03640"
                     /old_locus_tag="Hneap_0719"
                     /inference="COORDINATES: protein motif:HMM:PF04344.11"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441101.1"
                     /translation="MHLMDEEEKRVRLNQARALLAAVESGDEADFEHQLTALTAGQRQ
                     PVFEQVGQMTREVHEALMAFALDERLDRMAEAEMPDARDRLRYVISLTEQAATRTLAL
                     VEEAFPLTERLVERSERLHQQLAQVAEKEADNRRLVEVIHTITDYLDSVLGSGNALKS
                     RLTEVMMAQEFQDLSGQLLMRVINLLEQLESKMVSLLHLTSPEITSGDRQKKGGDSSE
                     DLQKGTGPALPKESSDVVKSQDDVDDLLASLGF"
     gene            782171..784330
                     /locus_tag="HNEAP_RS03645"
                     /old_locus_tag="Hneap_0720"
     CDS             782171..784330
                     /locus_tag="HNEAP_RS03645"
                     /old_locus_tag="Hneap_0720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheA"
                     /protein_id="WP_012823605.1"
                     /translation="MAFDADNELLQDFLIEAGELLDALDTQLVGLEQMPDDKDLLNAI
                     FRAFHTIKGGAGFLEVTPLVEVCHRAEDIFNLLRNGELKVTPAIMDVMLRVLDALNTM
                     FANLRAGKFPDSVGAAFLKEIEALSSSQKPSLAPSRVNTVSAAPPAQVKPEPVAQPNI
                     SQPPVASVVDSEFDQMLRDLESAEQTQVQAQTDSSAADDLITDEEFEALLDRLHGEGQ
                     FSPQAVVEEQKSAVEASSASDEITDEEFERVLDSLYGKGQGPTSVPVTQAEAAPANKT
                     VEKALESAPVDVASAQPISTAATVDKAKPAPEKDKPQQVAEAPKQETTVRVDTERLDF
                     IMNLVGELVLVRNRMNTLKLSFENEEVTQVIATLDMVTSDLQGAVMKTRMQPVKKVFG
                     RFPRVVRDTARVLGKQVELVLIGEETDLDKNLVEALADPLIHLVRNSVDHGIEMPDVR
                     EAQGKPAQGTVTLSAAQEGDHIRLSISDDGAGMNAEVLRRKAVEKGLMTQDAASRLSE
                     QECFELILLPGFSTKDQISDISGRGVGMDVVKTAITRLSGLISIDSEQGVGTTINIKV
                     PLTLAILPTLMVVVSGRKYAIPLGIVSEIFEMADKEINVVDGQATIIVRDRALPLYRL
                     NHWLALRGETLTGRDASDLVVMVQVGAQLIALVVDSVIGQEEVVIKPLGELLHNVGGF
                     AGATITGDGHIALILDLPGLMRRHIPARSKPKLKVVA"
     gene            784335..785387
                     /locus_tag="HNEAP_RS03650"
                     /old_locus_tag="Hneap_0721"
     CDS             784335..785387
                     /locus_tag="HNEAP_RS03650"
                     /old_locus_tag="Hneap_0721"
                     /EC_number="3.1.1.61"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004394820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis response regulator protein-glutamate
                     methylesterase"
                     /protein_id="WP_012823606.1"
                     /translation="MAFGVLIVDDSVFFRRALRELILADDRLTVVGEAANGREAILKA
                     CQLKPDIITMDVEMPIMDGISAVREIMNRCPTPIMMLSSLTQAGAVATLEALDAGAID
                     FYPKSSSDAKEALGEGARLLTTRLRLLAARKQRQAIVAESAARGSATVAPRHAEQGVI
                     GRRGLVVIGSSTGGPAALQTVLQEIPANFPVPIVIAQHMPASFTGPFASRLNSSMALN
                     VVEAKDGAPLVAGTAYIVPGGKHGEVHLRSGTLVFSEREPAAGENFRPSVNFLFQSAA
                     QAAGSDVLAVVLTGMGDDGTEGARAIRAASGHVWAQDQASSVIYGMPAAVAKAGLTEA
                     VLPLKEVGAAILRSVR"
     gene            785384..786238
                     /locus_tag="HNEAP_RS03655"
                     /old_locus_tag="Hneap_0722"
     CDS             785384..786238
                     /locus_tag="HNEAP_RS03655"
                     /old_locus_tag="Hneap_0722"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobyric acid synthase"
                     /protein_id="WP_012823607.1"
                     /translation="MNIWAVANQKGGVGKTTTSVSLAGLLAQRGQRVLLIDIDPHGSM
                     TTYFGMEPDAPGASVYSLFKAAAEGTVLNPLRVIHPTAFENISLMPAATALATLDRQL
                     GKQEGMGLVIKRALDTLSDQFDAVIIDCPPILGVTMVNALAAAQFLLIPVQTEFLALK
                     GLERMLKTLGMVQRSRKIRLDYLIIPTMYDQRTRASRDTLQVLQDRYHGSVWSEFVPI
                     DTLFREASRLGKPLSYLQPESRGSLAYANLLALLLKSNPASSKAAARPGSDNIPVAAN
                     ALAEGMLP"
     gene            786235..787104
                     /locus_tag="HNEAP_RS03660"
                     /old_locus_tag="Hneap_0723"
     CDS             786235..787104
                     /locus_tag="HNEAP_RS03660"
                     /old_locus_tag="Hneap_0723"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823608.1"
                     /translation="MKTHHTGVHSSSHSGHEQFTGLADQDAAIDAYLDGLLRDPESEP
                     YWSTDATDVVDHYDDGLSDDAMGDFEQIKRPVGLSLVDLSKYKTVVIDEQVAAQQTSS
                     LPQPEEPSSDALSLEMVAQESIELAEEDEAPVSASLAEASEEVVSAAVPKLESGWQVF
                     ALGHLKVALPSTEIFDIIDGASLRPIPGAPANVAGAVRFQDRSRMILSLDAWLPKVTG
                     DSRVVLLGAQGLWGVRVGAEIVDLTWDEAGTSWRDASERDAGRPWLAGVNRAAGVAFL
                     AVESLRSALNASR"
     gene            787170..787640
                     /locus_tag="HNEAP_RS03665"
                     /old_locus_tag="Hneap_0724"
     CDS             787170..787640
                     /locus_tag="HNEAP_RS03665"
                     /old_locus_tag="Hneap_0724"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012637915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600674.1"
                     /translation="MGLEQGPTVVTRWVSFTVADETYALNVLDVQEVLRAAEITPIPG
                     AHPAIRGIINLRGNVVTILDARIFFSLPEKPFDDDSRIMVAELRSGEVAGIVVDSVAE
                     VIALDEELVKEAKRSSSDEGSSHILGVVTQQSEKGNDKLIILVDLKGLSDLGEK"
     gene            787637..788071
                     /locus_tag="HNEAP_RS03670"
                     /old_locus_tag="Hneap_0725"
     CDS             787637..788071
                     /locus_tag="HNEAP_RS03670"
                     /old_locus_tag="Hneap_0725"
                     /inference="COORDINATES: protein motif:HMM:PF10975.6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823610.1"
                     /translation="MNQYWLIGLAAAALVLALVSLIAIARIQSVLKAQTSNARWLQAR
                     MERIENEQGSIESALAGLGRHMDGFDQKLVQQAKRLEHVETRFESVATGDSTERGFDH
                     ALRLSAQGRVTLQELINDFGLSESEAQLLLRINQPNAGTRAG"
     gene            complement(788244..790250)
                     /locus_tag="HNEAP_RS03675"
                     /old_locus_tag="Hneap_0726"
     CDS             complement(788244..790250)
                     /locus_tag="HNEAP_RS03675"
                     /old_locus_tag="Hneap_0726"
                     /inference="COORDINATES: protein
                     motif:HMM:PF01841.17,HMM:PF13559.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase"
                     /protein_id="WP_012823611.1"
                     /translation="MNSKMQPLDRPLGIVIALAIADHLPHMPIWAIPLVLLGLVWRFQ
                     HEWRGWPLPTQPLLILLAIVFSLLVLFTYQSLWGRDPGVTMLTLGALLKLLETRQLRD
                     QFALLLLGFFLIVSLLLFDQGIFTALISLGLFAGLVTAWIGISNPNIRLIKPRIKAAS
                     GLMLAGLPIALLLFLLFPRPPGALWGTKQPTTAQARTGLSDQLTAGEFERLSTDPTPA
                     FRVHVNGAMIPPPERYWRVLVMSDETNNTWHADIPNIFRPVRAPNVRVDPTSAVEYTV
                     TLEPSDRRFLPTLAMATVLPRQSVLSDTGSLFSLRPLNDRYRYTVTSAIRYHLDERRL
                     SADTRERNLALPTGDPKLKALAAQWKGLAPLEIRDRALNYFRSQGFSYTLTPGKLPEQ
                     NRMDTFLFDTKRGYCEHYASAFTLLMRAAGVPARIVTGYQGGEVNGDYLLVRQADAHA
                     WSEIWVKGEGWIRVDPTQTVAPERITDGIAQAAQQDAALPASLRRDDSLARQWSLLGD
                     RVENDWNQYVLGYSGSTQTDLLQWFGLEKISQWGRFGFAFIIVAIAWILIFGFWRHLS
                     RPEKHMPPVDRAWFAVATALSRLGITRQPGETLQAYCRRAEQSLPNHAAAIRQTQQLI
                     SQWRYAPRFSKRSQALAEKTAQNLSTQLKWLRWRENVFQGRKRN"
     gene            complement(790247..791155)
                     /locus_tag="HNEAP_RS03680"
                     /old_locus_tag="Hneap_0727"
     CDS             complement(790247..791155)
                     /locus_tag="HNEAP_RS03680"
                     /old_locus_tag="Hneap_0727"
                     /inference="COORDINATES: protein motif:HMM:PF01882.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823612.1"
                     /translation="MASTAKIRLRPNKIGFGFIALSIAMLLAAINYGNNLVFFISFLL
                     LALMGNSAWQTRRHLKSCQIQLLNPPARFDGEIGMLPVQIESSINNPSILARAGEAEP
                     LTLNLSAGRTELVELALRPMPRGRYAAPDVILSTRYPIGLWTAETRWVSLPHWQWIYP
                     KPVGEAPLPTNLLPAHAEDPDVSLQSGDDQFDHLRAYVSGDALSRIAFKHYARSGQMV
                     TQHWQSSEAIHDEIILDYSQLSGSTEMRLQQLTRWILSLAADHRSFTLKLPGIADRQG
                     ADSTHVTHCLEALTLFSPAHNPRHPS"
     gene            791368..792459
                     /locus_tag="HNEAP_RS03685"
                     /old_locus_tag="Hneap_0728"
     CDS             791368..792459
                     /locus_tag="HNEAP_RS03685"
                     /old_locus_tag="Hneap_0728"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AI-2E family transporter"
                     /protein_id="WP_012823613.1"
                     /translation="MRWIVIVGLALAMYIVYLLSPILTPFLAGVVLAYLFDPLVTRMV
                     GWKINRTLGTTVVFFVILLVMILAGLALVPVVINQAVKLISVFPKLLAMLQDQLVPYI
                     NAKLGLDINLNSMTQLTVQHAQEIGSVLAKSATVVFGNGSAVVLSMMNLILIPVIGFY
                     LLRDWPHLLQRIQELMPRRQEPQWVALAQESNQMLGGFLRGQLAVMLANGITYAIGLT
                     IVGLETGVVIGMAAGMLSFVPYLGNVIGITTALIAMYIQTGEFTPLLWVLLVFGIGQT
                     LESILWQPRFVGERIGLHPVAVIFAVMAGGVLFGFFGVLLALPVSAILVVLGRHALKR
                     YRESPFYEDADKVKVLLAPSKDTWAEKSE"
     gene            792500..793201
                     /locus_tag="HNEAP_RS03690"
                     /old_locus_tag="Hneap_0729"
     CDS             792500..793201
                     /locus_tag="HNEAP_RS03690"
                     /old_locus_tag="Hneap_0729"
                     /inference="COORDINATES: protein motif:HMM:TIGR03420"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DnaA regulatory inactivator Hda"
                     /protein_id="WP_012823614.1"
                     /translation="MNTSGKMQQIPLDLALNAPHSLDGFIGVENLLLRALITQLALGR
                     GEAQLFIHGAQNCGKTHLAQAACFYAGQQGRSAAYIDVKKNPSQLDHMNLSHIDLLVL
                     DDVDALAGDDQGEFLLFDLINRLREQEIPLLMTASLPPAACGFQLPDLLSRLGWGITM
                     LIHAPNEAEKIELLRRKAQERGFDLPFESAVYLLQRSPRDLGSLLKIIQDLDHASLSA
                     QRKLTIPFVRSVLFP"
     gene            complement(793214..793795)
                     /locus_tag="HNEAP_RS03695"
                     /old_locus_tag="Hneap_0730"
     CDS             complement(793214..793795)
                     /locus_tag="HNEAP_RS03695"
                     /old_locus_tag="Hneap_0730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823615.1"
                     /translation="MEKNVDEIRARIRGLQEELEAEYLKSIEAFEERRAHLAEEFQQQ
                     QKRYKMGLLQFIIKTKPLTLLTAPVIYLGWIPFFLLDLFVTLYQAICFPVYGIPKARR
                     SAYLVFGREDLPYLNLIEKFNCLYCSYGNGVVAYAREVAARTEQYWCPIKYARRIRSA
                     HDRYPEFFDYGDAEAYTKGLARLRKSYDEEQLK"
     gene            complement(793935..794336)
                     /locus_tag="HNEAP_RS03700"
                     /old_locus_tag="Hneap_0731"
     CDS             complement(793935..794336)
                     /locus_tag="HNEAP_RS03700"
                     /old_locus_tag="Hneap_0731"
                     /inference="COORDINATES: protein motif:HMM:PF13682.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823616.1"
                     /translation="MTASHSTKAKTFDYDQFINEFEEVTYWHFAWYSQIMAALLFDQS
                     KHIQGHHDCKFGQFLDRTEIPPELKTEFDAVRNLHKQMHESASALIASRNDSKEVEEE
                     IFQEFSELQSLFAAACNALLRVAITRFAKQS"
     gene            complement(794415..795173)
                     /locus_tag="HNEAP_RS03705"
                     /old_locus_tag="Hneap_0732"
     CDS             complement(794415..795173)
                     /locus_tag="HNEAP_RS03705"
                     /old_locus_tag="Hneap_0732"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /protein_id="WP_012823617.1"
                     /translation="MFKAILFDVDGTLAETERDGHRVAFNRAFADAGLDWNWGEALYG
                     ELLTVTGGKERIRFFIDEHQPEYPAQSDEAAWIAGLHKAKTKHYLELLAQGAIPLRPG
                     VRRLLDEARAQGLRLAISTTTTPENVTGLLEATLGKESLDWFEVIAAGDIVPKKKPAG
                     DIYVYALEAMNLRPEECLAVEDSANGVLSARDAGVPVLVTDNAYTQADEFNGALAVLS
                     DLGEPGQPVAVRTGSGPKSGYVDCAYLHSLAQAV"
     gene            795288..796130
                     /locus_tag="HNEAP_RS03710"
                     /old_locus_tag="Hneap_0733"
     CDS             795288..796130
                     /locus_tag="HNEAP_RS03710"
                     /old_locus_tag="Hneap_0733"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823618.1"
                     /translation="MRRVHAGRGWQWIKEAWRLIRPRFGLVLGTVLLMYVLLFVASMI
                     PMIGNIIAPILAPFLAGGVYVILRRVREIEQRSRIEPLASEQPISFDLLFSVFKDPAP
                     RKALLWLGFVSIAFSLALLLVVATFVTVKLSGVDHSMLTDPSANDEQRIRFLIPYLMD
                     PDAWALWIGILIASVAYSMATFFAVPLIVLRGETLRSAFSQSFSAVGRNWSAFLVYAL
                     VLFVLFLTVPITLMLSLILLLPLIVTSVFVAFEDIWNDSPVGGDADRQDQGRVLQERT
                     STVM"
     gene            complement(796253..796738)
                     /locus_tag="HNEAP_RS03715"
                     /old_locus_tag="Hneap_0734"
     CDS             complement(796253..796738)
                     /locus_tag="HNEAP_RS03715"
                     /old_locus_tag="Hneap_0734"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_012823619.1"
                     /translation="MQVAENKIVSIEYTLKNNQGEVLDSSVGNDPLAYLHGHHNIISG
                     LENALAGKSVGDAFSVEIPPEEAYGLRDENMTQVVPRHLFQGVDEIQPGMKFHAEAEH
                     GVNVVTVIDVKGDQVHLDANHELAGETLHFDVVVKDIRDATAEEIEHGHAHGPDGHHH
                     H"
     gene            complement(796769..797590)
                     /locus_tag="HNEAP_RS03720"
                     /old_locus_tag="Hneap_0735"
     CDS             complement(796769..797590)
                     /locus_tag="HNEAP_RS03720"
                     /old_locus_tag="Hneap_0735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="WP_012823620.1"
                     /translation="MIRKCLFPAAGYGTRFLPATKVMPKEMLPILDRPLIQYGVEEAM
                     EAGIKNMAIVTGRGKRALEDHFDVNYELEHQIRGTSKASLLTSIDKLIENCTFSYTRQ
                     IAMLGLGHAILTGEPLIGKEPFAVVLADDLCVGSPKGVLSQMVEIYERHKCSVVAVEE
                     VPMTEVHKYGVIAGTPIDEDTLQVSQMIEKPAADQAPSNLAIIGRYILTPDIFDILEA
                     TKAGAGGEIQLTDALRTQAEQGKVVAYKFKGQRFDCGSPSGFVAATNHFYHLSRR"
     gene            complement(797683..798051)
                     /locus_tag="HNEAP_RS03725"
                     /old_locus_tag="Hneap_0736"
     CDS             complement(797683..798051)
                     /locus_tag="HNEAP_RS03725"
                     /old_locus_tag="Hneap_0736"
                     /inference="COORDINATES: protein motif:HMM:PF09842.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823621.1"
                     /translation="MAPERLRLLRGLIIAAQPLIVLSYVGMAFWGIGMARPQGAWLIV
                     LILPALLSLPGMWLGRYRAFVWAALFDLFYLMIATTDAWSSPHDRRFNLAIVVFSLTG
                     FIAAWIQGIVLRRQSKRQTR"
     gene            complement(798052..798645)
                     /locus_tag="HNEAP_RS03730"
                     /old_locus_tag="Hneap_0737"
     CDS             complement(798052..798645)
                     /locus_tag="HNEAP_RS03730"
                     /old_locus_tag="Hneap_0737"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006476205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H quinone oxidoreductase"
                     /protein_id="WP_012823622.1"
                     /translation="MTDILVLYYSRYGATARLAHQAARGIEQVDGMQARIRRIPAIAD
                     ASGNTPELAADEPPIVTPQDFEECAGLLLGSPTYFGGMAAPVKHMIDDTSRQWFKGTL
                     TGKPAGVFTSTGSMHGGQETVLLSMIVPLLHHGMLIVGIPYAEQALAHTQTGGTPYGA
                     SHTAGNNRPLSQEERHLTQALGQRVAEVAKSLVASKS"
     gene            798899..799411
                     /locus_tag="HNEAP_RS03735"
                     /old_locus_tag="Hneap_0738"
     CDS             798899..799411
                     /locus_tag="HNEAP_RS03735"
                     /old_locus_tag="Hneap_0738"
                     /inference="COORDINATES: protein motif:HMM:PF08534.8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase/ thiol specific
                     antioxidant/ Mal allergen"
                     /protein_id="WP_012823623.1"
                     /translation="MRPSPRFTIAILHTSVWRHVLSGLLLLMLASPVFSAPFEFSAQD
                     VNGKTHTLSNERGNWVVINIWATWCPPCRKELPELAAFDKEHAKDHIKVWGLSVDMAA
                     SPDELSMFAQEHQIGYPIFKMNPQKLSVFGNIPGIPTTFLINPQGELVARHVGAITAQ
                     QLMQMIKNNS"
     gene            799466..800059
                     /locus_tag="HNEAP_RS03740"
                     /old_locus_tag="Hneap_0739"
     CDS             799466..800059
                     /locus_tag="HNEAP_RS03740"
                     /old_locus_tag="Hneap_0739"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823624.1"
                     /translation="MNSTFEGTGQPAINVSNGFANIGRRLMAALVLSLSFLGSAFWLP
                     VAHADGFWDDSFYDMPADLKQAKADGKTGVFLFFQMADCPFCHRMETTVFTDPDVKAF
                     MKKHFITASIDIEGDVMMTDFQGKSISQKEFAFKQFRVRATPVMAFIDTDGKVATLFT
                     GPTRSAEEFLTLAKFVTSGAYKQPGMNFFKYRKEHSE"
     gene            800122..801459
                     /locus_tag="HNEAP_RS03745"
                     /old_locus_tag="Hneap_0740"
     CDS             800122..801459
                     /locus_tag="HNEAP_RS03745"
                     /old_locus_tag="Hneap_0740"
                     /inference="COORDINATES: protein motif:HMM:PF02321.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane efflux protein"
                     /protein_id="WP_012823625.1"
                     /translation="MIFRPAKVIWAVVCLVVMSGRGVQADDGAASPLTLQAALSVPLQ
                     QQYGVMGAEADVLGAKADQQEVQSWYDPTISVEGRLRYIQPSNAATDQNVKYDNALGI
                     SARQRLYDFGRQSLRADAAKSGVTGAQLQRFNVEQAQRLAILKAFFGVLLADQTYTVA
                     NERMAIVYVRFDKAKDRKELGMASDYDLAGLQREYEDVLLARAKADAERRISRRKLAE
                     LMGTPQQIPSKLVAPKLTALFARTPPALDEAMKRALADDPGLQALHARYDAAEQSLRA
                     ARDHNAPTIYAQVNGDYYQRELGSRDPFRAGVYIDFPLYDGRLRDSKIGKAQADRMRL
                     AAQIATREADLRDQVTNVLEMIDVYRKAAISRVKALENYSDLNFTRKQTLYQMEKATD
                     LGDAMVEESAAQLERMRTTFALATYWAELASMQGQPIDSILTSSPSASAEPKK"
     gene            801456..802328
                     /locus_tag="HNEAP_RS03750"
                     /old_locus_tag="Hneap_0741"
     CDS             801456..802328
                     /locus_tag="HNEAP_RS03750"
                     /old_locus_tag="Hneap_0741"
                     /inference="COORDINATES: protein motif:HMM:PF13533.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823626.1"
                     /translation="MNLNLTTRETTGRAGVKANLSLILVPLILSLVGAVSPAFAADES
                     QTLDGHLAWAEVTRLSTPVSGVVTQIPVQPGQQVKQGAVLLRLDRKPLADRMAAAVAI
                     RSGLVRAAAEAKRDAERTQQLYDRTVASESERQEALIKQEQAEASLNEARARADLRQW
                     ELGSSTLTAPYPARILSVDTAVGETVSSELNAPVLLRIARSDEMLAVANASADVASHL
                     SLGQKMNVLVGQASAQTKVEAKVQAKVEGRLVGIVSEPQSNQDEVMNYRLEVMIKPEQ
                     GWIAGLPAKIELSD"
     gene            complement(802344..804122)
                     /locus_tag="HNEAP_RS03755"
                     /old_locus_tag="Hneap_0742"
     CDS             complement(802344..804122)
                     /locus_tag="HNEAP_RS03755"
                     /old_locus_tag="Hneap_0742"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthetase B"
                     /protein_id="WP_012823627.1"
                     /translation="MCGICGWLAAPGSRPDLGAVRRMMDRLERRGPDHEGSFSDGPLA
                     LGHRRLSILDLSFHGAQPMIDRENGLALAFNGTIYNHPELRQELRALGHRFTSTGDTE
                     VILKAFAQWGTDCVGHLTGMFAFAIWNLKTGALFLARDRLGIKPLYYTEDPANPMAPL
                     RFASSLPALLAGGSVNTEFDPIALHHQFTLHGSVPAPHTIFKGVRKLAPGHSLLIDAA
                     GKKTLTRYWQIDATERHDLDAQQWQEQIHAGLLKAVKRRLDISDVPVGVLLSGGLDSS
                     LIVALAHEAGIAPQTFTIGFEDQPEEKGSEFEFSDPVAERYQTKHHRFHIPNSQVLER
                     LPEAVAQMSEPMFAQDAVAFYLLSEQVSREVKVVLSGQGADEVFGGYFWYPQMNAAVG
                     DDLSRFAPYYFDRDHNELMSMITAPFRGEDHTSRRIRDELSRIRGSNYINRVLGLDVS
                     TLIVDDPVKRVDNMTMAWGLEARVPFLDHELVELAMQMPAAYKLDLDGKGMLKRIARG
                     RIPDAVIDRPKGYFPVPALKFVRGPFLEFMREILSSPTAQARGLFEPTYVNRLLAEPD
                     RHFTRLQGAKLWHLAVFELWLQQNGI"
     gene            804162..806168
                     /locus_tag="HNEAP_RS03760"
                     /old_locus_tag="Hneap_0743"
     CDS             804162..806168
                     /locus_tag="HNEAP_RS03760"
                     /old_locus_tag="Hneap_0743"
                     /inference="COORDINATES: protein
                     motif:HMM:PF01266.22,HMM:PF05430.9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional tRNA
                     (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase
                     MnmD/FAD-dependent
                     5-carboxymethylaminomethyl-2-thiouridine(34)
                     oxidoreductase MnmC"
                     /protein_id="WP_012823628.1"
                     /translation="MGRILAARSGSVLLFGPISGFFDLAIGRSNAQPAVWFDFMTISP
                     CAISWADVQWRSDGSPYSPDYGDIYYSAAGGLAEKKAVFLEGCALPARFAAGTPAHVL
                     ELGFGTGLSFLTTWASFLQHAPEPNPTHGLKPDLLFYSIEKHPWSRGDFLKLATRWPE
                     LAPLVVELAEQWPDPVTGFHRRFLSGGRVVLTLVFGDVEWALRQLDAPFHAFYLDGFS
                     PRLNDAMWSPHIFRALARLAADEARVATYSSANAVAQGLTAAGFLVEKVPGFGLKKHR
                     LVAVRRHMMRSRKPRQEKPPTSVVVIGAGIAGLTTAYALARRQVDVTVIDAAATLGDG
                     ASGNPAGVLSPLLSRDCHAATLLTQMGLGFAREQIKQLQQAEFSVPAAFDGVVQLARD
                     TIHAQRQQQIADEQSYAPEFAQWLDSSVLSGKVGIEVTEPGWLFPSAGWVSPRDWLAA
                     LQAHPGISLRKNTDVADLRFEDGLWCGYSVSGEELFSSSCVVLANAGAVATLLPEFES
                     VLTACRGQVDWIDRSDHLGLELAQMPLMREGYMLDLPDGRRLFGASFKPGDQDLSWRF
                     DERMENQERLAALSADLVTPTIQDDAEHQGRVSLRATSRDRLPIVGEMPGQSGLMVNT
                     GHGSRGLTWCPLLAEVLAASCCGEPNPVPRSLQLALRPERLIQE"
     gene            complement(806171..806440)
                     /locus_tag="HNEAP_RS03765"
                     /old_locus_tag="Hneap_0744"
     CDS             complement(806171..806440)
                     /locus_tag="HNEAP_RS03765"
                     /old_locus_tag="Hneap_0744"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009174431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphocarrier protein HPr"
                     /protein_id="WP_012823629.1"
                     /translation="MHTESIEIINKLGLHARAAAKFSTLASQFECTIQVEHLGRTVNG
                     KSIMGLMMLAAARGTTITISTDGDDEQAAMAALNQLIAQRFGEPE"
     gene            complement(806440..806832)
                     /locus_tag="HNEAP_RS03770"
                     /old_locus_tag="Hneap_0745"
     CDS             complement(806440..806832)
                     /locus_tag="HNEAP_RS03770"
                     /old_locus_tag="Hneap_0745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS mannose transporter subunit IIA"
                     /protein_id="WP_012823630.1"
                     /translation="MTVGILLICHNHIGAQLLETATDMMEVAPIPAGNLSVLQDDDPI
                     ELLSRARKRLADLDQGDGVLVLTDMYGSTPSNIAHRLKEKNRVHVISGVNLPMVVRAM
                     NYPQLNLADMTERVASGGREGIIEGDAV"
     gene            complement(807263..808126)
                     /locus_tag="HNEAP_RS03775"
                     /old_locus_tag="Hneap_0746"
     CDS             complement(807263..808126)
                     /locus_tag="HNEAP_RS03775"
                     /old_locus_tag="Hneap_0746"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013031422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNase adaptor protein RapZ"
                     /protein_id="WP_012823631.1"
                     /translation="MVFIVTGQSGSGKSVALAALEDAGFYCIDNLPPELLDNLLQIYQ
                     QGDIQAQGIAISIDARSPEPALRDLPKRIEKLKTDYPQLAIQSLFLEASEARIVARFS
                     ETRRRHPLSNRIENLVEAINQETELLLPMRAQADLIIDTSHTTIHQIREDISRRVIGR
                     DSSGPSIMLQSFGFKHGIPLDSDFLFDIRYLPNPHWVPVLRPFNGNDRVVIDYLEQHP
                     ITHKTRGYLRDFLSNTLSELVRTDRSYVTCSIGCTGGKHRSVYLVEQLFDDLRPRFDH
                     LIIRHRDLGNL"
     gene            complement(808226..809086)
                     /locus_tag="HNEAP_RS12190"
                     /old_locus_tag="Hneap_0747"
     CDS             complement(808226..809086)
                     /locus_tag="HNEAP_RS12190"
                     /old_locus_tag="Hneap_0747"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006786197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049772462.1"
                     /translation="MSIPMPQPQILPLEFEATGVRNHPVYERLFNPEFRFARFNPLEP
                     QPIGLLDKSLRAAITARKEPLTNQPLTYILTDCTAEEATEWVRQQTTSNSTFLHTIEN
                     AAAVTAWLFAERSQQNRQWQHGVFMEVAGSGVLITGASGIGKSELALELLSRGHRLIA
                     DDAPYFIRGHQGIEGHCPDNIKDLLEVRGLGIINVRSLFGDNALKPHKNLRLLIELYA
                     ADHKNIHADDRLRGERGQIMICQEMIPLFRLPVAPGRNIAVFVETVVRQHNLERTGND
                     STSPGRIPIA"
     gene            complement(809111..809590)
                     /locus_tag="HNEAP_RS03785"
                     /old_locus_tag="Hneap_0748"
     CDS             complement(809111..809590)
                     /locus_tag="HNEAP_RS03785"
                     /old_locus_tag="Hneap_0748"
                     /inference="COORDINATES: protein motif:HMM:PF00359.20"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS IIA-like nitrogen-regulatory protein PtsN"
                     /protein_id="WP_012823633.1"
                     /translation="MIIADMFPLQRILIDEVYQSRKRVLEVLAGLLADDQLGGQESTR
                     IYEILIERERLGCTAIGKGIAIPHGRDASTLRPRGAVIRLTEGIDFGAMDNQPVRLII
                     GLIVPAECPENHLAILGVLAEHLSNEGDLEAMMQAQSPERIRGLLIEWLSPLTTPDE"
     gene            complement(809986..810276)
                     /locus_tag="HNEAP_RS03790"
                     /old_locus_tag="Hneap_0750"
     CDS             complement(809986..810276)
                     /locus_tag="HNEAP_RS03790"
                     /old_locus_tag="Hneap_0750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal subunit interface protein"
                     /protein_id="WP_012823635.1"
                     /translation="MQIEITGHHVDITDALRDYCQTKFDKLKRHFDKVINVHVILTVE
                     KKVQKAEATLHMSGNDVHAEAESEDMYASIDTLIDKLDRQIMKHKEKMTDHR"
     gene            complement(810295..811803)
                     /locus_tag="HNEAP_RS03795"
                     /old_locus_tag="Hneap_0751"
     CDS             complement(810295..811803)
                     /locus_tag="HNEAP_RS03795"
                     /old_locus_tag="Hneap_0751"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823636.1"
                     /note="sigma factors are initiation factors that promote
                     the attachment of RNA polymerase to specific initiation
                     sites and are then released; sigma 54 factor is
                     responsible for the expression of enzymes involved in
                     nitrogen assimilation and metabolism; the rhizobia often
                     have 2 copies of this sigma factor; in Rhizobium etli
                     RpoN1 shown to be involved in the assimilation of several
                     nitrogen and carbon sources during free-living aerobic
                     growth and RpoN2 is involved in symbiotic nitrogen
                     fixation; in Bradyrhizobium both RpoN1 and N2 are
                     functional in free-living and symbiotic conditions, rpoN1
                     gene was regulated in response to oxygen; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-54 factor"
                     /protein_id="WP_012823636.1"
                     /translation="MKPGLELRLGQSLAMTPQLQQSIRLLQLSTLELSLEIQQAVDTN
                     PLLEIAETDEFGESGEAFNETGEAGSTPEADFQEDPNAVAGEALLAPNNELTPDDPFT
                     LDTQWEDYYEADGSTSFSASEQNFDDYDPYATTSNGVESLRDHLLSQIHLTHLTPRDT
                     AVATAIIEAIDPTGYLADSLEDIQAMLSEDWPDIDLEEIGTILHLVQSLDPVGVGARD
                     LNESLSLQLRQKPVDTPYLDIALQICERDLIEAIAQREYTKVQRTLGIDQAALEGALL
                     LLQGLNPRPGADVGAEAADYLIPDVMVTLRNNVWHVDLNPEIAPKLRVNQTYARMINR
                     SSRGEDASYIRSHLQEARWFIKSLRSRNETLLNVARAIVARQTAFFEQGETGMKPLVL
                     REIAEELSLHESTVSRVTTQKYMLTPRGTFEFKYFFSSHVGTSDGGECSATAIRAMIK
                     KLVSEENPRKPLSDAKIADMLIEQGIDVARRTIAKYREAMGIASSTDRKRLI"
     gene            complement(811966..812709)
                     /locus_tag="HNEAP_RS03800"
                     /old_locus_tag="Hneap_0752"
     CDS             complement(811966..812709)
                     /locus_tag="HNEAP_RS03800"
                     /old_locus_tag="Hneap_0752"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012823637.1"
                     /translation="MSTRTTKPILVAESLVKHYGARAVVQGVSLEVNAGEIVGLLGPN
                     GAGKTTSFYMIVGLVAADQGQIWLNGRDITLMPVNQRAQMGLGYLPQEASVFRKLTVE
                     QNILGVLELRRDLTRAQQRDELEGLLQELHIRAIRRSSGQSLSGGERRRVEIARALAA
                     NPRVILLDEPFAGVDPISVIDIQRIIHHLKARGIAVLITDHNVRETLGVCERAYIVSD
                     GKILAEGSPQDILDNPQVRAVYLGEHFTL"
     gene            complement(812706..813290)
                     /locus_tag="HNEAP_RS03805"
                     /old_locus_tag="Hneap_0753"
     CDS             complement(812706..813290)
                     /locus_tag="HNEAP_RS03805"
                     /old_locus_tag="Hneap_0753"
                     /inference="COORDINATES: protein motif:HMM:TIGR03002"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS ABC transporter substrate-binding protein
                     LptA"
                     /protein_id="WP_012823638.1"
                     /translation="MHQSNTANICSTGWTSALLILGIIAGLMTPTVFAAKADRNQPID
                     VTANEKVTDYKQGTSIYTGNVVINQGSLHATGDKATLYVEKGELVRAVLEGKPATFQE
                     LDDKGQLVKGSANDANYLAQQQKIILTGNAKLDRQGDTLSSQQITYDMNAEVVKAGGK
                     TGGERVHVVIQPRSKNADQPQDGKPAATTPSAKP"
     gene            complement(813290..813964)
                     /locus_tag="HNEAP_RS03810"
                     /old_locus_tag="Hneap_0754"
     CDS             complement(813290..813964)
                     /locus_tag="HNEAP_RS03810"
                     /old_locus_tag="Hneap_0754"
                     /inference="COORDINATES: protein motif:HMM:TIGR04409"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS export ABC transporter periplasmic protein
                     LptC"
                     /protein_id="WP_081441102.1"
                     /translation="MPGRPCWPITSNAIIMSFQQVGQFFIAAALFALLGILVWKNYIA
                     PKQEVATTPAAFDQRFSDFTARQFNRKGALDWTVSGSQLNHLTDDKGYRFNQVECLLE
                     SKENNAPPWRLSAPTGSADERLTSVELTGGVEGHRAASGNQGALVFSTQTMTIQPQEQ
                     KAASTDPTRLAEMNTDGQPRWTSNSSAFNLNYNNQVFQQSKVHDHFNRPVSAKVKSDT
                     SQGAQP"
     gene            complement(813930..814457)
                     /locus_tag="HNEAP_RS03815"
                     /old_locus_tag="Hneap_0755"
     CDS             complement(813930..814457)
                     /locus_tag="HNEAP_RS03815"
                     /old_locus_tag="Hneap_0755"
                     /EC_number="3.1.3.45"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_012823640.1"
                     /translation="MKKPDLLSRLRAVRALILDVDGVLTDGRLHFTEHGEEHKVFHSR
                     DGHGIKMAQKIGIEVAIISGRASPALRHRADNLGITHCLIGVRDKGAAIETLAATLGI
                     RPEECAVMGDDVIDLPMLNRAGVSVTVADAPRLIQSRVDWVTHLGGGQGAVRELIDLL
                     IDARDAWPTVLADYQ"
     gene            complement(814495..815466)
                     /locus_tag="HNEAP_RS03820"
                     /old_locus_tag="Hneap_0756"
     CDS             complement(814495..815466)
                     /locus_tag="HNEAP_RS03820"
                     /old_locus_tag="Hneap_0756"
                     /EC_number="5.3.1.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-arabinose 5-phosphate isomerase"
                     /protein_id="WP_012823641.1"
                     /translation="MNPNNLLAMAKQVIDIEAQACQALSARLDHQFITACELMLKCDG
                     RVIVIGMGKSGHIGGKIAATLASTGTPAFFVHPGEASHGDLGMITRRDVVLALSNSGE
                     TAEMLAILPVIKRLGTPLVALTGRPQSTLAKAAEAHLDVSVEREACPLNLAPTASTTA
                     ALVMGDALAVALLDARAFQPEDFALSHPGGTLGRRLLLRVQDVMHTGDRIPRVMHNQT
                     IKQALIVISSGGLGMTTIVDEQQKLLGLFTDGDLRRILDQEEYDLNQPIERVMIRNPR
                     TCTADKLAAEALAIMERDKINGLIVTDNQSHVIGALNMHDLLRAGVA"
     gene            815790..816653
                     /locus_tag="HNEAP_RS03825"
                     /old_locus_tag="Hneap_0757"
     CDS             815790..816653
                     /locus_tag="HNEAP_RS03825"
                     /old_locus_tag="Hneap_0757"
                     /inference="COORDINATES: protein motif:HMM:PF03781.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823642.1"
                     /translation="MNSAVLSSEILTSSVGASAQQVQAAEALNRDVFFHDTLADGSPA
                     PELAIIPAGEFMMGAKESEYQAQKSEQPRHEVSFPRHFALTRGTIRRREYNQFLLASD
                     HRRPRPYSWNDLDFPVYNVSIKDAAAYAAWLSEQTRQHYRLPTEAEWEYAARAGTTTM
                     FSFGDKIRREEVNCSGGLHCTRGLFICGIGRPVQVGTLPPNAWGLFEMHGNMQEFTLD
                     HWRDSYRSTPRVGDMPFRSPDARHRHFHVVRGGSWFDGPGACRSASRTLRHENEIDLN
                     LGFRLLREIYS"
     gene            816650..817189
                     /locus_tag="HNEAP_RS03830"
                     /old_locus_tag="Hneap_0758"
     CDS             816650..817189
                     /locus_tag="HNEAP_RS03830"
                     /old_locus_tag="Hneap_0758"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823643.1"
                     /translation="MTITRSIEVVPNTKISTDIHLGIRHRRAASLIQEFYPDGMPEDW
                     RHSYLAMMTQVIWVEDGDDDLAEMLAAIVDAPKPVLTVWVAEDSAQANLWQAAHPEQQ
                     LIIMTPSTPVWTPQAEGGGGARVALMPGSDQPAQIRAWLEQFVQQAPAGPCALFVDGE
                     SPSVPTLDRLQTLIELMGL"
     gene            817189..818058
                     /locus_tag="HNEAP_RS03835"
                     /old_locus_tag="Hneap_0759"
     CDS             817189..818058
                     /locus_tag="HNEAP_RS03835"
                     /old_locus_tag="Hneap_0759"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823644.1"
                     /note="ABC transporter maintaining outer membrane lipid
                     asymmetry; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid ABC transporter ATP-binding protein
                     MlaF"
                     /protein_id="WP_012823644.1"
                     /translation="MTSDSYITFENVRFSRGRKCIFDGVNIAIPRGKITAIMGPSGTG
                     KTTLLRLIGGQIKPDSGTVRVDGLDVARASSKSLLAMRRRLGMLFQNGALFTDLTAAE
                     NVAFPLREHSRLPEPMIQRMVTLKLQAVGLLEAAGQMPAALSGGMARRVALARALALD
                     PELMLYDEPFTGQDPINVGVLLRLIASLNQALGLTSVLVSHDVTEALSIADHVVVINQ
                     ARIVASGSPDALRAEMPGNPFLRQFLEGAPDDDQSELGQRSARTFAEALGLLPRPDKS
                     DAAAAASRHRNVG"
     gene            818055..818855
                     /locus_tag="HNEAP_RS03840"
                     /old_locus_tag="Hneap_0760"
     CDS             818055..818855
                     /locus_tag="HNEAP_RS03840"
                     /old_locus_tag="Hneap_0760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012823645.1"
                     /translation="MNGYRNAFFNGLALLGQGALAAVAHAGQMILFTGQLLWRLLPAW
                     TRPRLIVQELYAIGVLSLVIILISGGFVGLVLGLQGYNILSKFNATESLGVMVALSLV
                     RELGPVVTALLFAGRAGSAVTAEIALMKTTEQLSAMEMMAVDPLRRVVAPRFWGAVFS
                     MPLLAGLFSLVGIAGGYFIGVVVLGVDPASYWGQIQQQMQPVDDVLNGVIKSLVFGAV
                     VGLIAVFEGFNAEPTSLGISRATTRTVVLSSLCVLGLDFILTAWMFGA"
     gene            818859..819320
                     /locus_tag="HNEAP_RS03845"
                     /old_locus_tag="Hneap_0761"
     CDS             818859..819320
                     /locus_tag="HNEAP_RS03845"
                     /old_locus_tag="Hneap_0761"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011331062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipid asymmetry maintenance
                     protein MlaD"
                     /protein_id="WP_041600683.1"
                     /translation="MNAQRGIEMVVGAFVLAGIAALLVLTLKWSDFGTSSVSGYTLTA
                     EFDNIGGLTDRSPIKMAGVTIGRVSNIQIDPNTFEAVVTMVISSQYDNLPKDSFASIY
                     TAGLLGAQYIEISPGGDTKVLKNGDKITMTQSAVILEKVISKFLFNKAAAQ"
     gene            819317..820678
                     /locus_tag="HNEAP_RS03850"
                     /old_locus_tag="Hneap_0762"
     CDS             819317..820678
                     /locus_tag="HNEAP_RS03850"
                     /old_locus_tag="Hneap_0762"
                     /inference="COORDINATES: protein motif:HMM:PF02321.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane efflux protein"
                     /protein_id="WP_012823647.1"
                     /translation="MRKTHLIFLALAAFSGMAQAQTVNLEQATQMALNADPRIEEQRA
                     NVAAAQALIQKVEGEGGIRASVNLYAALAPRASNGLFTNGTNSCPAGGCTLRDDGNTI
                     NDGITVTSGITASIIKPLYTFGKLSNYMTAAKYNKDLKSDEVALAKGQTWLTVRRAYY
                     GYLTARDTRRLLIGVRHQLADAEAPLKKKADSGNGSMRDVYALENGLGLLDKYIAEAT
                     GVEQIALAGLKTIIGVPIDDPLTVADTHITPVSMPDGSLKQFSNEALANRPEMHMAES
                     GLAALRSYVQARKAERYPNLYAGVMAQAQYTPGRDRLDNPYIYDPLNSAFATPVIGIK
                     WDFNPGVLNANVSSAEAELRGAVAKAQLAQVGIPYQVTEAYRNVSSLHAQIEALEKAR
                     VASKRWMISSFLDFQAGLVDGGILGMAVAGNTSTQVDYFKAVNDFNMQVAQLRVATGD
                     YPQ"
     gene            820675..821316
                     /locus_tag="HNEAP_RS03855"
                     /old_locus_tag="Hneap_0763"
     CDS             820675..821316
                     /locus_tag="HNEAP_RS03855"
                     /old_locus_tag="Hneap_0763"
                     /inference="COORDINATES: protein motif:HMM:PF05494.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toluene tolerance family protein"
                     /protein_id="WP_012823648.1"
                     /translation="MNTMNWRRRLFLNAILLGGLGLSGLVPVSAFAGNLTNEAAMNLV
                     QSTADQVIHEIAKNQAEVEKDPSVLLDIVDKTLLPEVDSERMSRLVLGRYWRTASASQ
                     KAAFTEQFKRLLVRTYAGPLSKLGNQTIKVTGTKPGADKDEIEVLSVVSGGDMGPVPV
                     DYRLAAVDGNWKAYDVVIDGISLINNYRSSFAQVVQQKGLDSLISTLKTQNNG"
     gene            821309..821662
                     /locus_tag="HNEAP_RS03860"
                     /old_locus_tag="Hneap_0764"
     CDS             821309..821662
                     /locus_tag="HNEAP_RS03860"
                     /old_locus_tag="Hneap_0764"
                     /inference="COORDINATES: protein motif:HMM:PF13466.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma factor antagonist"
                     /protein_id="WP_012823649.1"
                     /translation="MADSSASESSAVQAEALRFVREAGRVRVQGDLLRSSIESLSDLS
                     LPMPDGQTPGTRLEIALGSVGRIDTAGVAFLLGWQAEAAAQSVTVRYTHPPKAMRAMM
                     RVYDLDDWMVVEGVS"
     gene            821727..822986
                     /locus_tag="HNEAP_RS03865"
                     /old_locus_tag="Hneap_0765"
     CDS             821727..822986
                     /locus_tag="HNEAP_RS03865"
                     /old_locus_tag="Hneap_0765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="WP_012823650.1"
                     /translation="MNKLIIRGGAPLRGDVRISGAKNAVLPIMAAGLLCETPCTIENV
                     PHLQDVTTMMELLGGMGVTLTISDKMSVEIDTSTIEKLVAPYDLVCTMRASILVLGPM
                     LARFGQAKVSLPGGCAIGSRPVDIHLHGLMALGAQIKVENGYIDAKAERLVGTRIVMD
                     QVTVTGTENLMMAAVFAEGETVLENAAREPEVIDLANFLIKMGADITGVGTDVITIRG
                     VKSLQGVRYRVLPDRIETGTYLVAAAMTGGKVRVRDTDPRLLDAVLSKLTEAGAHITT
                     GDDWIELDMTGRRLHSVNVRTAPHPGFPTDMQAQFLALNCIAEGTATVIETIFENRFM
                     HVQELLRIGADIHVEGNTAVVRGLPVLTGAQMMATDLRASASLILAGLVAEGETTINR
                     IYHIDRGYESIEEKLSKLGANIQRINQ"
     gene            823018..823668
                     /locus_tag="HNEAP_RS03870"
                     /old_locus_tag="Hneap_0766"
     CDS             823018..823668
                     /locus_tag="HNEAP_RS03870"
                     /old_locus_tag="Hneap_0766"
                     /EC_number="2.4.2.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="WP_012823651.1"
                     /translation="MSQQNIIIALSKGRIFKDTLPLLAHVGITPKDDPETTRKLILDT
                     NHAHIKLLILRASDVPTYVQYGAADLGVAGKDVLMEHGGEGLFELLDLNIARCKLMVA
                     GKPGSTDQPGRLRVATKYTHSAECYFAEQGRQIELIKLYGSMELAPLVDLSDCIVDVV
                     DTGNTLRANGLEPLLHIADISSRLIVNRAAQKLKHREIADLVRQLDEYLAAEAATA"
     gene            823665..824966
                     /locus_tag="HNEAP_RS03875"
                     /old_locus_tag="Hneap_0767"
     CDS             823665..824966
                     /locus_tag="HNEAP_RS03875"
                     /old_locus_tag="Hneap_0767"
                     /EC_number="1.1.1.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016984146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="WP_012823652.1"
                     /translation="MMKRLDALAPDFSANLQKLLDWSSVADASVQTTVDEIIHAIRDE
                     GDTALLRYTAKFDRLDLSSADALAFTREEIDASVARTSPELLAALTQAAARIRAYAEH
                     QKMTSWQFTEADGTVLGQQVSPLDRAGLYVPGGKAAYPSSVLMNAIPAKVAGVRELIM
                     VVPTPDGIINDTVLAAAHVAGVDRIFRIGGAQAVAALAYGTATVPAVDKIVGPGNIYV
                     AAAKRAVFGKVGIDMIAGPSEILILCDGKTDPDWIAMDLFSQAEHDEQAQSILISPDA
                     QFLDKVTASIEKLLADQPRAAIIRTALTNRGALIHVPDMDAAIELANRIAPEHLELSF
                     EGAEQRLPEIRHAGAIFVGKYTAEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRS
                     SIIQCSAEGSAVLGALAEVLAESEGLYAHGASARYRVKDHR"
     gene            825041..826150
                     /locus_tag="HNEAP_RS03880"
                     /old_locus_tag="Hneap_0768"
     CDS             825041..826150
                     /locus_tag="HNEAP_RS03880"
                     /old_locus_tag="Hneap_0768"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphate transaminase"
                     /protein_id="WP_012823653.1"
                     /translation="MSSPFWSRLVGGLTPYVPGEQPKGAGPDGRRLIKLNTNENPYGP
                     SPKVITAIESVLNESLRLYPDPTAHDLRETIAEYYRLTPDHVFVGNGSDEVLAFVFQA
                     LLAHEKPILFPDISYSFYPVYCALYGIDYRLIPLDEDLAIRVEDYAQAEQPSIGGIIF
                     PNPNAPTGRLLSLVEIERIVAGQPDVVVVIDEAYIDFGGESAVALIDRFPNVLVTQSL
                     SKSRSLAGLRVGLALGQPALIEALVRVKDSFNSYPLDRLALAGAKAAFEDGAYFAQTC
                     TRIIDAREALTKALVSRGFTVLPSGANFVFARHPKQGGEQLYLGLRQQGVMVRHFNKP
                     RIAEFLRITVGTPEENQCLLAALDVVMGIAMSATN"
     gene            826245..826341
                     /gene="ffs"
                     /locus_tag="HNEAP_RS12480"
                     /old_locus_tag="Hneap_R0025"
     ncRNA           826245..826341
                     /ncRNA_class="SRP_RNA"
                     /gene="ffs"
                     /locus_tag="HNEAP_RS12480"
                     /old_locus_tag="Hneap_R0025"
                     /product="signal recognition particle sRNA small type"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00169"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00169"
     gene            826389..828164
                     /locus_tag="HNEAP_RS03890"
                     /old_locus_tag="Hneap_0769"
     CDS             826389..828164
                     /locus_tag="HNEAP_RS03890"
                     /old_locus_tag="Hneap_0769"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005220338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, subunit gamma and tau"
                     /protein_id="WP_012823654.1"
                     /translation="MSYLVLARKWRPKSFAEMVGQGHVLQALTNALDQSRLHHAYLFT
                     GTRGVGKTTVARIFAKALNCEHGISSTPCGVCSACVEIDQGRFVDLIEVDAASRTGVD
                     DTRDLLENVAYAPVRGRFKIYLIDEVHMFSKSSFNALLKTLEEPPEHVKFLLATTDPQ
                     KLPVTVLSRCLQFNLRALPLSQIQQHLADVLQKENIAFEPAALHLIAEAANGSMRDAL
                     SLLDQAIAFTGGKLDTVQVSQILGLSDHQIIWDMIDALYQQSADRLFALVDEALDRAV
                     EPAILLAQFIESIHQLAMGQWIQSMSAAANPPPDELKSIDPQLLQLWYQIATTGRRDM
                     AWSPNARIGLEMTLLRMLAFQPGGEASNGAVKATEPAAVHSYPSDSRSVSAAKTKPER
                     VASSITQPESEPETKARLQKSAEHRVAEPMVAQTMPVQDKSDHDVPDHSGHARAQLTD
                     LPWHEWVERIPGQPGRNLADRCHINIVDGQIQLVVAPQYEVIANARARESLLSQLSKL
                     ADTSKVKIIIGQNDTASDRATSEISAQAAITPAERRNQEEINLQQQRRQSVVQHPVVQ
                     LLQEQAGAQLVEESILPRDGQSDPA"
     gene            828206..828532
                     /locus_tag="HNEAP_RS03895"
                     /old_locus_tag="Hneap_0770"
     CDS             828206..828532
                     /locus_tag="HNEAP_RS03895"
                     /old_locus_tag="Hneap_0770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019674843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid-associated protein, YbaB/EbfC family"
                     /protein_id="WP_012823655.1"
                     /translation="MMKGGIGNLMKQAQQMQEKMQRMQEEVAKIEVTGESGAGLVKVT
                     MTGKHEVRRLVIDDSLMGDDKEMLEDLIAAAVNDAVRRVEHNQQEMMSSVTAGMNLPA
                     GMKLPF"
     gene            828543..829136
                     /locus_tag="HNEAP_RS03900"
                     /old_locus_tag="Hneap_0771"
     CDS             828543..829136
                     /locus_tag="HNEAP_RS03900"
                     /old_locus_tag="Hneap_0771"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012488036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein RecR"
                     /protein_id="WP_012823656.1"
                     /translation="MFSPKFVALVQALRGLPSVGQKTAQRMALQLLEHDREGAAQLAR
                     AIVAALEGIGRCESCRIFSETPVCPVCADNHRDATQLCIVESPTDWLAIEQSGAYQGL
                     YFILSGHLSPLDGIGPEDIGIPELMNRLANSPVEEIIMATSATIEGEATAGYIMDRVD
                     PARYKVTRLAQGVPMGGELEYLDAQTLSLALKSRRSV"
     gene            complement(829163..829534)
                     /locus_tag="HNEAP_RS03905"
                     /old_locus_tag="Hneap_0772"
     CDS             complement(829163..829534)
                     /locus_tag="HNEAP_RS03905"
                     /old_locus_tag="Hneap_0772"
                     /inference="COORDINATES: protein motif:HMM:PF07238.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus assembly PilZ"
                     /protein_id="WP_012823657.1"
                     /translation="MDAGNPSQIDNNQDRRDFNRIKVRGKVLLKCMTPPFEIFNAEII
                     DVSANGLNISTKNALELNLPVQLSVCTVNDNNVFFMNGKITWCEKSSDDQGEPEYNAG
                     IEIQFDRRNKDYHDWRALYIA"
     gene            complement(829535..831709)
                     /locus_tag="HNEAP_RS03910"
                     /old_locus_tag="Hneap_0773"
     CDS             complement(829535..831709)
                     /locus_tag="HNEAP_RS03910"
                     /old_locus_tag="Hneap_0773"
                     /inference="COORDINATES: protein motif:HMM:PF07793.9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823658.1"
                     /translation="MMNRVNTNTEELRGELDRLAKSALDSALNSLFNEIEKKLFTRAD
                     HTSNQHDKSELFEKIAQLKNSRNDFEETLYSVIRESNPILNQINWASVVQNRSLALQM
                     EDMIAHAKAKYGIEHAQYESRIKSLNLTEKESFPQHLYTVSSITYGFIKASHHFQSDI
                     RDSLIRSLGTHVLYKLEPLYILLNDLLIQSGVLPEVKSKRPPQRSELESLIDAISDSE
                     SLIQEQLNEHSRISSEELQNFLKSSVDNKDVFLQSKSSWSPKNLIEAVIERFRKSHPS
                     LQSKTELHSHDQEIITLAGAILSDLINNNDINPIIKNQAISLQAIVLNTAFTDTDFFS
                     NLKNPAREVLNKLVMLGSDPYLSTDDIKKIANSVKSFIRSTSSKETPAFETLSEELDG
                     IENNELGHVAAPRAGNHSLSSSITTRSRNRITFIINSAIGAALLSDEASAFLAKVLNP
                     FMIHVLMTHGRQCDEWKEALAVLDNVIQLEVKSASDIRDVLIVESKVKELIKHPILGD
                     DFFKVAVQKTAADHYLTYLKNKRTQFSIIQKRKEEERETQATSNIDQLNSESVVEQVE
                     AAELKNAAKVSSIPLPQAHKNGIEANDGRSAEVDVPKTDAAVPVEETNQPEPEPSPYE
                     NLCSDPRIKQFLDRHILNNEWLQIYTSDDAALRRLKASKVNMELKIVSFANRNGEITL
                     VLPIAQFISDLLENRSNPVFDNPNYNSAKQQLLDTIKSEGLI"
     gene            complement(831681..833150)
                     /locus_tag="HNEAP_RS03915"
                     /old_locus_tag="Hneap_0774"
     CDS             complement(831681..833150)
                     /locus_tag="HNEAP_RS03915"
                     /old_locus_tag="Hneap_0774"
                     /EC_number="2.4.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014703819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen synthase"
                     /protein_id="WP_012823659.1"
                     /translation="MNVLFATSEMFPLIKTGGLADVSGALPLALSQVGVDVRVVLPRY
                     ANIKTDLIESEIQIGQKEILGQPVKINLANLNTGHLVYLVDHPVFSARQGNPYIGPDG
                     NNWHDNPDRFGLFCRAVVALSTGLFGDAWKPDIIHSNDWQTGLIPALLSESSSPKNIF
                     TIHNLAYQGVFDRPTFERLGLPWSLWRPDALEYWGNMSFMKAGIVFSKFVTTVSNTYA
                     QEIQSPEFGYGLDGLLHHKQDRLKGILNGIGEDWNPQTDPLLEKPFSTSDMTGKAIIK
                     ESIQHEFGLTIDGNIPLITHVGRLVEQKGIDLLIQAIETLGSAQVQFVILGAGEHRFE
                     HALRSLAEKNPDRIAVVIGYDEKLAHRLEAAGDAFIMPSRFEPCGLNQMYSLRYGALP
                     IVHRVGGLADTVTHITPESIKDGSASGIVIDHLDVSAIHWAIGYFMEIYKDRDLYRKI
                     QQQGMQKDFGWITSAKEYKKIYSAALKEQTHDESSQHEH"
     gene            complement(833167..835332)
                     /locus_tag="HNEAP_RS03920"
                     /old_locus_tag="Hneap_0775"
     CDS             complement(833167..835332)
                     /locus_tag="HNEAP_RS03920"
                     /old_locus_tag="Hneap_0775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycogen-branching enzyme"
                     /protein_id="WP_012823660.1"
                     /translation="MQLDFQPIIESRMHDPFSLLGRHPLGEGKCRFHTYQPQAEHIRI
                     LSTHGEWLELTADADFPGVFAGLFTEDLLPLHPVLEIETAEHHKYQITDPYSFGPVLG
                     ELDLYLFGEGKHYDLWKVLGAHVITIDGVEGVTFAVWAPNASRVSVVGDFNNWDGRRH
                     PMRNRISSGVWELFIPGLSAGDFYKFEIKNRDTQATSVRTDPFGRSFELRPNTAAKVV
                     SDEEFQWTDQFWLKAREQNDWMHAPMNVYEVHLGSWKLTGKQFPTYAELAEQLIPYVK
                     ERGYTHIELLPITEHPFDGSWGYQTTGYFAPTSRFGTPEQFKQFVNKAHEAGIGIILD
                     WVPAHFPRDEFALARFDGTALYEHEDPRRGEHRDWGTLIFNYGRKEVSNFLIASALYW
                     LEEMHLDGLRVDAVASMLYLDYSREHGDWLPNAYGGRENLEAIDFLRALNHVTQSRNP
                     GALMMAEESTAWPLVSRPPEVGGLGFALKWNMGWMNDTLKYFQEDPINRQYHHNNLTF
                     GLLYTFTENFVLPFSHDEVVHGKGSLLNKMPGDEWQKFANLRLLLAYQCAYPGKKLLF
                     MGCEFGQGNEWNHAKQLDWWMLEYKLHQGISQLSTALNHLYKNEVALHYHDFEGCGFS
                     WNDCNDRQNSVISFFRHAKGQSILTILNFTPVVRQNYKIGIPNTDRLNIVFNSDESVY
                     GGSATALELTHHKNSPYNGQSGHIELTLPPLGALMIRIN"
     gene            835747..837018
                     /locus_tag="HNEAP_RS03925"
                     /old_locus_tag="Hneap_0776"
     CDS             835747..837018
                     /locus_tag="HNEAP_RS03925"
                     /old_locus_tag="Hneap_0776"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate adenylyltransferase"
                     /protein_id="WP_012823661.1"
                     /translation="MLVDSPKRLVSRITRDTLALVLSGGRGSRLKQLTDWRAKPAVPF
                     GGKFRIIDFPLSNCVNSGIRRMAVLTQYKAHSLIKHVQLAWGTNRMARDEFVELLPAQ
                     QRINEQSWYSGTADAVYQNIDILRTHDAEYTLILAGDHIYKMDYGPMIAYHVEKGADL
                     TIGCIEVPLEEAKAFGVMGEDGKGRVNMFVEKPDVPPEMPGNPGKALASMGIYVFNTK
                     FLFEQLIYDADDPNSDHDFGKNVIPRVIKRYQVFAYPFRDVQNNTQAYWRDVGTIDSY
                     WAANLELIGVTPDLNLYDTDWPIWTHQEQLPPAKFVFDDEDRRGMAVDTMVSGGCIIS
                     GALVRHSLLFSNVIVNEHASVENSVILPNVIVNKKAKIRNAVVDKGCVIPEGMEIGFD
                     PVADKQRFEVSPNGIVLVTPDMLGQRLHMVR"
     gene            837018..838718
                     /locus_tag="HNEAP_RS03930"
                     /old_locus_tag="Hneap_0777"
     CDS             837018..838718
                     /locus_tag="HNEAP_RS03930"
                     /old_locus_tag="Hneap_0777"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_012823662.1"
                     /translation="MKHKKLPVVLCWHMHQPEYRDPRDKIYQQPWTYLHAIKDYVDMA
                     AHLERHPGARAVVNFVPILLEQLDDYSVQIAQYLETREISMLRDPLLVALVEPEKITD
                     PTARMTAVRACMRANEDRLIRRFEPFKDLVDLARSISVNTENGDYLSDQFIADLAVWY
                     HLAWMGETVRLENTLVKQLMAKPLGFNADERVQLLALIGSLIAGIFTRYRALSEGGQV
                     ELSMTPYAHPIMPLLLDITAGKQTCPHDPQPQQVSYPGGSDRVQWHLQHGLDVFKRFF
                     GVHPTGCWPSEGAVSEPTVHELAKAGFTWLASGDQVLSHSLQKQKMVESGCRHRVWQF
                     DALSPALFFRDDGLSDLIGFDYQKWHADDAVADFIAHLMKIRHDCQDDDAVVSIILDG
                     ENAWEFYPHNGYWFLDALYKGLSTHPDIELTTFSEVVTKTYQRKTLQHLVSGSWVYGN
                     LTTWIGSPAKNRAWDMLIDARLAFVKAQSAGQWDAQTEERNIQQLAICEGSDWFWWFG
                     DYNPGDAVRDFDHLYRLQLTRLYELIGEDVPANLAVPLCLGVGENSTVEAGGVMRRGQ
                     "
     gene            838760..840190
                     /locus_tag="HNEAP_RS03935"
                     /old_locus_tag="Hneap_0778"
     CDS             838760..840190
                     /locus_tag="HNEAP_RS03935"
                     /old_locus_tag="Hneap_0778"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017365635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-alpha-glucanotransferase"
                     /protein_id="WP_041600687.1"
                     /translation="MPCALRRAGVLAPVFSLPSGDFGPSVDQFLTFMNQSRLTVWQVL
                     PLGPPLMDGSPYQCASSFAINPAFLSDALLLNPDDFDPIAPIRERRAGQGALPSLLAE
                     FDEFCRASSNWLDDYALFIVIKSHEQGRSWLEWRPVWRDRDPASLEAFAQDHAKAVHA
                     VKFEQFLLDRQWRRIVTRAHELGVLIYGDLPIFVAGDSADVWANRAFFQLDERGLPTE
                     VAGVPPDYFSATGQRWGNPLFDWSRMAADGFSWWKQRMARHIDMFDWVRIDHFRGLAA
                     YWSIPAQCDTAIDGRWVEAPGAALLTALSEAFGGDLPIIAEDLGVITEDVTALRKAFG
                     MPGMLILQFAFDSDDDNPYLPANHHPDSVVYTGTHDNDTTLGWWQSLSPDAQAHMYDV
                     LAQQLNLSSSEPMPMALLRAAMASVAQLAIIPMADWLGCDSSGRINTPGTPTGNWTWQ
                     FERADMSAELSKRIRALVTEYQRDPD"
     gene            complement(840246..841510)
                     /locus_tag="HNEAP_RS03940"
                     /old_locus_tag="Hneap_0779"
                     /pseudo
     CDS             complement(840246..841510)
                     /locus_tag="HNEAP_RS03940"
                     /old_locus_tag="Hneap_0779"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018914356.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            841567..841770
                     /locus_tag="HNEAP_RS03945"
     CDS             841567..841770
                     /locus_tag="HNEAP_RS03945"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041600357.1"
                     /translation="MTARARTDTRINNGQEAVPRKKCLSEIQLERHDDYFDGDLPFNL
                     WKTTIVFGVKSKAKKLDLSKIFS"
     gene            complement(842110..843315)
                     /locus_tag="HNEAP_RS03950"
                     /old_locus_tag="Hneap_0780"
     CDS             complement(842110..843315)
                     /locus_tag="HNEAP_RS03950"
                     /old_locus_tag="Hneap_0780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019867772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012823665.1"
                     /translation="MLWNTFLLALREIRRNVMRSFLTILGIVIGVAAVIVMVTLGGGA
                     TAKVSEQIASLGSNLLIATPGKRMGPGQISGAPAFKVEDAEAIAREVPGLAAVAPASS
                     RAMTVVYGNQNWSTMVSGSTDDYFAARNWTIQDGRRFSSSELRSGAAVCIIGATVKSK
                     LFGSQDPIGDRIRLQKMACQVIGVLDAKGQSTMGTDQDDLVLIPLRTFQRRIAGNQDV
                     NIIQVSADKGVSTDRVKQDIEQILRERRHIPPAGESDFNVMDMKEITKMLTGTTQILT
                     ALLGAVAAVSLLVGGIGIMNIMLVSVTERTREIGIRMAIGALEREVLLQFLVEAIVLS
                     SLGGLIGIALALGGSIALASALNIPFVFNAGIVALAALFSAAVGVVFGYFPARKAARL
                     DPIEALRHE"
     gene            complement(843315..844031)
                     /locus_tag="HNEAP_RS03955"
                     /old_locus_tag="Hneap_0781"
     CDS             complement(843315..844031)
                     /locus_tag="HNEAP_RS03955"
                     /old_locus_tag="Hneap_0781"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="macrolide ABC transporter ATP-binding protein"
                     /protein_id="WP_012823666.1"
                     /translation="MSDAHAPAPLLELAGVTKVYGKGSASMQALRGINLAIAEGEFVA
                     IMGASGSGKSTAMNIIGCLDTPTSGNYRFRGFEVGQLNRDQRALLRRHELGFVFQGFN
                     LLARTSALENVELPLIYQGLPITERHNRARAALADVGLDGWEHHTPSELSGGQQQRVA
                     IARAIVTRPAILLADEPTGNLDTARSQEVMEMITRFNRDKGITVVMVTHEPDMAAYAR
                     RVIHFRDGLVESDTTQTGAA"
     gene            complement(844028..845314)
                     /locus_tag="HNEAP_RS03960"
                     /old_locus_tag="Hneap_0782"
     CDS             complement(844028..845314)
                     /locus_tag="HNEAP_RS03960"
                     /old_locus_tag="Hneap_0782"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_012823667.1"
                     /translation="MSATKPQPSAGTENARTPIFMQKSGGNRWKRWLLIVLAVAVLVA
                     GYIQFKGKETNTPQYVTQPVQRGDLTVEVTATGTLAPTNQVDVGIEVSGTIKEVLVDY
                     NDKVKVGQPLALLDPTKLEAQLRQSTAALDAARAKVQQAEATVQESKTQLARLKNVQK
                     MSGGKVPSKLEFDKAQATYNRAKADLASAWASVVQSEAVQNANRTDLSKTVVRSPING
                     IVLNRNVEPGQTIAASFQAPVLFTLAEDLTQMELQVDVDEADVGQVHVGQPARFTVDA
                     FPDRNFDAKVTQVRYGSQTVSGVVTYKTILKVDNRDLLLRPGMTATAHILVNEDKNAL
                     LVPNAALRFSPPVSTTTKSSGGLISNLMPRPPSSSQNSVQAATGKEQRVWVLKDGRPE
                     PIDVMTQQTNGIMTAITEGALQPGTPLIVDMNEQTK"
     gene            complement(845311..846792)
                     /locus_tag="HNEAP_RS03965"
                     /old_locus_tag="Hneap_0783"
     CDS             complement(845311..846792)
                     /locus_tag="HNEAP_RS03965"
                     /old_locus_tag="Hneap_0783"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_012823668.1"
                     /translation="MRPSGDLRLNFKTLYPRQITAGISAALILSGCAAVGPDYQKPTV
                     PVPKNWQSPIVNASPPSVDDAGLARWWREFHDPVLDRLIERALANNKNLKQAEARLLE
                     ARARRGFAEADRFPTLGTNASANRIGSSQELGSGLINNQYTAGFDARWEMDIFGGKRR
                     ALEAASAQVEASEADLSAVQTSLTAEVGVNYLNLRAFAARLAVAEANLAIQTQTRDLA
                     QWRYQAGLTSRLDLEQATSALEQTRAQIPVLETNLAQTKNQIAILLGINPEDLPPFAT
                     APIPQADAMMNTGIPADLLRRRPDIRRAERQLAAQTAQIGVATAAQYPDFSLAGSIGL
                     ASLASGNLFTAGAKTFSIGSNAAWTLFDAGRIHQNIQIQNALQAQALAQYESTVLTAF
                     AEVENALISYAREQERRAALTRAVAAAQSAQALAQSQYAAGLIDFQSVLDTQRSLLTL
                     QDLLTTSEAAVSTSLIQLYKALGGGWVANPPAADLTSSSEITP"
     gene            847106..847180
                     /locus_tag="HNEAP_RS03970"
                     /old_locus_tag="Hneap_R0026"
     tRNA            847106..847180
                     /locus_tag="HNEAP_RS03970"
                     /old_locus_tag="Hneap_R0026"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:847138..847140,aa:Val,seq:gac)
     gene            complement(847412..848857)
                     /locus_tag="HNEAP_RS03975"
                     /old_locus_tag="Hneap_0784"
     CDS             complement(847412..848857)
                     /locus_tag="HNEAP_RS03975"
                     /old_locus_tag="Hneap_0784"
                     /inference="COORDINATES: protein motif:HMM:PF02518.24"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="WP_012823669.1"
                     /translation="MSLVEVIGLPLRSWQRLKRLWRTSVFRLALLFALAFSLVVGVSL
                     AGVYWLSTQYIVGQIDVNLRDELTQLRGDVSDGSGEGEGLVGQIQEQVAQTDKSSRLY
                     LLVDANQHILAGNLLRWPDDLSCGQPAQFSDQSDIVPKKLQAEDSDIRVRALSTRLAD
                     GHCLLVGQAMVEEEGFTDHTGYLLSWALGIITLFSLAGGGWMGLAVLRRIDTITHTAT
                     QIMAGEFSRRIPDEGKGDEFSDLSARLNQMLDRIDELMAGMRSVTDNIAHDLRSPLTR
                     LRNRLEISLTHERPAEEYRNVMQQTLDDADQLLALFNTLIAIAQAEAGMRREVFTTVD
                     FSTLLIDLVDFYQLAAEDRGVHLSAQIQPGITRLASQGLLTQIVVNLLENALNHIPAG
                     SKVAVTLTQQEKSITLTIADNGPGIPNPADRLRVLERFVRLDAARSSPGSGLGLALVR
                     AAMHEQGGTVELHDNHPGLKVLLTFPRLKVS"
     gene            complement(848857..849537)
                     /locus_tag="HNEAP_RS03980"
                     /old_locus_tag="Hneap_0785"
     CDS             complement(848857..849537)
                     /locus_tag="HNEAP_RS03980"
                     /old_locus_tag="Hneap_0785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_012823670.1"
                     /translation="MKLLLVEDDVQAATYLAKGLEESGHSVDRAANGTDGLHLAMTGE
                     YDALIVDRMLPGLDGLGLIAAYRAAGRATPVLILSARGEVDDRVTGLKAGGDDYLTKP
                     YAFSELLARIEALTRRMQTRDSSDTLAVADLVLDRVRHKVMRRDQPILLQPREFRLLD
                     YLMRHAGQVVTRTMLLEQVWGYHFDPQTNVIDVHISRLRSKIDRDFDTPLLHTVRGAG
                     YVLSDVPV"
     gene            849673..851031
                     /locus_tag="HNEAP_RS03985"
                     /old_locus_tag="Hneap_0786"
     CDS             849673..851031
                     /locus_tag="HNEAP_RS03985"
                     /old_locus_tag="Hneap_0786"
                     /inference="COORDINATES: protein motif:HMM:PF02321.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane efflux protein"
                     /protein_id="WP_012823671.1"
                     /translation="MFIKSQLLNQTTRRWRATARAGTLLIMLAAVAGCAQYQPLPETA
                     RLPATPAPPKQVWTLESATRYAFKHNPQLIESNTQLTLARQQAGLANVPPPMSLGFSL
                     DHPWQQGLFNAFSLSVSQDLSYWLKQAPRKQATQARLRQAILNHRWQAWQLAAAVQQQ
                     YVTVWYQQKQLRLLHAQIQWLDQRITANAAAEQAGLITADTQALLLTNAAQWQQMAHA
                     ANLQQIKNLAQLRQLLGLPADTALHLIKPPQPALTSQIINTSSIAQRPDVLALKAAID
                     EQDAQYRQALIDQFPSISLGLTRAQDTSKVQTMGVGINLVLPSLDGNRHAISVAKTSR
                     KLAAEQYQHRLLQIRSDFAALRQKQAELQRARKQIKANLPALRQRLNEAEQAMAQGLL
                     NANTVDTLRQTVVNQRLALLQNTAARQRAGYALPALVGIDPAILSVSNAVANQSPTPT
                     EH"
     gene            851035..852132
                     /locus_tag="HNEAP_RS03990"
                     /old_locus_tag="Hneap_0787"
     CDS             851035..852132
                     /locus_tag="HNEAP_RS03990"
                     /old_locus_tag="Hneap_0787"
                     /inference="COORDINATES: protein motif:HMM:PF16576.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="WP_012823672.1"
                     /translation="MFSSFTRWTLIGLLGLAALNHTVLAADTAASDSVQIQVQLVPLA
                     EGRLQATPRFTGQIVPIPSAVRVASCAFEGRVTRLFVQPGSTVSKNAPLLTVHTSAQT
                     RQQVAQAKANLAFARKHLAQIKIMLKSQLATQSDWAQAEQGLALAEANWRSLVASGAT
                     KPQHTLTAARAGVVQTISVQLGGVFTANQPLLTTVAAGQWEIKIPTPVAVAQQLSNGD
                     AVKVQSVFGAQPPLTTHIFAIDPMVLPGSNRQPIHLHLPTSQSAQSPNWVLGEAISAQ
                     FTLPGQTGLILPHAAVQTDASGQNFIWLDRAHKAVAVPVHVLDTVEAQSVIEPIESGA
                     LTAGDQVVATGAPNVAAGMTLIAAPSTGAQP"
     gene            852129..855188
                     /locus_tag="HNEAP_RS03995"
                     /old_locus_tag="Hneap_0788"
     CDS             852129..855188
                     /locus_tag="HNEAP_RS03995"
                     /old_locus_tag="Hneap_0788"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007508791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="WP_012823673.1"
                     /translation="MRSYAAVAHFVLRHQRSLLFLLLVLVAGGVFTALTLPVALFPSL
                     SFPRIVVAVDAGNRDAAQMVRSITKPVEQALRSVPGVQSVASSTNRGSADLDLRFAWG
                     TDMARAELQTAAAMNSVLPSLPAGTAFRVHRENPTRFPVIAYSLTSNSQSQTELRTLA
                     QYTLAPLLSSIPGVRQVQIQGGALPEYHVLLNPERLKALNITAQEVVTALNSGQGQHA
                     IGHLQTPNRLELLLTDGRLRDAAEIGQVVIRHTAAGSVRVADVAQVVHSTVPNYQRIT
                     ADGKPAVLLMIKQQLGGNTVAIAHAVRASLHDNAPLIPAGVVLKKWYDQSTLIVDSAK
                     SVRDAIVLGVLFAILILFLFLKNGRVTLVALLVVPAVLASTLILLKLFGLDFNIMTLG
                     GMAAAVGLVIDDIIVMIEYLLHPKHTRRRPHLLHPLSEFTRPLVGSSTATIIIFAPLA
                     FLDGVTGAFFKALSLTMAASLILSFLFTWLVVPIVLNRLNIKPKPPKDSTVPQEGVMT
                     RGYRIVLSRLLRAPILLLPVIVGLGAIGWVSLTHIPTGFMPEMNEGGFVLDYQTRPGQ
                     SLTETNRELMQVEALIQAMPEVDTLTRRTGAQLGGGLTEANQGDMFIQLKSPDHQTEV
                     MDRIATEIAQKVPDVTVQDMNQPMGDLIGDLAGSPRPVVIRLFGQSQHELQALAPKVA
                     RAISGINGIKEVQNGLVIAGDTLEFHIDRNKAAVADITPGAIVQQMGTLFGGTVATRL
                     AEGEQVVGVRVITPKYLRATPQSLENMDLTNAAGQPVRVGDVGHFVSITGTPQITRYN
                     QKPMVAVSARIGGRGFGGTIADVKKALAQPGLLPQGVYYQLSGLYQQQQIAFHGLMLV
                     FATATALVFLALLFLYERFAISLSIISAPLMAVAGVLFGLWVTGQTLNITSLMGLTMI
                     IGIVTEVAVFYFFEVGRIRSGPWGDRLIEAGVRRLRPTIMTSLAAILTLLPLALGIGQ
                     GSAMQQPLAIAIISGMIVQIPLALLVMPTLYRLFLRKKYLAQQTSGS"
     gene            855307..855648
                     /locus_tag="HNEAP_RS04000"
                     /old_locus_tag="Hneap_0789"
     CDS             855307..855648
                     /locus_tag="HNEAP_RS04000"
                     /old_locus_tag="Hneap_0789"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014002296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049772565.1"
                     /translation="MSRALTAAVVLALGASTAVVYANNSPAKADAKITMEQAKAQALQ
                     LQPGTIKDAELEHEQGGSGLRYSFDIQTQQGVHEVGIDAMNGAVLENDIDHGDANDKT
                     DDHKDGETQDD"
     gene            856209..857192
                     /locus_tag="HNEAP_RS04005"
                     /old_locus_tag="Hneap_0790"
     CDS             856209..857192
                     /locus_tag="HNEAP_RS04005"
                     /old_locus_tag="Hneap_0790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012823675.1"
                     /translation="MKSVLRAVSRVVLGAVFLGGSALASAAPLTIGYSDWPGWVAWQV
                     AIEKNWFKDAGVDVKFDWFDYAPSMEAFAAGKLDAVTMTNGDALVTGATGAKSVMILI
                     NDYSNGNDMIVGAPGIDSLKDLKGKKVGVEIGFVDHLLLLNGLHKNGMTENDVQLVNV
                     PTNETPQVLASGQVSAIGAWQPNSGAALKLVPGSKPIYTSADAPGLIYDVLAVSPQSL
                     AMHRAEWEKVIKVWYRVVDYINDPKTHDEAVRIMASRVGVPPEEYQAFLKGTKILTLA
                     EAKSHFKKGPGLDSIYGSSEIVDKFNVDNKVYTVPQDINSYIDPALTDALK"
     gene            857226..858197
                     /locus_tag="HNEAP_RS04010"
                     /old_locus_tag="Hneap_0791"
     CDS             857226..858197
                     /locus_tag="HNEAP_RS04010"
                     /old_locus_tag="Hneap_0791"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011491902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate ABC transporter permease"
                     /protein_id="WP_041600358.1"
                     /translation="MSSMAHSSWFSVRQPLAPRRRFVLSLMSFGIPLLIWCLVSYVPA
                     VWHPMIKITDPGSVSYFSDGMLLNKDLFYKEQDRLEKEGKAPPQGIPANPVYLPTPGA
                     VATAFYTAFTTPPQRRDEKWLYQSLGDSISVIFLGFLISSLIAIPLGILAGTFDLFSR
                     LTEPFVEFFRYLPAPAFGALAVAILGINEAPKIAIIVIGTFFQQVLVVANTTRKIDTS
                     LLEAAMTLGANRLHLLFRVVIPGMLPDLFRDVRVLLGWAWTYLIVAEMIGASSGITWF
                     ITQQARYKNFENVYAAIMMIGFIGITTDLLLAWLSRRIFPWQRGSKA"
     gene            858250..859176
                     /locus_tag="HNEAP_RS04015"
                     /old_locus_tag="Hneap_0792"
     CDS             858250..859176
                     /locus_tag="HNEAP_RS04015"
                     /old_locus_tag="Hneap_0792"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012823677.1"
                     /translation="MSVNDTNSANHDLSYLDQSEAVRARFERLKQRPVVLEVKGLGKN
                     FDSSQGPVTALKDINFKVHKREFVCVIGPSGCGKSTLIRILAGLEQASGGAVLLDGKP
                     VEGPGPERGMVFQGYTLFPWLTVKKNVMFGLQVSGRGGLPEQEALQWIDLVGLSKFAN
                     HYPHQLSGGMKQRVAIARALANQPRILLMDEPFGALDAQTRARMQSHLMEIWKNIDIT
                     IVFITHDLDEAVYLADRILVLKAHPGEVQELIEVPVPQPRTSGHLDSPEFIATKKHIE
                     SLIHPKSMDEEEGEHLNMMRMVRVDDAVGDIF"
     gene            859190..859987
                     /locus_tag="HNEAP_RS04020"
                     /old_locus_tag="Hneap_0793"
     CDS             859190..859987
                     /locus_tag="HNEAP_RS04020"
                     /old_locus_tag="Hneap_0793"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="creatininase"
                     /protein_id="WP_012823678.1"
                     /translation="MKRTWHQLTWEEIGQIVADGMDAAILPVGATEQHGPHMGCGMDS
                     ELAGQLCRDAAAQTGVFLLPTLPYGCSVGHSRRWPGTLAVQPKTLIDLVKEIGDWVHS
                     AGINRLFIINSHVTNAAPLRCALEMLRAEHDGLMVALINSAQISPRVRDAHHADGDDW
                     HANAAETALMQYLAPELVREDKLIDADDPDRTADCVFSHPVNRTSLNGVTGSPSKATA
                     EDGRQLFEWMVTDLSEKIRMGLVEKPPLTHGYNDAVQFNKNAQSQKV"
     gene            859990..861375
                     /locus_tag="HNEAP_RS04025"
                     /old_locus_tag="Hneap_0794"
     CDS             859990..861375
                     /locus_tag="HNEAP_RS04025"
                     /old_locus_tag="Hneap_0794"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III glutamate--ammonia ligase"
                     /protein_id="WP_012823679.1"
                     /translation="MKSNASFKKKSKSSVKKIQASLAEKGVKYCLGAYVDIHGVPKGK
                     VVPLAHLDHMAQGSELYTGYALDGLGQRPNDDEIASVPDLDHIIQLPWQPEMAWMPAD
                     NTFHGEPYPLNTRVALKLQLEKAAEMGFGMNLGIEAELFVLKQNEDGSLSVPNPDDRL
                     TKPCYDARCFLDQFTWLDRMATAINDLGWDLYSFDHEDANGQYEFDFKYADALTTCDR
                     FTFLRLMAKEFAKQEGLLATFMPKPFANKTGTGAHFNMSLYDLETGSNLFACDPADDP
                     HGLGLTKLGYQFIAGVIKHGKALCAVLAPTVNSYKRLVRQGDMPYFTWAPVFNSFGSN
                     NRTNSIRVPMGGGRFESRNADGSVNPYLAATLLLAAGLEGIREGLDPGLPQEDNLYEL
                     TESERAARGIEFLPQNLAEAIDVFEADPFVTEVLGQELRDEFVRYKRREWTEYHLSVT
                     AWEVKRYSHLF"
     gene            861408..861854
                     /locus_tag="HNEAP_RS04030"
                     /old_locus_tag="Hneap_0795"
     CDS             861408..861854
                     /locus_tag="HNEAP_RS04030"
                     /old_locus_tag="Hneap_0795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013441780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel-responsive transcriptional regulator
                     NikR"
                     /protein_id="WP_012823680.1"
                     /translation="MNDLNRGALSRISISLPSRLLAELDKMVLKRGFDSRSQAIVEMI
                     NQQLVEHKSDLGFDVMAGTINLVYDHSTTNLQKELADLQHKYIDEVISSLHVHLMDNQ
                     TMEVILVQGPATKLQMIADQMISCSGVITGRLQLTTTQMPPLHPLT"
     gene            862196..862933
                     /locus_tag="HNEAP_RS04035"
                     /old_locus_tag="Hneap_0796"
     CDS             862196..862933
                     /locus_tag="HNEAP_RS04035"
                     /old_locus_tag="Hneap_0796"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea carboxylase"
                     /protein_id="WP_012823681.1"
                     /translation="MTEMMYEDVIPGGAHWSLEMAKGTQLVLIDETGGANVGMLFFNP
                     RNPLERYNAPDTLKCQHTFKLTQGHCLYSDMGRIFCSIVEDTVGWHDTVGGNLSKQKL
                     REKWTERRYQQAHNDWTLSGVDSFLVEMAKYGLGKKDMAANLNLFSKLAVEDDGTLVF
                     VEQHSTAGDKIALRFEMNTLVIFHTCPHPMNPAASYPKKPVRYQIWTADPVTDDDLCM
                     NSRVENQRGFKNTELYQPTCCSAHSCA"
     gene            862943..863581
                     /locus_tag="HNEAP_RS04040"
                     /old_locus_tag="Hneap_0797"
     CDS             862943..863581
                     /locus_tag="HNEAP_RS04040"
                     /old_locus_tag="Hneap_0797"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014578358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea carboxylase"
                     /protein_id="WP_012823682.1"
                     /translation="MIKHSTLTPEVATFRQVVEAGDYFIKIVQSGQTVRILDLEGNQA
                     ADTLFYRADNPTERYSAIDTIREQGNVYLSAGTLLLSTEGNPMLEIVADTCGRHDTLG
                     GACATESNTVRYGLQTKCMHACRDSWMLAVAEHEEYGLSKRDITHNINFFMNVPVTSE
                     GGLTFEDGISDAGKYVELTAKMDVIVLISNCPQLNNPCNAYNPTPIEVLIWN"
     gene            863706..867332
                     /locus_tag="HNEAP_RS04045"
                     /old_locus_tag="Hneap_0798"
     CDS             863706..867332
                     /locus_tag="HNEAP_RS04045"
                     /old_locus_tag="Hneap_0798"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea carboxylase"
                     /protein_id="WP_012823683.1"
                     /translation="MFHKVLIANRGAIACRIIRTLKKMGITSVAVYSEADRHARHVAE
                     ADEAVFIGAAPASESYLDQAKILEAARATGAEAIHPGYGFLSENAGFAEACAAAGIAF
                     IGPTPQQMRDFGLKHTARELAEKNSVPLLPGSGLLDDVAHALREAERIGYPVMLKSTA
                     GGGGIGMKLCWTADQLHEAYDSVERLSRSNFSQGGLFLEKYVEQARHIEVQIFGDGKG
                     QVVSLGERDCSVQRRNQKVIEETPAPGLDESLRTELWGAATRLGQAVNYQSAGTVEFV
                     YDVKNAAFYFLEVNTRLQVEHGVTERVTGVDLVEWMVRVAAGEPPALASFVFAPQGHS
                     VQVRLYAEDPGKLFQPSSGLLNSVVFPDHSSPDGIRIDSWIETGSEVSAYYDPMLAKI
                     IAHGADRTTALAQLSQALEQTHIYGIETNLAYLRQVLTDAVFVAGQQTTRYLDQFSFA
                     PRTIDVLSPGTQTMIQDYPGRVGYWSIGVPPSGPMDSLAFRVANRLVGNPEDAAGLEM
                     TITGPNLRFNVATTIALTGARMKAELDGVSVPYGQAVAVAAGSVLKLKSIQGGGSRTY
                     LALQGGLDAADYMGSKATFTLGQFGGHAGRCLRAGEVLRLDQLGTTPDLVVTAPQALV
                     PECTKHWDIAVMYGPHGAPDFFTDDDISMFFDTHWQVHYNSSRTGVRLIGPKPTWART
                     DGGEAGLHPSNIHDNAYAIGAVDFTGDMPVILGPDGPSLGGFVCPVTIIQAELWKMGQ
                     LTPGDTIRFYCVDYPQAQALALAQDEAIAHLSAPKTIEITPQTAGDTVSPILYRTAGS
                     EDKIAVCYRQAGDRSLLIEYGPLVLDLDLRFRVHALMTWMQNAAIPGVLDLTPGIRSL
                     QVQYDGRVLSQSELIRVLQQAEASLPAIDDMTVPSRIVHLPLSWGDPATRLAIEKYMQ
                     SVRPDAPWCPSNIEFIRRINGLDSIEDVKDILFNARYLVMGLGDVYLGAPVATPLDPR
                     HRLVTTKYNPARTWTPENAVGIGGAYLCVYGMEGPGGYQFVGRTVQMWNRYRQTQDFT
                     GGKQWLLRFFDQLRFYPVGADEIMQLREDFIQGKFKIKIEETELKLGDYRAFLAAERE
                     SIDAFKSKQQAAFDEERERWAQAGQANETPDFAEVDVVETDVAAIPPGCIALTSPVTG
                     NIWQLHVKPGDTIEIEQELLIVEAMKMEIAIPCEETGTVVEILCEQGTAVTAGQTLLI
                     IKPH"
     gene            complement(867431..867517)
                     /locus_tag="HNEAP_RS04050"
                     /old_locus_tag="Hneap_R0027"
     tRNA            complement(867431..867517)
                     /locus_tag="HNEAP_RS04050"
                     /old_locus_tag="Hneap_R0027"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(867481..867483),aa:Leu,seq:caa)
     gene            867758..869947
                     /locus_tag="HNEAP_RS04055"
                     /old_locus_tag="Hneap_0799"
     CDS             867758..869947
                     /locus_tag="HNEAP_RS04055"
                     /old_locus_tag="Hneap_0799"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011630229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal protein N'"
                     /protein_id="WP_041600691.1"
                     /translation="MVYWQVALPGPLQMLFTYGVPADVSARAGMRVWVPLGKGQRMGV
                     LWSPAEKETEWVIKPVLSVLDDEPLLDEELLACLGWAADYYHFPLGETVLAALAPSLR
                     QGRSLHELAWRILPSGEQALADGTLRGARQRALLERIAQTPQGVSESQLRDFPKAVRL
                     RLADLGLIEPFEQMMPSTWPVLAEMSGNKLPAPDLNEAQSAAVSAVAACLENFGVWLL
                     EGVTGSGKTEVYLNLISRVLAQGRQVLILVPEIALTPQLVTRFTDRLGLVPAVLHSGL
                     NDGDRLNAWLAARSGDATVVIGTRSAVFQPFADLGLIVVDEEHDGSFKQSEGFGYHAR
                     DVAIWRARRLGVPIMLGSATPSLESLRNVSLSRYHLLTLPERAGGAAMPDIRLLDVRQ
                     QRMRGGLSDDLVAAIETHLLAGGQVMLYLNRRGYASNLLCHACGWVAECAHCDSFMTW
                     HRGVNRLRCHHCGFERQPPSVCPNCSATLSPRGLGTEQLEDVLTGLFPGFGIERLDRD
                     ALSRVGELDRRLARIQSSEARLIVGTQILVKGHDFPHVSLVAVVDADQALFANDFRGA
                     ERFAQQLIQVAGRAGRASRAGTVLVQTHQPEHVGLNRLIHAGYASFAQTLLAERAEAG
                     LPPVRAAAMIRADARDADAPRELLTHMADWLHEHLADPADSPLDVWGPVPAPLARRAG
                     RYRYQLLILADDRPRLHAALSQLESWQGTRRTKGIRWSIDVDPVDMA"
     gene            870006..870344
                     /locus_tag="HNEAP_RS04060"
                     /old_locus_tag="Hneap_0800"
     CDS             870006..870344
                     /locus_tag="HNEAP_RS04060"
                     /old_locus_tag="Hneap_0800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015674060.1"
                     /note="indirectly regulates nitrogen metabolism; at high
                     nitrogen levels P-II prevents the phosphorylation of NR-I,
                     the transcriptional activator of the glutamine synthetase
                     gene (glnA); at low nitrogen levels P-II is uridylylated
                     to form PII-UMP and interacts with an adenylyltransferase
                     (GlnE) that activates GlnA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein P-II"
                     /protein_id="WP_012823685.1"
                     /translation="MKKIEAIIKPFRLDDVRTALMELGINGMTATEVKGFGRQKGHTE
                     LYRGAEYVVDFLPKIKLEIVVSDGLVDAVLDAIIKAAHSGKIGDGKIFVFPVERAVRI
                     RTGEENEDAL"
     gene            complement(870494..871597)
                     /locus_tag="HNEAP_RS04065"
                     /old_locus_tag="Hneap_0801"
     CDS             complement(870494..871597)
                     /locus_tag="HNEAP_RS04065"
                     /old_locus_tag="Hneap_0801"
                     /inference="COORDINATES: protein motif:HMM:TIGR02352"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine oxidase ThiO"
                     /protein_id="WP_012823686.1"
                     /translation="MSQTDCIIVGSGVAGLSSALRLAKAGWRVTVLEREEIGREASWA
                     GGGILCPLYGWRYPESVMRLAAAGMAQYRGFTQELSANGHTDPELFTSGMLILDAGST
                     PAEQSNASNWATHYGIPHQWQDANQHFPHLPKEPALWLPEIETVRNPRLMRALVESVR
                     EAGVDIRAHTPVHGLVQDAHRVTGVHTEQGELLAEHVLITAGAWSGQLVPDPLIPGLN
                     PADIFPVRGQMIRFDAAMHTGLSTILMDEGVYLIPRKDGSVVVGSTVEHVGFDKHTTD
                     DAMNRLHRKAVELWPNLAHAPVAQQWSGLRPGTRDEIPYIGAHPDIAGLFVSTGFYRN
                     GLAMAPAAAELITDVMLGRPTPSNLSDYRIDRP"
     gene            complement(871728..871801)
                     /locus_tag="HNEAP_RS04070"
                     /old_locus_tag="Hneap_R0028"
     tRNA            complement(871728..871801)
                     /locus_tag="HNEAP_RS04070"
                     /old_locus_tag="Hneap_R0028"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(871767..871769),aa:Gly,seq:ccc)
     gene            complement(871881..872591)
                     /locus_tag="HNEAP_RS04075"
                     /old_locus_tag="Hneap_0802"
     CDS             complement(871881..872591)
                     /locus_tag="HNEAP_RS04075"
                     /old_locus_tag="Hneap_0802"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012823687.1"
                     /translation="MLSKDKFDLHAEHHRINRNSWLRASVMGANDGIVSVSSLMLGFI
                     ASNADNHTIVLAGLAGLVAGAMSMAAGEYVSVQSQKDTEQADLAQEANELKNNFDYER
                     QELAAIYRERGLSEKLADQVATELMEHDALGAHARDELGLHEISRARPMQAAYSSAAA
                     FSVGAGLPLVTALLLPQAWLFTGVIAMTLLALVILGSLAAWTGGASIVRGASRVLIWG
                     ALAMAATSLIGHFFGISV"
     gene            872656..872880
                     /locus_tag="HNEAP_RS04080"
                     /old_locus_tag="Hneap_0803"
     CDS             872656..872880
                     /locus_tag="HNEAP_RS04080"
                     /old_locus_tag="Hneap_0803"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823688.1"
                     /translation="MHEGNKPNILWEVHKIPSLGIFDVVRANLKDFKLLRCLLSLTIV
                     LNWANIRASDCVGLGSTFILSSYFYSKPQV"
     gene            872893..875013
                     /locus_tag="HNEAP_RS04085"
                     /old_locus_tag="Hneap_0804"
     CDS             872893..875013
                     /locus_tag="HNEAP_RS04085"
                     /old_locus_tag="Hneap_0804"
                     /EC_number="2.7.6.5"
                     /inference="COORDINATES: protein
                     motif:HMM:PF04607.15,HMM:PF13328.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RelA/SpoT family protein"
                     /protein_id="WP_012823689.1"
                     /translation="MRYALDAPNESLCSELAERTAGNTQVLAACRLAGSVWDGVVTRA
                     RGPRAALDLLEIGADIETVQACVLADPRLQGKMDLAELRRDYGEVVAGQVEQMQRLLQ
                     LGEQYRRDQQADWYENLRRLLLSAISDVRVMLIQLVHRLERLRGLAFEPDLTKRRAIA
                     AETLDVYAPIAHRLGLGQIKWELEDLAFRHLEPEIYKRIAHLLDERRTEREAYLLRVR
                     TTLESALAAAGIKARVYGRPKHIYSIWGKMQRKKLSFDGLFDVRALRVEVDTLQDCYA
                     ALSVAHSLFSPIEAEYDDYIARPKENGYQSLHTAVHALDDKVVEIQIRTRAMHEQAEL
                     GVAAHWRYKEGGGHQEDPFAAELNRLRQALAAGGTAQPRVEDVYVFTPQGDIIALPLG
                     STVLDYAYRVHTLVGHRCRGAKINGQIVPIKTLLNQADQVEILTQPTPAPSREWGSAQ
                     AGFLHSASARAKVRNWFHRLDQTAARDAGAVYCDRLFRRLGLNRQAQSKLMSTLKFKS
                     LDALYEAVGDHKLDTNSLLNAARAVIKAPEQEQEPAQQLKNTSRSGAAKSPEDAVLSL
                     DGMKAQPAGCCQPRPGDPVLAFITRGQGLKLHKQDCANIRHLQAEFPARILAVEWPSQ
                     PTHWAQLLKLDFLLEDVARFWADLGPVLAPFKARVVESRSRLERNSGLTDMAVTFELP
                     AAGDVSGLIKRLQALPAVESVQRV"
     gene            complement(875035..875487)
                     /locus_tag="HNEAP_RS04090"
                     /old_locus_tag="Hneap_0805"
     CDS             complement(875035..875487)
                     /locus_tag="HNEAP_RS04090"
                     /old_locus_tag="Hneap_0805"
                     /inference="COORDINATES: protein motif:HMM:PF02635.13"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823690.1"
                     /translation="MNRRRFLNTLLGVSTLAGFPTVQAWAGEHRKLKHVVYELDEKDP
                     SHELAVLRNVKNNLNASGPTAMHIEIVIHGGGINLLKNAVLDDALQEKINGLKKDGVK
                     FRVCNNTIHANKLDYKNDLYGVSSEDIVPSGVAYLVDRQLEGWAYMHP"
     gene            875905..876507
                     /locus_tag="HNEAP_RS04095"
                     /old_locus_tag="Hneap_0806"
     CDS             875905..876507
                     /locus_tag="HNEAP_RS04095"
                     /old_locus_tag="Hneap_0806"
                     /inference="COORDINATES: protein motif:HMM:PF11845.6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012823691.1"
                     /translation="MLSPNIYLRYSLAAVIAISVTFPLGTLAESAQAQMSEQTAMQKS
                     QAAIKEYATTLKAALQTAMKAGGPMAAIPVCHTQAPQIAAQVGKKYDLEIHRTSLKPR
                     AIAPQPWEKTVLEQFEVEKDAGKPIGKIVWHKTVEVDGQKELRLMKAIPTGEVCLTCH
                     GTNVAPAVLSKIKSLYPNDEATGYKLGDIRGAFSVTAALN"
     gene            complement(876582..877691)
                     /locus_tag="HNEAP_RS04100"
                     /old_locus_tag="Hneap_0807"
     CDS             complement(876582..877691)
                     /locus_tag="HNEAP_RS04100"
                     /old_locus_tag="Hneap_0807"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter ATP-binding protein"
                     /protein_id="WP_012823692.1"
                     /translation="MFQGNLQLKLGNFALDSGEFAFESSGVTVLFGRSGSGKSTLLRA
                     MSGLDKQSHGELRFNDEVWQSGKKALPVEQRDIGFVFQTAALLPNKNVQGNLDFAIKR
                     IPKHRQHGPSTQEIIERVGISHLLNRPVDNLSGGERQRVAIARALLTRPRLLMMDEPL
                     SALDWRAKSELLLLIESVIADYQIPTLYITHAPIEVERLANRVVFMADGKITSIESLG
                     DATSRIDSPLFTEEGPVSVLHGQLGDIDPDGLIAFQSRQQPGSDSAFTFWLNRTEHSN
                     PHASGAQARLRVLARDVAIALHRPEGISMLNQIPATISQIEAEPPTQRQVVFLALADG
                     QTLLAELSRRSVQRLGLAIGQTVFALVKTAALLDR"
     gene            complement(877695..878387)
                     /locus_tag="HNEAP_RS04105"
                     /old_locus_tag="Hneap_0808"
     CDS             complement(877695..878387)
                     /locus_tag="HNEAP_RS04105"
                     /old_locus_tag="Hneap_0808"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter permease subunit"
                     /protein_id="WP_012823693.1"
                     /translation="MQILGYPLDVGPILLTLEVATITSIVLLLIGTPIAWWLANMRSR
                     ARIFFEALVALPLVLPPTVLGFYLIIALNPDGTLAQFLKYFGITGQLTFNKTGLIIGS
                     VVYSLPFTVQPIMAAFEALPTQIVDAARTMRASFFDRFFTVIVPLARQGFLVGVVLTF
                     AHTVGEFGVVLMVGGNIEGMTRTVSIAIFDHVESLEYTEAHILSILMLIFSMLVLIFV
                     YGLNRRLQIKTG"
     gene            complement(878741..879511)
                     /locus_tag="HNEAP_RS04110"
                     /old_locus_tag="Hneap_0809"
     CDS             complement(878741..879511)
                     /locus_tag="HNEAP_RS04110"
                     /old_locus_tag="Hneap_0809"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012823694.1"
                     /translation="MNRMLTTTFATTLLLSASIASAQADTITVAVAANFTKAAEQIGE
                     QWSKETGNKVRFSFGPTGGLYAQINNGAPFDAFFSADTKTPERLVKAGKATDFRVYAQ
                     GKLALYSTQLPVAKEHNQIIKAAKFNHIAVANSKAAPYGAAGVAVLKNMGMYDKLKSE
                     NKIATGESITATFQFVMTGNAQLGFVAFSQLMDPQSPAHNKGEYWLVPQKDYAPINQG
                     AVLIKTSKHAKTAKEFMDYMNSPAAKKIIESYGYAMPQ"
     gene            complement(879603..880406)
                     /locus_tag="HNEAP_RS04115"
                     /old_locus_tag="Hneap_0810"
     CDS             complement(879603..880406)
                     /locus_tag="HNEAP_RS04115"
                     /old_locus_tag="Hneap_0810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010811530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ModE family transcriptional regulator"
                     /protein_id="WP_012823695.1"
                     /translation="MSIYSERDLGEFVLPLALKFGEHEISNRRMKLLEAVHQTGSISG
                     AAKAIGMTYKAAWDAIDAINNRAAKPVVVSQHGGAGGGGAVLSEYGEELIAAFGKLEA
                     MQQELTKLFERHQIEHLTHDLRSVLMKTSARNTFSGTIKSLTKGAVNSEVVLGLQGDD
                     EITAIITNASVENMELAVGKPAFAMIKASFIIVSPERMSSSARNQLCGVVERVTDGSV
                     NAEVVIKLAGGNLVTAIITEGSTQSLGLKAGDKACAIIKASHVIIGVDN"
     gene            complement(880522..880974)
                     /locus_tag="HNEAP_RS12195"
     CDS             complement(880522..880974)
                     /locus_tag="HNEAP_RS12195"
                     /inference="COORDINATES: protein motif:HMM:PF02254.16"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441103.1"
                     /translation="MQRKDHIIVVGNGPFARNATESLEKRGLEVTRILPTAPAQGSDI
                     PKDFIIGDGADSETLLKVQADAARAIIALTEDDSENAFIILAAREVNEKIKTVVAVSD
                     AHHLNKIKRVHPDVVLALPVIGAELLAMALSGEEIKTDALLEQLLKLD"
     gene            complement(880884..881744)
                     /locus_tag="HNEAP_RS04120"
     CDS             complement(880884..881744)
                     /locus_tag="HNEAP_RS04120"
                     /inference="COORDINATES: protein motif:HMM:PF07885.14"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441104.1"
                     /translation="MKPMNQRLKHPLRIFHAFWHRVYHALRMDFWFPHVPIALAVGLS
                     GLMQITQTLSVIEEFLALPQQSIEQLSGGFSSLAIRGIPHDVIGVLLVIMSLGLLIRS
                     RLAWMVTVLMSIASLLLELTPLASQPAGLILFHAVVLLLLFFNRQHFQRTSLTTGTLF
                     SITGVLLTLGFGVIGSYVLGAQFKPAITDFPTALYFTIVSMSTVGYGDIIAQTTEARM
                     FTISLIILGLLVFATSLTAILGPMMNQQIMKLVQPRGKKCNARIILSWSVTAPSLEMR
                     PNRWKSAALK"
     gene            complement(881975..883447)
                     /locus_tag="HNEAP_RS04125"
                     /old_locus_tag="Hneap_0814"
     CDS             complement(881975..883447)
                     /locus_tag="HNEAP_RS04125"
                     /old_locus_tag="Hneap_0814"
                     /EC_number="4.1.99.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018139986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribodipyrimidine photo-lyase"
                     /protein_id="WP_012823697.1"
                     /translation="MTTIVWFRQDLRLGDHPALDAAIQTGADQGHIIPVYIHPGYAPS
                     DQTADATKPLYEGAAARWWRHHSLRSLAERLASCGSRLIIRQGEPLAELQRLIHETKA
                     NRVVWNRRMEPAARAEDTRIKAALRAEGINVDSFNGNYLHEPWTIQNKQGKPFKVFTP
                     YWKAVVAAGLDLPTYPEPDNLPTVPRALNSLAIDELELLPAIAWDKDFYNHWQPGEPG
                     AWSRFEDFLPLIDEYAEARNHLIGTGVSKLSAHLHFGEISPRQIVRYLLDTRGSVLEP
                     RGIEHFVRELGWREFGAYLAYHYPQTVDAPLDARFLNFKWRDAPDDLRAWQRGQTGIP
                     VVDAAMRCLWQTGWMHNRARMIVASFLTKNLLIDWRCGAAWFMDTLVDADEPSNTAGW
                     QWTAGTGADAAPYFRIFNPVLQAEKFDPDGTFIRRWVPELARLENKYLFAPWTASETA
                     LAQAGIVLGKTYPEPISDLKVSRQRALVHFDQIKQNTTAP"
     gene            883540..884700
                     /locus_tag="HNEAP_RS04130"
                     /old_locus_tag="Hneap_0815"
     CDS             883540..884700
                     /locus_tag="HNEAP_RS04130"
                     /old_locus_tag="Hneap_0815"
                     /inference="COORDINATES: protein motif:HMM:TIGR01730"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="WP_012823698.1"
                     /translation="MIELKHTQPAGGLPLRNGLTSPGSVMTSGLVLVLAMAITGCQKQ
                     SAEVELPPPVVRVATIAPGTLAQPDLTGVIVAKTQSAVGFQVSGRIAERVVKRGAGVK
                     AGEVLATLDDADFKAKQAAALAQAQQAQAEARFAQQNFTRVQSLLAKKLASQQEYDQA
                     KSNLQAAKANEQASQAQLEQARLALGYTALKAPFASVVAAIDADQGAVVNAGQPVVTL
                     AAGDARQALVAVPEQRLMRLPNTAQARVHGQSTAIEATFASNEGEVDPASRTWSVRFN
                     LAANPSVKTGLGQSITLSFPKQTVPKSVPITAILGQGSQAAVFEVRQNGTVKMQPVTV
                     TRLEHESAVISTDLASGTRIVALGVNRLHDGQRVRIQPGLGTDTAPNTEDTP"
     gene            884697..887804
                     /locus_tag="HNEAP_RS04135"
                     /old_locus_tag="Hneap_0816"
     CDS             884697..887804
                     /locus_tag="HNEAP_RS04135"
                     /old_locus_tag="Hneap_0816"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_012823699.1"
                     /translation="MSEQPRRSFSGFNLSALAVRERAVTLYFIIMVALVGVYSFISLG
                     RAEDPAFTLKVMLVSAQWPGATARQMQDQVADPLEKALQDVPYFDRVDTTSRPGSIAM
                     QINFREDTPPDQVQQAFYQVRKHLGDVAPTLPKGVQGPFFNDDFSDVYFTLYALTAPG
                     LPERDLAREAERLRSAVLNVPGVAKAHILGEQPEQVYVDFDPHRLTTLGITPAQIGQA
                     LAAENTIVPAGLIETTGPRLYFRLDSGLRASAPGLVQRIENTSVNIQGKVVRIGDVAN
                     VRLGYADPPSYIIQSNGQNAIIVGVIMAKNVNGLALGERLGAFEKAESQALPLGVQLT
                     KITDQAHAIALAVNTFQLKFFIALGVVMLVGFISLGLRAGLVVALAVPLTLSITFGIM
                     LMTGKNLDRITLGALILSLGLLVDDAIIAIEMMLVKLEEGVDRVEAAAAAWRITAAPM
                     LIGTLITVVGFVPIGFAQSNVGEYAGNIFWILGISLIASWLVAVVFTPYLGVHFLPKV
                     TPHAEGSAGMYQGRIYRGLRRVVTFCVNYRWLVAGVTLLLFVASIAVMGKGVAKQFFP
                     SSDRPELLIDINMPEGSSIEATKKVAHRVEAALHGAPQLESLSTYIGQGAPRFFLALN
                     PELPNPAFAKIIAVAHNATERDELQAMLQKKIDDGDFPEARIRPHPLLYGPPVIWPVQ
                     FRVMGPDIRELQRIGEQVRSVMAANAHTIDPHLEWGEKVPVLDFKLDQARLAALNITP
                     QAIAEQTQTWLSGTTATQLRVDIRSVDLSVRGSPAQSRQLTQLEALPIRLDNGKTVPL
                     GQLGHITTAYQYPILKRRNRDPYINVNAEVQGAQPPDVTAAIWKKLESIRTDLPLGYQ
                     IQIGGSVEESGKAQASIAKVMPIMVLLMLTLIMLIMRSFPGMFMVLLTAPLGLIGAVA
                     SLALFNQPFGFVALLGLIGLAGILMRNTLILVGQIHENERQGQDRYTAVIEATIRRAR
                     PVILTALAAVLAFIPLTESTFWGPLAYTLIGGIFGGTFLTLLFLPAMYALWFRVKRPV
                     VEKPV"
     gene            887901..887977
                     /locus_tag="HNEAP_RS04140"
                     /old_locus_tag="Hneap_R0029"
     tRNA            887901..887977
                     /locus_tag="HNEAP_RS04140"
                     /old_locus_tag="Hneap_R0029"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:887935..887937,aa:Pro,seq:ggg)
     gene            888262..>888492
                     /locus_tag="HNEAP_RS12485"
                     /old_locus_tag="Hneap_0817"
                     /pseudo
     CDS             888262..>888492
                     /locus_tag="HNEAP_RS12485"
                     /old_locus_tag="Hneap_0817"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611071.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     repeat_region   888499..890746
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=888569..888605
                     /rpt_unit_seq="gtttcaatccgcgcccggcggttaggccgggcgattc"
     gene            complement(890923..891213)
                     /locus_tag="HNEAP_RS04150"
                     /old_locus_tag="Hneap_0818"
     CDS             complement(890923..891213)
                     /locus_tag="HNEAP_RS04150"
                     /old_locus_tag="Hneap_0818"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011111456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated endonuclease Cas2"
                     /protein_id="WP_012823700.1"
                     /translation="MLIIVAYDVSTETAAGRKRLRRVAKVCERMGQRVQKSLFECTIN
                     EMQYEQLERDLLNEIEETEDNLRFYRIIEPVEMRVKQYGCFRSVDFEGTLIV"
     gene            complement(891222..892256)
                     /locus_tag="HNEAP_RS04155"
                     /old_locus_tag="Hneap_0819"
     CDS             complement(891222..892256)
                     /locus_tag="HNEAP_RS04155"
                     /old_locus_tag="Hneap_0819"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="subtype I-C CRISPR-associated endonuclease Cas1"
                     /protein_id="WP_012823701.1"
                     /translation="MHTVQNTLYIMTPNAYVHLENATVRIDVEREKKLQVPLHHLNGL
                     VCFGNIMISPALMHRLADDGKSLVLMDSSGRFKARLEGPVSGNILLRQAHHRQASDAA
                     FALEIARTIVSGKLKNSRSVVQRGARETSDTIETTQLTRSADNLAASLRAAAAATSMD
                     ELRGIEGEAARGYFSAINLIVKTAMRANFQLNGRTRRPPLDRFNALISFLYAMLMNDC
                     RSAIEATGLDAQLGFLHAVRPGRAALALDLMEEFRAIAADRLALTLINRGQINASDFD
                     EREGGAVMLNDRGRRAVVTAWQERKQEIVTHPLTETKIPIGLLPFIQARFLARTIRGE
                     MDGYLPYQSK"
     gene            892259..892609
                     /locus_tag="HNEAP_RS04160"
                     /old_locus_tag="Hneap_0820"
     CDS             892259..892609
                     /locus_tag="HNEAP_RS04160"
                     /old_locus_tag="Hneap_0820"
                     /inference="COORDINATES: protein motif:HMM:PF01402.19"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081441105.1"
                     /translation="MYYNVRYILCFMENDMATLNLRLPDSLDRQLSALAAQTQQNRSD
                     LARAALEQYLRDQERERLMAEMEAAFRVLATSPEARAESIGIAEEFMPLENEALDFVE
                     GREPGDAESEAWWK"
     gene            892609..892962
                     /locus_tag="HNEAP_RS04165"
                     /old_locus_tag="Hneap_0821"
     CDS             892609..892962
                     /locus_tag="HNEAP_RS04165"
                     /old_locus_tag="Hneap_0821"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MazF family transcriptional regulator"
                     /protein_id="WP_012823703.1"
                     /translation="MRRGDIWLARLNPNTGAEIGKVRPVVILLAQRYLDAGSPVVMIA
                     PLTTQFWPGMTALRIAVPQRGRLLKDSFVALEQTRALDRSRFGDTRLAELSADEMQIL
                     DRQLMAMFGMVIAPH"
     gene            complement(892946..893566)
                     /locus_tag="HNEAP_RS04170"
                     /old_locus_tag="Hneap_0822"
     CDS             complement(892946..893566)
                     /locus_tag="HNEAP_RS04170"
                     /old_locus_tag="Hneap_0822"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas4"
                     /protein_id="WP_012823704.1"
                     /translation="MNEPDSVPLSALQHWVYCPRQCGLIHLEQAFEDNIHTARGQAVH
                     HLVDTPGYEIKSGVRVERALPLWSDQYNLIGKADLVEFHPDGSIYPVEFKHGAKRQKL
                     HDDIQLAAQAICLEDMLGRPVPKAAIFHASSHRRREVAITQALRDLVLATAEDIRAML
                     ASSKLPPPVNDARCKECSLKEICQPEALAEQMRLHRLREELFNVAQ"
     gene            complement(893595..894470)
                     /locus_tag="HNEAP_RS04175"
                     /old_locus_tag="Hneap_0823"
     CDS             complement(893595..894470)
                     /locus_tag="HNEAP_RS04175"
                     /old_locus_tag="Hneap_0823"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I-C CRISPR-associated protein Cas7/Csd2"
                     /protein_id="WP_012823705.1"
                     /translation="MSLTNRYDFVLLFDVKDGNPNGDPDAGNLPRMDAETGHGLMTDV
                     SLKRKVRNFVGIAKGEQPPYEIYVKEKAILNNQHKRAYVGIGREELLAGDDKKRKGGD
                     AVDDARQWMCRNFFDVRTFGAVMSTGINCGQVRGPVQLTFARSIDPIIAQEHSITVCA
                     ARKEDKPIEEQIGIQGRKHTVPYGLYMAHGFISSFLAKQTGFSEDDLELLWQALTQMF
                     EHDRSAARGEMTTRGLYVFKHDSELGNAPAHALFERIQPKLKPGISVPRNFTDYEVWV
                     DEADFPAGVTLLKKF"
     gene            complement(894467..896203)
                     /locus_tag="HNEAP_RS04180"
                     /old_locus_tag="Hneap_0824"
     CDS             complement(894467..896203)
                     /locus_tag="HNEAP_RS04180"
                     /old_locus_tag="Hneap_0824"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012823706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology