GenomeNet

Database: RefSeq
Entry: NC_013422
LinkDB: NC_013422
Original site: NC_013422 
LOCUS       NC_013422            2582886 bp    DNA     circular CON 30-JUL-2013
DEFINITION  Halothiobacillus neapolitanus c2 chromosome, complete genome.
ACCESSION   NC_013422
VERSION     NC_013422.1  GI:261854630
DBLINK      BioProject: PRJNA41317
KEYWORDS    RefSeq.
SOURCE      Halothiobacillus neapolitanus c2
  ORGANISM  Halothiobacillus neapolitanus c2
            Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales;
            Halothiobacillaceae; Halothiobacillus.
REFERENCE   1  (bases 1 to 2582886)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H.,
            Bruce,D., Goodwin,L., Pitluck,S., Davenport,K., Brettin,T.,
            Detter,J.C., Han,C., Tapia,R., Larimer,F., Land,M., Hauser,L.,
            Kyrpides,N., Mikhailova,N., Kerfeld,C., Cannon,G. and Heinhort,S.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Halothiobacillus neapolitanus c2
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2582886)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-OCT-2009) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2582886)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H.,
            Bruce,D., Goodwin,L., Pitluck,S., Davenport,K., Brettin,T.,
            Detter,J.C., Han,C., Tapia,R., Larimer,F., Land,M., Hauser,L.,
            Kyrpides,N., Mikhailova,N., Kerfeld,C., Cannon,G. and Heinhort,S.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (16-OCT-2009) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP001801.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4083909
            Source DNA and bacteria available from Sabine Heinhorst
            (sabine.heinhorst@usm.edu)
            Contacts: Sabine Heinhorst (sabine.heinhorst@usm.edu)
                      David Bruce (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Halothiobacillus neapolitanus c2, ATCC
                                     23641
            Culture Collection ID :: ATCC 23641
            GOLD Stamp ID         :: Gi02105
            Isolation Site        :: Sulfide-rich natural spa
            Oxygen Requirement    :: Aerobe
            cell Shape            :: Rod-shaped
            Motility              :: Motile
            Temperature Range     :: Mesophile
            Temperature Optimum   :: 30 - 40C
            Gram Staining         :: gram-
            Biotic Relationship   :: Free living
            Diseases              :: None
            Phenotypes            :: carbon fixation, Sulfur oxidizer
            Energy Source         :: Chemolithoautotroph
            ##Metadata-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2582886
                     /organism="Halothiobacillus neapolitanus c2"
                     /mol_type="genomic DNA"
                     /strain="c2"
                     /db_xref="taxon:555778"
     gene            150..1559
                     /locus_tag="Hneap_0001"
                     /db_xref="GeneID:8535579"
     CDS             150..1559
                     /locus_tag="Hneap_0001"
                     /inference="protein motif:TFAM:TIGR00362"
                     /note="KEGG: tgr:Tgr7_0001 chromosomal replication
                     initiator protein DnaA;
                     TIGRFAM: chromosomal replication initiator protein DnaA;
                     PFAM: Chromosomal replication initiator DnaA; Chromosomal
                     replication initiator DnaA domain;
                     SMART: replication initiation factor DnaA; ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="YP_003261914.1"
                     /db_xref="GI:261854631"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="InterPro:IPR018312"
                     /db_xref="InterPro:IPR020591"
                     /db_xref="GeneID:8535579"
                     /translation="MSTITSELWQQCIDRLSEDLPVQQINMWIRPLQAELKAENHLIL
                     WAPNRFVMDMVAQQYKSKILEQAQILLERPDLQLGLQVGSVPSEQPVDMPAAATLSSK
                     SGAVSSGVAPRVEPMADLAEPDTGAKEFVSHINKKFNFDNFVEGKSNQLARAASQQVA
                     QNPGVGYNPLFIYGGVGLGKTHLMQAVGNAILERSPDAKVVYLHSERYVQQMVSSIKN
                     NTIEEFKDFYRSVNALLIDDIQFFAGKPRSQEEFFHTFNALIEQGQQIIMTCDRYPKE
                     IEGLEERLKSRFGWGLTVAVEPPDLETRVAILQSKAEQSQISLSTDVAFFIAKRVRAN
                     IRELEGALRRVIATAQFTGRPITVESTKEALKDQIAAQAKLITLENIQRTVAKFYNLK
                     LTDLTGARRNRSIARPRQVAMSLAKELTNHSLPEIGEAFGGRDHTTVIHACKKIEELR
                     EIESKLSDDYNLLRHTLNI"
     misc_feature    162..1556
                     /locus_tag="Hneap_0001"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    165..353
                     /locus_tag="Hneap_0001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    594..1025
                     /locus_tag="Hneap_0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    669..692
                     /locus_tag="Hneap_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(672..695,858..860,960..962)
                     /locus_tag="Hneap_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    846..863
                     /locus_tag="Hneap_0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    996..998
                     /locus_tag="Hneap_0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1281..1550
                     /locus_tag="Hneap_0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1350..1352,1374..1379,1398..1400,1416..1424,
                     1449..1463,1470..1472,1479..1484)
                     /locus_tag="Hneap_0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1623..2735
                     /locus_tag="Hneap_0002"
                     /db_xref="GeneID:8533115"
     CDS             1623..2735
                     /locus_tag="Hneap_0002"
                     /EC_number="2.7.7.7"
                     /inference="protein motif:TFAM:TIGR00663"
                     /note="KEGG: mmw:Mmwyl1_0002 DNA polymerase III subunit
                     beta;
                     TIGRFAM: DNA polymerase III subunit beta;
                     PFAM: DNA polymerase III beta chain;
                     SMART: DNA polymerase III beta chain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_003261915.1"
                     /db_xref="GI:261854632"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="GeneID:8533115"
                     /translation="MQFAVDRDRFSSAINQVIGGVEKRQTMQILSNLLLEVADGRLTL
                     VATDLEIQLRTSVDVQMQAPGATTVNARKLADIVKSASQDAKIALTQTDGWLEIDIGT
                     GVFRLASIEAGSFPQMTIDAATQSTVSITQKNLYALIDKTQFSMAQQDVRYFLNGLLL
                     EVKPGQMTAVATDGHRLAYAHLSDERLTENNRQVIVPRKMVSEMLKALDRDSDDEVSL
                     AFRDNQIELLIGENYLISKLIDGKYPDYSRVMPQSNSKILIVSKTELKQVLQRASILS
                     NERFSGAYFYLSPGRLMIESSNAEHESSKETMSVGYDASDLKISFNISYLLNILAVIE
                     SEEVCMELEAPESSVLIKPVMPGDIDSKYVLMPMKL"
     misc_feature    1623..2732
                     /locus_tag="Hneap_0002"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    1623..2729
                     /locus_tag="Hneap_0002"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1692..1694,1836..1838,1857..1859,2217..2219)
                     /locus_tag="Hneap_0002"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1839..1841,1848..1850,1926..1928,1932..1934,
                     2442..2444,2535..2540)
                     /locus_tag="Hneap_0002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2136..2138,2142..2153,2586..2588,2718..2729)
                     /locus_tag="Hneap_0002"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(2136..2138,2142..2147,2367..2369,2472..2474,
                     2511..2516,2595..2597,2718..2729)
                     /locus_tag="Hneap_0002"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2761..3840
                     /locus_tag="Hneap_0003"
                     /db_xref="GeneID:8533116"
     CDS             2761..3840
                     /locus_tag="Hneap_0003"
                     /inference="protein motif:TFAM:TIGR00611"
                     /note="TIGRFAM: DNA replication and repair protein RecF;
                     PFAM: SMC domain protein;
                     KEGG: apj:APJL_0003 recombination protein F"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="YP_003261916.1"
                     /db_xref="GI:261854633"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="GeneID:8533116"
                     /translation="MDLTHLTSLSITQFRNLTMTDCPLSAGFNLLVGDNGAGKTSVLE
                     AIYYLSTLKSFRTQTHNDLIARYPDRDRGCAVVRAGVHQDDHDFFMALERCKDQFRLR
                     LGREEVPRASLFVAHLPVLALHAQSDDLVLAGPEFRRKFIDRMAFYLFADFVPAYAQF
                     ARMLKQRNAALRTGQSTEIWDPLFIQYGERLNEQRVAALDLLKTVLPQVFEALAPQLS
                     VDMQFHPGHKSGLDLSEALARNRERDREMGQTLIGPQRADILFTLNDYAFKSFASRGQ
                     IKVFTAALTLATAHIWQAQRGKRAVLLFDDFMSEFDAHHSSALLHYLSNMGHQVFISA
                     VDRQQIDFPFDAVFRLDAGQISAVV"
     misc_feature    2773..3831
                     /locus_tag="Hneap_0003"
                     /note="recombination protein F; Reviewed; Region: recF;
                     PRK00064"
                     /db_xref="CDD:234608"
     misc_feature    2776..3828
                     /locus_tag="Hneap_0003"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    2857..2880
                     /locus_tag="Hneap_0003"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(2866..2871,2875..2883,3133..3135,3673..3678,
                     3766..3768)
                     /locus_tag="Hneap_0003"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    3124..3135
                     /locus_tag="Hneap_0003"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    3574..3603
                     /locus_tag="Hneap_0003"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    3661..3678
                     /locus_tag="Hneap_0003"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    3685..3696
                     /locus_tag="Hneap_0003"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    3754..3774
                     /locus_tag="Hneap_0003"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            4029..6482
                     /locus_tag="Hneap_0004"
                     /db_xref="GeneID:8533117"
     CDS             4029..6482
                     /locus_tag="Hneap_0004"
                     /EC_number="5.99.1.3"
                     /inference="protein motif:TFAM:TIGR01059"
                     /note="KEGG: tgr:Tgr7_0004 DNA gyrase subunit beta;
                     TIGRFAM: DNA gyrase subunit beta;
                     PFAM: DNA topoisomerase type IIsubunit alpha B region 2
                     domain protein; DNA gyrase subunit B domain protein;
                     TOPRIM domain protein; ATP-binding region ATPase domain
                     protein;
                     SMART: DNA topoisomerase II; ATP-binding region ATPase
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit beta"
                     /protein_id="YP_003261917.1"
                     /db_xref="GI:261854634"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="GeneID:8533117"
                     /translation="MSDNTPNDASQNAGQSSGYDSTSIKVLKGLDAVRKRPGMYIGDT
                     DDGSGLHHMVFEVVDNAVDEALAGHCDTVTVTMHADGSVSVSDNGRGIPVDIHAEEGV
                     SAAEVIMTVLHAGGKFDQNSYKVSGGLHGVGVSVVNALSDELELDIYRGGHAYHQSYR
                     LGVPQAPLAEVGATEKSGTSIRFLPSPTIFTDVVFHYDILAKRLRELSFLNSGIRVFL
                     NDEISGRADTFYYEGGIRAFVEHLNKGKTVIHKNVLSFSGQKDSVLVELALQWNDSYQ
                     ENLFCYTNNIPQRDGGTHLTGFRTALTRTLNDYMERAGILKKAKVSTSGEDWREGLVA
                     VISVKVPDPKFSSQTKEKLVSSEVKSAVESLTSERLAEFLEENPQEALLITNKIIEAA
                     RAREAARRAREMTRRKGALDIAGLPGKLADCQEKDPALSEIYLVEGDSAGGSAKQGRD
                     RRTQAILPLKGKILNVEKARFDKMLSSAEVGTLITALGCGIGREDFNPDKLRYHRIII
                     MTDADVDGSHIRTLLLTFFYRQMKELVERGHIYIAQPPLYKVKKGKQEQYLKDDLALN
                     QYLLQLAVDGAALQVNAEAPLISGPALESMAREYLVAQAVIDRLSHRYDPAALKAVLH
                     LPPMTAAEIVEDSALFEAWLNRFTESMNQFADAGVNYSSRFARTEEGLAGIQITRSQH
                     GVSHETFLPAGFFSTADYRVLGELAIQLDGLIGEDARVLRGEKSAPITHFEQAIDWLM
                     QEGRRGLGIQRYKGLGEMNPDQLWETTMNPETRRLLQVRIEDAIASDEIFTILMGDLV
                     EPRRDFIEKFALSAVNIDI"
     misc_feature    4071..6479
                     /locus_tag="Hneap_0004"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     misc_feature    4176..4472
                     /locus_tag="Hneap_0004"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(4194..4196,4206..4208,4215..4217,4281..4283,
                     4287..4289,4293..4295,4299..4304,4419..4430)
                     /locus_tag="Hneap_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    4206..4208
                     /locus_tag="Hneap_0004"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(4293..4295,4299..4301,4419..4421,4425..4427)
                     /locus_tag="Hneap_0004"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    4725..5195
                     /locus_tag="Hneap_0004"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    4878..4880
                     /locus_tag="Hneap_0004"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5052..5054,5061..5066,5070..5072)
                     /locus_tag="Hneap_0004"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(5070..5072,5076..5078)
                     /locus_tag="Hneap_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    5319..5663
                     /locus_tag="Hneap_0004"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(5337..5342,5349..5351,5559..5561,5565..5567,
                     5571..5573)
                     /locus_tag="Hneap_0004"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(5337..5339,5559..5561)
                     /locus_tag="Hneap_0004"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    6252..6446
                     /locus_tag="Hneap_0004"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            6658..7233
                     /locus_tag="Hneap_0005"
                     /db_xref="GeneID:8533118"
     CDS             6658..7233
                     /locus_tag="Hneap_0005"
                     /inference="protein motif:PFAM:PF04011"
                     /note="PFAM: LemA family protein;
                     KEGG: pmy:Pmen_3325 LemA family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LemA family protein"
                     /protein_id="YP_003261918.1"
                     /db_xref="GI:261854635"
                     /db_xref="InterPro:IPR007156"
                     /db_xref="GeneID:8533118"
                     /translation="MGVTLSVLLFLVAVIVIWAIIMYNGLVVLKHNVSQAWSNIDVLL
                     KQRHDELPKLVETAKQYMKYEQETLEKVMRARSAVRGAQDRGDIDALGMAEGQLRAGL
                     MDFYAVAEAYPDLKANTSFQHLQQRISGLENMIADRREFYNASVNINNVRIEQFPDVL
                     IAQLFRFRPFKLLTFREDELKDVDLKTLFNQ"
     misc_feature    6664..7224
                     /locus_tag="Hneap_0005"
                     /note="LemA family; Region: LemA; cl00742"
                     /db_xref="CDD:242062"
     gene            7248..8171
                     /locus_tag="Hneap_0006"
                     /db_xref="GeneID:8533119"
     CDS             7248..8171
                     /locus_tag="Hneap_0006"
                     /inference="similar to AA sequence:KEGG:NE0281"
                     /note="KEGG: neu:NE0281 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261919.1"
                     /db_xref="GI:261854636"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="GeneID:8533119"
                     /translation="MAWYAHWVGSLDDNGYHFLLVGLILLTLILLVAGIWFVRRTYWI
                     INTPTSNIVSAHQGYIEIEGITKNIDASPLVSPLTGTACVWYWVSVEHREQSFGESKR
                     SDWRRIYQHESDNLIAVEDATGECLVDPESASIRPNMRRQWYGATERPSGVTNSVGGH
                     FFGDYRYTEKLLLPHRNLYVLGWFKTIAHDPYVVENESVASLLRAWKHDPQMMKTFDL
                     DGNGSIDSKEWDQAREAGRQQIQAQQVKELERPQQTHLITANPQSRRPYIISADDQTV
                     LAKRFRRWGYLLWASSVLAFFFWVSAYYVRP"
     misc_feature    7509..7901
                     /locus_tag="Hneap_0006"
                     /note="E3 Ubiquitin ligase; Region: GIDE; pfam12483"
                     /db_xref="CDD:257080"
     gene            8681..9454
                     /locus_tag="Hneap_0007"
                     /db_xref="GeneID:8533120"
     CDS             8681..9454
                     /locus_tag="Hneap_0007"
                     /inference="protein motif:TFAM:TIGR00633"
                     /note="TIGRFAM: exodeoxyribonuclease III Xth;
                     exodeoxyribonuclease III;
                     PFAM: endonuclease/exonuclease/phosphatase;
                     KEGG: cvi:CV_0877 exodeoxyribonuclease III"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease III Xth"
                     /protein_id="YP_003261920.1"
                     /db_xref="GI:261854637"
                     /db_xref="InterPro:IPR000097"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="GeneID:8533120"
                     /translation="MKIATWNVNSLNVRKPQVLSWLAQQQPAILGLQELKQVNEAIDN
                     SDFAAMGYQTLLNGQKTYNGVALIYQEELGEPSDVVCDIPALDDPQRRVIAATFGELR
                     VINAYVVNGEAIDSEKYQYKLNWLEAFSNWLALEIAQHPNLVVMGDFNIAPSDADVFD
                     PERFKDAVLCSPPERDYFNRLLAMGFTDALNCFSNEENNFTWWDYRGGGYRRNHGLRI
                     DHILTSPAVQAKATACHVDKEPRGWERPSDHAPVVLTLA"
     misc_feature    8681..9448
                     /locus_tag="Hneap_0007"
                     /note="Escherichia coli exonuclease III (ExoIII) and
                     Neisseria meningitides NExo-like subfamily of the ExoIII
                     family purinic/apyrimidinic (AP) endonucleases; Region:
                     ExoIII-like_AP-endo; cd09086"
                     /db_xref="CDD:197320"
     misc_feature    order(8699..8701,8780..8782,8999..9001,9008..9010,
                     9122..9124,9128..9130,9425..9427)
                     /locus_tag="Hneap_0007"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197320"
     misc_feature    order(8699..8701,8780..8782,8999..9001,9122..9124,
                     9128..9130,9335..9337,9422..9427)
                     /locus_tag="Hneap_0007"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197320"
     misc_feature    order(8705..8710,8714..8722,8780..8782,8858..8863,
                     8999..9001,9008..9010,9014..9016,9032..9034,9122..9124,
                     9128..9130,9284..9286,9293..9298,9326..9328,9332..9337,
                     9413..9418,9425..9427)
                     /locus_tag="Hneap_0007"
                     /note="active site"
                     /db_xref="CDD:197320"
     misc_feature    order(8705..8707,8780..8782,9422..9427)
                     /locus_tag="Hneap_0007"
                     /note="metal binding site A [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:197320"
     misc_feature    order(8705..8710,8714..8722,8858..8863,8999..9001,
                     9008..9010,9014..9016,9032..9034,9293..9298,9413..9418)
                     /locus_tag="Hneap_0007"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:197320"
     misc_feature    order(8999..9001,9008..9010,9122..9124,9128..9130,
                     9284..9286,9326..9328,9332..9334,9425..9427)
                     /locus_tag="Hneap_0007"
                     /note="putative AP binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:197320"
     misc_feature    order(8999..9001,9122..9124,9128..9130,9425..9427)
                     /locus_tag="Hneap_0007"
                     /note="putative metal binding site B [ion binding]; other
                     site"
                     /db_xref="CDD:197320"
     gene            complement(9655..12165)
                     /locus_tag="Hneap_0008"
                     /db_xref="GeneID:8533121"
     CDS             complement(9655..12165)
                     /locus_tag="Hneap_0008"
                     /inference="protein motif:PFAM:PF02687"
                     /note="PFAM: protein of unknown function DUF214;
                     KEGG: tgr:Tgr7_2114 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261921.1"
                     /db_xref="GI:261854638"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="GeneID:8533121"
                     /translation="MAIVEPPKPATHLGLPRLILLAWRGLWRELRSGALVTMFLALVI
                     AVSAVTAVGFFTDRVDAGMRAQAAEFLAADGRVESPDSLLKWQQKASELGLTTTQTLE
                     FPTVILAGEHTLLVSLKAVGAGYPLRGALTISTGAQQQKIQQEPREGHAWLAPRALAL
                     LDLKVGDSFQIGQKKFTVSATLQREPDVGNFLAQAAPRAMINLADIPATGLVTPASRV
                     THYLLLAVPSGVSTNVLQAFGKSLPADLSLERPENSQPAFKTAFDRAARFLGLAAMVA
                     VLLAGAALMLAAQQYNRLQQDPAALMRAFGVQSRHILYLYTLRLVFLALLAAVPGIAL
                     GGLAQFGLSALLGSLLDFQLPPPSWLPVGFGVSIALVALLGFALPSLIRLQDTPPLRV
                     LNRQLAAPPTAAVLLFGAGLLAIGLLVWLQARDAWLTTYVTGGMVISFAAFIGIVWLL
                     LQALRRYPARGVARFGLARLARSPWSSAMQIAALTLGLTALLLLGVVRGDLVSTWQNQ
                     IPNDAPNFFAINIQPDQVPELTRFFQTNRIDDAGLVAMHRARWTSFNGKAVNADQLTG
                     QAKRLAEREFNLSVMPEHLAADNKIVAGSWQPDAQDAGWSVEQGIAKTLQWQLGDRLT
                     FVVNGAPVTAAITSIRTVDWNSMRPNFFVLGSAVLLPRQSAQFITSFFLPSPNVEQQK
                     ALLRAFPTLTLFDLNQILNEVRTLILRASQAVQYVFLFTLLAGLVVLLSAFAAGEAER
                     IRETAVLRVLGASHRQIMNSLWFEFILIGLLSGLLASIAAGGLGALLALKLFDLPWAL
                     DWRIPLYGLAAGVLLAALFVPYLGRRVLALPPARSLRG"
     misc_feature    complement(9658..12105)
                     /locus_tag="Hneap_0008"
                     /note="Predicted ABC-type transport system involved in
                     lysophospholipase L1 biosynthesis, permease component
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG3127"
                     /db_xref="CDD:225669"
     misc_feature    complement(11455..12102)
                     /locus_tag="Hneap_0008"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:257236"
     misc_feature    complement(11014..>11268)
                     /locus_tag="Hneap_0008"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            complement(12156..12857)
                     /locus_tag="Hneap_0009"
                     /db_xref="GeneID:8533122"
     CDS             complement(12156..12857)
                     /locus_tag="Hneap_0009"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter;
                     SMART: ATPase AAA;
                     KEGG: kko:Kkor_0791 ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_003261922.1"
                     /db_xref="GI:261854639"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8533122"
                     /translation="MPEDTALILRALRVSKTVTAPGNEPLTILRDASLTVAEGEAVAL
                     MGASGAGKSTLLALLAGLDTPTSGEVELAGFSLNNLNEDERAAVRAGRVGFVFQSFQL
                     IDGLTALENVALPLELQGTANSTAQAKAALDEVGLSHRLHHLPKVLSGGEQQRVALAR
                     AFAGTPAILFADEPTGSLDTATGERIIDLLFALRDQHQTALVLVTHDPALAARCNRGY
                     RLQGGLQGGELTPWQ"
     misc_feature    complement(12189..12857)
                     /locus_tag="Hneap_0009"
                     /note="Predicted ABC-type transport system involved in
                     lysophospholipase L1 biosynthesis, ATPase component
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG4181"
                     /db_xref="CDD:226647"
     misc_feature    complement(12189..12833)
                     /locus_tag="Hneap_0009"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    complement(12699..12722)
                     /locus_tag="Hneap_0009"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(order(12240..12242,12339..12344,12564..12566,
                     12696..12704,12708..12713))
                     /locus_tag="Hneap_0009"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(12564..12575)
                     /locus_tag="Hneap_0009"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(12387..12416)
                     /locus_tag="Hneap_0009"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(12339..12356)
                     /locus_tag="Hneap_0009"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(12321..12332)
                     /locus_tag="Hneap_0009"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(12234..12254)
                     /locus_tag="Hneap_0009"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            13056..13742
                     /locus_tag="Hneap_0010"
                     /db_xref="GeneID:8533123"
     CDS             13056..13742
                     /locus_tag="Hneap_0010"
                     /EC_number="3.1.1.2"
                     /inference="protein motif:PRIAM:3.1.1.2"
                     /note="PFAM: lipolytic protein G-D-S-L family;
                     KEGG: ttu:TERTU_1706 GDSL-like lipase/acylhydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="arylesterase"
                     /protein_id="YP_003261923.1"
                     /db_xref="GI:261854640"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="GeneID:8533123"
                     /translation="MRLVLSLLLPALIACSASAAFGQQAPHKTPQKVISSERSHTVLV
                     LGDSLSAAHNLAESQGWVALMQKRLAEKNAGATHKWQIVNASISGETTSGGLSRLPEL
                     LTVVQPGWVLLELGANDGLRGLPLALIRANLQKLIDQSKQSGARVVLLGIMLPPNYGP
                     AYAEPFAAMYQQLAEKNTLPLVPFLLKDVATNPKLMQQDGLHPTAEGEPIVLDNVWAV
                     VKPLWLPSSK"
     misc_feature    13176..13715
                     /locus_tag="Hneap_0010"
                     /note="Lysophospholipase L1-like subgroup of
                     SGNH-hydrolases. The best characterized member in this
                     family is TesA, an E. coli periplasmic protein with
                     thioesterase, esterase, arylesterase, protease and
                     lysophospholipase activity; Region:
                     Lysophospholipase_L1_like; cd01822"
                     /db_xref="CDD:238860"
     misc_feature    order(13197..13199,13320..13322,13407..13409,13650..13652,
                     13659..13661)
                     /locus_tag="Hneap_0010"
                     /note="active site"
                     /db_xref="CDD:238860"
     misc_feature    order(13197..13199,13650..13652,13659..13661)
                     /locus_tag="Hneap_0010"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238860"
     misc_feature    order(13197..13199,13320..13322,13407..13409)
                     /locus_tag="Hneap_0010"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238860"
     misc_feature    13413..13430
                     /locus_tag="Hneap_0010"
                     /note="switch loop; other site"
                     /db_xref="CDD:238860"
     gene            complement(14129..14500)
                     /locus_tag="Hneap_0011"
                     /db_xref="GeneID:8533124"
     CDS             complement(14129..14500)
                     /locus_tag="Hneap_0011"
                     /inference="protein motif:PFAM:PF04480"
                     /note="PFAM: protein of unknown function DUF559;
                     KEGG: msu:MS1954 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261924.1"
                     /db_xref="GI:261854641"
                     /db_xref="InterPro:IPR007569"
                     /db_xref="GeneID:8533124"
                     /translation="MQPYNPALRQTARHLRSNMTDAEQVLWRHLRRKQVCGVAFYRQK
                     PLLTYIVDFYCPRARLVVELDGGQHFTTAHQGKDQTRDAALSSLGMKVLRFNNLEVLR
                     QMESVLMLIHSEVAFRLAAET"
     misc_feature    complement(14168..14482)
                     /locus_tag="Hneap_0011"
                     /note="Domain of unknown function, appears to be related
                     to a diverse group of endonucleases; Region:
                     Endonuclease_DUF559; cd01038"
                     /db_xref="CDD:238509"
     misc_feature    complement(order(14267..14269,14294..14296,14345..14347,
                     14432..14434))
                     /locus_tag="Hneap_0011"
                     /note="putative active site [active]"
                     /db_xref="CDD:238509"
     gene            complement(14569..15519)
                     /locus_tag="Hneap_0012"
                     /db_xref="GeneID:8533125"
     CDS             complement(14569..15519)
                     /locus_tag="Hneap_0012"
                     /inference="protein motif:PFAM:PF02371"
                     /note="PFAM: transposase IS116/IS110/IS902 family protein;
                     transposase IS111A/IS1328/IS1533;
                     KEGG: gem:GM21_4047 transposase IS116/IS110/IS902 family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902"
                     /protein_id="YP_003261925.1"
                     /db_xref="GI:261854642"
                     /db_xref="InterPro:IPR002525"
                     /db_xref="InterPro:IPR003346"
                     /db_xref="GeneID:8533125"
                     /translation="MNDKLAEAFVGIDVSKDTLDVHIAPSGVSLHETYDEKGIEKIIE
                     ALKAASSTLIVLEATGGLEVRLACELSATGLTVAIINPRQARDFAKATGRLAKTDRVD
                     AAMLAAFAQAIRPAARPLKDADARALEDMLNRRRQLIAMRVQELLRLNTAESKALQKS
                     LKTHIAWLEKQITTVDNDLNTQLRASDVWRAKDDVLKGIPGIGAVTSLTMLSKCPELG
                     ALNRREIAALVEVAPLANGSGKHRGKRSIWGGRAEVRAVLYMAALSAMRFNPDIKAFA
                     ERLKNKGKATKVVIVACMRKLLTIMNAMLKNMQPWVAQIA"
     misc_feature    complement(15076..15495)
                     /locus_tag="Hneap_0012"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    complement(14620..15492)
                     /locus_tag="Hneap_0012"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    complement(14695..14940)
                     /locus_tag="Hneap_0012"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(16436..16546)
                     /locus_tag="Hneap_0013"
                     /db_xref="GeneID:8533126"
     CDS             complement(16436..16546)
                     /locus_tag="Hneap_0013"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261926.1"
                     /db_xref="GI:261854643"
                     /db_xref="GeneID:8533126"
                     /translation="MNSDDKYSLSEILFIIVIIEILMVVGLWIYKGLQTL"
     gene            complement(16642..17178)
                     /locus_tag="Hneap_0014"
                     /db_xref="GeneID:8533127"
     CDS             complement(16642..17178)
                     /locus_tag="Hneap_0014"
                     /inference="similar to AA sequence:KEGG:PA14_58730"
                     /note="KEGG: pau:PA14_58730 type IV pilin structural
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilin structural subunit"
                     /protein_id="YP_003261927.1"
                     /db_xref="GI:261854644"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="GeneID:8533127"
                     /translation="MLKQMNKSVNKGFTLIELMIVIAIIGILAAIAIPAYQDYTVRAK
                     VTELISVADAAKTGVAEAWTSDGLTGVTNFATSFNAEPATAHQSKYVSAIAIDPNTGA
                     ITVTSSTAAGSGLPTDAQGMTIVLQPNVQNAALVAGATGAIDWACASTSAATAGSNGL
                     AGITLGTMPAKYVPSQCK"
     misc_feature    complement(16780..17058)
                     /locus_tag="Hneap_0014"
                     /note="Pilin (bacterial filament); Region: Pilin;
                     pfam00114"
                     /db_xref="CDD:249599"
     gene            17753..18331
                     /locus_tag="Hneap_0015"
                     /db_xref="GeneID:8533128"
     CDS             17753..18331
                     /locus_tag="Hneap_0015"
                     /inference="protein motif:COG:COG4970"
                     /note="KEGG: xca:xccb100_1667  pilus assambly protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Tfp pilus assembly protein FimT-like protein"
                     /protein_id="YP_003261928.1"
                     /db_xref="GI:261854645"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="GeneID:8533128"
                     /translation="MRLNPHHASPASASTHPRGSQSRYRRMRGFTIIELMITLVVAAI
                     LLAIAIPSFTYLTVSNKLTTSANSLVSNLAIARMAAIKRNADVGVCGDNTCSVNFPAG
                     SATVIHVGISSIQPGVIDIKNVKALDYGAQGLAHTTTSTAPYNGLIADIYTGQISSNN
                     HRCVYLTSGSVVSTCTESNANCALGGPSGTCQ"
     misc_feature    17825..18181
                     /locus_tag="Hneap_0015"
                     /note="Tfp pilus assembly protein, major pilin PilA [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: PilA; COG4969"
                     /db_xref="CDD:227304"
     misc_feature    17834..17902
                     /locus_tag="Hneap_0015"
                     /note="prepilin-type N-terminal cleavage/methylation
                     domain; Region: IV_pilin_GFxxxE; TIGR02532"
                     /db_xref="CDD:213719"
     misc_feature    17948..>18073
                     /locus_tag="Hneap_0015"
                     /note="Type II transport protein GspH; Region: GspH;
                     pfam12019"
                     /db_xref="CDD:256804"
     gene            18315..18794
                     /locus_tag="Hneap_0016"
                     /db_xref="GeneID:8533129"
     CDS             18315..18794
                     /locus_tag="Hneap_0016"
                     /inference="protein motif:TFAM:TIGR02523"
                     /note="TIGRFAM: type IV pilus modification protein PilV;
                     KEGG: xac:XAC2668 pre-pilin leader sequence"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus modification protein PilV"
                     /protein_id="YP_003261929.1"
                     /db_xref="GI:261854646"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="InterPro:IPR013362"
                     /db_xref="GeneID:8533129"
                     /translation="MEPVNKPVYGPSQRGVGLIEVLIAVLVLSIGFLGIAALQAKSLS
                     TNNSAMARSMAVVASYSILDAMRADRTNALTGNYNQTVTANACTGNGSLAQTQLNTWC
                     NELAQNLGAQAATTGTVDCKNTGDCTVTVTFDESRVGTNTGGTSGTGVTTITTRAML"
     misc_feature    18351..18716
                     /locus_tag="Hneap_0016"
                     /note="Type IV pilin N-term methylation site GFxxxE;
                     Region: N_methyl_2; cl06830"
                     /db_xref="CDD:263062"
     gene            18791..19822
                     /locus_tag="Hneap_0017"
                     /db_xref="GeneID:8533130"
     CDS             18791..19822
                     /locus_tag="Hneap_0017"
                     /inference="similar to AA sequence:KEGG:XAC2667"
                     /note="KEGG: xac:XAC2667 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261930.1"
                     /db_xref="GI:261854647"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="GeneID:8533130"
                     /translation="MSRQTPAAALKQRGFTLIELMIALVLGLIVIGGVISVLLSNQQT
                     YRSNQALSQVQDGSRTAFEFLARDIRQAGLTGCGATAKIANVLNNKGTSWWDTWNNGL
                     QGYAANATAPIAVGTTANLRAANTDSITLMSAGDSGYSVNAPSSTSANFKLNEPNSDL
                     QTGDIIIVCDPNQATILQVSDYQSKSVTVVHNTGNKVSPGNCSDGLGFPTLCTTTGTK
                     YTYQNNAMLAKLNASYWYIGNNSLGTCSATTPQACSLFRSTISVSGGNAAAQAQEIVR
                     GVTNMQLAYLQGGTSFVAAGSVTDWSAVTAVRVTLTVAVPTNPNNINNPEIVQRVFTN
                     TIALRNRVG"
     misc_feature    18821..19225
                     /locus_tag="Hneap_0017"
                     /note="Tfp pilus assembly protein, major pilin PilA [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: PilA; COG4969"
                     /db_xref="CDD:227304"
     misc_feature    <18821..18880
                     /locus_tag="Hneap_0017"
                     /note="Type IV pilin N-term methylation site GFxxxE;
                     Region: N_methyl_2; pfam13544"
                     /db_xref="CDD:257863"
     gene            20011..20643
                     /locus_tag="Hneap_0018"
                     /db_xref="GeneID:8533131"
     CDS             20011..20643
                     /locus_tag="Hneap_0018"
                     /inference="similar to AA sequence:KEGG:azo2916"
                     /note="KEGG: azo:azo2916  Tfp pilus assembly protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Tfp pilus assembly protein"
                     /protein_id="YP_003261931.1"
                     /db_xref="GI:261854648"
                     /db_xref="GeneID:8533131"
                     /translation="MSAVALRKGEASTVALRKGRGERGGFMKTGLDRQRGVALVVALV
                     LLVVVTLVGLAAIRGTTMQQQMTSNFYDREIGFQAAEAGLRTGESWLIANPNNTTLIR
                     DCSDPNNQCFANPFETGAATAGIIQAVPTATFDAGALGAGQPQYVVEKMGICNSGGGG
                     NFAFTNDQNNQGGGNSLVSSGMCYRVTAESNANAAANDRSNVILQSILRL"
     misc_feature    20176..20487
                     /locus_tag="Hneap_0018"
                     /note="Tfp pilus assembly protein PilX [Cell motility and
                     secretion / Intracellular trafficking and secretion];
                     Region: PilX; COG4726"
                     /db_xref="CDD:227070"
     gene            20656..24519
                     /locus_tag="Hneap_0019"
                     /db_xref="GeneID:8533132"
     CDS             20656..24519
                     /locus_tag="Hneap_0019"
                     /inference="similar to AA sequence:KEGG:Neut_1833"
                     /note="KEGG: net:Neut_1833  type 4 fimbrial biogenesis
                     protein PilY1"
                     /codon_start=1
                     /transl_table=11
                     /product="type 4 fimbrial biogenesis protein PilY1"
                     /protein_id="YP_003261932.1"
                     /db_xref="GI:261854649"
                     /db_xref="GeneID:8533132"
                     /translation="MNQSNKNTQIKRSKRHMRYARGNTMNFLHTTMQQVGRVAVRFFA
                     FALLTAMPMITAQAAVDIDQSPLILQKPLPPNIVLMLDDSGSMTWDYMPDFGYLKNNS
                     NNDALINSANNSVYYDPTITYLPPLKADNTSYTNQTDFTNTPVDGFGTTSNDMIDLTN
                     YNGYDDTGNINYSKSVLTNSSYTKTGISRIDCYILYYNDQTAYDYSYSRARKSRPSSC
                     TIYTQVSSGYFQYSTGPAAGPYTVHYVANTSCGTQSNCVVASDKSGVSAPIGVAAGNN
                     IANWFAYYHTRILTTKTGLTLAFSGLDKTYRFGFASINGRNTADIPSPQYSFSTSNNS
                     DNKLAEVQPFGDGSSGTQKAKFWTWITNISPNDGTPLRGALQAVGEYYKTQQPWETSS
                     SDTSEYACRPSYTILTTDGFWNGDTPSGIGNADGQNGPKITTPSTYQYLKTAPYQDGY
                     SDTLADVAMKYWETDLRTSVANEVPTTPSDPAFWQHMTTFTIGLGWDPTNLIRSTSGD
                     ANLTVPQILAWARSGNPPAGSSLTNSSNIWPKPTSNSINNIADLAHAAVNGHGEFYSV
                     KSPDDLVNGLQSALKKIGESPGAGNAVTLSDTALPTDSTAADALYRFRGTFYTGQWSG
                     TLTAENYTTTTTPPSYESFWSTKDLTPSFSTVGTGSSAERLSNRNVWTSTLGNGNKTS
                     SVAFRVATDLSATQQTDLAATIGNSSVTAQTMVNYLLGDSTYAQGNPGGTLRNRDSFL
                     GDIVSSTPVLIAAPQADLYAGTTFTGADTYSTFVNKEATRAPIVYVAANDGMLHAFRV
                     TAGAGYERDGSTVSPVADQAKGTEVYAYMPSAVLTQTGDASITNLANPKYGDVDPVNG
                     TQAVPHQYYNDGRITTQNVYFDKAWHTVLVGTTGRGPAKAIYALDITDPSVLMNPATA
                     DQALLWERSAGDGKTGSSYIGEMVGTPVIAQVDQGGQPSWAVFVGNGYNSAEGKPALL
                     QFDLQTGDLSVHTTTGSVAADGGLAEPGLMQGDKTTGISTYAFAGDLQGHLWKFNLDS
                     ASSTGSVAFNAVDDKGNAQPITSLVTLAYDGVTNSTFALFGTGKYLASADTKDDQVQT
                     WYGVRVGMGADLAGVASATTPVADSSTARSDLTERFAFDFASGDRATSAQTSDTDMNN
                     KAGWFMDLPQTGERIVNRIQLISGKAVATTLIPKVNDPCNTVPAGAVMGVDPFTGANQ
                     LVSTGNGYNLGTKIITVDGKPQQVAINGKVFDAGPAAGVTAVRNADGTISITFNTLGG
                     GLQSLGPLNLGGNQASRLSWRELTN"
     misc_feature    21388..24510
                     /locus_tag="Hneap_0019"
                     /note="Tfp pilus assembly protein, tip-associated adhesin
                     PilY1 [Cell motility and secretion / Intracellular
                     trafficking and secretion]; Region: PilY1; COG3419"
                     /db_xref="CDD:225953"
     misc_feature    22996..23931
                     /locus_tag="Hneap_0019"
                     /note="Neisseria PilC beta-propeller domain; Region:
                     Neisseria_PilC; pfam05567"
                     /db_xref="CDD:253258"
     gene            24658..25152
                     /locus_tag="Hneap_0020"
                     /db_xref="GeneID:8533133"
     CDS             24658..25152
                     /locus_tag="Hneap_0020"
                     /inference="similar to AA sequence:KEGG:XAC2664"
                     /note="KEGG: xac:XAC2664 PilE protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PilE protein"
                     /protein_id="YP_003261933.1"
                     /db_xref="GI:261854650"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="GeneID:8533133"
                     /translation="MKQIAHKAAARQQLGFTLIELMIVIAIIAIIAAIAYPSYIKSVV
                     KTKRAAAEGCLSEYANYMERFYTTNLRYDKDSAGTANPVVGSPVPAANQLDCSTAQNS
                     GADYAFTVVATAPNAAANPNTYTVTATPTGAQLSRDTQCGTLSINQVGTRTESGSGTV
                     ADCW"
     misc_feature    24658..>24729
                     /locus_tag="Hneap_0020"
                     /note="Type IV pilin N-term methylation site GFxxxE;
                     Region: N_methyl_2; pfam13544"
                     /db_xref="CDD:257863"
     misc_feature    24682..25149
                     /locus_tag="Hneap_0020"
                     /note="Tfp pilus assembly protein PilE [Cell motility and
                     secretion / Intracellular trafficking and secretion];
                     Region: PilE; COG4968"
                     /db_xref="CDD:227303"
     gene            25490..26074
                     /locus_tag="Hneap_0021"
                     /db_xref="GeneID:8533134"
     CDS             25490..26074
                     /locus_tag="Hneap_0021"
                     /inference="similar to AA sequence:KEGG:Noc_2270"
                     /note="KEGG: noc:Noc_2270  type-4 fimbrial pilin related
                     signal peptide protein"
                     /codon_start=1
                     /transl_table=11
                     /product="type-4 fimbrial pilin related signal peptide
                     protein"
                     /protein_id="YP_003261934.1"
                     /db_xref="GI:261854651"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="GeneID:8533134"
                     /translation="MPNHFTEPGFTPPDSALGFTAIELMMTLIIAMILLAIAIPSFSR
                     MKAQNHLATTANDFVSAFGAARQTAIVKGRPVTLCAGDQSGCFDTVDWSNGWLAFVDA
                     DKSGTLNAGEPVVFTGVARRGDVVVQGNTPVEKPIIFSPLGFASQPGGAFTAGTLRVC
                     VPADIANNARDLVLAKSGRLRVEAKDLSGACPAP"
     misc_feature    25649..26023
                     /locus_tag="Hneap_0021"
                     /note="Type II transport protein GspH; Region: GspH;
                     pfam12019"
                     /db_xref="CDD:256804"
     gene            26258..26629
                     /locus_tag="Hneap_0022"
                     /db_xref="GeneID:8533135"
     CDS             26258..26629
                     /locus_tag="Hneap_0022"
                     /inference="protein motif:PFAM:PF04480"
                     /note="PFAM: protein of unknown function DUF559;
                     KEGG: msu:MS1954 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261935.1"
                     /db_xref="GI:261854652"
                     /db_xref="InterPro:IPR007569"
                     /db_xref="GeneID:8533135"
                     /translation="MQPYNPALRQTARYLRSNMTDAEQILWRHLRRKQVCGVTFYRQK
                     PLLTFILDFYCPRARLVVELDGGQHFTTAHQGKDQARDAALSSLGMKVLRFNNLDVLQ
                     QMESVLMLIYSEVTFRLSAET"
     misc_feature    26276..26593
                     /locus_tag="Hneap_0022"
                     /note="Domain of unknown function, appears to be related
                     to a diverse group of endonucleases; Region:
                     Endonuclease_DUF559; cd01038"
                     /db_xref="CDD:238509"
     misc_feature    order(26324..26326,26411..26413,26462..26464,26489..26491)
                     /locus_tag="Hneap_0022"
                     /note="putative active site [active]"
                     /db_xref="CDD:238509"
     gene            26749..26856
                     /locus_tag="Hneap_0023"
                     /db_xref="GeneID:8533136"
     CDS             26749..26856
                     /locus_tag="Hneap_0023"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261936.1"
                     /db_xref="GI:261854653"
                     /db_xref="GeneID:8533136"
                     /translation="MQKGGAAFPKKRGGVLGVVPLLEGRAGFLALRLPL"
     gene            complement(26886..29708)
                     /locus_tag="Hneap_0024"
                     /db_xref="GeneID:8533137"
     CDS             complement(26886..29708)
                     /locus_tag="Hneap_0024"
                     /inference="protein motif:TFAM:TIGR00630"
                     /note="TIGRFAM: excinuclease ABC subunit A;
                     PFAM: ABC transporter related;
                     KEGG: tgr:Tgr7_2295 excinuclease ABC subunit A"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="YP_003261937.1"
                     /db_xref="GI:261854654"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR004602"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8533137"
                     /translation="MADPFIRIRGARTHNLKNIDVDLPRDALIVITGLSGSGKSSLAF
                     DTLFAEGQRRYVESLSAYARQFLSMMDKPDVDHIEGLSPAISIEQKTTSHNPRSTVGT
                     VTEIYDYLRLLYARAGIPRCPEHGVDLTAQTVSQMVDQVLALPEDSRWLLLAPVIENR
                     KGEHHKLFDEWRSQGFLRVRINGTVYEIDEIPALDPKGKNTIEVVVDRIKIRPDIGLR
                     LAESFETALRMADGRTFVVNMDDDSAHTFSAKHACPICGYALAELEPRLFSFNNPVGA
                     CPSCDGLGVKQFFDPQKVIVNAELSLAAGAIRGWDRRNVYYYQLLLGLSKHYGFDLDT
                     AWQDLPESIQNAILQGSGREKITFTYLSPKGKASTKDHPWEGVLPNMDRRYRETDSQA
                     VREELAKYISESACPSCGGTRLNLAARNVFIENENLPAITHRSISEALAFFQTLDLPG
                     ARGEIAGRIVREISARLGFLNDVGLTYLSLDRSAETLSGGEAQRIRLASQIGSGLVGV
                     TYILDEPSIGLHQRDNDRLLGTLNHLRELGNTVIVVEHDEDAIRAADFVLDIGPGAGV
                     HGGHIVAQGTPEQIAANADSLTGAYLSGKKKITVPKRVTPDAERWLKLYGARGNNLVG
                     DTLEIPMGLLTCITGVSGSGKSTLINDTLYLIAARDLNGASTRPSAYERIEHLNQLDK
                     VIDINQSPIGRTPRSNPATYTGLFTPIRELFAGTQEARSRGYTPGRFSFNVKGGRCEA
                     CQGDGVIKVEMHFLPDVYVACDVCHGKRYNRETLDIRYKGKTISDVLAMTVEDAAPFF
                     DAVPALHRKLNTLLDVGLGYLTLGQNATTLSGGEAQRVKLAKELSKRDTGNTLYILDE
                     PTTGLHFADVEQLLAVLYRLRDQGNTVVVIEHNLDVIKTADWIADLGPEGGSGGGQII
                     ASGTPETVAKIAGSHTGRYLARLLDH"
     misc_feature    complement(26892..29708)
                     /locus_tag="Hneap_0024"
                     /note="excinuclease ABC subunit A; Reviewed; Region: uvrA;
                     PRK00349"
                     /db_xref="CDD:234734"
     misc_feature    complement(<29352..29693)
                     /locus_tag="Hneap_0024"
                     /note="ATP-binding cassette domain I of the excision
                     repair protein UvrA; Region: ABC_UvrA_I; cd03270"
                     /db_xref="CDD:213237"
     misc_feature    complement(27984..>28322)
                     /locus_tag="Hneap_0024"
                     /note="ATP-binding cassette domain I of the excision
                     repair protein UvrA; Region: ABC_UvrA_I; cd03270"
                     /db_xref="CDD:213237"
     misc_feature    complement(26952..27875)
                     /locus_tag="Hneap_0024"
                     /note="ATP-binding cassette domain II of the excision
                     repair protein UvrA; Region: ABC_UvrA_II; cd03271"
                     /db_xref="CDD:213238"
     gene            29824..30381
                     /locus_tag="Hneap_0025"
                     /db_xref="GeneID:8533138"
     CDS             29824..30381
                     /locus_tag="Hneap_0025"
                     /inference="protein motif:TFAM:TIGR00621"
                     /note="TIGRFAM: single-strand binding protein;
                     PFAM: single-strand binding protein/Primosomal replication
                     protein n;
                     KEGG: asa:ASA_3997 single-strand binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand binding protein"
                     /protein_id="YP_003261938.1"
                     /db_xref="GI:261854655"
                     /db_xref="InterPro:IPR000424"
                     /db_xref="InterPro:IPR011344"
                     /db_xref="GeneID:8533138"
                     /translation="MATRGINKVIVLGNLGKDPEVRYMPSGGQVTNITVATSETWKDK
                     DSGEQKENTEWHRIVFFGKLAEIAGQYLKKGGQVYVEGRLQTRKWQGQDGQDRYTTEI
                     VANEMQMLGGRGGSGGSGGGQQESGDYEDDGYSNTPPARGAGRAAAAPARPSSGNRDS
                     YGAPPPPPRSPAKSEPNFVDDDIPF"
     misc_feature    29836..30378
                     /locus_tag="Hneap_0025"
                     /note="Single-stranded DNA-binding protein [DNA
                     replication, recombination, and repair]; Region: Ssb;
                     COG0629"
                     /db_xref="CDD:223702"
     misc_feature    29848..30153
                     /locus_tag="Hneap_0025"
                     /note="SSB_OBF: A subfamily of OB folds similar to the OB
                     fold of ssDNA-binding protein (SSB). SSBs bind with high
                     affinity to ssDNA. They bind to and protect ssDNA
                     intermediates during DNA metabolic pathways. All bacterial
                     and eukaryotic SSBs studied to date...; Region: SSB_OBF;
                     cd04496"
                     /db_xref="CDD:239942"
     misc_feature    order(29848..29859,29932..29940,29983..29985,29989..29991,
                     30052..30054,30079..30081,30112..30114,30121..30123)
                     /locus_tag="Hneap_0025"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(29863..29871,29887..29889,29917..29919,29938..29943,
                     29977..29982,29986..29988,29992..29994,29998..30000,
                     30004..30006,30043..30048,30070..30072,30076..30078,
                     30082..30087,30124..30126,30130..30132)
                     /locus_tag="Hneap_0025"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    order(30052..30054,30058..30060,30064..30066,30145..30147)
                     /locus_tag="Hneap_0025"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            complement(30592..32391)
                     /locus_tag="Hneap_0026"
                     /db_xref="GeneID:8533139"
     CDS             complement(30592..32391)
                     /locus_tag="Hneap_0026"
                     /EC_number="2.3.2.2"
                     /inference="protein motif:TFAM:TIGR00066"
                     /note="KEGG: mrd:Mrad2831_1522 gamma-glutamyltransferase;
                     TIGRFAM: gamma-glutamyltransferase;
                     PFAM: gamma-glutamyltranspeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase"
                     /protein_id="YP_003261939.1"
                     /db_xref="GI:261854656"
                     /db_xref="InterPro:IPR000101"
                     /db_xref="GeneID:8533139"
                     /translation="MPSKNTHKIISSFMALALLMSTAMAQGATPQTTTADAATITQQA
                     LDATAPATTRAELAAAKPVLAKQAMVVTAQHLATQVGVDILKQGGNAVDAAVAVGYAL
                     AVVHPCCGNIGGGGFMVLHLAEGKTLFLDFREKAPLKATPTLFQDAEGNVVKGRSTHS
                     YLGVGVPGTVMGLNTALATYGSMSRKQVMAPAIKLARDGFVLTAGDVNILHTRREDFA
                     KYPNVSNTFLNHGKPYEVGDRLVQPQLAHTLALISKEGSHAFYRGHIAQAVVKASKEN
                     GGLLSLQDFADYTVNWAQPIACGYHGYTIMSAPPPSSGGTTICQILQLIQPYPIKKWG
                     YGSVKAIHYLVEAERRAFADRNTYLGDPAFVKNPITDLLSPKHIAQMRASIEPDKATP
                     SSEIKGSLGADEGQQTTHYSIVDAKGNAVSITYTINYLFGLGQIAGDTGFFLNNEMDD
                     FTAKPGVPNSFGLVQGRVNQIEPGKRPLSSMSPTIVLKDGKLFMVTGSPGGSTIISTT
                     LESILNVVDFGMNMQQAVDAPRVHHQWYPDLVFIEPGLLTPKTQTTLKDMGYRFKEVT
                     SWGADEAILLNPKTGLLEGANDRRRPAGLAAGY"
     misc_feature    complement(30595..32208)
                     /locus_tag="Hneap_0026"
                     /note="Gamma-glutamyltransferase [Amino acid transport and
                     metabolism]; Region: Ggt; COG0405"
                     /db_xref="CDD:223482"
     gene            complement(32408..33346)
                     /locus_tag="Hneap_0027"
                     /db_xref="GeneID:8533140"
     CDS             complement(32408..33346)
                     /locus_tag="Hneap_0027"
                     /inference="protein motif:PFAM:PF04378"
                     /note="PFAM: protein of unknown function DUF519;
                     KEGG: hdu:HD1760 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261940.1"
                     /db_xref="GI:261854657"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR007473"
                     /db_xref="GeneID:8533140"
                     /translation="MMNIIVNRYACLNLCLVETMNYQHHFHAGNHADVLKHLVLLQLI
                     ELMQQKPTGFLLLETHAGAGLYDLQATEARRSDEASGGIARLLQATQAADTVPVLIQT
                     YLKQIEQFGSVPNLGYYPGSPLLAVCALRPQDRYIGVELVPKVARELSRNLAQRPMLE
                     PCIPDRRVIARDGEGLAALKADLPPLERRGLFLIDPPYEQPQERDDIAAALQAGLQRF
                     ETGVYALWYPIKQRPYLDRWLNRIAKSTPRPVLTIENSIFPDESGNRLTGSGLLIINP
                     PWQFDTLMQPVLDFVNDALKQDTAAPRAIRWLNPAQ"
     misc_feature    complement(32417..33289)
                     /locus_tag="Hneap_0027"
                     /note="Protein involved in catabolism of external DNA
                     [General function prediction only]; Region: ComJ; COG2961"
                     /db_xref="CDD:225509"
     gene            33737..34285
                     /locus_tag="Hneap_0028"
                     /db_xref="GeneID:8533141"
     CDS             33737..34285
                     /locus_tag="Hneap_0028"
                     /inference="protein motif:TFAM:TIGR00040"
                     /note="TIGRFAM: phosphodiesterase, MJ0936 family;
                     PFAM: metallophosphoesterase;
                     KEGG: hha:Hhal_1389 phosphodiesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphodiesterase"
                     /protein_id="YP_003261941.1"
                     /db_xref="GI:261854658"
                     /db_xref="InterPro:IPR000979"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="GeneID:8533141"
                     /translation="MDLESHASVCVGIISDTHGAIENSILELMQQCDVIVHAGDILNP
                     DILRRVTPKTGHVIAVRGNNDTVEQWPAGTADLLESLPEVATLRLPGGVLAVEHGHRV
                     NPAHQRHEKLRARHPEARAVVYGHTHHRTIDTSAPIWVLNPGAAGKVRAYGGSGCLLL
                     HASAERWWIEEKTLPNLRAGSA"
     misc_feature    33767..34216
                     /locus_tag="Hneap_0028"
                     /note="Escherichia coli YfcE and related proteins,
                     metallophosphatase domain; Region: MPP_YfcE; cd00841"
                     /db_xref="CDD:163617"
     misc_feature    order(33782..33784,33788..33790,33854..33856,33923..33928,
                     34028..34030,34112..34114,34118..34120)
                     /locus_tag="Hneap_0028"
                     /note="active site"
                     /db_xref="CDD:163617"
     misc_feature    order(33782..33784,33788..33790,33854..33856,33923..33925,
                     34028..34030,34112..34114,34118..34120)
                     /locus_tag="Hneap_0028"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163617"
     misc_feature    order(33833..33838,33908..33910,33917..33931,33980..34015,
                     34034..34036)
                     /locus_tag="Hneap_0028"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163617"
     gene            34356..35618
                     /locus_tag="Hneap_0029"
                     /db_xref="GeneID:8533142"
     CDS             34356..35618
                     /locus_tag="Hneap_0029"
                     /EC_number="2.7.1.3"
                     /inference="protein motif:PRIAM:2.7.1.3"
                     /note="PFAM: PfkB domain protein; Rieske [2Fe-2S]
                     iron-sulphur domain;
                     KEGG: tcx:Tcr_1488 PfkB"
                     /codon_start=1
                     /transl_table=11
                     /product="Ketohexokinase"
                     /protein_id="YP_003261942.1"
                     /db_xref="GI:261854659"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="GeneID:8533142"
                     /translation="MAKILGIGIATLDIINEVEGYPVEDSEQRALAQRQRTGGNVTNT
                     LTVLRQFDHDCALAALLTPDADGRQIQEKLAQRGIDLSSAQILGFGHAPTSYITLNRQ
                     NGSRTIVHYRDLPEFDLNAFLKIDLAPFDWLHFEGRHCMDTAAMLAMARRAAGTKLLS
                     LEVEKERPYLDQLFSFPDVVFFSRAFAEQRGFNDPEAFLNAAHQWAPQAVLVLGWGAT
                     GAYLKESLNDSVQLVPAQPIRGVVDSIGAGDTLIAGVIHARANQANADWRAAVTFGVR
                     LAERKIQQFGFDGLAVDPNANNQPLCHLDDLGPEDAMGVQPVDGIPSVIVVRDHRAIR
                     AYRNVCPHNGSALSKGVRGYLADKSTGPSDGMSLRCRLHNAYFEPLTGACTGGPCPGT
                     HLTPVAIRQVGEMIYLDDLDENSRPTGK"
     misc_feature    34362..35219
                     /locus_tag="Hneap_0029"
                     /note="ribokinase/pfkB superfamily: Kinases that accept a
                     wide variety of substrates, including carbohydrates and
                     aromatic small molecules, all are phosphorylated at a
                     hydroxyl group. The superfamily includes ribokinase,
                     fructokinase, ketohexokinase; Region:
                     ribokinase_pfkB_like; cl00192"
                     /db_xref="CDD:260247"
     misc_feature    order(34482..34484,35091..35093,35100..35102)
                     /locus_tag="Hneap_0029"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238177"
     misc_feature    order(34902..34904,34995..34997,35085..35087,35094..35099,
                     35106..35108)
                     /locus_tag="Hneap_0029"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238177"
     misc_feature    35250..35576
                     /locus_tag="Hneap_0029"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cd03467"
                     /db_xref="CDD:239550"
     misc_feature    order(35373..35375,35379..35384,35463..35465,35469..35474,
                     35478..35480,35484..35486)
                     /locus_tag="Hneap_0029"
                     /note="iron-sulfur cluster [ion binding]; other site"
                     /db_xref="CDD:239550"
     misc_feature    order(35373..35375,35379..35384,35463..35465,35472..35474,
                     35478..35480)
                     /locus_tag="Hneap_0029"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     gene            35755..38121
                     /locus_tag="Hneap_0030"
                     /db_xref="GeneID:8533143"
     CDS             35755..38121
                     /locus_tag="Hneap_0030"
                     /inference="protein motif:TFAM:TIGR00254"
                     /note="KEGG: glo:Glov_3328 diguanylate
                     cyclase/phosphodiesterase with PAS/PAC sensor(s);
                     TIGRFAM: diguanylate cyclase; PAS sensor protein;
                     PFAM: EAL domain protein; GGDEF domain containing protein;
                     PAS fold domain protein; hypothetical protein;
                     SMART: EAL domain protein; GGDEF domain containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor-containing diguanylate
                     cyclase/phosphodiesterase"
                     /protein_id="YP_003261943.1"
                     /db_xref="GI:261854660"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:8533143"
                     /translation="MNEDRVGLTSLPQRPCDYAEAWLWVDVNGQGALTATQAITSLDA
                     IAPIDQILETLPQSDAWHQHMGQIGPMENIRDWIWQARWLSADRLDGSHSPLDDANLT
                     NIGGRRLLHVSLYPRLPDDAIGWLDSLPDCVIGRDANQAVVYRNRAAQTFNNPSLLDQ
                     LSRGVPAQCAEGVIEDQVSVDDHGRLRHFQRLLIAAPSPASSVKDFLELYELTTPKSL
                     GKAEGDYGQLIELLVEATHDLIVIKDPEGRWLFANLSIVHSLGLAHVVWLGKTDRELV
                     DLASPTVRGALQFCHETDKAAWNQGQQIRHLETIPCEDGHSLIVDVIKQPVFDDKGKP
                     RAIIVVGRDVTELHTTQEQFQILASQDELTGLLNRRFFQVEAQRWIDMLSDDGSKHLA
                     LLVFDLDYFRSINDSYGHERGDQLLQEMARRLQNECVASPLLIARMGGDEFAILVETD
                     NKPESLSALGEQVKSLTARPFQIEHLTLFTSASTGIVIWPEHGRSIGELLHQADSAMY
                     AAKEQGRNGHAVFSPEIMEHQNRQSALLTALRQSQGDERFFLVYQVQQNASSLAITGV
                     EALLRWQAPSPELAAGPDQFIPLLEKSGLIIDVGGWVLDEACQQIARWREYIGERITV
                     AVNVSSIQLHSPCFIGRVQAALKKSGINPSLLELELTETALVNDPAKAASTLIELKKL
                     GVQLALDDFGTGYSSLSYLTQFEFNRLKIDQSFVRDILVDPKDLVIVKAIVAMGHALG
                     LEVVAEGVETVAERDLLDSLGCDSFQGYLVGRPGKPEEISPMLGVGLL"
     misc_feature    36451..36798
                     /locus_tag="Hneap_0030"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    36460..36786
                     /locus_tag="Hneap_0030"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(36508..36510,36520..36522,36538..36540,36586..36597,
                     36682..36684,36697..36699)
                     /locus_tag="Hneap_0030"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(36577..36579,36589..36591,36613..36615,36622..36627,
                     36718..36720,36724..36726)
                     /locus_tag="Hneap_0030"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    36835..37302
                     /locus_tag="Hneap_0030"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(36943..36945,37075..37077)
                     /locus_tag="Hneap_0030"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(36958..36960,36967..36972,36982..36984,36994..36996,
                     37063..37065,37069..37080)
                     /locus_tag="Hneap_0030"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(37051..37053,37138..37140)
                     /locus_tag="Hneap_0030"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    37363..38088
                     /locus_tag="Hneap_0030"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            38154..38462
                     /locus_tag="Hneap_0031"
                     /db_xref="GeneID:8533144"
     CDS             38154..38462
                     /locus_tag="Hneap_0031"
                     /inference="protein motif:PFAM:PF01722"
                     /note="PFAM: BolA family protein;
                     KEGG: tau:Tola_0801 BolA family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="BolA family protein"
                     /protein_id="YP_003261944.1"
                     /db_xref="GI:261854661"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="GeneID:8533144"
                     /translation="MSRSERIKKLIEDQMAPVYLEIDNESHLHAGNREETHFRLVIVS
                     ALFEGEALLARHRRVQTLLQAEREGGMHALSLHTFTPAEWQAKGASAAPSPACAGQNH
                     "
     misc_feature    38178..38405
                     /locus_tag="Hneap_0031"
                     /note="BolA-like protein; Region: BolA; pfam01722"
                     /db_xref="CDD:250816"
     gene            38491..39528
                     /locus_tag="Hneap_0032"
                     /db_xref="GeneID:8533145"
     CDS             38491..39528
                     /locus_tag="Hneap_0032"
                     /inference="protein motif:PFAM:PF08668"
                     /note="PFAM: metal-dependent hydrolase HDOD;
                     KEGG: tgr:Tgr7_2585  signal transduction protein"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction protein"
                     /protein_id="YP_003261945.1"
                     /db_xref="GI:261854662"
                     /db_xref="InterPro:IPR013976"
                     /db_xref="GeneID:8533145"
                     /translation="MWQWIRQLWATKPTAPPAHLPRLRENGLAAGKPEPISDIIIPDA
                     EQASLVFFQKLLNAPEHPRGYTDALRPDETAWLSARIEDLKRTPTQLTHLVPRLPSVL
                     PKLMTALNNPDTPIRTLTGLIESDPVISSMVLRLINSPAMRVRRENIESLEQAVMLLG
                     FSGMREVVSAAMFSPIGQLGRIEGANPLLVHDVWPISLRAANALRLGLKTRSDHQRPL
                     LSSDEAFDLYLSVLIEHTGLIALLRQKPLTGANTSAAYVARFRALIPAYSARIAEAWA
                     LSENTIRLIRSAPAELEHLRSQARYFSVACALNRRGTLDQAQFLHLCRQLPDYARGWY
                     DLCVTANVSAD"
     misc_feature    38776..39348
                     /locus_tag="Hneap_0032"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cl17215"
                     /db_xref="CDD:266561"
     gene            complement(39572..41770)
                     /locus_tag="Hneap_0033"
                     /db_xref="GeneID:8533146"
     CDS             complement(39572..41770)
                     /locus_tag="Hneap_0033"
                     /EC_number="2.7.6.5"
                     /inference="protein motif:TFAM:TIGR00691"
                     /note="KEGG: tgr:Tgr7_3185 GTP diphosphokinase;
                     TIGRFAM: RelA/SpoT family protein;
                     PFAM: RelA/SpoT domain protein; TGS domain protein; amino
                     acid-binding ACT domain protein; metal-dependent
                     phosphohydrolase HD sub domain;
                     SMART: metal-dependent phosphohydrolase HD region"
                     /codon_start=1
                     /transl_table=11
                     /product="(p)ppGpp synthetase I SpoT/RelA"
                     /protein_id="YP_003261946.1"
                     /db_xref="GI:261854663"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004811"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="InterPro:IPR007685"
                     /db_xref="GeneID:8533146"
                     /translation="MPEASVPQPQPEKLVLVAEAAEAEIYFAPLAMTLATYIDPEGIA
                     HVRDAFIFGANSHVGQARQSGEPYISHPVAVAEILAGLHMDEATLTAAILHDVIEDTA
                     VAREEIVARFGEEVARLVDGVSKLTQIRFKSKAEAQAANFRKMMMAMVEDVRVILIKL
                     ADRLHNMRTLGVMRPDKRRRIARETLDIYTPIASRLGLNSLRHELEDMGFSALYPTRY
                     RVISEAVRKARGNRKEIVAGIEERFIHRFGEEGLRVQIDAREKRPYSIYRKMMQKHLT
                     FKEVFDVFAVRIVANSVDDCYRALGIVHNLYKPLPGRFKDYIAIPKANGYQSLHTILF
                     GPHGIPLEVQIRTNEMHQFAESGIAAHWLYKSSHDQGTVTQARAREWLRDLLEIQQKA
                     GNPQEFLESVKVDLFPDEVYVFTPMGEIIELPRRATVVDFAYAIHTDVGNHCVACKID
                     RRFAPLSTPLENGQTIEIITAEGAEPNPNWLSFVVTARARANIRNYLKNLQDSEAIKL
                     GHRLLAKSLNAESIDFNDIKTDRLKRLLAEYHHDGLSDLLREIGLGNRMAPLVARLLM
                     ADENTDEGAESHGAMTSLNATQTPIISGTEGLVVDFAKCCHPIPGDAVVGFLSTGRGI
                     VVHRHDCGNAADVGVHPERWLAVNWADPALGDYQALIVIHAKNVRGGLARIASAAAET
                     GADIDDVRFDDRDVNLTIITVTLRVADRVHLARVMRRIKQVPDVVKVLRP"
     misc_feature    complement(39578..41701)
                     /locus_tag="Hneap_0033"
                     /note="Guanosine polyphosphate
                     pyrophosphohydrolases/synthetases [Signal transduction
                     mechanisms / Transcription]; Region: SpoT; COG0317"
                     /db_xref="CDD:223394"
     misc_feature    complement(41204..41575)
                     /locus_tag="Hneap_0033"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(41285..41287,41483..41488,41558..41560))
                     /locus_tag="Hneap_0033"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(41483..41485)
                     /locus_tag="Hneap_0033"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(40706..41032)
                     /locus_tag="Hneap_0033"
                     /note="Nucleotidyltransferase (NT) domain of RelA- and
                     SpoT-like ppGpp synthetases and hydrolases; Region:
                     NT_Rel-Spo_like; cd05399"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(40706..40711,40733..40735,40739..40741,
                     40745..40747,40781..40783,40793..40795,40799..40801,
                     40805..40807,40820..40822,40826..40828,40910..40912,
                     40922..40927,40988..40990,40994..40996))
                     /locus_tag="Hneap_0033"
                     /note="synthetase active site [active]"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(40709..40711,40739..40741,40745..40747,
                     40781..40783,40793..40795,40799..40801,40805..40807,
                     40820..40822,40826..40828,40994..40996))
                     /locus_tag="Hneap_0033"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(40745..40747,40925..40927))
                     /locus_tag="Hneap_0033"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143389"
     misc_feature    complement(40361..40540)
                     /locus_tag="Hneap_0033"
                     /note="TGS_RelA_SpoT: The RelA (SpoT) protein, also
                     referred to as ppGpp hydrolase/synthetase, is a
                     ribosome-associated protein that is activated during amino
                     acid starvation and thought to mediate the stringent
                     response. RelA contains a TGS domain, named after...;
                     Region: TGS_RelA_SpoT; cd01668"
                     /db_xref="CDD:133438"
     misc_feature    complement(39578..39790)
                     /locus_tag="Hneap_0033"
                     /note="ACT  domain found C-terminal of the RelA/SpoT
                     domains; Region: ACT_RelA-SpoT; cd04876"
                     /db_xref="CDD:153148"
     gene            complement(41772..42095)
                     /locus_tag="Hneap_0034"
                     /db_xref="GeneID:8533147"
     CDS             complement(41772..42095)
                     /locus_tag="Hneap_0034"
                     /inference="protein motif:TFAM:TIGR00690"
                     /note="TIGRFAM: DNA-directed RNA polymerase subunit omega;
                     PFAM: RNA polymerase Rpb6;
                     KEGG: tgr:Tgr7_3186 RNA polymerase, omega subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="YP_003261947.1"
                     /db_xref="GI:261854664"
                     /db_xref="InterPro:IPR003716"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="GeneID:8533147"
                     /translation="MARVTVEDCLVKIPNRFELVLMAARRARQIEQGAEPLVPMGKEK
                     PVVIALREIGEGKIDQARIDEIQEHMVVLRSQISEAEIRAELAQFADEDEGSVRRPAT
                     TSDEG"
     misc_feature    complement(41889..42095)
                     /locus_tag="Hneap_0034"
                     /note="DNA-directed RNA polymerase subunit omega;
                     Reviewed; Region: rpoZ; PRK00392"
                     /db_xref="CDD:234744"
     gene            complement(42146..42775)
                     /locus_tag="Hneap_0035"
                     /db_xref="GeneID:8533148"
     CDS             complement(42146..42775)
                     /locus_tag="Hneap_0035"
                     /EC_number="2.7.4.8"
                     /inference="protein motif:TFAM:TIGR03263"
                     /note="KEGG: tgr:Tgr7_3187 guanylate kinase;
                     TIGRFAM: guanylate kinase;
                     PFAM: guanylate kinase;
                     SMART: guanylate kinase/L-type calcium channel region"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="YP_003261948.1"
                     /db_xref="GI:261854665"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="InterPro:IPR017665"
                     /db_xref="InterPro:IPR020590"
                     /db_xref="GeneID:8533148"
                     /translation="MSQGQLFVISAPSGAGKTSLIKALREQMPDLGLSISHTTRPMRP
                     GEVDGQHYHFVSKPTFESMIAEGAFVEHALVFGNHYGTSKAAVSAVLDKGQDLILEID
                     WQGAEQVRPLFSGAQSIFILPPSREALRERLFGRGQDDADVIARRLAEAEREMQAYPN
                     YDFLIINDDFSQALNQLRCLFESARLRTPRQAEKERVRLENLLNTPKKT"
     misc_feature    complement(42224..42769)
                     /locus_tag="Hneap_0035"
                     /note="Guanylate kinase; Region: Guanylate_kin; pfam00625"
                     /db_xref="CDD:250008"
     misc_feature    complement(42242..42760)
                     /locus_tag="Hneap_0035"
                     /note="Guanosine monophosphate kinase (GMPK, EC 2.7.4.8),
                     also known as guanylate kinase (GKase), catalyzes the
                     reversible phosphoryl transfer from adenosine triphosphate
                     (ATP) to guanosine monophosphate (GMP) to yield adenosine
                     diphosphate (ADP) and guanosine...; Region: GMPK; cd00071"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(42536..42538,42551..42553,42620..42622,
                     42647..42649,42656..42658,42677..42679,42725..42727,
                     42743..42745))
                     /locus_tag="Hneap_0035"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(42725..42727,42743..42745))
                     /locus_tag="Hneap_0035"
                     /note="G-X2-G-X-G-K; other site"
                     /db_xref="CDD:238026"
     gene            complement(42782..43396)
                     /locus_tag="Hneap_0036"
                     /db_xref="GeneID:8533149"
     CDS             complement(42782..43396)
                     /locus_tag="Hneap_0036"
                     /inference="similar to AA sequence:KEGG:Psyr_1541"
                     /note="KEGG: psb:Psyr_1541 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261949.1"
                     /db_xref="GI:261854666"
                     /db_xref="GeneID:8533149"
                     /translation="MFGIDIAALLAQYGLLVLAIGCLLEGETVLVLAGLAAHQGMLPL
                     PQVFVIAVVFGWLGDQIFFWLGRWKGDAILLRFPSWAKQKPRLDRWIHKYHAPVVVMV
                     RFMYGLRAAGPVLIGHSGLCPWKFAFYNAIGALIWATIFIALGWVFGQAAERILEQIN
                     HWGHYVFYVGAVVILVIGFVFWIVNRRRAARAVERAALSEQERD"
     misc_feature    complement(42848..43387)
                     /locus_tag="Hneap_0036"
                     /note="Uncharacterized membrane-associated protein
                     [Function unknown]; Region: DedA; COG0586"
                     /db_xref="CDD:223659"
     gene            complement(43484..43954)
                     /locus_tag="Hneap_0037"
                     /db_xref="GeneID:8533150"
     CDS             complement(43484..43954)
                     /locus_tag="Hneap_0037"
                     /inference="protein motif:PFAM:PF05433"
                     /note="PFAM: 17 kDa surface antigen;
                     KEGG: dat:HRM2_44910 outer membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261950.1"
                     /db_xref="GI:261854667"
                     /db_xref="InterPro:IPR008816"
                     /db_xref="GeneID:8533150"
                     /translation="MRAQSIIKWSVPIIMLAALTGCVTPMSGDVYSRNNAMQMQSVQY
                     GTIESLRGVRIAGTQTPIGAIGGAVVGGLLGSGVGGGLGRDLATVGGAIGGGVAGSAI
                     EEGVTQQNGVEIVVRLDNGRTVSIVQSVGGQIFSLGQRVQVITAPNGTSRVTAG"
     misc_feature    complement(43493..43924)
                     /locus_tag="Hneap_0037"
                     /note="Glycine zipper 2TM domain; Region: Rick_17kDa_Anti;
                     cl10470"
                     /db_xref="CDD:263979"
     gene            44187..44936
                     /locus_tag="Hneap_0038"
                     /db_xref="GeneID:8533151"
     CDS             44187..44936
                     /locus_tag="Hneap_0038"
                     /inference="protein motif:PFAM:PF03741"
                     /note="PFAM: integral membrane protein TerC;
                     KEGG: swd:Swoo_1180 integral membrane protein TerC"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein TerC"
                     /protein_id="YP_003261951.1"
                     /db_xref="GI:261854668"
                     /db_xref="InterPro:IPR005496"
                     /db_xref="GeneID:8533151"
                     /translation="MIELLLAPETWIAFATLTALEIVLGIDNIIVIAILVSKLPEHQR
                     AAGRLFGLALAMVTRIGLLFSLVWLMGLTEPFLHIGELAFSGRDLILLVGGLFLVYKA
                     VTEMHDTMETGGHIETNSTGAMLKKVSIWAVVTQIALIDIVFSLDSVITAIGLVKHIE
                     IMVAAIIVAVLVMMIAAKPISEFVERHPTIKMLALAFLILVGVFLIAESFGQHVPKGY
                     IYTAMAFSLVVESLNIRMRKKREQLTSKVLE"
     misc_feature    44187..44912
                     /locus_tag="Hneap_0038"
                     /note="Membrane protein TerC, possibly involved in
                     tellurium resistance [Inorganic ion transport and
                     metabolism]; Region: TerC; COG0861"
                     /db_xref="CDD:223930"
     gene            complement(44946..45716)
                     /locus_tag="Hneap_0039"
                     /db_xref="GeneID:8533152"
     CDS             complement(44946..45716)
                     /locus_tag="Hneap_0039"
                     /EC_number="4.2.99.18"
                     /inference="protein motif:TFAM:TIGR00633"
                     /note="KEGG: tgr:Tgr7_0109 exodeoxyribonuclease III Xth;
                     TIGRFAM: exodeoxyribonuclease III Xth;
                     exodeoxyribonuclease III;
                     PFAM: endonuclease/exonuclease/phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease III Xth"
                     /protein_id="YP_003261952.1"
                     /db_xref="GI:261854669"
                     /db_xref="InterPro:IPR000097"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="GeneID:8533152"
                     /translation="MRVISFNANGIRSAARKGFFDWLSEQNADFVCIQETKAQADQLT
                     DPEFCPAGYTCQYVSAEKKGYSGVAIYARRSPDAIITQLGLPEFDAEGRYCAFEYPDL
                     MVASLYLPSGSAGDHRQESKDRFLAAYLPILESYLQKQHKPLILCGDWNIAHKEIDLK
                     NWKSNQKNSGFLPHERAWLDELFDRLGFVDAHRLVAPGEAVYTWWSNRANAWENNVGW
                     RIDYQIITPDLADRVERATVYRDMKFSDHAPLIIDYRS"
     misc_feature    complement(44955..45716)
                     /locus_tag="Hneap_0039"
                     /note="Neisseria meningitides Nape-like subfamily of the
                     ExoIII family purinic/apyrimidinic (AP) endonucleases;
                     Region: Nape_like_AP-endo; cd10281"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(44976..44981,44985..44987,45054..45059,
                     45063..45065,45069..45071,45075..45077,45087..45089,
                     45093..45101,45105..45107,45222..45224,45228..45230,
                     45234..45236,45264..45266,45270..45272,45363..45365,
                     45378..45380,45384..45386,45393..45395,45438..45440,
                     45522..45527,45591..45593,45606..45608,45612..45614,
                     45675..45692,45696..45698))
                     /locus_tag="Hneap_0039"
                     /note="putative active site [active]"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(44976..44978,44985..44987,45057..45059,
                     45063..45065,45069..45071,45075..45077,45093..45101,
                     45105..45107,45222..45224,45228..45230,45234..45236,
                     45264..45266,45270..45272,45363..45365,45378..45380,
                     45384..45386,45393..45395,45438..45440,45522..45527,
                     45591..45593,45606..45608,45612..45614,45675..45692,
                     45696..45698))
                     /locus_tag="Hneap_0039"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(44976..44978,45264..45266,45270..45272,
                     45384..45386,45393..45395,45612..45614,45696..45698))
                     /locus_tag="Hneap_0039"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(44976..44981,45054..45056,45264..45266,
                     45270..45272,45393..45395,45612..45614,45696..45698))
                     /locus_tag="Hneap_0039"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(44979..44981,45612..45614,45690..45692))
                     /locus_tag="Hneap_0039"
                     /note="metal binding site A [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(44976..44978,45057..45059,45063..45065,
                     45105..45107,45264..45266,45270..45272,45384..45386,
                     45393..45395))
                     /locus_tag="Hneap_0039"
                     /note="putative AP binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:197336"
     misc_feature    complement(order(44976..44978,45264..45266,45270..45272))
                     /locus_tag="Hneap_0039"
                     /note="putative metal binding site B [ion binding]; other
                     site"
                     /db_xref="CDD:197336"
     gene            complement(46091..47545)
                     /locus_tag="Hneap_0040"
                     /db_xref="GeneID:8533153"
     CDS             complement(46091..47545)
                     /locus_tag="Hneap_0040"
                     /EC_number="3.4.21.108"
                     /inference="protein motif:TFAM:TIGR02037"
                     /note="KEGG: csa:Csal_1628 peptidase S1C, Do;
                     TIGRFAM: protease Do;
                     PFAM: peptidase S1 and S6 chymotrypsin/Hap; PDZ/DHR/GLGF
                     domain protein;
                     SMART: PDZ/DHR/GLGF domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protease Do"
                     /protein_id="YP_003261953.1"
                     /db_xref="GI:261854670"
                     /db_xref="InterPro:IPR001254"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001940"
                     /db_xref="InterPro:IPR011782"
                     /db_xref="GeneID:8533153"
                     /translation="MRTQILVEAIRAGLPRRGRLLMAAALIATPLMAMTPAISFADNG
                     VPDYVQLVKQASPWVVNISSVSNPKTQEAFNNGEMPTFPPGPAGDMFRHFFQEQMPQM
                     KREPIRSLGSGFIISADGYILTNAHVVNGADKITVRLPDQQTYKAKVIGKDKRTDIAL
                     LKIDAKNLPVAPIGNSDNIQVGEWVLAIGEPFGLDHTATHGIVSALGRDLPDESYVPF
                     IQTDAPVNPGNSGGPLINANGKVIGINSQIYTKSGGFMGISFAIPINVAMNVVDQIKS
                     TGHVTRGYLGVLIQPVTYDLAQSFGLDTTKGALVAKVEPNTPAAKAGLKSGDIILKFN
                     GSEIKHSGELPIMVGMSPIGKPATLTLMRDGKQMELNVTIEKLDKKALEAESGTSEAI
                     EKMGLQVTELSPDELQQLNIKYGIKVKSVKNDSQFASVIAPGDILLEVNRMPMKSATD
                     LKKALDSAPKDRPIAIRLLRDGQPLFMAVQLGTQ"
     misc_feature    complement(46109..47410)
                     /locus_tag="Hneap_0040"
                     /note="periplasmic serine protease, Do/DeqQ family;
                     Region: degP_htrA_DO; TIGR02037"
                     /db_xref="CDD:233695"
     misc_feature    complement(46814..47215)
                     /locus_tag="Hneap_0040"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    complement(46430..46699)
                     /locus_tag="Hneap_0040"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(46511..46516,46523..46528,46679..46681,
                     46685..46696))
                     /locus_tag="Hneap_0040"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     misc_feature    complement(46109..46363)
                     /locus_tag="Hneap_0040"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(46190..46195,46202..46207,46349..46351,
                     46355..46363))
                     /locus_tag="Hneap_0040"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     gene            47739..48017
                     /locus_tag="Hneap_0041"
                     /db_xref="GeneID:8533154"
     CDS             47739..48017
                     /locus_tag="Hneap_0041"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261954.1"
                     /db_xref="GI:261854671"
                     /db_xref="GeneID:8533154"
                     /translation="MSRKARRETGLRQLRVNGYSIRERRNTAGLRQLRVKSPSKARPM
                     RVDAQKTQHFVIGLGIVAQLRPSASASFCGFWISNSAHEGFNQRFLRS"
     gene            48154..50388
                     /locus_tag="Hneap_0042"
                     /db_xref="GeneID:8533155"
     CDS             48154..50388
                     /locus_tag="Hneap_0042"
                     /EC_number="3.1.3.1"
                     /inference="protein motif:PRIAM:3.1.3.1"
                     /note="KEGG: mxa:MXAN_1389  alkaline phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="YP_003261955.1"
                     /db_xref="GI:261854672"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8533155"
                     /translation="MNATSPSLALAHSNSRRQFLKLIVLTASAGALAACGGGDGGAEN
                     ISTDTRYFPQSVASGDPAANSVILWTRLGTLGPQTDGQLRVQVSTQEDFSNLIVDESA
                     VPVAAAHDHCLRLKVAGLKPGTTYYYRFLFSTGNQAWASSRTGRTKTAPDATANVPVS
                     YAVTSCQDYIGRYYNVWAYLLQTEPDLDFILQIGDYIYETTGDPSFQTVGSARSITFT
                     DTAGAIQLGDATAPYYAASSVSNYRDLYKAYRSDPILQQVHERYPMIGIWDDHEYSDD
                     CWGATATYFNGREDEYNPPRRDRAEQVYYEFMPLDDPAIASGALNKDPATLWPNNVLY
                     RRLRFGQNLEAVLLDYRSYRPDHLIPEGGFPGKVVMSEPVLVSILGQTAYDAVKANFG
                     PYVDTTTAPWNSYLTALIPVLAQGYLQAGFTGDAQTKATDDLTGLVSAFVFNQLIGQF
                     NAAVAAGQIPGASALPAIDSTTYDALPRGIAFLHIGKQSFFSELGARYAVVQPTFDLY
                     AQYMQATGQYEQDPLGATQRQFLANALASDATFINVISTVSTAPLRWDLRSATNLPAD
                     YQTVFKPNVDQWDGFPQGKQAFLETLANRPGAFLASGDIHASFVTQHQTSSMAMPVAD
                     FTGPAISSGTFNNFVESAISGLPGLDSAQKAAANQALVLGLDQTLQASAPADEPIVFA
                     DTTHHGIMVFRVDGSQTQVDYLLIDQSAVSQNLTGDSSALIKAFSRQRFTLDPQTGKV
                     TSAS"
     misc_feature    48319..>49398
                     /locus_tag="Hneap_0042"
                     /note="PhoD-like phosphatase; Region: PhoD; pfam09423"
                     /db_xref="CDD:255356"
     misc_feature    48637..>49215
                     /locus_tag="Hneap_0042"
                     /note="Bacillus subtilis PhoD and related proteins,
                     metallophosphatase domain; Region: MPP_PhoD; cd07389"
                     /db_xref="CDD:163632"
     misc_feature    order(48649..48651,48655..48657,48736..48738,48961..48966,
                     49204..49206)
                     /locus_tag="Hneap_0042"
                     /note="putative active site [active]"
                     /db_xref="CDD:163632"
     misc_feature    order(48649..48651,48655..48657,48736..48738,48961..48963,
                     49204..49206)
                     /locus_tag="Hneap_0042"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:163632"
     misc_feature    <49879..50043
                     /locus_tag="Hneap_0042"
                     /note="metallophosphatase superfamily, metallophosphatase
                     domain; Region: MPP_superfamily; cl13995"
                     /db_xref="CDD:265413"
     gene            complement(50405..51196)
                     /locus_tag="Hneap_0043"
                     /db_xref="GeneID:8533156"
     CDS             complement(50405..51196)
                     /locus_tag="Hneap_0043"
                     /inference="protein motif:TFAM:TIGR01458"
                     /note="TIGRFAM: HAD-superfamily subfamily IIA hydrolase
                     like protein; HAD-superfamily hydrolase, subfamily IIA;
                     PFAM: Haloacid dehalogenase domain protein hydrolase;
                     KEGG: pla:Plav_1666 HAD family hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase"
                     /protein_id="YP_003261956.1"
                     /db_xref="GI:261854673"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006355"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="GeneID:8533156"
                     /translation="MQTTTQAVIFDIGGVLLDGNTPMPGAVDALARLREASIPFLLLT
                     NTTRRSHADLLAALHEAGLDVSAQQLLTPARAAAAWLQSYQTHGVLLIHPGLLPDFAG
                     VDTTLIGAKSEATGPRAVIVGDAGEGFTYTTLNAAFRELMAGATLISLSDSRYFREAD
                     SLSLDAGPFVRLLENAAGVTSNAMGKPGASFFQQAIAALGFSAENITLIGDDVHSDIQ
                     GADAVGLQTILVQTGKYQDGDEDLAPENTLIAKDVLASVYLLNQR"
     misc_feature    complement(50465..51181)
                     /locus_tag="Hneap_0043"
                     /note="HAD-superfamily subfamily IIA hydrolase, TIGR01458;
                     Region: HAD-SF-IIA-hyp3"
                     /db_xref="CDD:162372"
     misc_feature    complement(50825..51178)
                     /locus_tag="Hneap_0043"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(order(51062..51067,51158..51166))
                     /locus_tag="Hneap_0043"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    complement(51149..51166)
                     /locus_tag="Hneap_0043"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(51065..51067)
                     /locus_tag="Hneap_0043"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(50447..50647)
                     /locus_tag="Hneap_0043"
                     /note="HAD-hyrolase-like; Region: Hydrolase_like;
                     pfam13242"
                     /db_xref="CDD:257599"
     gene            complement(51408..52196)
                     /locus_tag="Hneap_0044"
                     /db_xref="GeneID:8533157"
     CDS             complement(51408..52196)
                     /locus_tag="Hneap_0044"
                     /inference="protein motif:PFAM:PF00994"
                     /note="PFAM: molybdopterin binding domain;
                     KEGG: aeh:Mlg_1211 molybdopterin binding domain-containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin binding domain-containing protein"
                     /protein_id="YP_003261957.1"
                     /db_xref="GI:261854674"
                     /db_xref="InterPro:IPR001453"
                     /db_xref="GeneID:8533157"
                     /translation="MSVASGKPIAIGVLIIGDEILSGRRKDTHLAAVIERLAPRGRQP
                     DWAQMIGDDADHIERTLRESQQAGSIVFCFGGIGATPDDLTRASAARAFERPLTRHPE
                     AERRIIAQFGEAAFPHRVHMADFPEQVDLIPNPINNVAGFYLENHFFMPGFPQMAHPM
                     LDWILANPLASLGTLDYREQSIWTIGASENDLLPTMTGLCAEFPDLKFFSLPIGQGER
                     RLIELGFKGASARVAQAIKALQNQLDALDVTHQSERPPTEPTQT"
     misc_feature    complement(51468..52169)
                     /locus_tag="Hneap_0044"
                     /note="Predicted nucleotide-utilizing enzyme related to
                     molybdopterin-biosynthesis enzyme MoeA [General function
                     prediction only]; Region: CinA; COG1058"
                     /db_xref="CDD:223986"
     misc_feature    complement(51681..52166)
                     /locus_tag="Hneap_0044"
                     /note="Competence-damaged protein. CinA is the first gene
                     in the competence- inducible (cin) operon and is thought
                     to be specifically required at some stage in the process
                     of transformation. This domain is closely related to a
                     domain, found in a variety of...; Region: cinA; cd00885"
                     /db_xref="CDD:238450"
     misc_feature    complement(order(51720..51722,51729..51731,51741..51746,
                     51963..51971))
                     /locus_tag="Hneap_0044"
                     /note="putative MPT binding site; other site"
                     /db_xref="CDD:238450"
     gene            complement(52193..53305)
                     /locus_tag="Hneap_0045"
                     /db_xref="GeneID:8533158"
     CDS             complement(52193..53305)
                     /locus_tag="Hneap_0045"
                     /EC_number="4.99.1.1"
                     /inference="protein motif:TFAM:TIGR00109"
                     /note="KEGG: tcx:Tcr_1864 ferrochelatase;
                     TIGRFAM: ferrochelatase;
                     PFAM: ferrochelatase"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="YP_003261958.1"
                     /db_xref="GI:261854675"
                     /db_xref="InterPro:IPR001015"
                     /db_xref="InterPro:IPR019772"
                     /db_xref="GeneID:8533158"
                     /translation="MTYQGEPHYAHGSAERMGVLLLNLGTPDEPTTPALRRYLKQFLS
                     DPRVIELPKLLWWPILNLIILNTRPKKSAAAYREVWDHYEDGSPLLTISRQQQRGLQE
                     RLSQQMAGPVSVALGMRYGNPSVATALAELRDAGARRILVLPMYPQYAAATTASTFDA
                     VFDEMKTWRWVPELRFITHYHREPAYLDALAASVREHFAEHGQPQKLVMSFHGVPKRY
                     LLAGDPYHCECHVTGRLLADRLGLSADQYMVTFQSRFGREEWLKPYTDETLKGLPAKG
                     IKHIAVVCPGFSADCLETIEEIGQENREYFEEAGGETYHYIPALNARDDHLDALTHLI
                     RRHTQGWIEHSGYDAQADAQERDRVRANALAMGAER"
     misc_feature    complement(52277..53272)
                     /locus_tag="Hneap_0045"
                     /note="ferrochelatase; Reviewed; Region: hemH; PRK00035"
                     /db_xref="CDD:234585"
     misc_feature    complement(52757..53257)
                     /locus_tag="Hneap_0045"
                     /note="Ferrochelatase, N-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_N;
                     cd03411"
                     /db_xref="CDD:239504"
     misc_feature    complement(order(52763..52765,52769..52771,52853..52864,
                     52871..52873,53018..53020,53030..53032,53069..53071,
                     53081..53083,53237..53239))
                     /locus_tag="Hneap_0045"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239504"
     misc_feature    complement(order(52847..52852,53174..53182,53192..53194,
                     53234..53236))
                     /locus_tag="Hneap_0045"
                     /note="active site"
                     /db_xref="CDD:239504"
     misc_feature    complement(52343..52744)
                     /locus_tag="Hneap_0045"
                     /note="Ferrochelatase, C-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_C;
                     cd00419"
                     /db_xref="CDD:238240"
     misc_feature    complement(order(52427..52429,52526..52528,52655..52657,
                     52670..52672))
                     /locus_tag="Hneap_0045"
                     /note="active site"
                     /db_xref="CDD:238240"
     misc_feature    complement(order(52343..52345,52418..52420,52430..52432,
                     52436..52444,52448..52450,52610..52612,52622..52624,
                     52631..52639))
                     /locus_tag="Hneap_0045"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238240"
     gene            53431..54390
                     /locus_tag="Hneap_0046"
                     /db_xref="GeneID:8533159"
     CDS             53431..54390
                     /locus_tag="Hneap_0046"
                     /inference="protein motif:TFAM:TIGR01292"
                     /note="TIGRFAM: thioredoxin reductase;
                     PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     KEGG: ppr:PBPRA1159  thioredoxin reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin reductase"
                     /protein_id="YP_003261959.1"
                     /db_xref="GI:261854676"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:8533159"
                     /translation="MSETNTRHARLLILGSGPAGYAAAVYAARANLNPVLITGMEMGG
                     QLTTTTEVENWPGDPGDLTGPALMDRMKAHAEKFDTEIIFDHIQSTNLKQRPFTLKGD
                     SGTYTCDALIVATGASAKYLGLESESKFKGKGVSACATCDGFFYKNQEIAVVGGGNTA
                     VEEALYLANVASKVHVIHRRDKFKAENILIDRLMKKVDEGKVEIHWHSAIDEILGDNT
                     GVTGLRIKQVQTEKTTDIALTGVFIAIGHAPNTGIFEGELDLAGGYIQVKSGTQGNAT
                     ATSVPGVFAAGDVMDHVYRQAITSAGTGCMAALDAKTYLEGLE"
     misc_feature    53446..54384
                     /locus_tag="Hneap_0046"
                     /note="thioredoxin reductase; Provisional; Region:
                     PRK10262"
                     /db_xref="CDD:182343"
     misc_feature    <53575..53973
                     /locus_tag="Hneap_0046"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    53881..54093
                     /locus_tag="Hneap_0046"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            54484..54804
                     /locus_tag="Hneap_0047"
                     /db_xref="GeneID:8533160"
     CDS             54484..54804
                     /locus_tag="Hneap_0047"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261960.1"
                     /db_xref="GI:261854677"
                     /db_xref="GeneID:8533160"
                     /translation="MDPVIAAYTVLLAVALGLSGFLRGDARRRGRGLLMAATLSGFIV
                     VAAASALVNAVSVPDLILTSLAVFFSAQAATTAFSLLWREISSTRQARGSVPDSDHRE
                     DTST"
     gene            54801..55673
                     /locus_tag="Hneap_0048"
                     /db_xref="GeneID:8533161"
     CDS             54801..55673
                     /locus_tag="Hneap_0048"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: art:Arth_4084 NAD(P) transhydrogenase, beta
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261961.1"
                     /db_xref="GI:261854678"
                     /db_xref="GeneID:8533161"
                     /translation="MSVGLQIDLVGWFALALILAALYGLNSEKGERSGNTTWHKPAIG
                     LLSAALLLMLLSVLWTSDGSNVPLAIVMVLLGIVAAPLSSRYRSSRYRDARGSSPQRT
                     LREGILSGLSLITIGTGLSVALLGLTGWFDMDRDAFTWDIRLVSVSSEFIGVWTFAAG
                     LMLWLRLNDYLPQSSPGRNQKRVGLAVLALAVVLSGLSVLFPAYASALMIVVAVLALE
                     LGALSALGVAETRVARVLGQHTGLIGAAIAMLGYVQASLFLLSMGGLIVAAAIHYLRG
                     AMAFNQARRRRTDF"
     gene            complement(55687..56304)
                     /locus_tag="Hneap_0049"
                     /db_xref="GeneID:8533162"
     CDS             complement(55687..56304)
                     /locus_tag="Hneap_0049"
                     /EC_number="3.1.3.5"
                     /inference="protein motif:PRIAM:3.1.3.5"
                     /note="KEGG: eic:NT01EI_2688 5'-nucleotidase,
                     PFAM: metal-dependent phosphohydrolase HD sub domain;
                     SMART: metal-dependent phosphohydrolase HD region"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="YP_003261962.1"
                     /db_xref="GI:261854679"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="GeneID:8533162"
                     /translation="MLSKSTTPEQSHFFAYLARMKYITRWGLMRNTRTENIQEHSLQV
                     AMIAHALAVIGNELYGETNDIGRIVTVALYHDASEIITGDLPTPVKYFRQDILDSYKA
                     LEAHAERKLTGLLPERLRSAFASTIESAQIEPEVTRVVKAADSMSAYLKCLEEGFAGN
                     QEFKKAESYLLAKLVEMQETMPAVAYFRTHFVEGFALTLDDLSHE"
     misc_feature    complement(55861..56190)
                     /locus_tag="Hneap_0049"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(55873..55875,56077..56082,56185..56187))
                     /locus_tag="Hneap_0049"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(56077..56079)
                     /locus_tag="Hneap_0049"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            complement(56333..57763)
                     /locus_tag="Hneap_0050"
                     /db_xref="GeneID:8533163"
     CDS             complement(56333..57763)
                     /locus_tag="Hneap_0050"
                     /EC_number="3.1.5.1"
                     /inference="protein motif:TFAM:TIGR01353"
                     /note="KEGG: mpo:Mpop_2521 deoxyguanosinetriphosphate
                     triphosphohydrolase;
                     TIGRFAM: deoxyguanosinetriphosphate triphosphohydrolase;
                     SMART: metal-dependent phosphohydrolase HD region"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyguanosinetriphosphate triphosphohydrolase"
                     /protein_id="YP_003261963.1"
                     /db_xref="GI:261854680"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006261"
                     /db_xref="GeneID:8533163"
                     /translation="MKRTESNWPRWLNAARRRPSQTSPALFHTETRAEIERDYDRVLF
                     STPVRRMADKTQVFPLDHSDSVRTRLTHSHEVANLARSVGLDLVFNRNLAAGLPQALR
                     DVPALLATIGLAHDLGNPPFGHQGEEAIGRWFARHEATVLNPQTGLSEAMRQDFLRFE
                     GNAQTLRLLTKLQLINDDYGLNLTVATLAALIKYPVGSDDIDKKFVVRKKHGFFQSEQ
                     ALVAEVQAQCGLDAGQRHPLTWILEACDDIAYSVLDAEDAVKKGLLSFSDIIAFLRHA
                     ADGDPVVTRVCDAAQEEHRRYRQTDLSPAELNDISMQTFRIRAIGALMQAVADTFLTQ
                     LPAMSAGTFNQELIAASPARALLSTLKACNWQHAYRHKTVLKVELTGFEVIHGLMDAF
                     WYAITDRVDPLDPASARRTPLASYLYQLISENYRRVFEAPSNPMPLRYREAQLLTDMV
                     SGMTDSFAVRSWQQIQEAGFRPNVPY"
     misc_feature    complement(56366..57745)
                     /locus_tag="Hneap_0050"
                     /note="deoxyguanosinetriphosphate triphosphohydrolase-like
                     protein; Provisional; Region: PRK01096"
                     /db_xref="CDD:234897"
     misc_feature    complement(<57350..57559)
                     /locus_tag="Hneap_0050"
                     /note="HD domain; Region: HD; pfam01966"
                     /db_xref="CDD:251000"
     misc_feature    complement(56372..56722)
                     /locus_tag="Hneap_0050"
                     /note="Phosphohydrolase-associated domain; Region:
                     HD_assoc; pfam13286"
                     /db_xref="CDD:257627"
     gene            57863..58720
                     /locus_tag="Hneap_0051"
                     /db_xref="GeneID:8533164"
     CDS             57863..58720
                     /locus_tag="Hneap_0051"
                     /inference="protein motif:PFAM:PF03446"
                     /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
                     NADP oxidoreductase coenzyme F420-dependent;
                     KEGG: cyt:cce_2482  3-hydroxyacid dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="YP_003261964.1"
                     /db_xref="GI:261854681"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="GeneID:8533164"
                     /translation="MNIAVLGLGLMGRAIAERLVKAGMTVRGYNRSALSAPPTGVTMS
                     ESVAAAVEPSDIVWVMLADFAACESVLLAENPWDLFKNKLIINGATIGPEQSRALAES
                     IKQLGGHYLESPVLGSTPQAETGTLQILVGGDPADVAVADPVLKALGKPTHFGGIGQG
                     AAVKLAMNQLIGSLTAAFSMSLGLVEREGVDVDTFMNTLRDSALYAPTFDKKLDRMRT
                     RDFAAANFPLKHLLKDIRLFTEVAGAQQIDARMLDGLARILADGVTAGHADEDYSALF
                     GQIVPNITP"
     misc_feature    57863..58687
                     /locus_tag="Hneap_0051"
                     /note="3-hydroxyisobutyrate dehydrogenase and related
                     beta-hydroxyacid dehydrogenases [Lipid metabolism];
                     Region: MmsB; COG2084"
                     /db_xref="CDD:224995"
     misc_feature    57863..58330
                     /locus_tag="Hneap_0051"
                     /note="NAD binding domain of 6-phosphogluconate
                     dehydrogenase; Region: NAD_binding_2; pfam03446"
                     /db_xref="CDD:251959"
     misc_feature    58334..58687
                     /locus_tag="Hneap_0051"
                     /note="NAD-binding of NADP-dependent 3-hydroxyisobutyrate
                     dehydrogenase; Region: NAD_binding_11; pfam14833"
                     /db_xref="CDD:258970"
     gene            58846..60408
                     /locus_tag="Hneap_0052"
                     /db_xref="GeneID:8533165"
     CDS             58846..60408
                     /locus_tag="Hneap_0052"
                     /EC_number="3.5.4.10"
                     /inference="protein motif:TFAM:TIGR00355"
                     /note="KEGG: asa:ASA_3451 bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase;
                     TIGRFAM: phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase;
                     PFAM: AICARFT/IMPCHase bienzyme formylation region; MGS
                     domain protein;
                     SMART: AICARFT/IMPCHase bienzyme formylation region"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /protein_id="YP_003261965.1"
                     /db_xref="GI:261854682"
                     /db_xref="InterPro:IPR002695"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR013982"
                     /db_xref="GeneID:8533165"
                     /translation="MKNNRTTPRRALLSVSDKTGLLAFAQSLNRHGVALISTGGTASM
                     LRDAGLPVTEVADVTGFPEMMAGRVKTLNPKIHGGILARRGVDEDVMAEHGIEPIDIV
                     VVNLYPFAETVAKPNCQFDDAVENIDIGGPAMVRAAAKNHQDVAIIVDPSDYGRVLSE
                     VEAGGIEAQTRFELAVRAFEHTAHYDGMIADYFGKMVSGNAFAPTFNLQLKKAQDLRY
                     GENPHQEAAFYVEHTPPVGSIAAAHMIQGKALSYNNIADSDAALECVKQFAEPACVIV
                     KHANPCGVAVAEDLTVAYDRAYATDPTSAFGGIIAFNRPLDGHTARTIVERQFVEVVI
                     APEISPEARIEFEAKPNVRVLTVGQWPAVSPARLDFKRVHGGLLVQDDDAARITARDL
                     TVVSERQPTPEELRDLLFAWQVAKFVKSNAIIYASGEQTIGVGAGQMSRVYSARIAAI
                     KAEDACLPVAGSVMASDAFFPFRDGIDAAAAVGIRAVIQPGGSMRDQEVIDAANEHGI
                     AMVFTGIRHFRH"
     misc_feature    58870..60405
                     /locus_tag="Hneap_0052"
                     /note="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase; Provisional; Region:
                     purH; PRK00881"
                     /db_xref="CDD:234854"
     misc_feature    58870..59424
                     /locus_tag="Hneap_0052"
                     /note="Inosine monophosphate cyclohydrolase domain. This
                     is the N-terminal domain in the purine biosynthesis
                     pathway protein ATIC (purH). The bifunctional ATIC protein
                     contains a C-terminal  ATIC formylase domain that
                     formylates...; Region: IMPCH; cd01421"
                     /db_xref="CDD:238709"
     misc_feature    order(58891..58893,58897..58899,58957..58959,58966..58968,
                     59053..59058,59158..59160,59227..59229)
                     /locus_tag="Hneap_0052"
                     /note="purine monophosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    order(59026..59028,59035..59040,59047..59052,59059..59067,
                     59074..59079,59086..59088,59224..59232,59239..59241,
                     59251..59256,59263..59265,59359..59361,59368..59376,
                     59398..59406,59410..59415,59422..59424)
                     /locus_tag="Hneap_0052"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    order(59053..59055,59227..59229)
                     /locus_tag="Hneap_0052"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:238709"
     misc_feature    59257..60201
                     /locus_tag="Hneap_0052"
                     /note="AICARFT/IMPCHase bienzyme; Region: AICARFT_IMPCHas;
                     smart00798"
                     /db_xref="CDD:214822"
     gene            60466..62061
                     /locus_tag="Hneap_0053"
                     /db_xref="GeneID:8533166"
     CDS             60466..62061
                     /locus_tag="Hneap_0053"
                     /inference="protein motif:PFAM:PF02646"
                     /note="PFAM: protein of unknown function DUF195;
                     KEGG: afr:AFE_3259 DNA recombination protein RmuC"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261966.1"
                     /db_xref="GI:261854683"
                     /db_xref="InterPro:IPR003798"
                     /db_xref="GeneID:8533166"
                     /translation="MSSFFAQLPNLPPVWAWAGLASTALLLVALLFVWLVLAQRARQN
                     RQSAAEEIERLNVALAESRHEVTEQELAARQAQRDLTAASTELARTQATLSALSDQLS
                     RMQAERMSERQQSEQRIDVLSRQVQTQAAEQAELQERLAQERRAAAEKLALIDQAQVQ
                     LQQAFQALSADALRANNESFLKLAEENLARFQAGAAQDLNKRQEAIVQMTQPIRERLE
                     QFDVKLNSLEQARTNAYGAMNQQINDLLQIHLPKLHRETADLVRALRQPQTRGRWGEV
                     QLKRVVELAGMLEHCDFEEQVSQSDTGGRLRPDMIVHLPGGRQVVVDAKAPLNAYLQA
                     MEAPSDEARAAALQDHARQVRTHISQLSKKEYFDQFSPTPEFVVLFVPGEVFFSAALM
                     QDPTLIEFGAEKRVIPASPTTLIALLKAVSYGWRQEALAKNAQEMAELGRDLYERMGT
                     LAQHWQKVGKHLDQAVGAFNQSVGSLEGRVLPTARKFRELGAVRSDKEDLPSLTPLTT
                     ETRPLTAQELTGPDSAAAITQKD"
     misc_feature    60685..>61032
                     /locus_tag="Hneap_0053"
                     /note="HemX; Region: HemX; cl19375"
                     /db_xref="CDD:267728"
     misc_feature    60697..62004
                     /locus_tag="Hneap_0053"
                     /note="Predicted nuclease of restriction endonuclease-like
                     fold, RmuC family [General function prediction only];
                     Region: COG1322"
                     /db_xref="CDD:224241"
     misc_feature    61072..61938
                     /locus_tag="Hneap_0053"
                     /note="RmuC family; Region: RmuC; pfam02646"
                     /db_xref="CDD:251445"
     gene            complement(62045..62242)
                     /locus_tag="Hneap_0054"
                     /db_xref="GeneID:8533167"
     CDS             complement(62045..62242)
                     /locus_tag="Hneap_0054"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261967.1"
                     /db_xref="GI:261854684"
                     /db_xref="GeneID:8533167"
                     /translation="MNLNTELNALSTQELEHLIQAIAAELSERSSKPAKPLDEEEIVQ
                     VLSFELKRHRKQKDEVFNPFA"
     gene            complement(62254..63108)
                     /locus_tag="Hneap_0055"
                     /db_xref="GeneID:8533168"
     CDS             complement(62254..63108)
                     /locus_tag="Hneap_0055"
                     /inference="protein motif:PFAM:PF00149"
                     /note="PFAM: metallophosphoesterase;
                     KEGG: bbr:BB3098 serine/threonine protein phosphatase 1"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="YP_003261968.1"
                     /db_xref="GI:261854685"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="GeneID:8533168"
                     /translation="MTLFKQLLVNPNGRDFVVGDIHGHLSRLEKVLDYHQFKPESDRL
                     IAVGDLINRGTDSLNTLRLLSEPWFFSVAGNHERMISQYRQALTRRQLTADERQKMVS
                     IGAQWLLDAYDALNEDKWADLITEIMNLITQMPLMIQVGNGPEAVGVIHAELPDWDWS
                     RSVTRLERIKKVKFWDQPRDEPSIESLLWGNAQFQSLRNGEQNDRHISGIAWVIQGHS
                     VSNIPRRAGNRLWIDTGADESQSAHGLSIAELGPQLTVTTHFRDLRIRTERFNLTPQP
                     RFHSVLMS"
     misc_feature    complement(62392..63072)
                     /locus_tag="Hneap_0055"
                     /note="PrpA and PrpB, metallophosphatase domain; Region:
                     MPP_PrpA_PrpB; cd07424"
                     /db_xref="CDD:163667"
     misc_feature    complement(order(62410..62412,62458..62460,62536..62538,
                     62542..62544,62656..62658,62881..62886,62950..62955,
                     62962..62964,63043..63045,63049..63051))
                     /locus_tag="Hneap_0055"
                     /note="active site"
                     /db_xref="CDD:163667"
     misc_feature    complement(order(62458..62460,62656..62658,62884..62886,
                     62962..62964,63043..63045,63049..63051))
                     /locus_tag="Hneap_0055"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163667"
     gene            63522..63998
                     /locus_tag="Hneap_0056"
                     /db_xref="GeneID:8533169"
     CDS             63522..63998
                     /locus_tag="Hneap_0056"
                     /inference="protein motif:PFAM:PF08754"
                     /note="PFAM: Domain of unknown function DUF1791;
                     KEGG: tgr:Tgr7_2583 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261969.1"
                     /db_xref="GI:261854686"
                     /db_xref="InterPro:IPR014865"
                     /db_xref="GeneID:8533169"
                     /translation="MKKIRLLQSAFVLFMLGLLSALPVQAQTVDAKAIDALGGNSLAN
                     HHIVLQETDSDLQRQTLVLNVASNLINAYGDNADIEIVGFGPGISLLFANNEHAKRIE
                     SLAQQGVRFSACMNSLAKATERLGYEPKLNPVAKKVPAGIVRIIDLVDAGYILVRP"
     misc_feature    63657..63995
                     /locus_tag="Hneap_0056"
                     /note="DsrE/DsrF-like family; Region: DrsE; pfam02635"
                     /db_xref="CDD:251438"
     gene            64169..64549
                     /locus_tag="Hneap_0057"
                     /db_xref="GeneID:8533170"
     CDS             64169..64549
                     /locus_tag="Hneap_0057"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261970.1"
                     /db_xref="GI:261854687"
                     /db_xref="GeneID:8533170"
                     /translation="MTETTASESMSHKEVAEYIANHDADRRGGFVARPILLQKLNEFG
                     SPSLAVLTFEGEKTLTLAGLLSLQPDDEVVLYDDNAPDGAQSFYGVVEDVREGVRPAD
                     SIKRMRLIYLQKKSSDKVLDPREA"
     gene            64622..67444
                     /locus_tag="Hneap_0058"
                     /db_xref="GeneID:8533171"
     CDS             64622..67444
                     /locus_tag="Hneap_0058"
                     /EC_number="2.7.7.42"
                     /inference="protein motif:PRIAM:2.7.7.42"
                     /note="PFAM: glutamate-ammonia ligase adenylyltransferase;
                     GlnD PII-uridylyltransferase;
                     KEGG: tgr:Tgr7_0463 (glutamate--ammonia-ligase)
                     adenylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="(glutamate--ammonia-ligase) adenylyltransferase"
                     /protein_id="YP_003261971.1"
                     /db_xref="GI:261854688"
                     /db_xref="InterPro:IPR005190"
                     /db_xref="InterPro:IPR013546"
                     /db_xref="GeneID:8533171"
                     /translation="MINLIEPEMRLHIESAARDAGASVNQLAQLRVLLEVSPFVAENI
                     TKQPCLWPFLLEQVNHANGPTGLAERIEQQLSNSPIEDLDQQLRHIRRAEMLRIAWRD
                     VARLAPTTETLRDLSDLADQCVQQALMAHERVLVARHGFPRSKQGAYQQLVVLGMGKL
                     GGYELNYSSDIDLIFLFEEEGETDGPKSISNSEFFIKLGQRVIRSLNEVTRDGFVFRV
                     DMRLRPHGDEGALALSFDAAELYYTTLGREWERYALIKARVIAGDQAAGARLLALLKP
                     FVYRKYLDFGAFAQLRDMKKAIEREMNRRGMHDNIKLGPGGIREIEFIGQLYQLLRGG
                     REPKLQSRSILTTLEVLRGLKELPSAIIDELLAGYDFLRRAENRLQMMHDRQTQTLPL
                     DDLDQARLALAMGYSSWGDFMAALDQHRQRIHRYFGEILQTSRDDNVNELPMQQIWLN
                     NLTPEVAEELLRKQGFDDPESILDTLLAWKRDLSPQLSDTVQHRLDLLMPNVLQEVAT
                     HGTSAETLRAVLALVDAVLSRSVYLALLIEQPAALKHLVQLCSASPWIAELLRQQPIL
                     LDELVDANNLYSQPDVQALSQEISGFLSRFPDDEERQFDELRRFRQLATLRVAAADAM
                     DILPVMRVSDQLTWIAEVVLEKVLQLAYQQMVTRHGEPRALDEHGAEYTPGFAIIAYG
                     KLGGIELGYGSDLDVVFLHDSTDTSAMTTGQKPIDNQLFFARLAQKIIHILSIRTPSG
                     VLYEVDTRLRPDGAGGLLVSSLQGFEQYQKQHAWLWETQALCRARFIAGQNQIAERFA
                     TIRRDTLCAPRDPATLKEAVLDMRQKMRAEHGQTGAGETFHLKRGIGGITDIEFMVQY
                     LLLRHAHAHPEIVAFTDNIRQLRALAQADLLDGERSEQLVTAYQRLRNTSHRRTLNKQ
                     SLELPCADFAEERAVVLAAWQQIFEL"
     misc_feature    64652..67438
                     /locus_tag="Hneap_0058"
                     /note="bifunctional glutamine-synthetase
                     adenylyltransferase/deadenyltransferase; Reviewed; Region:
                     PRK11072"
                     /db_xref="CDD:236836"
     misc_feature    64892..65410
                     /locus_tag="Hneap_0058"
                     /note="Nucleotidyltransferase (NT) domain of Escherichia
                     coli adenylyltransferase (GlnE), Escherichia coli uridylyl
                     transferase (GlnD), and similar proteins; Region:
                     NT_GlnE_GlnD_like; cd05401"
                     /db_xref="CDD:143391"
     misc_feature    order(65129..65131,65135..65137,65276..65278)
                     /locus_tag="Hneap_0058"
                     /note="metal binding triad; metal-binding site"
                     /db_xref="CDD:143391"
     misc_feature    65495..65914
                     /locus_tag="Hneap_0058"
                     /note="GlnD PII-uridylyltransferase; Region:
                     GlnD_UR_UTase; pfam08335"
                     /db_xref="CDD:254738"
     misc_feature    66446..67033
                     /locus_tag="Hneap_0058"
                     /note="Nucleotidyltransferase (NT) domain of Escherichia
                     coli adenylyltransferase (GlnE), Escherichia coli uridylyl
                     transferase (GlnD), and similar proteins; Region:
                     NT_GlnE_GlnD_like; cd05401"
                     /db_xref="CDD:143391"
     misc_feature    order(66701..66703,66707..66709,66857..66859)
                     /locus_tag="Hneap_0058"
                     /note="metal binding triad; metal-binding site"
                     /db_xref="CDD:143391"
     misc_feature    67067..>67345
                     /locus_tag="Hneap_0058"
                     /note="GlnD PII-uridylyltransferase; Region:
                     GlnD_UR_UTase; cl19627"
                     /db_xref="CDD:267980"
     gene            67499..67957
                     /locus_tag="Hneap_0059"
                     /db_xref="GeneID:8533172"
     CDS             67499..67957
                     /locus_tag="Hneap_0059"
                     /inference="protein motif:PFAM:PF02639"
                     /note="PFAM: protein of unknown function DUF188;
                     KEGG: hha:Hhal_1913 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261972.1"
                     /db_xref="GI:261854689"
                     /db_xref="InterPro:IPR003791"
                     /db_xref="GeneID:8533172"
                     /translation="MHIWVDADACPVAVKEILFRAAARTGLPMTLVANQPLAIPRGAS
                     TVRFIQVAGGFDVADNEIVRRLSAGDLVITQDIPLAAEVIEKGGLALNPRGEHYTPDS
                     IKARLSMRHFMESLRESGVNTGGPAKLNQSDRQVFANALDKILLARPGSV"
     misc_feature    67547..67933
                     /locus_tag="Hneap_0059"
                     /note="Uncharacterized BCR, YaiI/YqxD family COG1671;
                     Region: DUF188; pfam02639"
                     /db_xref="CDD:251442"
     gene            68056..68586
                     /locus_tag="Hneap_0060"
                     /db_xref="GeneID:8533173"
     CDS             68056..68586
                     /locus_tag="Hneap_0060"
                     /inference="protein motif:PFAM:PF03938"
                     /note="PFAM: outer membrane chaperone Skp (OmpH);
                     KEGG: aeh:Mlg_1854 outer membrane chaperone Skp (OmpH)"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane chaperone Skp"
                     /protein_id="YP_003261973.1"
                     /db_xref="GI:261854690"
                     /db_xref="InterPro:IPR005632"
                     /db_xref="GeneID:8533173"
                     /translation="MDRAVRYGLSVLVFLFAAATQAEVLAAPIKVGYVNSVALMEQAP
                     QADIAKHALEREFSPREREIRALQQQAQTLQGRLDNGGASMGDTERSTLRQQLDQKML
                     RIQQMQSDFQDDLNLKKNEALGKLQQAVLQAIKDVAKTNGYQLVLSDGVVYAAPSVDI
                     TKLVAERLKQLAKGKQ"
     misc_feature    68146..68562
                     /locus_tag="Hneap_0060"
                     /note="Outer membrane protein (OmpH-like); Region: OmpH;
                     smart00935"
                     /db_xref="CDD:214922"
     gene            68944..69192
                     /locus_tag="Hneap_0061"
                     /db_xref="GeneID:8533174"
     CDS             68944..69192
                     /locus_tag="Hneap_0061"
                     /inference="protein motif:PFAM:PF00550"
                     /note="PFAM: phosphopantetheine-binding;
                     KEGG: app:CAP2UW1_0380 phosphopantetheine-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine-binding protein"
                     /protein_id="YP_003261974.1"
                     /db_xref="GI:261854691"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="GeneID:8533174"
                     /translation="MEAIQLIRDFLQERTQTDPALVTPDARLETLGIDSFTLLELIFE
                     FEEKYGVSIPNDTQTPETVQDLLNLIARFRQQAEAKPS"
     misc_feature    68944..69153
                     /locus_tag="Hneap_0061"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; cl09936"
                     /db_xref="CDD:263928"
     gene            69189..70436
                     /locus_tag="Hneap_0062"
                     /db_xref="GeneID:8533175"
     CDS             69189..70436
                     /locus_tag="Hneap_0062"
                     /inference="protein motif:PFAM:PF02801"
                     /note="PFAM: beta-ketoacyl synthase;
                     KEGG: dar:Daro_4170 3-oxoacyl-[acyl-carrier-protein]
                     synthase II"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoacyl synthase"
                     /protein_id="YP_003261975.1"
                     /db_xref="GI:261854692"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="GeneID:8533175"
                     /translation="MTRPHRVAVTGLGMVSPFGGSTQDFFTRMLAGESAVALYETDDA
                     PRGLSVPAVRCADFDPAERVPKHMLATMDRYAQLGLAAAFEAWAQAGLTLGANEDSPD
                     AGVAWGSALGGTLAYERGYRDLWQNGQERVSPMSVVQGMNNAASAQIGIALGLGNSCL
                     TYTVACASAAAAIGEAFNRIRYGDAKIMLTGGSDAPLAYAVVRAWEAMRVLAPGDRDT
                     AYRACRPFHPDRRGLVLAEGAAALVLEDWDHAVARGAPILAEMSGFGASCDHSHLVRP
                     DAGGQVRALQQALDQAGLAPKDIGYVNAHGTATREGDPTEIQALKTVFGAHAEHLAVS
                     ATKSMHGHVMGATGAIEALITVLALWQDAIVPTAHLDAIDPACAGVRHITQAEHGSDL
                     QAALCSSFAFGGSNAVLAFKACK"
     misc_feature    69201..70424
                     /locus_tag="Hneap_0062"
                     /note="beta-ketoacyl-acyl-carrier-protein synthase II;
                     Region: fabF; TIGR03150"
                     /db_xref="CDD:200247"
     misc_feature    69201..70421
                     /locus_tag="Hneap_0062"
                     /note="Beta-ketoacyl-acyl carrier protein (ACP) synthase
                     (KAS), type I and II. KASs are responsible for the
                     elongation steps in fatty acid biosynthesis. KASIII
                     catalyses the initial condensation and KAS I and II
                     catalyze further elongation steps by Claisen...; Region:
                     KAS_I_II; cd00834"
                     /db_xref="CDD:238430"
     misc_feature    order(69516..69518,69537..69542,69552..69554,69558..69563,
                     69597..69599,69615..69617,69627..69629,69639..69641,
                     69657..69659,69663..69665,69669..69677,69711..69713,
                     69720..69725,69732..69734,69795..69800,69807..69812,
                     69987..70001,70035..70037,70395..70397,70401..70403)
                     /locus_tag="Hneap_0062"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238430"
     misc_feature    order(69684..69686,70101..70103,70212..70214)
                     /locus_tag="Hneap_0062"
                     /note="active site"
                     /db_xref="CDD:238430"
     gene            70516..70800
                     /locus_tag="Hneap_0063"
                     /db_xref="GeneID:8533176"
     CDS             70516..70800
                     /locus_tag="Hneap_0063"
                     /inference="similar to AA sequence:KEGG:CAP2UW1_0378"
                     /note="KEGG: app:CAP2UW1_0378 acyl carrier protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="YP_003261976.1"
                     /db_xref="GI:261854693"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="GeneID:8533176"
                     /translation="MTDLSQKITDQALVEELANLIVDGLNLEVSAAEIDADAPLFGQG
                     LGLDSIDILEIAMMVSKRYGFALRSDDENNTRIFSSLRHLAQHIAEHRSC"
     misc_feature    70537..70794
                     /locus_tag="Hneap_0063"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; cl09936"
                     /db_xref="CDD:263928"
     gene            70809..71507
                     /locus_tag="Hneap_0064"
                     /db_xref="GeneID:8533177"
     CDS             70809..71507
                     /locus_tag="Hneap_0064"
                     /inference="protein motif:COG:COG4648"
                     /note="KEGG: eba:ebA7058 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261977.1"
                     /db_xref="GI:261854694"
                     /db_xref="GeneID:8533177"
                     /translation="MSRAGLLSRVKAGLILFLLGLDLFLANILSPKAHVSAAVVVLAF
                     LPITLIMLDVLWHTAGKAVALAVAALIVLGGVLLLPQLQAQISLIYLLQHLTANLLLG
                     FWFGRSLWRNRQPVCTQFAGVLHPRMTPLLVQYTTRVTQAWTIFFFAMATTSILLYLF
                     APITLWSIFANSLTLPLLVLMFGAEYLVRRRVLPPEDQLGPLSAFRAYRRSVLARLAQ
                     GRHSNVNPDTPTSK"
     misc_feature    <71079..71417
                     /locus_tag="Hneap_0064"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4648"
                     /db_xref="CDD:226995"
     gene            71516..73297
                     /locus_tag="Hneap_0065"
                     /db_xref="GeneID:8533178"
     CDS             71516..73297
                     /locus_tag="Hneap_0065"
                     /inference="protein motif:PFAM:PF00501"
                     /note="PFAM: AMP-dependent synthetase and ligase;
                     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
                     FabA/FabZ;
                     KEGG: bcj:BCAL0843 AMP-binding enzyme family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="YP_003261978.1"
                     /db_xref="GI:261854695"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR013114"
                     /db_xref="GeneID:8533178"
                     /translation="MTSFPLIFADPDQLLFYRQQGNAVHTITAREFMADAEALAVDLT
                     TRMGAHQSIINLCQDRYRFMVGFAATILAGKTNLLPSTFTGETLRQIFIDAPDALCLH
                     DHDDWPFPYPHLSLDHLSLSHRALANRCPREPLPDGLGESDHIKPEHVVAQVFTSGST
                     GLPMPHNKTWGKLVRNVEAALQQLGLWRPVSLVGTVPPQHMFGFESLVLLCLIGRCPL
                     WSGKPFYPADIVAALDAMPEPRMLVTTPFHLQALLDAQIALPKIDRLLLATAPLSPEL
                     AERAERVTGAPLFEIYGSTETGQIANRRPTQSTAWTLFPGITLTKAHLDENDELFIAN
                     GEHIEAPVMLSDRIHVRADGRFDLLGRIADQVNMAGKRSSLNYLSAQLKAIDGVTDGV
                     FFLPETKKDRTGKNRVGKDQAITRLCAVVVAPALSAADILAALRDRLDPVFLPRPLIL
                     VENLPYNATGKLPQIALQAILDQHLAALAPKNQTSWRIPSDHPVFAGHFPGHPLVPGA
                     LLLDWVVERVAAYWQVASAGLRIEQAKFTHPVLPDARVTLDLKPEADRCRFTLHVHAG
                     ETNPVAVSGVLSRQSNDEAGDTEARQA"
     misc_feature    71546..72922
                     /locus_tag="Hneap_0065"
                     /note="Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
                     II [Lipid metabolism / Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: CaiC; COG0318"
                     /db_xref="CDD:223395"
     misc_feature    71978..72898
                     /locus_tag="Hneap_0065"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    order(71981..71983,72317..72322,72383..72400,72551..72553,
                     72587..72589,72596..72598,72629..72631,72896..72898)
                     /locus_tag="Hneap_0065"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    order(71981..71983,72101..72106,72248..72250,72254..72259,
                     72266..72268,72317..72322,72383..72400,72551..72553,
                     72587..72589,72596..72598,72620..72631,72839..72841)
                     /locus_tag="Hneap_0065"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    order(71981..71998,72002..72004)
                     /locus_tag="Hneap_0065"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    order(72101..72103,72254..72259,72266..72268,72317..72319,
                     72620..72628,72821..72823,72839..72841)
                     /locus_tag="Hneap_0065"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    <72974..73192
                     /locus_tag="Hneap_0065"
                     /note="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier
                     protein) dehydratases [Lipid metabolism]; Region: FabA;
                     COG0764"
                     /db_xref="CDD:223835"
     misc_feature    order(73031..73036,73121..73132)
                     /locus_tag="Hneap_0065"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    order(73049..73051,73058..73063,73070..73072,73100..73102)
                     /locus_tag="Hneap_0065"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            73294..74238
                     /locus_tag="Hneap_0066"
                     /db_xref="GeneID:8533179"
     CDS             73294..74238
                     /locus_tag="Hneap_0066"
                     /inference="protein motif:PFAM:PF03279"
                     /note="PFAM: lipid A biosynthesis acyltransferase;
                     KEGG: pna:Pnap_1376 lipid A biosynthesis acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis acyltransferase"
                     /protein_id="YP_003261979.1"
                     /db_xref="GI:261854696"
                     /db_xref="InterPro:IPR004960"
                     /db_xref="GeneID:8533179"
                     /translation="MNASAKAEWQQRPERGSQFMLRVMLWLSRHLGRSVSRWVLYPIA
                     LYFLLFVPAARRASRQYLARVFGRPARLIEVFRHIFTFASTVHDRVYLLDGRDDLFKI
                     EFVNRHWFDSPEGAILIGAHMGSFEALRSAGKTHARRRVSMLMYPENARKINALLALV
                     NPDAANDIIPLGQVDSMLTAQERLAAGHLVGMLADRSLPQDTLRPCVFLGEPAAFALG
                     PFRVAALLKKPVYFMAGLYLGGNRYRVHFDRLADFSDTPRAGRDAAILAAQDRYVEIL
                     ESLCRQAPYNWFNFYDFWSDDSSSDHARTNPPDKEPAD"
     misc_feature    73588..74175
                     /locus_tag="Hneap_0066"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: LABLAT-like; Region:
                     LPLAT_LABLAT-like; cd07984"
                     /db_xref="CDD:153246"
     misc_feature    order(73657..73659,73666..73668,73672..73674,73723..73734,
                     73879..73887)
                     /locus_tag="Hneap_0066"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153246"
     gene            74238..74837
                     /locus_tag="Hneap_0067"
                     /db_xref="GeneID:8533180"
     CDS             74238..74837
                     /locus_tag="Hneap_0067"
                     /inference="similar to AA sequence:KEGG:Daro_4176"
                     /note="KEGG: dar:Daro_4176 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261980.1"
                     /db_xref="GI:261854697"
                     /db_xref="GeneID:8533180"
                     /translation="MRQTLFLMLLLLQGLVQPVTVVAAAPSPDWSPASVLHTLAEHRR
                     GEVRFTEQKFIGVLDTPLLSEGTLTFRPPDYLEKHTTSPRDERMTIEGDVLTYTRQSQ
                     TYTLNLAEHPEATAYANSIRGLLNGNAALLRKSYVLKLSGDRAHWVLLLLPTDPRIQS
                     LIKSISVNGSGDHLQRIEYDQANGDRSVMTLLPVIPPTP"
     gene            74834..77248
                     /locus_tag="Hneap_0068"
                     /db_xref="GeneID:8533181"
     CDS             74834..77248
                     /locus_tag="Hneap_0068"
                     /inference="protein motif:PFAM:PF03176"
                     /note="PFAM: MMPL domain protein;
                     KEGG: bac:BamMC406_2683 exporter-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MMPL domain-containing protein"
                     /protein_id="YP_003261981.1"
                     /db_xref="GI:261854698"
                     /db_xref="InterPro:IPR004869"
                     /db_xref="GeneID:8533181"
                     /translation="MKHQGLEKMSWTERRLPVIGLWLLALALSLAVILHTRFTADMSA
                     FLPEHPTAAQAFLVDQIKDGAISRMILIGIEGGDAATRADASKALGNALRQSGLFTVV
                     RNGDAPTRDQDKTLLFDHRYLLSPDITPERFTVAGLHEAIANGIDLLASPFGMFSQTI
                     FTRDPTAETFAIVGKLGQNTGTDDAPRNQNGVWVSPDGKRSLMMLQTRAAGSDTDAMA
                     RAIEAVRADFSNAVKAHPDGSSLRLLVSGAPVFSVDARALIKSDVERFSIIGSVAVML
                     LLLVVYRSFSMLVLGLLPVLTGIAVAIATVSLGFGTVHGITIGFGTTLIGEAIDYSIY
                     YFIQTQNAPKEGSAFRSAGRSEGMERFWPTIRLGVLTSITGFAALLFSGFPGLAQIGL
                     YSIAGLTTAALVTRFVLPHLGTARLNRHSLAGIGRLLAPVFRAIQALRWGFVLLALAG
                     FVLLVWRHDAIWQTGLSGLNPISGQAKAMDDELRADMNADDARYFIVAKAPTQQAALA
                     AAERIDAALEPLIKQGVLARFDSPAKFLPSVATQRVRQQALPDSTTLTERLDAAVQGL
                     PISASKLKPFVDAVEQARKQTPLTPADLEGTSFGLAVSALLQKQNGEWLTLIRLYVPS
                     VGTLDTARITAALKSSGISDALFVDKDAESSRLFNSYLENTITLSLAGLLGIVILLGF
                     VLRRPARLIRVLLPLLVAVVLVMAGLNLAGEKLNILNLVGLLLIVAIGSNYALFFNQN
                     TAPDHQTLASLLLANLTTVIAFGTLAFSQLPILHAFGSTVAPGAFLALVVAAAFAKPN
                     APKAPA"
     misc_feature    74864..77182
                     /locus_tag="Hneap_0068"
                     /note="Predicted exporter [General function prediction
                     only]; Region: COG4258"
                     /db_xref="CDD:226709"
     misc_feature    <75413..76069
                     /locus_tag="Hneap_0068"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            77245..77697
                     /locus_tag="Hneap_0069"
                     /db_xref="GeneID:8533182"
     CDS             77245..77697
                     /locus_tag="Hneap_0069"
                     /inference="similar to AA sequence:KEGG:BCAL0836"
                     /note="KEGG: bcj:BCAL0836 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261982.1"
                     /db_xref="GI:261854699"
                     /db_xref="GeneID:8533182"
                     /translation="MTNAQAQSRTLDHEEIAALIPHQGSMCLLDHVVDWNAQKIACTA
                     ISHRAIDNPLRRNGRLGAAVGIEYAAQAMAVHGALLAARDTAPKKGMITRVQRIALHA
                     ERLDDCPDALRITAKRLMGDERMVRYGFELRCAERMLLEGEASVILDA"
     misc_feature    77290..77694
                     /locus_tag="Hneap_0069"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:260469"
     misc_feature    order(77425..77430,77542..77553)
                     /locus_tag="Hneap_0069"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    order(77443..77445,77452..77457,77464..77466,77515..77523)
                     /locus_tag="Hneap_0069"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            complement(77721..77927)
                     /locus_tag="Hneap_0070"
                     /db_xref="GeneID:8533183"
     CDS             complement(77721..77927)
                     /locus_tag="Hneap_0070"
                     /inference="similar to AA sequence:KEGG:Pnap_3867"
                     /note="KEGG: pna:Pnap_3867 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261983.1"
                     /db_xref="GI:261854700"
                     /db_xref="GeneID:8533183"
                     /translation="MYQRIVVLGALGLVTLVSGCSSAAWYSAGQSYQRNECLKVPNQA
                     ERERCLDNANTDYNTYTKETTPAP"
     gene            78057..79043
                     /locus_tag="Hneap_0071"
                     /db_xref="GeneID:8533184"
     CDS             78057..79043
                     /locus_tag="Hneap_0071"
                     /inference="protein motif:PFAM:PF02826"
                     /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
                     catalytic region;
                     KEGG: ana:alr0058 D-lactate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-binding D-isomer specific 2-hydroxyacid
                     dehydrogenase protein"
                     /protein_id="YP_003261984.1"
                     /db_xref="GI:261854701"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="GeneID:8533184"
                     /translation="MRVAVFSSKPYDQESLTRANAAFRHELHFFEAALNLQTCSLAEN
                     AEAVCVFVHDQIDAHLLCCLAGRGVKVVALRCAGFNNVDLPAAREVGIDVVRVPAYSP
                     YAVAEHAVAMMLTLNRHTHRAYNRVREGNFALNGLLGFDMNGKTVGIVGTGRIGTVLA
                     RIMIGFGCTVLAYDLYPNDECKALGVRYVPLDELLPQSDIISLHCPLSEETRHLIDSK
                     AIGKMKRGAMLINTGRGALIDTSAVIAALKSGHIGALGLDVYEQEENLFFEDHSEEII
                     QDDVLERLMTFPNVLVTAHQGFFTREAIDAIAKITLNNLKQVEAAEPCPNQL"
     misc_feature    78057..79040
                     /locus_tag="Hneap_0071"
                     /note="D-Lactate and related Dehydrogenases, NAD-binding
                     and catalytic domains; Region: LDH_like_2; cd12183"
                     /db_xref="CDD:240659"
     misc_feature    78057..79034
                     /locus_tag="Hneap_0071"
                     /note="Lactate dehydrogenase and related dehydrogenases
                     [Energy production and conversion / Coenzyme metabolism /
                     General function prediction only]; Region: LdhA; COG1052"
                     /db_xref="CDD:223980"
     misc_feature    order(78282..78290,78354..78356,78756..78758,78939..78941,
                     78948..78950)
                     /locus_tag="Hneap_0071"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240659"
     misc_feature    order(78354..78356,78369..78371,78507..78509,78513..78524,
                     78573..78581,78666..78677,78687..78689,78696..78698,
                     78750..78758,78828..78833,78939..78941,78945..78950)
                     /locus_tag="Hneap_0071"
                     /note="putative NAD binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240659"
     misc_feature    order(78756..78758,78843..78845,78939..78941)
                     /locus_tag="Hneap_0071"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240659"
     gene            79194..79484
                     /locus_tag="Hneap_0072"
                     /db_xref="GeneID:8533185"
     CDS             79194..79484
                     /locus_tag="Hneap_0072"
                     /inference="protein motif:PFAM:PF07238"
                     /note="PFAM: type IV pilus assembly PilZ;
                     KEGG: tgr:Tgr7_1284 type IV pilus assembly PilZ"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus assembly PilZ"
                     /protein_id="YP_003261985.1"
                     /db_xref="GI:261854702"
                     /db_xref="InterPro:IPR009875"
                     /db_xref="GeneID:8533185"
                     /translation="MLLKPDLRDFQRMPQRAPMRYQNEHDPTWQSAELMDLSASGLAM
                     LTIESLPEGSVLNVEIAPALAVVPPLRAVVEVRRCEPDGEGHLVGVRFVEMY"
     misc_feature    79209..79478
                     /locus_tag="Hneap_0072"
                     /note="PilZ domain; Region: PilZ; pfam07238"
                     /db_xref="CDD:254119"
     gene            complement(79586..80446)
                     /locus_tag="Hneap_0073"
                     /db_xref="GeneID:8533186"
     CDS             complement(79586..80446)
                     /locus_tag="Hneap_0073"
                     /EC_number="5.1.1.3"
                     /inference="protein motif:TFAM:TIGR00067"
                     /note="KEGG: neu:NE0449 aspartate and glutamate
                     racemase:glutamate racemase;
                     TIGRFAM: glutamate racemase;
                     PFAM: Asp/Glu/hydantoin racemase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="YP_003261986.1"
                     /db_xref="GI:261854703"
                     /db_xref="InterPro:IPR004391"
                     /db_xref="InterPro:IPR015942"
                     /db_xref="InterPro:IPR018187"
                     /db_xref="GeneID:8533186"
                     /translation="MKLTDTKPTAPIGIFDSGVGGLSVYQAVRHALPAEDIIYIADSG
                     FAPYGDRSSDFITERAVAMTDFLIAAGAKAVVVACNTATVIAVTQLRRQFSIPIIALE
                     PAIKPAIEHSQSGTIGVLATRKTIESPAVERLCRTHGVNTRVLLQPCPGFVEQVERGE
                     MDHPDTTDLIRRYVEPLLAAGADTLVLGCTHYVYLAQQIRTIVGPDVSILDSSAAVAR
                     QVGRRIGSSEVAASTGRCGQDQFFTTAASTDHARAVMSTLVGRPVEVHYAGTTRPAST
                     LEAETAQTRD"
     misc_feature    complement(79649..80434)
                     /locus_tag="Hneap_0073"
                     /note="glutamate racemase; Provisional; Region: PRK00865"
                     /db_xref="CDD:234851"
     gene            complement(80598..80861)
                     /locus_tag="Hneap_0074"
                     /db_xref="GeneID:8533187"
     CDS             complement(80598..80861)
                     /locus_tag="Hneap_0074"
                     /inference="protein motif:TFAM:TIGR02116"
                     /note="TIGRFAM: addiction module toxin, Txe/YoeB family;
                     PFAM: Addiction module toxin Txe/YoeB; plasmid
                     stabilization system;
                     KEGG: tau:Tola_2844 addiction module toxin, Txe/YoeB
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="Txe/YoeB family addiction module toxin"
                     /protein_id="YP_003261987.1"
                     /db_xref="GI:261854704"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="InterPro:IPR009614"
                     /db_xref="GeneID:8533187"
                     /translation="MSWQLVYTKHAQKDAKKLAASGLKEKAMDLLKVLEENPYQNPPP
                     FEKLVGDLAGAYSRRINIQHRIVYEVLEQAHIVKILRLWTHYE"
     misc_feature    complement(80604..80843)
                     /locus_tag="Hneap_0074"
                     /note="Plasmid encoded toxin Txe; Region: Plasmid_Txe;
                     cl17389"
                     /db_xref="CDD:247943"
     gene            complement(80858..81100)
                     /locus_tag="Hneap_0075"
                     /db_xref="GeneID:8533188"
     CDS             complement(80858..81100)
                     /locus_tag="Hneap_0075"
                     /inference="protein motif:TFAM:TIGR01552"
                     /note="TIGRFAM: prevent-host-death family protein;
                     PFAM: protein of unknown function DUF172;
                     KEGG: dol:Dole_2606 prevent-host-death family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="YP_003261988.1"
                     /db_xref="GI:261854705"
                     /db_xref="InterPro:IPR003756"
                     /db_xref="InterPro:IPR006442"
                     /db_xref="GeneID:8533188"
                     /translation="MAILNATEARSKLYSLIDEANDSHQPIVIKGKRGSAVLISEEDW
                     NAITETLNLLAIPGMRESIQEGLNTPASECAKDLDW"
     misc_feature    complement(80882..81100)
                     /locus_tag="Hneap_0075"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; pfam02604"
                     /db_xref="CDD:251410"
     gene            complement(81147..81383)
                     /locus_tag="Hneap_0076"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:8533189"
     gene            complement(81463..81732)
                     /locus_tag="Hneap_0077"
                     /db_xref="GeneID:8533190"
     CDS             complement(81463..81732)
                     /locus_tag="Hneap_0077"
                     /inference="similar to AA sequence:KEGG:Noc_0084"
                     /note="KEGG: noc:Noc_0084 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261989.1"
                     /db_xref="GI:261854706"
                     /db_xref="GeneID:8533190"
                     /translation="MKAKDFDKKFEEGQEDIVDDLDLSSARRVNQGQKRINVDFPAWV
                     VESLDREAARMGVTRQSIIKVWLVERLQAESANKPLHGDTAGGAH"
     gene            complement(81722..81817)
                     /locus_tag="Hneap_0078"
                     /db_xref="GeneID:8533191"
     CDS             complement(81722..81817)
                     /locus_tag="Hneap_0078"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261990.1"
                     /db_xref="GI:261854707"
                     /db_xref="GeneID:8533191"
                     /translation="MRSQPFLYFAPNITLIPTAHPLRGRVDLYES"
     gene            complement(82067..82297)
                     /locus_tag="Hneap_0079"
                     /db_xref="GeneID:8533192"
     CDS             complement(82067..82297)
                     /locus_tag="Hneap_0079"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261991.1"
                     /db_xref="GI:261854708"
                     /db_xref="GeneID:8533192"
                     /translation="MSKAVPDEPKFPIQLVWIESGDVETYEDARDLLCNLEEFDSNDP
                     VDRNAARLTDALGRHISLVVRIYDDLCECKLE"
     gene            complement(82401..82859)
                     /locus_tag="Hneap_0080"
                     /db_xref="GeneID:8533193"
     CDS             complement(82401..82859)
                     /locus_tag="Hneap_0080"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261992.1"
                     /db_xref="GI:261854709"
                     /db_xref="GeneID:8533193"
                     /translation="MRSTAKFLLALLVALAFVVSLISFGWWLVFAYNIVTGHTAIEFG
                     TKFAPQMLEQASQQKILFTQMREYFVLIGGAIGWGAFFALPNFSNRPFRALPKLLLIS
                     CVIGITAALVMPASVIFKVTPILTVILIFMRCLLIEDHPKHAMDQKNIET"
     gene            complement(82918..83169)
                     /locus_tag="Hneap_0081"
                     /db_xref="GeneID:8533194"
     CDS             complement(82918..83169)
                     /locus_tag="Hneap_0081"
                     /inference="similar to AA sequence:KEGG:CPS_2541"
                     /note="KEGG: cps:CPS_2541 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261993.1"
                     /db_xref="GI:261854710"
                     /db_xref="GeneID:8533194"
                     /translation="MKQKEIDRWAKARTKGMLMYVLLTGIVSYGIPMFAVMTFLFHHS
                     KLSVVQSAALWLAAGAFYGIATWLVQEHRYRKATDVPQV"
     gene            complement(83197..83307)
                     /locus_tag="Hneap_0082"
                     /db_xref="GeneID:8533195"
     CDS             complement(83197..83307)
                     /locus_tag="Hneap_0082"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261994.1"
                     /db_xref="GI:261854711"
                     /db_xref="GeneID:8533195"
                     /translation="MRSQPFLYFAPNITLIPTAHPLRVRVPSALRAPAAG"
     gene            83541..83720
                     /locus_tag="Hneap_0083"
                     /db_xref="GeneID:8533196"
     CDS             83541..83720
                     /locus_tag="Hneap_0083"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261995.1"
                     /db_xref="GI:261854712"
                     /db_xref="GeneID:8533196"
                     /translation="MGLIDHMVQRDKFQSEELTNGFDFPCCVCIHRHGTDKDEPCRTC
                     DHNMGSVPDDEVPNA"
     gene            83787..83966
                     /locus_tag="Hneap_0084"
                     /db_xref="GeneID:8533197"
     CDS             83787..83966
                     /locus_tag="Hneap_0084"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261996.1"
                     /db_xref="GI:261854713"
                     /db_xref="GeneID:8533197"
                     /translation="MRREQLTELESHLTKAASALRAAWILCKHNHMEPTAKELADTVL
                     DVETARDRVKDISTA"
     gene            complement(84404..84736)
                     /locus_tag="Hneap_0085"
                     /db_xref="GeneID:8533198"
     CDS             complement(84404..84736)
                     /locus_tag="Hneap_0085"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: swd:Swoo_0030 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261997.1"
                     /db_xref="GI:261854714"
                     /db_xref="GeneID:8533198"
                     /translation="MNIDEVVDLLPDEKLRSDLAKWVNDWKEDDTDITRLEKMLSKWH
                     SYTWFKDDERTLHFLNQLNEFRKTAISNVGGLTMNERLYYFCLFDNWDNGNVQQKDKI
                     RHKLLAQA"
     gene            complement(84810..85118)
                     /locus_tag="Hneap_0086"
                     /db_xref="GeneID:8533199"
     CDS             complement(84810..85118)
                     /locus_tag="Hneap_0086"
                     /inference="similar to AA sequence:KEGG:AZC_4005"
                     /note="KEGG: azc:AZC_4005 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261998.1"
                     /db_xref="GI:261854715"
                     /db_xref="GeneID:8533199"
                     /translation="MACDKCKELCIRYAIRLPGNLRKAISIASQNVTDGTLIDTTDPS
                     AHSVSFAQLAAGQTWDDIVAYHFRCSCCGEQFSLHAETYHGSGGFWEPVRKAAIRENL
                     "
     gene            complement(85145..85255)
                     /locus_tag="Hneap_0087"
                     /db_xref="GeneID:8533200"
     CDS             complement(85145..85255)
                     /locus_tag="Hneap_0087"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003261999.1"
                     /db_xref="GI:261854716"
                     /db_xref="GeneID:8533200"
                     /translation="MRSQSFLYFVPNITLNPTAHPLRGRVPSARRAPAAG"
     gene            complement(85475..86020)
                     /locus_tag="Hneap_0088"
                     /db_xref="GeneID:8533201"
     CDS             complement(85475..86020)
                     /locus_tag="Hneap_0088"
                     /inference="similar to AA sequence:KEGG:Sden_3281"
                     /note="KEGG: sdn:Sden_3281  yfeABCD locus regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="yfeABCD locus regulator"
                     /protein_id="YP_003262000.1"
                     /db_xref="GI:261854717"
                     /db_xref="GeneID:8533201"
                     /translation="MTYDEAKKKILIKWLVGAPVVVATSLSSAVSALKMFYFGLDSGD
                     QLSSAIALPIKRLVYLIYENTFFLGFFWKHSPTPTPKELFATSNIAFFVIYLCIFFGM
                     ALVGSARSLSARLAEIDKEIENELIRESVKGNVPRRRQEIQEQVSVPKPGRLSQFHTL
                     YLAPIVAGVVVLVIAKISGLG"
     misc_feature    complement(85481..85978)
                     /locus_tag="Hneap_0088"
                     /note="YniB-like protein; Region: YniB; pfam14002"
                     /db_xref="CDD:206172"
     gene            complement(86050..86634)
                     /locus_tag="Hneap_0089"
                     /db_xref="GeneID:8533202"
     CDS             complement(86050..86634)
                     /locus_tag="Hneap_0089"
                     /inference="similar to AA sequence:KEGG:BMULJ_02360"
                     /note="KEGG: bmj:BMULJ_02360 predicted ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_003262001.1"
                     /db_xref="GI:261854718"
                     /db_xref="GeneID:8533202"
                     /translation="MSSQEFYVITGASGAGKSTLIAALDDLGYSTIPEAALAFMREQL
                     ECNGRILPATDRTAFMESVLARSIQDYEAAKSLDAPVFFDRGIPEWLRFLEPSEPNCR
                     IAAECRYASTVFVAEPWPEIYVCDHERTHSYDRAAKSYVPTISAYLQSGYEACVLPKV
                     TVRERVAFVLAQVGAGAQQAAAADRHPATRPAGG"
     misc_feature    complement(<86563..86622)
                     /locus_tag="Hneap_0089"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cd00267"
                     /db_xref="CDD:213179"
     misc_feature    complement(86140..86619)
                     /locus_tag="Hneap_0089"
                     /note="AAA domain; Region: AAA_28; pfam13521"
                     /db_xref="CDD:257841"
     misc_feature    complement(86581..86604)
                     /locus_tag="Hneap_0089"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(86578..86586,86590..86595))
                     /locus_tag="Hneap_0089"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     gene            complement(86936..87046)
                     /locus_tag="Hneap_0090"
                     /db_xref="GeneID:8533203"
     CDS             complement(86936..87046)
                     /locus_tag="Hneap_0090"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262002.1"
                     /db_xref="GI:261854719"
                     /db_xref="GeneID:8533203"
                     /translation="MRSQSFLYFAPNITLNPTAHPLRGWVPSALRATAAG"
     gene            complement(87208..87318)
                     /locus_tag="Hneap_0091"
                     /db_xref="GeneID:8533204"
     CDS             complement(87208..87318)
                     /locus_tag="Hneap_0091"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262003.1"
                     /db_xref="GI:261854720"
                     /db_xref="GeneID:8533204"
                     /translation="MRSQSFLYFVPNITLNPTAHPLRGRVPSARRAPAAG"
     gene            complement(87553..87843)
                     /locus_tag="Hneap_0092"
                     /db_xref="GeneID:8533205"
     CDS             complement(87553..87843)
                     /locus_tag="Hneap_0092"
                     /inference="protein motif:PFAM:PF07045"
                     /note="PFAM: protein of unknown function DUF1330;
                     KEGG: ttu:TERTU_1786 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262004.1"
                     /db_xref="GI:261854721"
                     /db_xref="InterPro:IPR010753"
                     /db_xref="GeneID:8533205"
                     /translation="MNAYLILDISINDFESFKGYIEKIPAFIQKHDGRYVIQGVEPEV
                     MEGDWKPERVVVIEFPTKEGAKGFLNDPDAQALFDIRHKSTTSKLILAEGCL"
     misc_feature    complement(87562..87843)
                     /locus_tag="Hneap_0092"
                     /note="Protein of unknown function (DUF1330); Region:
                     DUF1330; cl02288"
                     /db_xref="CDD:261234"
     gene            complement(87840..88214)
                     /locus_tag="Hneap_0093"
                     /db_xref="GeneID:8533206"
     CDS             complement(87840..88214)
                     /locus_tag="Hneap_0093"
                     /inference="protein motif:PFAM:PF00903"
                     /note="PFAM: glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: bmr:BMI_I1921 glyoxalase family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_003262005.1"
                     /db_xref="GI:261854722"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="GeneID:8533206"
                     /translation="MIIDHIGMAISDYDKSKKFYSKALAPLGIGLVAEVQGWAGFGKD
                     GKPEFWFGVHEKIQNPMHIAFSAVSREEVNKFYEAAILAGAKDNGKPGVREIYHPNYY
                     GAFVIDPDGHNIEAVCHAEENK"
     misc_feature    complement(87861..88208)
                     /locus_tag="Hneap_0093"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_19; cd07262"
                     /db_xref="CDD:176683"
     gene            complement(88585..89196)
                     /locus_tag="Hneap_0094"
                     /db_xref="GeneID:8533207"
     CDS             complement(88585..89196)
                     /locus_tag="Hneap_0094"
                     /inference="similar to AA sequence:KEGG:Dole_2141"
                     /note="KEGG: dol:Dole_2141 cation efflux protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cation efflux protein"
                     /protein_id="YP_003262006.1"
                     /db_xref="GI:261854723"
                     /db_xref="GeneID:8533207"
                     /translation="MSDCGCGAEQAEKLERTTLAYLLSINGVMFVVEAALGFYAQSTG
                     LIADSLDMLADATVYGISLYVVGKGISQQAKAASVSGVLQIILGLGVLFEVVRRSLYG
                     SEPQSMLIMAVGLLALIANVACLMLISKHRDGGVHMRASWIFSTNDVIANVGVICSGA
                     LVWLLGSRYPDLVIGAIISAVVVRGGIKILKDAKATKSQEIVT"
     misc_feature    complement(<88615..89169)
                     /locus_tag="Hneap_0094"
                     /note="Co/Zn/Cd efflux system component [Inorganic ion
                     transport and metabolism]; Region: CzcD; COG1230"
                     /db_xref="CDD:224151"
     gene            complement(89303..89722)
                     /locus_tag="Hneap_0095"
                     /db_xref="GeneID:8533208"
     CDS             complement(89303..89722)
                     /locus_tag="Hneap_0095"
                     /inference="protein motif:PFAM:PF00583"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: cte:CT1841 acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_003262007.1"
                     /db_xref="GI:261854724"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:8533208"
                     /translation="MVGELLAEIMNAIGVQAFNFDLAETTSRLQDFLNREKYFVFVAR
                     GVSGNPAGFIALYESYALYAEGTFGTIPELYVRPDYRTNGLGLRLVSQAKSFGAARGW
                     KRLEVTTPPLPQFDRTLAFYEREGFAISGGRKLKVSL"
     misc_feature    complement(89342..89707)
                     /locus_tag="Hneap_0095"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    complement(89399..89605)
                     /locus_tag="Hneap_0095"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(89462..89467,89495..89503))
                     /locus_tag="Hneap_0095"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(90138..90461)
                     /locus_tag="Hneap_0096"
                     /db_xref="GeneID:8533209"
     CDS             complement(90138..90461)
                     /locus_tag="Hneap_0096"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262008.1"
                     /db_xref="GI:261854725"
                     /db_xref="GeneID:8533209"
                     /translation="MSDNEIQAQGSSMSLRKSIGIYAAFLAVFIILVNLSFSTTWFPG
                     VIAFFAYLVFGFLLNRIVLRGLIEWHPMYNTIENVSSAKLSSFLLWPISYAGLFFRLA
                     VNKVL"
     gene            complement(90867..91082)
                     /locus_tag="Hneap_0097"
                     /db_xref="GeneID:8533210"
     CDS             complement(90867..91082)
                     /locus_tag="Hneap_0097"
                     /inference="similar to AA sequence:KEGG:Ping_1936"
                     /note="KEGG: pin:Ping_1936 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262009.1"
                     /db_xref="GI:261854726"
                     /db_xref="GeneID:8533210"
                     /translation="MEIILASTLTCPECGHKETETMPTDSCQWFYECKGCGVLLKPKK
                     GDCCVFCSYGSVPCPPIQQGTGSCCSS"
     misc_feature    complement(<90990..>91055)
                     /locus_tag="Hneap_0097"
                     /note="leucyl-tRNA synthetase; Validated; Region: leuS;
                     PRK00390"
                     /db_xref="CDD:234743"
     gene            complement(91085..91495)
                     /locus_tag="Hneap_0098"
                     /db_xref="GeneID:8533211"
     CDS             complement(91085..91495)
                     /locus_tag="Hneap_0098"
                     /inference="similar to AA sequence:KEGG:Sfri_3489"
                     /note="KEGG: sfr:Sfri_3489  mercury transporter MerC"
                     /codon_start=1
                     /transl_table=11
                     /product="mercury transporter MerC"
                     /protein_id="YP_003262010.1"
                     /db_xref="GI:261854727"
                     /db_xref="InterPro:IPR004891"
                     /db_xref="GeneID:8533211"
                     /translation="MRLTAISEKLGSLGAIVSAMGCASCFPVLGSLGATIGLGFLAKF
                     EGLFINTLLPIFAVIALVSVAISWWSHRQHIRGILGVAGPAMVLATLYLFWTDSWSTY
                     MFYFALALMFAVGVWDIVSPPNKKCAIPISSSEG"
     misc_feature    complement(91112..91495)
                     /locus_tag="Hneap_0098"
                     /note="putative mercury transport protein MerC;
                     Provisional; Region: PRK13755"
                     /db_xref="CDD:237490"
     gene            complement(91540..91896)
                     /locus_tag="Hneap_0099"
                     /db_xref="GeneID:8533212"
     CDS             complement(91540..91896)
                     /locus_tag="Hneap_0099"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262011.1"
                     /db_xref="GI:261854728"
                     /db_xref="GeneID:8533212"
                     /translation="MLNLLYGLWLESPPIRAPGFIAALVVAGLGGYLCFAKVRVKAWN
                     VFSKSLAVAFCCFVILLIFAIIGILVVSTGILGMARSWASFGDAYVWGVFSLPLLAFF
                     LSLGSFALTNHSRATR"
     gene            complement(91913..92266)
                     /locus_tag="Hneap_0100"
                     /db_xref="GeneID:8533213"
     CDS             complement(91913..92266)
                     /locus_tag="Hneap_0100"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: amr:AM1_1549 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262012.1"
                     /db_xref="GI:261854729"
                     /db_xref="GeneID:8533213"
                     /translation="MSAADQKTLKDAAMADIRLVEEILRRWDPIGVEPGIVAPADEYD
                     SYAPHIVSMAKSGCTVKALAAHLEHLGSDTMGLGSSNELSRSHSLKFAAEILVALQPS
                     NNSLKSDAAKPRTLG"
     gene            complement(92363..93529)
                     /locus_tag="Hneap_0101"
                     /db_xref="GeneID:8533214"
     CDS             complement(92363..93529)
                     /locus_tag="Hneap_0101"
                     /inference="similar to AA sequence:KEGG:Nham_0140"
                     /note="KEGG: nha:Nham_0140 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262013.1"
                     /db_xref="GI:261854730"
                     /db_xref="GeneID:8533214"
                     /translation="MNLPNDIDSLRERVQKILDPIVSAVDKGTKAEKDFLFTASRTDA
                     GRGLPSYYLVYFLFVDLLGYKNLGQFEKVAWSVPIDYNGTAYLLEHRKMGMGLFAADK
                     EKQEGECQEIVKKIKKAAKAAQPYFEWIANEAAKQSKLNVLNHSLRLHDRYSFLESEH
                     KKKLEEAISRKDERIKTQHSENSWSVRMPYYELKRESEWLALSAIDAFYSFTEHVFIH
                     AAILKGHLLTGEDVANLADKDWASKFKACLDVQENSVKPHYDKLVAIKRQIRNYMAHG
                     AFGKNGEAFQIHSGAGAVPLLMPHQKGSSRFSMQSGTEFQEEEAISAIEEFMRFYWES
                     NDFPEVMYIKSTLPSILTYASDATYKNAMASTEDMESFVDYLIGVHDRAGDMDW"
     gene            93675..94408
                     /locus_tag="Hneap_0102"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:8533215"
     gene            94568..95170
                     /locus_tag="Hneap_0103"
                     /db_xref="GeneID:8533216"
     CDS             94568..95170
                     /locus_tag="Hneap_0103"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: methyltransferase type 11;
                     KEGG: tgr:Tgr7_2760 tellurite resistance protein TehB"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_003262014.1"
                     /db_xref="GI:261854731"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="GeneID:8533216"
                     /translation="MSEFWNQKYARDDYFYGEQPNDFLHSQIFRLPTGARVLVVGDGE
                     GRNGVWLAEQGFTVTTVDGSHVGCDKSRALAAQRKVSLEIVCADLLTWDWPVGAFDAV
                     VSVFLHFSPDERKVAHARIQAALVHGGWLIIEQFHPNQLNGYTSGGPKAVDMLTTMGD
                     LADDFNAIDWWLLAEGTTRLEEGPGHSGLGYVSHGVGRRQ"
     misc_feature    94574..>94753
                     /locus_tag="Hneap_0103"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     misc_feature    94673..94978
                     /locus_tag="Hneap_0103"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(94685..94705,94751..94756,94826..94834,94880..94882)
                     /locus_tag="Hneap_0103"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(95561..98821)
                     /locus_tag="Hneap_0104"
                     /db_xref="GeneID:8533217"
     CDS             complement(95561..98821)
                     /locus_tag="Hneap_0104"
                     /inference="protein motif:PFAM:PF00176"
                     /note="PFAM: SNF2-related protein; zinc finger SWIM domain
                     protein; helicase;
                     SMART: DEAD-like helicase ; helicase domain protein;
                     KEGG: dar:Daro_3870 SNF2-related:helicase, C-terminal:SWIM
                     Zn-finger"
                     /codon_start=1
                     /transl_table=11
                     /product="SNF2-like protein"
                     /protein_id="YP_003262015.1"
                     /db_xref="GI:261854732"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007527"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:8533217"
                     /translation="MTRPIHLPFTLADITDYFGAHEIKKAEPYARHAVQLMHVENGYI
                     NAEVQGTVRTPYDVHINFYHDTDGKVFFDAECSCPVGYQCKHAAATLIAALNNHQHTI
                     PGVSAQTLAWLDQWRQSTTNAAKAMKEMLVYLLKPPSGRELLAKVYLNKVRVGKEGPI
                     LESAKTWYNIDGALRKPPRFVQQVDRSILHLINDQPFGFGYNGFSLENDLGEMALDLM
                     CDTGRLYIERNHTPLKRGADRAARLQWRREGDTLHPELVAEPEAKLFALSAFWYLDAH
                     TGEVGRLSTAEDPSKIKHLLSIPPVTEQALPLVATVLAESAPDLAPPIQSEATATAID
                     IAPTPVLSLHTLAARRINPYRSYDRKIDGFDVAEFAFDYDGVRVGLDDCSGLSQDARG
                     HWVFIKRQADDEARWARQLRKHGLTRIPANVLDDARALYGLENEAAWVEFMTEALPKL
                     RAAGWLVEIPDDFRHVWHEPQGWDATVNEEGAGWFDLDLGVLIDGQRLSLTPMLSELF
                     AREPRWLDSSYIDEQPDDASVILHSHENLRIRVEAGRIKTIVRQLIDLFDRPQGDSLR
                     LHTLDATRLETLPEDMRPNESIHALEVARRIRSAGAAVAVEAPEGLGIELRGYQREGL
                     GWLSHLRTLGVGGILADDMGLGKTAQTLAFLLREKQQGRLGHPALIVLPTSLIFNWRH
                     EAKHITPALRVLTLHGANRSALFDQISKHDIVLSTYPLVWRDIEALEQHTWSQLILDE
                     AQTVKNASSQAAQAIRRIKSEHRLSLTGTPMENHLGELWAQFDFLLPGFLGDKTAFTR
                     AFRTPIEKHGDTIRRDLLARRLRPFLLRRRKEDVAAELPPKTSIIRSVSLEGAQRDLY
                     ETVRSAMDEKVRQSIDSMGLARSHIVILDALLKLRQVCCDPRLLPSSKTGQSAKRPTQ
                     SAKLDLLLTMLPELVDEGRRILVFSQFTSMLALISEALTKAKLAHSMLTGETRDRETV
                     VRQFQNGDTPVFLISLKAGGVGLNLTAADTVIHYDPWWNPAAEDQATDRAHRIGQTRQ
                     VFVYKLVTEGSIEEKILALQDKKAKLAEGVLSGDGSAFTKFSEVDIQALMAPLPRD"
     misc_feature    complement(98540..98656)
                     /locus_tag="Hneap_0104"
                     /note="SWIM zinc finger; Region: SWIM; pfam04434"
                     /db_xref="CDD:252595"
     misc_feature    complement(96122..96967)
                     /locus_tag="Hneap_0104"
                     /note="SNF2 family N-terminal domain; Region: SNF2_N;
                     pfam00176"
                     /db_xref="CDD:249654"
     misc_feature    complement(96512..96916)
                     /locus_tag="Hneap_0104"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(96878..96892)
                     /locus_tag="Hneap_0104"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(96596..96607)
                     /locus_tag="Hneap_0104"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(95720..96091)
                     /locus_tag="Hneap_0104"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(95852..95860,95936..95941,95993..96004))
                     /locus_tag="Hneap_0104"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(95750..95752,95759..95761,95771..95773,
                     95834..95836))
                     /locus_tag="Hneap_0104"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            99273..99587
                     /locus_tag="Hneap_0105"
                     /db_xref="GeneID:8533218"
     CDS             99273..99587
                     /locus_tag="Hneap_0105"
                     /inference="protein motif:PFAM:PF04023"
                     /note="PFAM: FeoA family protein;
                     KEGG: ava:Ava_B0167 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FeoA family protein"
                     /protein_id="YP_003262016.1"
                     /db_xref="GI:261854733"
                     /db_xref="InterPro:IPR007167"
                     /db_xref="GeneID:8533218"
                     /translation="MLALSQLLSRSEIPAMPHTSSQHNPARSASFGIGLAARGSRVRV
                     VGLTGEHPALAKRLEGMGIHAGSELEILQREGGALIVRIGSSRVALGTGMVHKILVTA
                     QS"
     misc_feature    99387..99572
                     /locus_tag="Hneap_0105"
                     /note="FeoA domain; Region: FeoA; pfam04023"
                     /db_xref="CDD:252322"
     gene            99584..99838
                     /locus_tag="Hneap_0106"
                     /db_xref="GeneID:8533219"
     CDS             99584..99838
                     /locus_tag="Hneap_0106"
                     /inference="protein motif:PFAM:PF04023"
                     /note="PFAM: FeoA family protein;
                     KEGG: mag:amb2732 ferrous iron transporter A"
                     /codon_start=1
                     /transl_table=11
                     /product="FeoA family protein"
                     /protein_id="YP_003262017.1"
                     /db_xref="GI:261854734"
                     /db_xref="InterPro:IPR007167"
                     /db_xref="GeneID:8533219"
                     /translation="MTTNVQITLLDLKPGDVGVVKGFAPGNADYRRRLMAMGLTPGTR
                     FTVTRLAPLGDPIQLQVRNFALTLRKDEACLLRIERADAS"
     misc_feature    99602..99823
                     /locus_tag="Hneap_0106"
                     /note="FeoA domain; Region: FeoA; pfam04023"
                     /db_xref="CDD:252322"
     gene            99908..102244
                     /locus_tag="Hneap_0107"
                     /db_xref="GeneID:8533220"
     CDS             99908..102244
                     /locus_tag="Hneap_0107"
                     /inference="protein motif:TFAM:TIGR00437"
                     /note="TIGRFAM: ferrous iron transporter B; small
                     GTP-binding protein;
                     PFAM: Ferrous iron transporter B domain protein;
                     GTP-binding protein HSR1-related; nucleoside recognition
                     domain protein; Ferrous iron transport B domain protein;
                     KEGG: rru:Rru_A2470 ferrous iron transporter B"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron transporter B"
                     /protein_id="YP_003262018.1"
                     /db_xref="GI:261854735"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR003373"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR011619"
                     /db_xref="InterPro:IPR011640"
                     /db_xref="InterPro:IPR011642"
                     /db_xref="GeneID:8533220"
                     /translation="MATFTVGLIGNPNCGKTTLFNALTGLRQKVGNWPGVTVDRKVGT
                     FDVGADRVELVDLPGTYSLDAASSASLDEAIAREYALSGEADVIINILDASNLERNLY
                     LTTQLLEMRVPLILAVNMLDLAEEAGIHIDFAALEQRIGCPVVPITAAKKQGLDELKR
                     RLVERAAHADEPGIKIEYAALIETALRELKPKIEPVAAAQNIDPRWMGVKLLESDRLT
                     LATIDDSLRTDVEAAQEKIRAHLDEEADVFIADARYTFIHQLTSASVTQRGQLRRSLT
                     DRIDAIVLNRFLGIPIFLLMMYLLFVMSFNGGSIFLDFFDQATHTIFVSGFAHVLQLV
                     HAPDWLITFLATSVGGAIQLVSTFIAPIGMTFLFLSLLEDSGYMARAAFVMDRFMRKI
                     GLPGKAFVPMIVGFGCNVPAVMATRTLEDPRERLISALMQPFMSCSARLVIYMAFVAV
                     FFRENGGQIVFALYVLGIVLAILTALLLKKTALRGEATPFIMELPTYHVPTLRGLLLT
                     TWERLSVFILRVGKVIIVASVIVTLLSSFSTSGKPLGEGEVGDSILGSIGKTITPVFH
                     PMGITDENWPAAVGLLSGVVVKEIVMGTLNGVYTRMDAGDAAKAAADEPKPKTFDFWG
                     GLAAAVQTIPDNAKAFAKGFFDPLGFGQVEQTQQSNLQQAAAQQDLDATTLSRMGNLF
                     TTSAAIAYLIFILLYIPCVNTMAAIYRETRSRAWTLFAIVWGIGLAYGLAVLFYQFAN
                     FNAHPMQSLVWLVVILAALIAVIVALKRNGQRLVHVPH"
     misc_feature    99908..102226
                     /locus_tag="Hneap_0107"
                     /note="ferrous iron transport protein B; Reviewed; Region:
                     feoB; PRK09554"
                     /db_xref="CDD:236563"
     misc_feature    99929..100408
                     /locus_tag="Hneap_0107"
                     /note="Ferrous iron transport protein B (FeoB) family;
                     Region: FeoB; cd01879"
                     /db_xref="CDD:206667"
     misc_feature    99935..99958
                     /locus_tag="Hneap_0107"
                     /note="G1 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    order(99944..99946,99950..99961,100262..100267,
                     100271..100273,100349..100357)
                     /locus_tag="Hneap_0107"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206667"
     misc_feature    100013..100027
                     /locus_tag="Hneap_0107"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206667"
     misc_feature    100016..100018
                     /locus_tag="Hneap_0107"
                     /note="G2 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    100073..100084
                     /locus_tag="Hneap_0107"
                     /note="G3 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    order(100082..100096,100106..100147,100157..100162)
                     /locus_tag="Hneap_0107"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206667"
     misc_feature    100262..100273
                     /locus_tag="Hneap_0107"
                     /note="G4 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    100349..100357
                     /locus_tag="Hneap_0107"
                     /note="G5 box; other site"
                     /db_xref="CDD:206667"
     misc_feature    100976..101251
                     /locus_tag="Hneap_0107"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:254346"
     misc_feature    101282..101443
                     /locus_tag="Hneap_0107"
                     /note="Ferrous iron transport protein B C terminus;
                     Region: FeoB_C; pfam07664"
                     /db_xref="CDD:254341"
     misc_feature    101462..>101704
                     /locus_tag="Hneap_0107"
                     /note="Nucleoside recognition; Region: Gate; pfam07670"
                     /db_xref="CDD:254346"
     gene            102268..102612
                     /locus_tag="Hneap_0108"
                     /db_xref="GeneID:8533221"
     CDS             102268..102612
                     /locus_tag="Hneap_0108"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: rsq:Rsph17025_3856 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262019.1"
                     /db_xref="GI:261854736"
                     /db_xref="GeneID:8533221"
                     /translation="MNSSRLLTPSQLKAYLKFRGTAPLRDVLLHFDAAPSAVLHLLAF
                     WRERGHIRQIAVTPAVCDKGCGGCGSGDVCTPDPHEYDLIEWVESSASPVCFDVLSDY
                     DEAWKPGSPHGV"
     misc_feature    102295..102489
                     /locus_tag="Hneap_0108"
                     /note="FeoC like transcriptional regulator; Region: FeoC;
                     pfam09012"
                     /db_xref="CDD:255143"
     gene            complement(102736..103629)
                     /locus_tag="Hneap_0109"
                     /db_xref="GeneID:8533222"
     CDS             complement(102736..103629)
                     /locus_tag="Hneap_0109"
                     /inference="protein motif:PFAM:PF00226"
                     /note="PFAM: heat shock protein DnaJ; chaperone DnaJ
                     domain protein;
                     SMART: heat shock protein DnaJ;
                     KEGG: tgr:Tgr7_2956 heat shock protein DnaJ
                     domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein DnaJ"
                     /protein_id="YP_003262020.1"
                     /db_xref="GI:261854737"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR003095"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="GeneID:8533222"
                     /translation="MKFHDYYATLGVERTATQAEIKKAYRKAAQKYHPDRNKEAGAEE
                     KFKEINEAYDVLGDEEKRQRYDTLGSNYRAGEDFRPPPGFDPNQFGDQYGGAGFSDFF
                     SSIFGGGFDPGAAHGGRRTRAARGPDYEMALSLSVQEMIEGGSKSVTTDHPETGRKTL
                     KVTIPKGSTPGKRMRLTGQGGSGANGGPAGDLYLVFQLEANSLFTLDGNDVLYNLPVT
                     PWEAALGEKVTVPTPTGGKISMTIPAGSQSGSRLRVRGRGLAGGDYFVTVMIHTPPAK
                     TDEARDFYREMKASMPFNPRD"
     misc_feature    complement(102760..103617)
                     /locus_tag="Hneap_0109"
                     /note="chaperone protein DnaJ; Region: DnaJ_bact;
                     TIGR02349"
                     /db_xref="CDD:233829"
     misc_feature    complement(103456..103617)
                     /locus_tag="Hneap_0109"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     misc_feature    complement(order(103477..103482,103489..103494,
                     103501..103503,103525..103533))
                     /locus_tag="Hneap_0109"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     misc_feature    complement(102811..103251)
                     /locus_tag="Hneap_0109"
                     /note="C-terminal substrate binding domain of DnaJ and
                     HSP40; Region: DnaJ_C; cd10747"
                     /db_xref="CDD:199909"
     misc_feature    complement(order(103087..103089,103159..103161,
                     103177..103194,103237..103239))
                     /locus_tag="Hneap_0109"
                     /note="substrate binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199909"
     misc_feature    complement(order(102811..102816,102886..102897,
                     102958..102963,102970..102975))
                     /locus_tag="Hneap_0109"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:199909"
     gene            complement(103831..103956)
                     /locus_tag="Hneap_0110"
                     /db_xref="GeneID:8533223"
     CDS             complement(103831..103956)
                     /locus_tag="Hneap_0110"
                     /inference="protein motif:TFAM:TIGR01022"
                     /note="TIGRFAM: ribosomal protein L36;
                     KEGG: tcx:Tcr_1270 ribosomal protein L36"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="YP_003262021.1"
                     /db_xref="GI:261854738"
                     /db_xref="InterPro:IPR000473"
                     /db_xref="GeneID:8533223"
                     /translation="MKILSSLKSAKTRHKDCQIVRRRGKVYVINKTNPRFKARQR"
     misc_feature    complement(103834..103956)
                     /locus_tag="Hneap_0110"
                     /note="50S ribosomal protein L36; Validated; Region: rpmJ;
                     PRK00831"
                     /db_xref="CDD:179138"
     gene            complement(104152..104227)
                     /locus_tag="Hneap_R0001"
                     /note="tRNA-Phe1"
                     /db_xref="GeneID:8533224"
     tRNA            complement(104152..104227)
                     /locus_tag="Hneap_R0001"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:8533224"
     gene            104375..104971
                     /locus_tag="Hneap_0111"
                     /db_xref="GeneID:8533225"
     CDS             104375..104971
                     /locus_tag="Hneap_0111"
                     /EC_number="4.2.1.19"
                     /inference="protein motif:PRIAM:4.2.1.19"
                     /note="PFAM: imidazoleglycerol-phosphate dehydratase;
                     KEGG: dar:Daro_3382 imidazoleglycerol-phosphate
                     dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="YP_003262022.1"
                     /db_xref="GI:261854739"
                     /db_xref="InterPro:IPR000807"
                     /db_xref="InterPro:IPR020565"
                     /db_xref="GeneID:8533225"
                     /translation="MMPARTAEITRDTAETQIELRINLDGSGRAEFKTGVPFFEHMLD
                     QIARHGLIDMDLTAQGDLHIDDHHTVEDCGIVFGQALAKAVGDKRGITRYGHAYVPLD
                     EALSRVVIDLSGRPGLVFSCSFTRASIGRFETQLVEEFFRGLVNHAGMTLHIDNIRGD
                     NAHHQAETIFKAFGRALRMALSPDPRQADQIPSTKGSL"
     misc_feature    104393..104968
                     /locus_tag="Hneap_0111"
                     /note="Imidazoleglycerol-phosphate dehydratase; Region:
                     IGPD; cd07914"
                     /db_xref="CDD:153419"
     misc_feature    order(104417..104419,104495..104497,104507..104509,
                     104516..104521,104573..104578,104585..104587,
                     104651..104653,104675..104680,104717..104719,
                     104789..104791,104861..104866,104873..104875)
                     /locus_tag="Hneap_0111"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:153419"
     misc_feature    order(104483..104488,104495..104497,104561..104569,
                     104573..104578,104750..104764,104771..104773,
                     104777..104779,104786..104791,104852..104866)
                     /locus_tag="Hneap_0111"
                     /note="4-fold oligomerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:153419"
     misc_feature    order(104495..104497,104573..104578,104585..104587,
                     104789..104791,104861..104866,104873..104875)
                     /locus_tag="Hneap_0111"
                     /note="metal binding residues [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153419"
     misc_feature    order(104648..104650,104654..104656,104660..104668,
                     104672..104680,104684..104689,104699..104707,
                     104717..104719,104723..104725,104825..104827,
                     104831..104833,104837..104839,104843..104845,
                     104897..104899,104906..104908,104924..104926)
                     /locus_tag="Hneap_0111"
                     /note="3-fold/trimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:153419"
     gene            104974..105624
                     /locus_tag="Hneap_0112"
                     /db_xref="GeneID:8533226"
     CDS             104974..105624
                     /locus_tag="Hneap_0112"
                     /inference="protein motif:TFAM:TIGR01855"
                     /note="TIGRFAM: imidazole glycerol phosphate synthase,
                     glutamine amidotransferase subunit;
                     PFAM: glutamine amidotransferase class-I;
                     KEGG: tgr:Tgr7_0214 imidazole glycerol phosphate synthase,
                     glutamine amidotransferase subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase, glutamine
                     amidotransferase subunit"
                     /protein_id="YP_003262023.1"
                     /db_xref="GI:261854740"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR010139"
                     /db_xref="InterPro:IPR011702"
                     /db_xref="GeneID:8533226"
                     /translation="MAEAIAIVDYGMGNLRSVAKAVAHVAPAGTEVRITDSAEYILSA
                     DRVVFPGQGAAADCMAALKSRDLIAPLTEAAKTRPFLGICMGMQVMLDHSDENGGVHL
                     LAWFKGAVQRFPAGVDASGLALKIPQMGWNEIRQVRPHPLWHGVADMSRFYFVHSYYC
                     APEDASLTVGETEYGLRYTAALARGSVFAIQSHPEKSADDGLTLLKNFTRWDGRFD"
     misc_feature    104986..105597
                     /locus_tag="Hneap_0112"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in imidazole glycerol phosphate synthase (IGPS);
                     Region: GATase1_IGP_Synthase; cd01748"
                     /db_xref="CDD:153219"
     misc_feature    104986..105591
                     /locus_tag="Hneap_0112"
                     /note="imidazole glycerol phosphate synthase subunit HisH;
                     Provisional; Region: hisH; PRK13142"
                     /db_xref="CDD:171871"
     misc_feature    order(105109..105132,105217..105231,105550..105552,
                     105556..105558)
                     /locus_tag="Hneap_0112"
                     /note="putative active site [active]"
                     /db_xref="CDD:153219"
     misc_feature    105109..105132
                     /locus_tag="Hneap_0112"
                     /note="oxyanion strand; other site"
                     /db_xref="CDD:153219"
     misc_feature    order(105223..105225,105550..105552,105556..105558)
                     /locus_tag="Hneap_0112"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153219"
     gene            105661..106416
                     /locus_tag="Hneap_0113"
                     /db_xref="GeneID:8533227"
     CDS             105661..106416
                     /locus_tag="Hneap_0113"
                     /EC_number="5.3.1.16"
                     /inference="protein motif:TFAM:TIGR00007"
                     /note="KEGG: tgr:Tgr7_0215
                     phosphoribosylformimino-5-aminoimidazole carboxamide
                     ribotide isomerase;
                     TIGRFAM: phosphoribosylformimino-5-aminoimidazole
                     carboxamide ribotide isomerase;
                     PFAM: histidine biosynthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformimino-5-aminoimidazole
                     carboxamide ribotide isomerase"
                     /protein_id="YP_003262024.1"
                     /db_xref="GI:261854741"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR006063"
                     /db_xref="GeneID:8533227"
                     /translation="MLLIPAIDLKAGQCVRLKQGRMDDDTVFSDDPVAMAQRWVDAGA
                     RRLHLVDLDGAFAGSPKNRESIAAICAAFPELPIQVGGGIREEETIEQYLAMGVSYVI
                     IGSKAVSDPHFVSDACLSFPGHVIVGLDARDGKVAIDGWAKTSNTDATDLARRFEQDG
                     VSSIVFTDIARDGMMQGANMEATRALARAVRIPIIASGGMTDMADIDRLIDAADDGVA
                     GAIIGRALYEGGIDLGMAQSRVDARCGVPPFTE"
     misc_feature    105664..106374
                     /locus_tag="Hneap_0113"
                     /note="HisA.  Phosphoribosylformimino-5-aminoimidazole
                     carboxamide ribonucleotide (ProFAR) isomerase catalyzes
                     the fourth step in histidine biosynthesis, an
                     isomerisation of the aminoaldose moiety of ProFAR to the
                     aminoketose of PRFAR (N-(5'-phospho-D-1...; Region: HisA;
                     cd04732"
                     /db_xref="CDD:240083"
     misc_feature    order(105682..105684,105802..105804,106048..106050)
                     /locus_tag="Hneap_0113"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:240083"
     gene            106496..107269
                     /locus_tag="Hneap_0114"
                     /db_xref="GeneID:8533228"
     CDS             106496..107269
                     /locus_tag="Hneap_0114"
                     /inference="protein motif:TFAM:TIGR00735"
                     /note="TIGRFAM: imidazoleglycerol phosphate synthase,
                     cyclase subunit;
                     PFAM: histidine biosynthesis protein;
                     KEGG: tgr:Tgr7_0216 imidazoleglycerol phosphate synthase,
                     cyclase subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Imidazole glycerol phosphate synthase cyclase
                     subunit"
                     /protein_id="YP_003262025.1"
                     /db_xref="GI:261854742"
                     /db_xref="InterPro:IPR004651"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR018313"
                     /db_xref="GeneID:8533228"
                     /translation="MSLAKRIIPCLDVADGRVVKGIQFESLRDAGDPVEAARRYNLEG
                     ADELTFLDISASHEGRDTMRHVVEQVAEEVFIPLTVGGGIRALADVRSLLNAGADKVS
                     INTAAVFNPDLIKEIADSIGAQCLVVAIDARRVSQPGEPLRWEIFTHGGRKPTGLDAV
                     EWANRMAEYGAGELLVTSMDRDGTKQGFDLELTRAIADSVPVPVIASGGVGNLDDLTA
                     GILQGHADAVLAASIFHFGTYRISEAKANMAAAGIEVRQ"
     misc_feature    106508..107248
                     /locus_tag="Hneap_0114"
                     /note="The cyclase subunit of imidazoleglycerol phosphate
                     synthase (HisF). Imidazole glycerol phosphate synthase
                     (IGPS) catalyzes the fifth step of histidine biosynthesis,
                     the formation of the imidazole ring. IGPS converts
                     N1-(5'-phosphoribulosyl)...; Region: HisF; cd04731"
                     /db_xref="CDD:240082"
     misc_feature    order(106553..106555,106646..106648,106742..106744,
                     106805..106810,106880..106882,106886..106888,
                     106943..106945,107024..107026,107039..107044,
                     107114..107122,107186..107191)
                     /locus_tag="Hneap_0114"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240082"
     misc_feature    order(106616..106618,106631..106633,106697..106699,
                     106709..106711,106718..106720,106724..106726,
                     106781..106783,106790..106795,106865..106867,
                     107012..107014,107096..107098,107171..107173)
                     /locus_tag="Hneap_0114"
                     /note="glutamase interaction surface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:240082"
     gene            107266..107676
                     /locus_tag="Hneap_0115"
                     /db_xref="GeneID:8533229"
     CDS             107266..107676
                     /locus_tag="Hneap_0115"
                     /EC_number="3.5.4.19"
                     /inference="protein motif:PRIAM:3.5.4.19"
                     /note="PFAM: phosphoribosyl-AMP cyclohydrolase;
                     KEGG: eba:ebB39 phosphoribosyl-AMP cyclohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-AMP cyclohydrolase"
                     /protein_id="YP_003262026.1"
                     /db_xref="GI:261854743"
                     /db_xref="InterPro:IPR002496"
                     /db_xref="GeneID:8533229"
                     /translation="MTVPLWIDAVQWTDDGLVPAIAQDAQTGRILMFAWMNRVALEQT
                     VSTGEAVYFSRSRQRLWHKGEESGHVQRVQEIRLDCDGDVILLQIEQIGGIACHTGRE
                     SCFFRRLVDGQWQITDPVLKSPGEIYGEGAHGHE"
     misc_feature    107275..107652
                     /locus_tag="Hneap_0115"
                     /note="phosphoribosyl-AMP cyclohydrolase; Reviewed;
                     Region: hisI; PRK00051"
                     /db_xref="CDD:234598"
     gene            107663..108037
                     /locus_tag="Hneap_0116"
                     /db_xref="GeneID:8533230"
     CDS             107663..108037
                     /locus_tag="Hneap_0116"
                     /inference="protein motif:TFAM:TIGR03188"
                     /note="TIGRFAM: phosphoribosyl-ATP diphosphatase;
                     PFAM: phosphoribosyl-ATP pyrophosphohydrolase;
                     KEGG: mfa:Mfla_0256 phosphoribosyl-ATP pyrophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP diphosphatase"
                     /protein_id="YP_003262027.1"
                     /db_xref="GI:261854744"
                     /db_xref="InterPro:IPR008179"
                     /db_xref="GeneID:8533230"
                     /translation="MATNNPGELLAQLAAVIEQRKQADPGSSYVAQLFAKGRSKIAQK
                     VGEEGVEVALAAVSGDNVAIVSEMADLWFHSMVLLADAGLSHQAVLDELGERFGLSGL
                     EEKASRPQSIKSGASKTGNHKN"
     misc_feature    107690..107941
                     /locus_tag="Hneap_0116"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) MazG-like domain found in Escherichia coli
                     phosphoribosyl-ATP pyrophosphohydrolase (HisIE or
                     PRATP-PH) and its homologs; Region: NTP-PPase_HisIE_like;
                     cd11534"
                     /db_xref="CDD:212141"
     misc_feature    order(107804..107806,107813..107815,107861..107863,
                     107870..107872)
                     /locus_tag="Hneap_0116"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212141"
     gene            108062..108343
                     /locus_tag="Hneap_0117"
                     /db_xref="GeneID:8533231"
     CDS             108062..108343
                     /locus_tag="Hneap_0117"
                     /inference="protein motif:TFAM:TIGR01411"
                     /note="TIGRFAM: twin-arginine translocation protein,
                     TatA/E family subunit;
                     PFAM: sec-independent translocation protein mttA/Hcf106;
                     KEGG: cti:RALTA_A2864 twin arginine translocase protein A"
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocation protein, TatA/E
                     family subunit"
                     /protein_id="YP_003262028.1"
                     /db_xref="GI:261854745"
                     /db_xref="InterPro:IPR003369"
                     /db_xref="InterPro:IPR006312"
                     /db_xref="GeneID:8533231"
                     /translation="MGSFSIWHWLVILAIVLLLFGTKRLKNLGGDLGSAIKGFKNAVK
                     DEEKKDADTAASEGSKESLSHKEADSSRVIEGEAVRRQNANDESGNKPS"
     misc_feature    108062..108280
                     /locus_tag="Hneap_0117"
                     /note="twin arginine translocase protein A; Provisional;
                     Region: tatA; PRK02958"
                     /db_xref="CDD:235091"
     gene            108390..109016
                     /locus_tag="Hneap_0118"
                     /db_xref="GeneID:8533232"
     CDS             108390..109016
                     /locus_tag="Hneap_0118"
                     /inference="protein motif:TFAM:TIGR01410"
                     /note="TIGRFAM: twin-arginine translocation protein, TatB
                     subunit;
                     PFAM: sec-independent translocation protein mttA/Hcf106;
                     KEGG: tgr:Tgr7_0220 twin-arginine translocation protein,
                     Tatsubunit beta"
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocation protein subunit
                     TatB"
                     /protein_id="YP_003262029.1"
                     /db_xref="GI:261854746"
                     /db_xref="InterPro:IPR003369"
                     /db_xref="InterPro:IPR003998"
                     /db_xref="InterPro:IPR018448"
                     /db_xref="GeneID:8533232"
                     /translation="MFGFSIWEIFLILVIALLVVGPERLPGLARTIGTWVHKIKKFVA
                     NAKAELDSEFNFQDMKDILNSQESEIAKLRALVEETRQEVNESGRQVLGAVDDAEASF
                     RAAAQSEQEVAGAPLKAIDDAAPAEQPVSAENKQAKTGKDADAATGKVKTSAPTSVPL
                     SFDEEIRMLEESSGQAFKRPFAPAEPVDAPSNTADANKPSPDSDSKTS"
     misc_feature    108390..108776
                     /locus_tag="Hneap_0118"
                     /note="sec-independent translocase; Provisional; Region:
                     tatB; PRK00404"
                     /db_xref="CDD:166942"
     misc_feature    108390..108650
                     /locus_tag="Hneap_0118"
                     /note="Sec-independent protein secretion pathway
                     components [Intracellular trafficking and secretion];
                     Region: TatA; COG1826"
                     /db_xref="CDD:224739"
     gene            109013..110113
                     /locus_tag="Hneap_0119"
                     /db_xref="GeneID:8533233"
     CDS             109013..110113
                     /locus_tag="Hneap_0119"
                     /inference="protein motif:TFAM:TIGR00945"
                     /note="TIGRFAM: Sec-independent protein translocase, TatC
                     subunit;
                     PFAM: Sec-independent periplasmic protein translocase;
                     KEGG: tgr:Tgr7_0221 sec-independent protein translocase,
                     TatC subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase subunit
                     TatC"
                     /protein_id="YP_003262030.1"
                     /db_xref="GI:261854747"
                     /db_xref="InterPro:IPR002033"
                     /db_xref="InterPro:IPR019820"
                     /db_xref="InterPro:IPR019822"
                     /db_xref="GeneID:8533233"
                     /translation="MTERDSSPEADKNGLADVVEETGMAGFLGHLVELRNRLLKGVLA
                     VLVLFLILFPFRNELFTMLADPLSRHMPAGSTMIAVEVASPFFIPLKLTALTAVFIAI
                     PFLLYQLWAFIAPGLYKHERKLVAPLVFSSTILFYLGAAFAYFVVFPVVFGFLSTAGP
                     SDVNFAPDIGEYLSFVTSLFFAFGFVFEVPVAIVLLVIVGVVTPDKLAGFRRYAILIA
                     FIIAAILTPPDVLSQFMMALPIIMLYEFGLFVSRFFYKAKLARAAEVEAEESGAADDE
                     SDEAVSARHAEYEAKAQTQADEPLDMDKAFDEAEADQRRLESDSSASDDGPESNTAGR
                     TEEGEQPSTGSKPEDEPNAPSEPSPKKPDSPV"
     misc_feature    109100..109774
                     /locus_tag="Hneap_0119"
                     /note="Sec-independent protein translocase protein (TatC);
                     Region: TatC; cl00521"
                     /db_xref="CDD:260475"
     gene            110181..111722
                     /locus_tag="Hneap_0120"
                     /db_xref="GeneID:8533234"
     CDS             110181..111722
                     /locus_tag="Hneap_0120"
                     /EC_number="5.4.2.1"
                     /inference="protein motif:TFAM:TIGR01307"
                     /note="catalyzes the interconversion of 2-phosphoglycerate
                     and 3-phosphoglycerate"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglyceromutase"
                     /protein_id="YP_003262031.1"
                     /db_xref="GI:261854748"
                     /db_xref="InterPro:IPR005995"
                     /db_xref="InterPro:IPR006124"
                     /db_xref="InterPro:IPR011258"
                     /db_xref="GeneID:8533234"
                     /translation="MSRTAPRNPVLLIIMDGIGVNPSRENNAYALANTPNLDYLFSHH
                     PHTVIEASGRACGLPDGQMGNSEVGHLTLGCGDLIRQDLVRIDDAIADGSFYENTALV
                     EAAQKAAADHRPLHLIGLVSDGGVHSHINHLLALIDLASRHGARPLVHMITDGRDTAP
                     KSARSYLPELEASLKAAGGAIATISGRYYAMDRDQRWERTALAWETIVRGDGPRAESA
                     EAALEASYADGKTDEFVLPMALKAFEPIEAGDSVIFFNFRNDRPRQLTEALAQTDFSG
                     FDRGDYQTVRVTCLTEYDPRFLSPIGFPPERPKNVLAEVISQAGIKQFHCAETEKYAH
                     VTFFFNGGKETPFAGEDRYMAPSPKVATYDLQPEMSAHEVADATIAAVEREEYGFVLV
                     NFANGDMVGHTAVRDAVIKAVETVDLEVGRLVQVAQKHGYSIIVTADHGNCDEMVDPV
                     TGEPHTQHTVYPVPCLLIDETEPRLRTGGGIANIAATVLELMGLPVPKKMKRSLLLNS
                     SNVSE"
     misc_feature    110190..111695
                     /locus_tag="Hneap_0120"
                     /note="phosphoglyceromutase; Provisional; Region:
                     PRK05434"
                     /db_xref="CDD:235463"
     gene            complement(111734..112534)
                     /locus_tag="Hneap_0121"
                     /db_xref="GeneID:8533235"
     CDS             complement(111734..112534)
                     /locus_tag="Hneap_0121"
                     /inference="protein motif:PFAM:PF03649"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: tgr:Tgr7_3122 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262032.1"
                     /db_xref="GI:261854749"
                     /db_xref="InterPro:IPR005226"
                     /db_xref="GeneID:8533235"
                     /translation="MNIETLSAIDLGLAALLVVALGVVQFLMGLGLQRSLVIGTVRMT
                     LQLLLVGLVLKTLFESAHLVWIGLMALVMLALAGYEVSARQKRPIKGWRGYVIGLLSM
                     GVTAAIITLLALIVIISPQPWYTPQYAIPLLGMILGNTMTGIGLALNHLTQTAWSNKS
                     RIEARLLLGQTATQAMADLRTEALRAGLIPTLNMLAAAGLISLPGMMTGQILAGAPPM
                     EAVRYQILIMLLITAATGFGSLLAVHLGARRLFDDRQRLRLERLGQRS"
     misc_feature    complement(111764..112534)
                     /locus_tag="Hneap_0121"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG0390"
                     /db_xref="CDD:223467"
     gene            complement(112531..113148)
                     /locus_tag="Hneap_0122"
                     /db_xref="GeneID:8533236"
     CDS             complement(112531..113148)
                     /locus_tag="Hneap_0122"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter;
                     SMART: ATPase AAA;
                     KEGG: tgr:Tgr7_3121 ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_003262033.1"
                     /db_xref="GI:261854750"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:8533236"
                     /translation="MLFEARNVTGEPGSGVRYRPVSLQLEAGEILTIYGQSGIGKSQF
                     LRALADLTPHTGDVLLDGVSQTKIRPENWRQQVGYVPAESGWWADVVAQHFSEQPPEA
                     WLSMLSLAPELLDAPVERLSTGERQRLALVRALVLQPKVLLLDEPTANLDQRNAQKLI
                     ELVKTYAQSEQAAVIWVSHDVDERALLGNRSLEICADTTHQAHRS"
     misc_feature    complement(112543..113148)
                     /locus_tag="Hneap_0122"
                     /note="ABC-type uncharacterized transport system, ATPase
                     component [General function prediction only]; Region:
                     COG4619"
                     /db_xref="CDD:226970"
     misc_feature    complement(112603..113139)
                     /locus_tag="Hneap_0122"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(113023..113046)
                     /locus_tag="Hneap_0122"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(112612..112614,112711..112716,
                     112855..112857,113020..113028,113032..113037))
                     /locus_tag="Hneap_0122"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(112855..112857,112906..112914))
                     /locus_tag="Hneap_0122"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(112759..112788)
                     /locus_tag="Hneap_0122"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(112711..112728)
                     /locus_tag="Hneap_0122"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(112693..112704)
                     /locus_tag="Hneap_0122"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(112606..112626)
                     /locus_tag="Hneap_0122"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(113272..114528)
                     /locus_tag="Hneap_0123"
                     /db_xref="GeneID:8533237"
     CDS             complement(113272..114528)
                     /locus_tag="Hneap_0123"
                     /inference="protein motif:PFAM:PF00034"
                     /note="PFAM: cytochrome C class I;
                     KEGG: cps:CPS_0283 cytochrome c family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C class I"
                     /protein_id="YP_003262034.1"
                     /db_xref="GI:261854751"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR008168"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:8533237"
                     /translation="MAQGHTPKVDSSAKFVGLVGTVLLLAAIYYLVTSLIHVVTGQTY
                     KNEFSPGDAPSVASATSAPASPTSEAASSSPAPTTTPVAAVSGGDAAAGKTKYATCAA
                     CHGADGKGNGGAFPNLTKLNAADAEAILHAFKKGDKAYLSKHGLGGARYGTMAPQAAG
                     LSDADIADLAAYIAELGGHSASAAEPAAAPAAATSTTASASTGDAAAGKTKYATCAAC
                     HGADGKGNGGAFPNLTKLNAADAEAILHAFKKGDKEYLAKHGLGGARYGTMAPQAAGL
                     SDADIADLGAYIAELGGHSASAAPAAAEAAPAAKPAAAAAPTQKIVSSEVVAWGHALF
                     SSCAVCHGAAGEGGKLFAAPKLAGLPYDSVVSLLNLYRKGQQMGANSYAMIPQAKHLT
                     DSEINALASYIAVMNNSADHGATATE"
     misc_feature    complement(114001..114291)
                     /locus_tag="Hneap_0123"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     misc_feature    complement(113656..113922)
                     /locus_tag="Hneap_0123"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     misc_feature    complement(113317..113550)
                     /locus_tag="Hneap_0123"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     gene            114766..116844
                     /locus_tag="Hneap_0124"
                     /db_xref="GeneID:8533238"
     CDS             114766..116844
                     /locus_tag="Hneap_0124"
                     /inference="protein motif:TFAM:TIGR00643"
                     /note="KEGG: csa:Csal_3245 ATP-dependent DNA helicase
                     RecG;
                     TIGRFAM: ATP-dependent DNA helicase RecG;
                     PFAM: DEAD/DEAH box helicase domain protein; helicase;
                     SMART: DEAD-like helicase ; helicase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="YP_003262035.1"
                     /db_xref="GI:261854752"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004609"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:8533238"
                     /translation="MVKIAAQQRSVPQKLHLPVDSLAGVGPRVAAQLVRLSIESIGDL
                     LWHLPLRYENRGQIVPLGYHLIGQSVLIHVTIAEAKSLMRGKARQVAQGYDDAASITL
                     WQFGRFGPTLQTGQSYLLFGEVREGASGLEMAQPELIQSAQLEAIVPIYPSTEGLSQS
                     KLRTLVGQALRVALHDLDECLPAPIRQRFGWPTMLAALQRIHAPVLADGVPTRDEPAF
                     ARMIGEELLAHLLALRLKRHEQSRDHAPRLSAPGRLYQELLAQLHFLPTKAQTRVLDE
                     IRADMAQGSPMLRLVQGDVGSGKTLVAAGAALTAIEQGYQVALMAPTALLAEQHQRNF
                     SQWFSPLGIDVQLLSGQQSASERRASLAALAEARSLMVIGTHALFQERVAFDQLGLVI
                     VDEQHRFGVHQRLALSDKGTHPDRAGHRPHQLVMTATPIPRTLAMSAYADLDVSIIDE
                     LPPGRTPITTALVRSDRRDQLIERISTVCAEGRQAYWVCPLVEDSERIEAQAAESTAE
                     LLREQLPHLTVGLVHGRMSAAEKNTQMARFKSHEVDLLVATTVIEVGVDVPNASLMII
                     ENADRMGLAQLHQLRGRVGRGRTDSYCVLLFDEPISDKARARLSLMRETQDGFRLAEA
                     DLAQRGPGEILGTRQTGLAKLRVADLVRDADLLDTARQLADELIAAQSPDIKPLIQRW
                     VGAAHQYGQV"
     misc_feature    114805..116841
                     /locus_tag="Hneap_0124"
                     /note="ATP-dependent DNA helicase RecG; Provisional;
                     Region: PRK10917"
                     /db_xref="CDD:236794"
     misc_feature    114985..115182
                     /locus_tag="Hneap_0124"
                     /note="RecG_wedge_OBF: A subfamily of OB folds
                     corresponding to the OB fold found in the N-terminal
                     (wedge) domain of Escherichia coli RecG. RecG is a
                     branched-DNA-specific helicase, which catalyzes the
                     interconversion of a DNA replication fork to a...; Region:
                     RecG_wedge_OBF; cd04488"
                     /db_xref="CDD:239934"
     misc_feature    order(115009..115011,115027..115029,115072..115074,
                     115162..115164)
                     /locus_tag="Hneap_0124"
                     /note="ssDNA binding site; other site"
                     /db_xref="CDD:239934"
     misc_feature    order(115114..115116,115120..115122,115126..115128)
                     /locus_tag="Hneap_0124"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239934"
     misc_feature    115630..116055
                     /locus_tag="Hneap_0124"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    115651..115665
                     /locus_tag="Hneap_0124"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    115945..115956
                     /locus_tag="Hneap_0124"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    116134..116553
                     /locus_tag="Hneap_0124"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(116233..116244,116332..116337,116410..116418)
                     /locus_tag="Hneap_0124"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(116434..116436,116500..116502,116512..116514,
                     116521..116523)
                     /locus_tag="Hneap_0124"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            117014..117433
                     /locus_tag="Hneap_0125"
                     /db_xref="GeneID:8533239"
     CDS             117014..117433
                     /locus_tag="Hneap_0125"
                     /inference="protein motif:PFAM:PF00011"
                     /note="PFAM: heat shock protein Hsp20;
                     KEGG: nmu:Nmul_A1762 heat shock protein HSP20"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp20"
                     /protein_id="YP_003262036.1"
                     /db_xref="GI:261854753"
                     /db_xref="InterPro:IPR002068"
                     /db_xref="GeneID:8533239"
                     /translation="MSIVRYEPFGLLSQLQRELARSEGSTATAEWSPSVDIKEEPDRF
                     VILADVPGVQPQDIDVHMENGQLTIKGEKKTEATAEDKNYKRIERTYGSFYRRFGLPD
                     SAEADKISARTKHGVLEIVIPKRESVQPRKINVVSED"
     misc_feature    117026..117418
                     /locus_tag="Hneap_0125"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    117119..117385
                     /locus_tag="Hneap_0125"
                     /note="Alpha-crystallin domain (ACD) of
                     alpha-crystallin-type small(s) heat shock proteins (Hsps).
                     sHsps are small stress induced proteins with monomeric
                     masses between 12 -43 kDa, whose common feature is the
                     Alpha-crystallin domain  (ACD). sHsps are generally...;
                     Region: ACD_sHsps-like; cd06464"
                     /db_xref="CDD:107221"
     misc_feature    order(117119..117133,117152..117154,117158..117160,
                     117164..117169,117299..117301,117359..117364)
                     /locus_tag="Hneap_0125"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107221"
     gene            117857..118837
                     /locus_tag="Hneap_0126"
                     /db_xref="GeneID:8533240"
     CDS             117857..118837
                     /locus_tag="Hneap_0126"
                     /inference="protein motif:PFAM:PF00165"
                     /note="PFAM: helix-turn-helix- domain containing protein
                     AraC type;
                     SMART: Helix-turn-helix, AraC domain;
                     KEGG: nha:Nham_2823 AraC family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_003262037.1"
                     /db_xref="GI:261854754"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="GeneID:8533240"
                     /translation="MALFEFSSAGQRGTEQLDAAVAHYAQIGRVLVEPDQQSGFAYNA
                     RIMQERPLAVGSLSVTAARVTRTRAHAAEGNPYDVLGVVLDAGEVEVSLEGRAPFRYA
                     HGEAFLWRGDEAGRSHYLSPQTRLLNIALPRATLEGGLAHPDRAEGRRLAASPEFRLL
                     AAYATAFLDVCPKLAPESTQTVALQLQDLALLALGANRDSAEQARNRGVRAARLVAIK
                     SDVEAHLLDPELSVRWVLRRHRISERYLRALFADEASSFGDFVLERRLARAWLRLIDP
                     RQHSTPIGVIAAESGFGDPSWFNRAFRRRFGVSPSEARAIYLTGNGADRC"
     misc_feature    118541..118798
                     /locus_tag="Hneap_0126"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    118673..118798
                     /locus_tag="Hneap_0126"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            119029..120123
                     /locus_tag="Hneap_0127"
                     /db_xref="GeneID:8533241"
     CDS             119029..120123
                     /locus_tag="Hneap_0127"
                     /inference="protein motif:PFAM:PF00691"
                     /note="PFAM: OmpA/MotB domain protein;
                     KEGG: hch:HCH_01122 outer membrane protein and related
                     peptidoglycan-associated (LipO)protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ompA/MotB domain-containing protein"
                     /protein_id="YP_003262038.1"
                     /db_xref="GI:261854755"
                     /db_xref="InterPro:IPR006664"
                     /db_xref="InterPro:IPR006665"
                     /db_xref="InterPro:IPR006690"
                     /db_xref="GeneID:8533241"
                     /translation="MKQPFMAIVLTVSGSALLAAGSAIAFDFGDVLKRTVERATQSEV
                     QRKVDQETRKTVRCALGDTRCEKAARADAEADAADADPAAGEHADAGGDHPLIAPYRG
                     SVRKERDVDAFNEYLRIVGRAGKAAKTERLEGKLTRLRYDNPKGRSTFEIERNYRDAL
                     TARGFRVDYECVKRTVCGTTDKPSWQSLNGINLGIAGDVRYFTGKLAYGSGAAYVSVA
                     VNPTVTYVHVLETASMERDMVAVDADALAAGLEKDGRVRLDGIFFDSGKALLKPESNP
                     ALDQAVQLLRQQASLKLLIAGHTDDTGSHAANQKLSQQRAEAVRNALLARGIAADRLT
                     AQGFGSGVPLADNASDAGRAQNRRVELVKQ"
     misc_feature    <119803..120114
                     /locus_tag="Hneap_0127"
                     /note="Outer membrane protein and related
                     peptidoglycan-associated (lipo)proteins [Cell envelope
                     biogenesis, outer membrane]; Region: OmpA; COG2885"
                     /db_xref="CDD:225439"
     misc_feature    119809..120114
                     /locus_tag="Hneap_0127"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    order(119821..119826,119923..119928,119935..119937,
                     119947..119952,119959..119961,120085..120087,
                     120097..120099)
                     /locus_tag="Hneap_0127"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            120120..121379
                     /locus_tag="Hneap_0128"
                     /db_xref="GeneID:8533242"
     CDS             120120..121379
                     /locus_tag="Hneap_0128"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262039.1"
                     /db_xref="GI:261854756"
                     /db_xref="GeneID:8533242"
                     /translation="MKRGLVAGGVIAVVGLASMAAGFVPNPFDAPGVEVVESGGEAAR
                     GAGEIRAPAPSDNPFDAPIPVVESGSPEARDLVGEEIIGPDPFVLPPIPVVESGSAEA
                     RALGERFSNPEAQRLREAAWRADSRFSVNPDSIPGHYRFDLRQRLRVDSADGLVDMSC
                     FVNSRDASLICPDWGLSGWGLDLETAQGKLDFVLRQADGDVFACGRHRDVGPACLQLG
                     EEIGPAFAWLRNMGLHQALLDSIPATPQALGEGPGGGVQGVRARTADGYLQLWFDRRA
                     STIATQMPWLGLGVGVMKDSRARVNRTVRRARFEGADRDGGDVVIDLVELEPARLERR
                     LDGYRVVTAFTAQALDEATSLGQHLHALQREAVGIRAELDACPSGTVGRDCRKHHRER
                     LKALDTRARDRALDFGERHGLPVPERP"
     gene            121407..121916
                     /locus_tag="Hneap_0129"
                     /db_xref="GeneID:8533243"
     CDS             121407..121916
                     /locus_tag="Hneap_0129"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: amr:AM1_2973 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262040.1"
                     /db_xref="GI:261854757"
                     /db_xref="GeneID:8533243"
                     /translation="MTIKATCNAALLLIAAGFTPSVFAVECRVVERIGNHFKDHILTD
                     IRGLAVGEYEVSPRKNLIVHSVDDIRFTGCRAVVKATIEVERKVRRDAKGNARIAGDI
                     DPDSVKLVDPSVGKWEFCFTKEPRIEKMKLSNTAGIGERQYKKIANRVWPRERCYTFI
                     VPKDEERPR"
     gene            121913..122284
                     /locus_tag="Hneap_0130"
                     /db_xref="GeneID:8533244"
     CDS             121913..122284
                     /locus_tag="Hneap_0130"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262041.1"
                     /db_xref="GI:261854758"
                     /db_xref="GeneID:8533244"
                     /translation="MSRSVASRVVKPVALLAIASLLAAAAHATTGKLTKREPVQRPPT
                     DSNGCMIESISGSLSFSYQLEGRAKREAIDNWKKQVKRKAPPEFASWKHANRYTKSMN
                     CDKYKGKFSCWAKAHPCERPR"
     gene            122315..123301
                     /locus_tag="Hneap_0131"
                     /db_xref="GeneID:8533245"
     CDS             122315..123301
                     /locus_tag="Hneap_0131"
                     /inference="protein motif:PFAM:PF00165"
                     /note="PFAM: helix-turn-helix- domain containing protein
                     AraC type;
                     SMART: Helix-turn-helix, AraC domain;
                     KEGG: nha:Nham_2823 AraC family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_003262042.1"
                     /db_xref="GI:261854759"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="GeneID:8533245"
                     /translation="MNLKNTPATLLPFNMVSGRYEGLEPVREAWSQLVCLDVMPAEPT
                     VPKLSASIWSLGDLKIGTFDGSAVKMVRTTKLAQDCADDLIICIERKTPTRATWGGAG
                     ARVFVPGDIHLWRADGTMQCETKGAFSALLLSIPRTVLSNHGIDIAPLLREGGICGNS
                     PETRLLCRYTDSVLGEVDALSPMGVSCCLSHLVDLAMLVLGGRNTVRLANRHRVRSVR
                     LASIKSDIDAHLLNPELSVGWVLRRHRISERYLRSLFADEDTSFTRFVLERRLMRAHA
                     ALDQSGRSISEIAYDCGFSDLSWFNRAFRQRFDMTPSQARAGLLDLSLERDG"
     misc_feature    122390..122914
                     /locus_tag="Hneap_0131"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     misc_feature    123014..123262
                     /locus_tag="Hneap_0131"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    123152..123262
                     /locus_tag="Hneap_0131"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            123488..126406
                     /locus_tag="Hneap_0132"
                     /db_xref="GeneID:8533246"
     CDS             123488..126406
                     /locus_tag="Hneap_0132"
                     /inference="protein motif:TFAM:TIGR01414"
                     /note="TIGRFAM: outer membrane autotransporter barrel
                     domain protein;
                     PFAM: Autotransporter beta- domain protein;
                     KEGG: rpt:Rpal_2455 outer membrane autotransporter barrel
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane autotransporter barrel
                     domain-containing protein"
                     /protein_id="YP_003262043.1"
                     /db_xref="GI:261854760"
                     /db_xref="InterPro:IPR005546"
                     /db_xref="InterPro:IPR006315"
                     /db_xref="GeneID:8533246"
                     /translation="MFMDTRAQTKKAPWSSCRFQRFWLWVTTSALALVIAQLAQADEW
                     TGVTDDDWFNSANWSFFVVPTSSSPRLVIIDAGSSNPARIGGAGIDNAEATTMDIGVN
                     RNGVLEIEGGSRRLFSGDATLGRFWGSRGVVGVNGPDAQWGILGNLVIGNEGSGQITL
                     ENGATLGVSGNVDFARFRLAGFGQASEGALIINGGSFVQDPDTGTFGIGISGDATLEI
                     SNGGQLVSGYTTLGLNADGTAEASIYSNDATRLSRWQANNLRIGGAGQAGLAIGQGAV
                     VHVAGDALIGDEAGSRGTVLVFREASSAVDAGILNIGGALAVGEGGHASLLIGNGGKV
                     DVAGVVVIADNASASGNLVVGSAGELNTHHDGIYVGALGEGELTLSEGGRALLHGGAV
                     TLGFFAGSSGTLNIGAADGSDARAPGVLDASNVRFGAGAGTLVFNHTGHDYVFSSDIS
                     GNGLIKHRAGGTTLTGDGSAFTGGVFLEGGRLSVNGLLGGGIDVAGGTLAGTGQVGAV
                     ILRRGSQIAPGNSIGTLKVAGDITIALGSDYEAEVNAAGASDLIHATGTATINGGSIN
                     VLPSPDFAVGTPYTLLTADGGLVGAGFDAVNFDSLFVSPVLSDDANHVFLTITQTTDF
                     VAVARTSNQVAAAGGIQSVASGLLFGAIASLGDADEARRAFDDISGEVHASIKTALIE
                     DTRFVRSATLSRQIGEGEDSGLWTKSFGSWGRWDSDGNAGELSRHLGGLLFGRDSLVL
                     EDIQLGWVAGYARSSLHIDERASTSTADSYTLGAYVGRRWDAFSLKGGVAHSWHRLDT
                     ARTVAFSGFTDNLSANYSARAFQTYGEAAYSLDIEGARIEPFTNLTYVHLSTDVYSET
                     GGAAALTAASQSIAETFTTIGLRGKSQFDFGGAPTHISGSAGWRHAFGNTPTATHHFS
                     GADNFTVTGVPIAVDALALDLGVSVNLTQDATIGLSYHGQFGSSLIDQGLRASLNVAF
                     "
     misc_feature    125039..126397
                     /locus_tag="Hneap_0132"
                     /note="outer membrane autotransporter barrel domain;
                     Region: autotrans_barl; TIGR01414"
                     /db_xref="CDD:233402"
     misc_feature    125579..126346
                     /locus_tag="Hneap_0132"
                     /note="Autotransporter beta-domain; Region:
                     Autotransporter; pfam03797"
                     /db_xref="CDD:252169"
     gene            complement(126577..127962)
                     /locus_tag="Hneap_0133"
                     /db_xref="GeneID:8533247"
     CDS             complement(126577..127962)
                     /locus_tag="Hneap_0133"
                     /inference="protein motif:TFAM:TIGR00254"
                     /note="KEGG: sat:SYN_01079 GGDEF domain-containing
                     protein;
                     TIGRFAM: diguanylate cyclase;
                     PFAM: GGDEF domain containing protein; response regulator
                     receiver;
                     SMART: GGDEF domain containing protein; response regulator
                     receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver modulated
                     diguanylate cyclase"
                     /protein_id="YP_003262044.1"
                     /db_xref="GI:261854761"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:8533247"
                     /translation="MADTHPCDAHIRHDLRTPLNHMIGYTEMLLDDLPPTCNDLLSPR
                     LKTLLDDAYRMLETINRPAPMSSGHFDGLFPDWRAKMALIEADFNGLKSTIENAWQEA
                     CPDVEKIGSAIGNMRALLESLSAKPSIDLGDARSQQNARETATHATGGSGHAGGHLLI
                     VDDRQENLELMQRRLIREGYRVTVSNSGREALDRLESEQFDVILLDWLMPDMSGTEVL
                     AKIRSKSSAHEQPVIVVTARHGSETIVDALTQGANDYLAKPLDFPVALARIATQVYLR
                     RVTQQLADANRQLKQFSYIDGLTAIANRRKFDEYLMTTWRRAQQEGAPVSLILIDVDY
                     FKRYNDSLGHEAGDHALMRVAKAVSSSLYRVKDLAARYGGEEFAVILPETELADALSV
                     AERVRSAVMSLELPHPDSTVMPVVTASLGVGEWRPTAFCEPSALINLADKGLYQAKAS
                     GRNQVGTLGQN"
     misc_feature    complement(<127780..>127938)
                     /locus_tag="Hneap_0133"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(127780..127938)
                     /locus_tag="Hneap_0133"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(127789..127791,127798..127800,
                     127810..127812,127819..127821,127831..127833,
                     127888..127890,127897..127899,127909..127911,
                     127918..127920,127930..127932))
                     /locus_tag="Hneap_0133"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(127924..127926)
                     /locus_tag="Hneap_0133"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(127156..127488)
                     /locus_tag="Hneap_0133"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(127186..127191,127198..127200,
                     127255..127257,127321..127323,127345..127347,
                     127474..127479))
                     /locus_tag="Hneap_0133"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(127345..127347)
                     /locus_tag="Hneap_0133"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(127321..127329,127333..127338))
                     /locus_tag="Hneap_0133"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(127183..127191)
                     /locus_tag="Hneap_0133"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(126598..127083)
                     /locus_tag="Hneap_0133"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(126838..126840,126970..126972))
                     /locus_tag="Hneap_0133"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(126835..126846,126850..126852,
                     126919..126921,126931..126933,126943..126948,
                     126955..126957))
                     /locus_tag="Hneap_0133"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(126778..126780,126862..126864))
                     /locus_tag="Hneap_0133"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(127966..128337)
                     /locus_tag="Hneap_0134"
                     /db_xref="GeneID:8533248"
     CDS             complement(127966..128337)
                     /locus_tag="Hneap_0134"
                     /inference="protein motif:PFAM:PF00072"
                     /note="PFAM: response regulator receiver;
                     SMART: response regulator receiver;
                     KEGG: cyn:Cyan7425_0748 response regulator receiver
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_003262045.1"
                     /db_xref="GI:261854762"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:8533248"
                     /translation="MARILLVEDNEMNRDMLSRRLARKGYEVLLAVDGGEGVAMAKSQ
                     QPDLILMDMSLPVLDGWEATRAIRAEPATEAIPIIALTAHAMDGERAKALEAGCNDFD
                     TKPVDLPRLLEKIEQQMAKRD"
     misc_feature    complement(<127993..128331)
                     /locus_tag="Hneap_0134"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(127981..128325)
                     /locus_tag="Hneap_0134"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(128023..128028,128035..128037,
                     128092..128094,128158..128160,128182..128184,
                     128311..128316))
                     /locus_tag="Hneap_0134"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(128182..128184)
                     /locus_tag="Hneap_0134"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(128158..128166,128170..128175))
                     /locus_tag="Hneap_0134"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(128020..128028)
                     /locus_tag="Hneap_0134"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(128341..130917)
                     /locus_tag="Hneap_0135"
                     /db_xref="GeneID:8533249"
     CDS             complement(128341..130917)
                     /locus_tag="Hneap_0135"
                     /inference="protein motif:PFAM:PF02518"
                     /note="PFAM: ATP-binding region ATPase domain protein;
                     response regulator receiver; histidine kinase HAMP region
                     domain protein; histidine kinase A domain protein;
                     SMART: ATP-binding region ATPase domain protein; response
                     regulator receiver; histidine kinase A domain protein;
                     KEGG: syf:Synpcc7942_1816 periplasmic sensor hybrid
                     histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor hybrid histidine
                     kinase"
                     /protein_id="YP_003262046.1"
                     /db_xref="GI:261854763"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:8533249"
                     /translation="MLQNLRIGTKLTGFLILAFLISIAVSGFFLSSAMNKKAEAEIQT
                     RAEMLSRMMNAVRSYTSLHISPKLQQRLFTEQQFISETVPAFSARIIFNSFRDDPAFA
                     DFRYKEATLNPTSPHDQADAFESGLVAKFRADPSIKILSGFRELNGRNLFYTARPLAV
                     TKASCLQCHSTPQAAPKSLVATYGDKNGFGWKLGEIVSAQTIYVPSDEIFAQGHQYLL
                     WSMGIFFGVFAVGTTLLIWQIRRTVVIPIQRLTAAARAIGTGSATREQMAVFDQPQMQ
                     QLARRGDEPGELARSFQSMAHEVADREQNLNTAVMQRTEELEQALKIAGEARKEAEDA
                     NQTKSQFVANMSHELRTPLNAIIGYSEILLEESEDDGNTQYAPDLERILNSGKHLLAL
                     VNDILDISRIEAGKMELYLESFPICREIQTVIDTARPVIDKNQNSLVFECDDSLGHMR
                     GDLTKFRQILLNLISNAAKFTQVGTLTLSVRREDTDHFTIAVADTGIGMNEEQLGRLF
                     QVFSQADASTTRKYGGSGLGLSISRHFARMMGGDITATSTPGSGSVFTVSLPLTVEPQ
                     TQTEPANATDIPSQPSAPSTNAALDKQAETILVIDDDPSVHDLLKRSLGRAGYRVITA
                     SNGTDGLAMARIDRPDFITLDIMMPGVDGWSVLTSLKADPDLKDIPVFVLTMTNEKSL
                     GYALGAAQFLTKPVNKDALLGLLRQYKRHPDRCHVLMIDDDADNRNLIRRVLEPEGTV
                     VDEATDGQSGLDWLSSHAAPDLVILDLMMPNMDGFAFIDALRQRPEFNSLPVLVLTAK
                     TLTDDDRQRLSQRVEYIIERDGLNEELLVGRLHEQLCTHRKNIPSTPSGKAADGDERK
                     ET"
     misc_feature    complement(130303..130875)
                     /locus_tag="Hneap_0135"
                     /note="Protein of unknown function (DUF3365); Region:
                     DUF3365; pfam11845"
                     /db_xref="CDD:256666"
     misc_feature    complement(129220..130353)
                     /locus_tag="Hneap_0135"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(130015..130257)
                     /locus_tag="Hneap_0135"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    complement(129715..129915)
                     /locus_tag="Hneap_0135"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(129730..129732,129742..129744,
                     129751..129753,129763..129765,129772..129774,
                     129784..129786,129841..129843,129850..129852,
                     129862..129864,129871..129873,129883..129885,
                     129895..129897))
                     /locus_tag="Hneap_0135"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(129877..129879)
                     /locus_tag="Hneap_0135"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(129241..129552)
                     /locus_tag="Hneap_0135"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(129253..129255,129259..129264,
                     129277..129279,129283..129285,129331..129342,
                     129421..129426,129430..129432,129436..129438,
                     129442..129444,129511..129513,129520..129522,
                     129532..129534))
                     /locus_tag="Hneap_0135"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(129520..129522)
                     /locus_tag="Hneap_0135"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(129334..129336,129340..129342,
                     129424..129426,129430..129432))
                     /locus_tag="Hneap_0135"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(128794..129126)
                     /locus_tag="Hneap_0135"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(128833..128838,128845..128847,
                     128893..128895,128959..128961,128983..128985,
                     129112..129117))
                     /locus_tag="Hneap_0135"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(128983..128985)
                     /locus_tag="Hneap_0135"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(128959..128967,128971..128976))
                     /locus_tag="Hneap_0135"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(128830..128838)
                     /locus_tag="Hneap_0135"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(128416..128766)
                     /locus_tag="Hneap_0135"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(128461..128466,128473..128475,
                     128530..128532,128596..128598,128620..128622,
                     128752..128757))
                     /locus_tag="Hneap_0135"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(128620..128622)
                     /locus_tag="Hneap_0135"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(128596..128604,128608..128613))
                     /locus_tag="Hneap_0135"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(128455..128457,128461..128466))
                     /locus_tag="Hneap_0135"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            131124..131918
                     /locus_tag="Hneap_0136"
                     /db_xref="GeneID:8533250"
     CDS             131124..131918
                     /locus_tag="Hneap_0136"
                     /inference="protein motif:SMART:SM00331"
                     /note="SMART: protein phosphatase 2C domain protein;
                     KEGG: azo:azo0896  phosphoprotein phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein serine/threonine phosphatase"
                     /protein_id="YP_003262047.1"
                     /db_xref="GI:261854764"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="GeneID:8533250"
                     /translation="MNVELTTAPAPALEFMGADRHVGGRAYQQDQVICLSTPDMKYQL
                     VVVADGVGGHWGGEMASKTVIEVARRLFPAQLNQFPASGGFLEYFCQTANDEIRARAA
                     RENQEAFSTVVALLTTPGRAYWAHVGDSRLYGFKGAELVHQTNDHSLVQALFDQGRIT
                     ADERRVHPERNRVLNVLGLNDTVQPTLGEISLTPDMAFLLCTDGFWEHVAVSEMPLIL
                     AAADLSFAASVWVRQAARRAGAGGDNVALALWRSPPRSKRGWLSFR"
     misc_feature    131166..131876
                     /locus_tag="Hneap_0136"
                     /note="Serine/threonine phosphatases, family 2C, catalytic
                     domain; The protein architecture and deduced catalytic
                     mechanism of PP2C phosphatases are similar to the PP1,
                     PP2A, PP2B family of protein Ser/Thr phosphatases, with
                     which PP2C shares no sequence...; Region: PP2Cc; cd00143"
                     /db_xref="CDD:238083"
     misc_feature    order(131196..131198,131208..131213,131268..131276,
                     131730..131732,131850..131852)
                     /locus_tag="Hneap_0136"
                     /note="active site"
                     /db_xref="CDD:238083"
     gene            131937..133043
                     /locus_tag="Hneap_0137"
                     /db_xref="GeneID:8533251"
     CDS             131937..133043
                     /locus_tag="Hneap_0137"
                     /inference="protein motif:TFAM:TIGR00383"
                     /note="TIGRFAM: magnesium and cobalt transporter CorA;
                     PFAM: Mg2 transporter protein CorA family protein;
                     KEGG: tgr:Tgr7_1992 magnesium and cobalt transporter CorA"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium and cobalt transporter CorA"
                     /protein_id="YP_003262048.1"
                     /db_xref="GI:261854765"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="InterPro:IPR004488"
                     /db_xref="GeneID:8533251"
                     /translation="MSFENRRVGTADRVGMAPGALLEDTHSVPAQIELIHYREHDSSA
                     IDPASLQAMQTAIAAHDGVTWLHVQGLPSKAFLEEMGARFGLHPLLLEDIQSRDQRPK
                     LDEYVEHLFAVFSVPRWQGDGAVLEQFSLLLGDGYVISIHDAQSDITDILRARLAQSS
                     SRLRQHGADYLFYSLIDLIIDQIYPLLETFGGTVDELEERLVTNPGHRALPDIQSAKR
                     TLNQLRRQLWPTREVISHLIRGVSNEPLLEAGLRPYLNDLYDHTVSVMDMLETYRDTV
                     TGLIDIHLSSVSNRLNEIMRTLTVISTLFIPLTFVTGIYGMNFGNNADSPFAMPELRW
                     YFGYPLILSVMVAVALGMILFFKRRGWIFSRDRF"
     misc_feature    132117..133010
                     /locus_tag="Hneap_0137"
                     /note="CorA-like Mg2+ transporter protein; Region: CorA;
                     pfam01544"
                     /db_xref="CDD:250695"
     misc_feature    132120..133022
                     /locus_tag="Hneap_0137"
                     /note="Thermotoga maritima CorA_like subfamily; Region:
                     TmCorA-like_1; cd12828"
                     /db_xref="CDD:213362"
     misc_feature    order(132201..132203,132210..132215,132231..132236,
                     132240..132242,132246..132248,132387..132389,
                     132399..132401,132417..132419,132444..132446,
                     132453..132455,132477..132479,132486..132488,
                     132498..132500,132516..132521,132528..132530,
                     132540..132545,132564..132569,132576..132578,
                     132585..132590,132597..132599,132609..132611,
                     132681..132683,132693..132698,132702..132707,
                     132714..132719,132723..132728,132735..132740,
                     132744..132749,132753..132761,132768..132791,
                     132795..132833,132837..132845,132849..132866,
                     132870..132893,132945..132950,132957..132962,
                     132969..132971,133002..133004,133011..133013)
                     /locus_tag="Hneap_0137"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213362"
     misc_feature    order(132210..132212,132465..132467,132705..132707)
                     /locus_tag="Hneap_0137"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213362"
     misc_feature    order(132213..132215,132705..132707)
                     /locus_tag="Hneap_0137"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213362"
     misc_feature    order(132399..132401,132444..132446)
                     /locus_tag="Hneap_0137"
                     /note="Cl binding site [ion binding]; other site"
                     /db_xref="CDD:213362"
     misc_feature    132777..132779
                     /locus_tag="Hneap_0137"
                     /note="aspartate ring; other site"
                     /db_xref="CDD:213362"
     misc_feature    order(132804..132806,132822..132824,133005..133016)
                     /locus_tag="Hneap_0137"
                     /note="basic sphincter; other site"
                     /db_xref="CDD:213362"
     misc_feature    order(132819..132821,132828..132830)
                     /locus_tag="Hneap_0137"
                     /note="putative hydrophobic gate; other site"
                     /db_xref="CDD:213362"
     misc_feature    order(132873..132875,132879..132884)
                     /locus_tag="Hneap_0137"
                     /note="periplasmic entrance; other site"
                     /db_xref="CDD:213362"
     gene            133186..134403
                     /locus_tag="Hneap_0138"
                     /db_xref="GeneID:8533252"
     CDS             133186..134403
                     /locus_tag="Hneap_0138"
                     /inference="protein motif:PFAM:PF00534"
                     /note="PFAM: glycosyl transferase group 1;
                     KEGG: lch:Lcho_3607 glycosyl transferase group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_003262049.1"
                     /db_xref="GI:261854766"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:8533252"
                     /translation="MYISLVTETFDPDINGVATTLKQIHSALLSSGHRVQLVCPRGKT
                     ARVLDDMLEVPGLALPFYTDVRLGLPVGRRLKRRWQNERPDLVHIATEGPLGYAALRT
                     AKALGLPITSSLHTNFHTYMRFYRVGWLAAPVMRYLKWFHNRTARTFIPTGQQAEALG
                     LSGFDRLAVLGRGVDTALFNPERRDAALRAQWSQHSGRAAGDESKVALHVGRLAPEKN
                     LDLLLQTFNAMRVAQPDMIGVVVGDGPERARLEKALPWVIFTGMKRGAQLARHYASAD
                     LFIFPSQTETFGNVLLEAMACGLICVSFDYAAGKHLIHDGKNGYLVPLGDDARFIKAA
                     VDLIRVDGPEIRQMGSRARDVAATYDWTRVTRAFEQHLKDVLQVESAQSASDEQPALQ
                     GSGRSTNQGKTGV"
     misc_feature    133186..134316
                     /locus_tag="Hneap_0138"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    133192..134301
                     /locus_tag="Hneap_0138"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. Glycosyltransferases
                     catalyze the transfer of sugar moieties from activated
                     donor molecules to specific acceptor molecules, forming
                     glycosidic bonds. The acceptor molecule can...; Region:
                     GT1_like_2; cd03814"
                     /db_xref="CDD:99985"
     gene            134405..134968
                     /locus_tag="Hneap_0139"
                     /db_xref="GeneID:8533253"
     CDS             134405..134968
                     /locus_tag="Hneap_0139"
                     /inference="protein motif:PFAM:PF01569"
                     /note="PFAM: phosphoesterase PA-phosphatase related;
                     SMART: phosphoesterase PA-phosphatase related;
                     KEGG: mmb:Mmol_1697 phosphoesterase PA-phosphatase
                     related"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase PA-phosphatase-like protein"
                     /protein_id="YP_003262050.1"
                     /db_xref="GI:261854767"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="GeneID:8533253"
                     /translation="MTAFIRTVRSSSLLNRYLHWEEVIMYRLNLVNAMRGLRRLFAIC
                     SRLGDGVAWYVAAALIALFVGEQAWLPMSAMMLSAGVGLGIYASIKRLTARPRPHMAH
                     DGLVLSVAPLDKYSFPSGHTLHAVNFAIQIAVFAPGLAWLVIPFALMVALSRMVLGLH
                     YLSDVLVGGVIGALIAVSSLWVVGTLS"
     misc_feature    <134501..134950
                     /locus_tag="Hneap_0139"
                     /note="Membrane-associated phospholipid phosphatase [Lipid
                     metabolism]; Region: PgpB; COG0671"
                     /db_xref="CDD:223743"
     misc_feature    134519..134932
                     /locus_tag="Hneap_0139"
                     /note="PAP2_like proteins, a super-family of histidine
                     phosphatases and vanadium haloperoxidases, includes type 2
                     phosphatidic acid phosphatase or lipid phosphate
                     phosphatase (LPP), Glucose-6-phosphatase,
                     Phosphatidylglycerophosphatase B and bacterial acid...;
                     Region: PAP2_like; cl00474"
                     /db_xref="CDD:260448"
     misc_feature    order(134672..134674,134693..134695,134759..134767,
                     134864..134866,134882..134884,134894..134896)
                     /locus_tag="Hneap_0139"
                     /note="active site"
                     /db_xref="CDD:238813"
     gene            135220..136077
                     /locus_tag="Hneap_0140"
                     /db_xref="GeneID:8533254"
     CDS             135220..136077
                     /locus_tag="Hneap_0140"
                     /inference="protein motif:TFAM:TIGR01713"
                     /note="TIGRFAM: general secretion pathway protein C;
                     KEGG: tgr:Tgr7_0224 general secretion pathway protein C"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein C"
                     /protein_id="YP_003262051.1"
                     /db_xref="GI:261854768"
                     /db_xref="InterPro:IPR001639"
                     /db_xref="GeneID:8533254"
                     /translation="MSWSKSRFVWIPSALFLILLATAGVLAARITWMWLAPAPAYVAP
                     PESGAEASEQSQSASVEQIGSWHLFGQAATPDNPTATKISASQLGATLEGTISGSPLP
                     LVMLRVGGEVRLLQAGDTLSAGVRIVSIAPDRVVISNQGRLESIAFPKPQSLDQAPAP
                     SAASLTTANPRDVSASAVAPTVRAQAEEIRHNPQTLLRFVTVSPVQQNGEISGYSLRP
                     VPGQEALMRALGLMPGDVLTSVDGMPVNDPALLPRVMPLLNSGQPLQVLVERGGQPLS
                     MTINLDSLQ"
     misc_feature    135259..136041
                     /locus_tag="Hneap_0140"
                     /note="type II secretion system protein C; Region:
                     typeII_sec_gspC; TIGR01713"
                     /db_xref="CDD:233542"
     misc_feature    135436..135657
                     /locus_tag="Hneap_0140"
                     /note="Type IV pilus biogenesis; Region: Pilus_PilP;
                     pfam11356"
                     /db_xref="CDD:256430"
     misc_feature    <135907..136056
                     /locus_tag="Hneap_0140"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     gene            136074..138251
                     /locus_tag="Hneap_0141"
                     /db_xref="GeneID:8533255"
     CDS             136074..138251
                     /locus_tag="Hneap_0141"
                     /inference="protein motif:TFAM:TIGR02517"
                     /note="TIGRFAM: general secretion pathway protein D;
                     PFAM: type II and III secretion system protein; NolW
                     domain protein;
                     KEGG: tgr:Tgr7_0225 general secretion pathway protein D"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein D"
                     /protein_id="YP_003262052.1"
                     /db_xref="GI:261854769"
                     /db_xref="InterPro:IPR001775"
                     /db_xref="InterPro:IPR001814"
                     /db_xref="InterPro:IPR004845"
                     /db_xref="InterPro:IPR004846"
                     /db_xref="InterPro:IPR005644"
                     /db_xref="InterPro:IPR013356"
                     /db_xref="GeneID:8533255"
                     /translation="MMNTARRIRGQASSLVIFMALTLVTAEVLINSPVRAADAPPPGI
                     SRVQGDNSDTDKVTLNFRDMDIGALIEAVSKVTGKNFIVDPRVKARVTVISAKPMSPQ
                     KLYDVFLSILQVNGFAAVPAGAVIKIVPEINARSDAQPVNPGSSAVGDQMVTEVVHLR
                     YVPAAPLLTVLRQIMPQQAALSVYPDSNSLVITDRAGNIDRLKKILAKVDQPAVGDVE
                     IIRLKRASADSVVSTLKALFGASGGGGAKGAPVPGGGAGGNFSSVPAFAADDRTNSVL
                     LSGDAVSRAKMRAIILNLDMPQTNYGNTRVFRLKYANAEDLVDVLKGIVSTNGATSTG
                     ATATKEATTNPDNNQLEIAADKSLNALVVTASPSRMQTVESVIDQLDIRRKQVLVEAI
                     IAEVSNGVTKKLGTQFLVGGGSGTVPIGISTFNGLLSSVASSAAQAGTGSVGSAIGLG
                     LAGALGDGGNIGVGRYGQGGADFALLVSALAGNSGNNILSTPSLLTLDNQEASIVVGQ
                     NIPIVTGSYAQTGSATSPTNPFQTITREDIGVKLKVTPTISPDGTVRLKIEQEVSSLD
                     SAAQSSAGLITNKRNVTTTVQVDDGDVVVLGGLIDDSTNSNQQSVPGLGDIPILGNLF
                     RYRSASTNKRNLMIFIRPLIVGDGGKLSEFSREQYNRIRQSQQDTFDKRSLVNPSDWS
                     VLSPEQNFQRNLPIPMPQNIQTLMDQDRARSQTASGQTAAPRP"
     misc_feature    136248..138020
                     /locus_tag="Hneap_0141"
                     /note="type II secretion system protein D; Region:
                     type_II_gspD; TIGR02517"
                     /db_xref="CDD:233907"
     misc_feature    136533..136709
                     /locus_tag="Hneap_0141"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    136722..136967
                     /locus_tag="Hneap_0141"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    136983..137225
                     /locus_tag="Hneap_0141"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    137508..138011
                     /locus_tag="Hneap_0141"
                     /note="Bacterial type II and III secretion system protein;
                     Region: Secretin; pfam00263"
                     /db_xref="CDD:249725"
     gene            138262..139770
                     /locus_tag="Hneap_0142"
                     /db_xref="GeneID:8533256"
     CDS             138262..139770
                     /locus_tag="Hneap_0142"
                     /inference="protein motif:TFAM:TIGR02533"
                     /note="KEGG: tgr:Tgr7_0226 general secretory pathway
                     protein E;
                     TIGRFAM: general secretory pathway protein E;
                     PFAM: type II secretion system protein E;
                     SMART: ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretory pathway protein E"
                     /protein_id="YP_003262053.1"
                     /db_xref="GI:261854770"
                     /db_xref="InterPro:IPR001482"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013369"
                     /db_xref="GeneID:8533256"
                     /translation="MTVDADTHAHLAKTSPLSYGYARRFGVLIEPDTTAEAAWIVRHC
                     KPLPVSVLAELGRKLPDGFTLDWLETDEFERRLARAYEGGSSVAQTMVDDLGDGGLDA
                     LANTLNTPIDLLEADDEAPIIRLINALLSEAVREGASDIHLESFESRMVVRFRVDGML
                     REVLEPPRAVAGIIVSRIKVMANLDIAEKRVPQDGRISLRLAGRPVDVRVSTLPSGQG
                     ERVVLRLLDKEAGRLTLDNLGLTRELQARLNKLIHRPHGILLVTGPTGSGKTTTLYAA
                     LSEINTRERNILTVEDPIEYYLDGVGQTQVNPKVEMTFARGLRAILRQDPDVVMVGEI
                     RDVETAEIAVQASLTGHLVLSTLHTNSAIGAITRLRDMGVEPFLLSSSLIGVLAQRLV
                     RRLDARYREAYTPDASECALLGLDASQPPTLYRVSEEARQRGQGYLGRTGVYELISID
                     ADTRRLIHDGAAEPAIEAQVRKHSSSILAYGAALVMAGVTTTEELLRVTAEG"
     misc_feature    138310..139758
                     /locus_tag="Hneap_0142"
                     /note="type II secretion system protein E; Region:
                     type_II_gspE; TIGR02533"
                     /db_xref="CDD:131585"
     misc_feature    138790..139581
                     /locus_tag="Hneap_0142"
                     /note="PulE/GspE The type II secretory pathway is the main
                     terminal branch of the general secretory pathway (GSP).
                     It is responsible for the export the majority of
                     Gram-negative bacterial exoenzymes and toxins. PulE is a
                     cytoplasmic protein of the GSP, which...; Region:
                     PulE-GspE; cd01129"
                     /db_xref="CDD:238549"
     misc_feature    139048..139071
                     /locus_tag="Hneap_0142"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238549"
     misc_feature    order(139051..139053,139063..139071,139126..139128,
                     139132..139137,139255..139260)
                     /locus_tag="Hneap_0142"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238549"
     misc_feature    139243..139260
                     /locus_tag="Hneap_0142"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238549"
     gene            139777..141000
                     /locus_tag="Hneap_0143"
                     /db_xref="GeneID:8533257"
     CDS             139777..141000
                     /locus_tag="Hneap_0143"
                     /inference="protein motif:TFAM:TIGR02120"
                     /note="TIGRFAM: general secretion pathway protein F;
                     PFAM: type II secretion system F domain;
                     KEGG: tgr:Tgr7_0227 general secretion pathway protein F"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein F"
                     /protein_id="YP_003262054.1"
                     /db_xref="GI:261854771"
                     /db_xref="InterPro:IPR001992"
                     /db_xref="InterPro:IPR003004"
                     /db_xref="InterPro:IPR011850"
                     /db_xref="InterPro:IPR018076"
                     /db_xref="GeneID:8533257"
                     /translation="MAAFEYSALDAQGKTRKGVIESDSARGARSLLRDQGLAPLTIEA
                     VVADQSTAGGMQGWMSRFQSLNPTELALFTRQISTLIAAGLPIDAALSGIIRQTENPR
                     IRRIVTAVRSKVVEGHSLAQGLATFPRAFSELYRATVAAGEESGHLEAVLERLADYTE
                     GRQATTQKVQMALFYPALLTLMAVAVVIGLVTYVVPQVVQVFVQMKQTLPPLTRGLIA
                     VSAFLREQWPWILLGMAAFAIWFYWALRQPKFAFRWAQIQLKLPLIGRLIRGFNAARF
                     ARTLSILSAAGVPMLKALTISGEVVASEPMRRAIKEATDRVREGAPIARSLEQSRLFP
                     PMMLQLIAAGEQSGALGNMLERAAVQQERELDTLINALLGLFEPILILVMGGVVLLIV
                     LAILIPIFDLNQMVH"
     misc_feature    139786..140994
                     /locus_tag="Hneap_0143"
                     /note="type II secretion system protein F; Region: GspF;
                     TIGR02120"
                     /db_xref="CDD:233734"
     misc_feature    139993..140346
                     /locus_tag="Hneap_0143"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; pfam00482"
                     /db_xref="CDD:249893"
     misc_feature    140602..140970
                     /locus_tag="Hneap_0143"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; pfam00482"
                     /db_xref="CDD:249893"
     gene            141003..141503
                     /locus_tag="Hneap_0144"
                     /db_xref="GeneID:8533258"
     CDS             141003..141503
                     /locus_tag="Hneap_0144"
                     /inference="protein motif:TFAM:TIGR01710"
                     /note="TIGRFAM: general secretion pathway protein G;
                     PFAM: type II secretion system protein G;
                     KEGG: tgr:Tgr7_0231 general secretion pathway protein G"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein G"
                     /protein_id="YP_003262055.1"
                     /db_xref="GI:261854772"
                     /db_xref="InterPro:IPR000983"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR010054"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="InterPro:IPR013545"
                     /db_xref="GeneID:8533258"
                     /translation="MMSYFSSRLSSQAARIERGNGLISRGFTLIEVMVVVVILAILAT
                     IVVPKIMDRPDDARIAKAKQDIRAIDSALQLYKLDNLTYPTTDQGLEALVKPPANAKN
                     WRQGGYLDRLPIDPWNNPYQYLSPGQHGAFDVYSLGADGQPGGTGADADIGNWQEEGG
                     ATNTGN"
     misc_feature    141075..141470
                     /locus_tag="Hneap_0144"
                     /note="type II secretion system protein G; Region:
                     typeII_sec_gspG; TIGR01710"
                     /db_xref="CDD:130771"
     misc_feature    141075..141143
                     /locus_tag="Hneap_0144"
                     /note="prepilin-type N-terminal cleavage/methylation
                     domain; Region: IV_pilin_GFxxxE; TIGR02532"
                     /db_xref="CDD:213719"
     misc_feature    141153..141467
                     /locus_tag="Hneap_0144"
                     /note="Type II secretion system (T2SS), protein G; Region:
                     T2SG; pfam08334"
                     /db_xref="CDD:254737"
     gene            141512..142153
                     /locus_tag="Hneap_0145"
                     /db_xref="GeneID:8533259"
     CDS             141512..142153
                     /locus_tag="Hneap_0145"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: aav:Aave_0925 general secretion pathway
                     protein G"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262056.1"
                     /db_xref="GI:261854773"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="GeneID:8533259"
                     /translation="MLALRAVLDARHAPYAGRHQRMGRQRCAQGFTLIELIVVIVIIG
                     ILVGFVVMSMNKRAPDDVGVCQARMASWLAQQAVAANRLDQTIYIQNASTKSPSAFVL
                     NHPSAQLQTAASKQTSQNANESPAFVANIISRLDWDKGCALMARPSAADTFAAKDPRA
                     DAVIAVTPDGIWSLPSGAPQSKPEITVRGDKQKTLPINLSSGFGEQASAGSAP"
     gene            142153..142545
                     /locus_tag="Hneap_0146"
                     /db_xref="GeneID:8533260"
     CDS             142153..142545
                     /locus_tag="Hneap_0146"
                     /inference="protein motif:TFAM:TIGR01707"
                     /note="TIGRFAM: general secretion pathway protein I;
                     PFAM: type II secretion system protein I/J;
                     KEGG: psa:PST_0129 general secretion pathway protein I"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein I"
                     /protein_id="YP_003262057.1"
                     /db_xref="GI:261854774"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR002416"
                     /db_xref="InterPro:IPR003413"
                     /db_xref="InterPro:IPR010052"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="GeneID:8533260"
                     /translation="MTTTTKTRAQGFTLLEVLIALVVLAIALAAVIKVSGQSAQTLDR
                     LRADTAATVIADDLCARLQLSAQAPELGTRQSQVEINGQSWRVRQTVSAGQVPGVLKV
                     AYLVETPAPYAGQASIVTYFYPPAQKAP"
     misc_feature    142153..142230
                     /locus_tag="Hneap_0146"
                     /note="Type IV pilin N-term methylation site GFxxxE;
                     Region: N_methyl_2; pfam13544"
                     /db_xref="CDD:257863"
     misc_feature    142183..142479
                     /locus_tag="Hneap_0146"
                     /note="type II secretion system protein I; Region: gspI;
                     TIGR01707"
                     /db_xref="CDD:233539"
     misc_feature    142282..142515
                     /locus_tag="Hneap_0146"
                     /note="Type II secretion system (T2SS), protein I; Region:
                     T2SI; pfam02501"
                     /db_xref="CDD:251336"
     gene            142542..143303
                     /locus_tag="Hneap_0147"
                     /db_xref="GeneID:8533261"
     CDS             142542..143303
                     /locus_tag="Hneap_0147"
                     /inference="protein motif:TFAM:TIGR01711"
                     /note="TIGRFAM: general secretion pathway protein J;
                     KEGG: pmy:Pmen_2920 general secretion pathway protein J"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein J"
                     /protein_id="YP_003262058.1"
                     /db_xref="GI:261854775"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR010055"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="GeneID:8533261"
                     /translation="MSVHDSLIQGVGSTRCSIKRAASGFTLLELLVAIAIFALVAVMA
                     YGGLNTVIKQSAIVEDQMGQLNAMQNGLRQMRGDLTFAVDRFARDALGGDVPEFAGGG
                     LNLLTLTRLGASNPWAAAEPQLALVRWRLENGNLERATFVPPDGAVGNSAEQPDWRII
                     LRNVSKIQLTFYDQNNQSMLDWPPINQPSAGLPKAVEVLLTVNNLPPLRMTVAMVSDW
                     PEAAPANPPGGTNNGAEPATSPQTQTQTEVEAERR"
     misc_feature    142584..142661
                     /locus_tag="Hneap_0147"
                     /note="Type IV pilin N-term methylation site GFxxxE;
                     Region: N_methyl_2; pfam13544"
                     /db_xref="CDD:257863"
     misc_feature    142611..143141
                     /locus_tag="Hneap_0147"
                     /note="type II secretion system protein J; Region: gspJ;
                     TIGR01711"
                     /db_xref="CDD:130772"
     misc_feature    142704..143171
                     /locus_tag="Hneap_0147"
                     /note="Type II secretion system (T2SS), protein J; Region:
                     T2SJ; pfam11612"
                     /db_xref="CDD:256530"
     gene            143300..144247
                     /locus_tag="Hneap_0148"
                     /db_xref="GeneID:8533262"
     CDS             143300..144247
                     /locus_tag="Hneap_0148"
                     /inference="protein motif:PFAM:PF03934"
                     /note="PFAM: general secretion pathway protein K;
                     KEGG: psa:PST_0131 general secretion pathway protein K"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein K"
                     /protein_id="YP_003262059.1"
                     /db_xref="GI:261854776"
                     /db_xref="InterPro:IPR005628"
                     /db_xref="GeneID:8533262"
                     /translation="MTRVNRFASPTRQQGVALIVALLVLAIATGLAAAVMVRNQNALD
                     ATAAFENGARADQLANSAFLLAKALLDRDDRNSDGPADLWAQPLANIPIDGATVSLTI
                     SDLQGRFNINNLLLPDGKVNLLGKERFARLLNLLNLSPDISNEIIGWIDPSRSLSLGF
                     NSAASRSGNMPAGQPMMSVTELRSLAGVTPAYYDKLAPYVTALPIGTPVNLNSAPPLV
                     LQAIGANAASLPVVADSKTPPPNIGSVADFLARPGFAGAVTQPDGLSVNSQFFLCAVT
                     VQFDQVVRHRYALIYRPQSGPSQVIALSNEPCLTGSSCL"
     misc_feature    143336..144205
                     /locus_tag="Hneap_0148"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cl19066"
                     /db_xref="CDD:267419"
     misc_feature    143411..144199
                     /locus_tag="Hneap_0148"
                     /note="Type II secretion system (T2SS), protein K; Region:
                     T2SK; pfam03934"
                     /db_xref="CDD:252257"
     gene            144220..145470
                     /locus_tag="Hneap_0149"
                     /db_xref="GeneID:8533263"
     CDS             144220..145470
                     /locus_tag="Hneap_0149"
                     /inference="protein motif:COG:COG3297"
                     /note="KEGG: swd:Swoo_4726 general secretion pathway
                     protein L"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretory pathway component PulL-like
                     protein"
                     /protein_id="YP_003262060.1"
                     /db_xref="GI:261854777"
                     /db_xref="GeneID:8533263"
                     /translation="MSDRLFLFVTNREATELHWWQPEHSAQSASPALGDWDAFADWQA
                     KANLRRPVTLSVLLPDSVCSRLIVPIPGTRREKALQALPFALEDLVADDLSQLYPVLA
                     ERPLSPGRWPVLLVDADVRTRVLDALKDQGLVPQHLVAMADTLPQPEMGEFCVWVDPV
                     QEHISVLTGPHEGMALAPSTVHNAAEQLAEWLPRMTPAPNRVAFHVPLDQPAHWPEGI
                     EFTAQAAPDWAQWHQLWQAGLEQNRALSAITSAKAVNDQQWQRRWWQVAAAAGVVLVL
                     LLVAQGIKTAQMNHQAERLQTQITQDFHAALPQITRMVNVRVQLQQALDQRVGAHEDT
                     FMPALAAFGSAYQVAKPQDAQLVIKSIRFGEQQLTVELTAQKYAVLQQLLEHLKKNAP
                     AEVKQIDAGVDAGVAHMRIGIKAL"
     misc_feature    144220..145431
                     /locus_tag="Hneap_0149"
                     /note="Type II secretory pathway, component PulL
                     [Intracellular trafficking and secretion]; Region: PulL;
                     COG3297"
                     /db_xref="CDD:225834"
     misc_feature    144232..144951
                     /locus_tag="Hneap_0149"
                     /note="Type II secretion system (T2SS), protein L; Region:
                     T2SL; pfam05134"
                     /db_xref="CDD:253032"
     misc_feature    145060..145434
                     /locus_tag="Hneap_0149"
                     /note="GspL periplasmic domain; Region: GspL_C; cl14909"
                     /db_xref="CDD:265479"
     gene            145507..146025
                     /locus_tag="Hneap_0150"
                     /db_xref="GeneID:8533264"
     CDS             145507..146025
                     /locus_tag="Hneap_0150"
                     /inference="protein motif:PFAM:PF04612"
                     /note="PFAM: general secretion pathway M protein;
                     KEGG: aeh:Mlg_2384 general secretion pathway M protein"
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway M protein"
                     /protein_id="YP_003262061.1"
                     /db_xref="GI:261854778"
                     /db_xref="InterPro:IPR007690"
                     /db_xref="GeneID:8533264"
                     /translation="MMKAPVWFSSFWQQRNQSERRTLTLAAIALVALVGYQFVWSPMQ
                     QAVQRAHDRLAQAEQLAAFTAQAKKALMQAGPKSAQPSADSPMLWVEQAARTVGIEQQ
                     LVQRQPDGDDRVQLKFAAVPFDLLLRWLAQANDAGLSVQSANITPKNGDSSDAAGLVD
                     AEITLAKRAAAS"
     misc_feature    145525..146013
                     /locus_tag="Hneap_0150"
                     /note="Type II secretion system (T2SS), protein M; Region:
                     T2SM; pfam04612"
                     /db_xref="CDD:252702"
     gene            146022..146858
                     /locus_tag="Hneap_0151"
                     /db_xref="GeneID:8533265"
     CDS             146022..146858
                     /locus_tag="Hneap_0151"
                     /inference="protein motif:PFAM:PF01203"
                     /note="PFAM: type II secretion system protein N;
                     KEGG: cps:CPS_4581 general secretion pathway protein N"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein N"
                     /protein_id="YP_003262062.1"
                     /db_xref="GI:261854779"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR000645"
                     /db_xref="GeneID:8533265"
                     /translation="MSRTPLKELALRRPRSLVRLGVFIVLVSWFTALLATAPITLIPV
                     SRLTLPPGVQLQPLGGTVWHGQWRLSLPRAPDMTVQTDFLPSSVFRLQLAWHVQAQTD
                     ARTSPTNANPNIGADLAIGFKQLNVRNFQGRMSADSPLIASLTAWPLSGLIDFSGDAS
                     LVRTKRGFDLQAARATANWRNAEITTTEPLALGDLVFDAKIAQGQLNATVKPAPNNAG
                     PLLGELNLAGTWPVAKAPAVRGYVQPTARASAALRQQLSLLGRPDASGKITIQGVLPG
                     RY"
     misc_feature    146160..146834
                     /locus_tag="Hneap_0151"
                     /note="Type II secretion system (T2SS), protein N; Region:
                     T2SN; pfam01203"
                     /db_xref="CDD:250440"
     gene            147180..147905
                     /locus_tag="Hneap_0152"
                     /db_xref="GeneID:8533266"
     CDS             147180..147905
                     /locus_tag="Hneap_0152"
                     /inference="similar to AA sequence:KEGG:Tcr_0042"
                     /note="KEGG: tcx:Tcr_0042 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262063.1"
                     /db_xref="GI:261854780"
                     /db_xref="GeneID:8533266"
                     /translation="MWQTIKNLWFQDPSAKPILINDTAVRIRAGMLLAIPIYMGFTLW
                     SARFGGHWIVDGDTIHDTLDTDWDGHIIYSANVIRRTWDYTIQTYVLFYGLFEMIAGM
                     FVWTSRLSPTILLSSFLARKQHALWKPLTPKRYAWSLGAFMIALCLIFFNPSTFADWV
                     NAIAGRTLLPDTSQYLSYWIPSLVFVCVAFMWLEAVLGFCVGCKIHWLLVKLGVHKEE
                     CLACNNIDWDEIARRKAEQAGNG"
     misc_feature    147438..147815
                     /locus_tag="Hneap_0152"
                     /note="Domain of unknown function (DUF4395); Region:
                     DUF4395; pfam14340"
                     /db_xref="CDD:258513"
     gene            complement(148001..149341)
                     /locus_tag="Hneap_0153"
                     /db_xref="GeneID:8533267"
     CDS             complement(148001..149341)
                     /locus_tag="Hneap_0153"
                     /inference="similar to AA sequence:KEGG:PSHAa2968"
                     /note="KEGG: pha:PSHAa2968 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262064.1"
                     /db_xref="GI:261854781"
                     /db_xref="GeneID:8533267"
                     /translation="MSLADAPVAPVYDQAQLDQMAKAMATMQAQIKAMQAKLAAVRAK
                     NATLEAQQETERKNQSAKKVNNKPDATKPSQTDKSLIQRVADAVAKKNAAPIKVGGAV
                     RFNYTLEQFNQNSRNTVGDLNFDTFRLNLDGQIDNVILSAEWRYYDYMQVIHHAWVGY
                     KFTPNWLVRAGVVKVPFGNLPFNSNSYYFSSLFYAGFEDNYQLGLSTTYDLGNWRFDA
                     AFLKNPQPNGFGTSSYSENVVGFDNGLDPSDPNYQRTDAKPINTVVGRAEYTWKANDD
                     LTLKPGLSLMRGSLYGQNQREGDYHAYAAHLVADWQRWNLKLEYADYDYALNNKLAER
                     LVYGAYAYNSFGPTSAKAVTAGVAYALPVHWGPISKLNFYNDFSRIYDKNDGIDPTWM
                     NVSGVSVVAGPVFAYFDFVQGKNQPFVGGNLAPARGSGNAPINRLFNINLGYYF"
     misc_feature    complement(<149051..>149305)
                     /locus_tag="Hneap_0153"
                     /note="TolA protein; Region: tolA_full; TIGR02794"
                     /db_xref="CDD:234017"
     misc_feature    complement(<149066..149302)
                     /locus_tag="Hneap_0153"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl19113"
                     /db_xref="CDD:267466"
     misc_feature    complement(<148640..>149035)
                     /locus_tag="Hneap_0153"
                     /note="Carbohydrate-selective porin, OprB family; Region:
                     OprB; cl17816"
                     /db_xref="CDD:266858"
     gene            150296..152344
                     /locus_tag="Hneap_0154"
                     /db_xref="GeneID:8533268"
     CDS             150296..152344
                     /locus_tag="Hneap_0154"
                     /inference="protein motif:TFAM:TIGR00842"
                     /note="TIGRFAM: choline/carnitine/betaine transporter;
                     PFAM: BCCT transporter;
                     KEGG: ilo:IL2388 choline-glycine betaine transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="choline/carnitine/betaine transporter"
                     /protein_id="YP_003262065.1"
                     /db_xref="GI:261854782"
                     /db_xref="InterPro:IPR000060"
                     /db_xref="GeneID:8533268"
                     /translation="MSTSAPKKLNSTLLAPVFIPSIIVITLLVIGTVADPKRAGDAFS
                     ATLAFITNDFGWFYMLAVALFLIFIVVVAISPWGKIKLGPDHAEPEYSFSAWFAMLFS
                     AGYGIALLFFGVAEPVLHYADPPVGDPRTIEAARQSMQITFFHWGFHIWAIYGLVGLV
                     LAYFGFRHGLPLSMRSALYPLVGDRIYGPIGHTVDVFAVLGTMFGIATTLGLSVAQLN
                     AGLNYLWPSVPVNITVQIISIALITALATLSVVAGMDAGIKRLSQLNMLLAIALMLFV
                     FAVGPTVFILKTFMQNTGSYLSNIVERSFSLEAYTGGKWIGNWTLFIFGWTIAWAPFV
                     GLFIAKISRGRTIRQFVLGVMVVPTLFTFFWFSVFGDTALHAIMVDGYTHLIDQVEQN
                     KAIALFKLFEHLPFASITSFLAIILIVTFFVTSADSGALVVDSLASGGALRTPVWQRI
                     FWASSQGVLAAVLLLAGGLSALQTASITSALPFAIIMLISAVGLWRALQIEGYRETSL
                     QHHMNSGRHNRLGDSNHWEKRLRNLVDFPSRENVSKYIETTVADSLKTVEAELKKQDW
                     PVKLTQNKELCRYKLSVISGEDMAFEYEVRLRGFAKPSYAFPAITRDNDGDEQYYRAE
                     VFMRRGGLAYDVYGYEKDQLISDVLDHFEKYMHFLHTTPAILPWKVVDDEEGEVSGAK
                     "
     misc_feature    150344..151798
                     /locus_tag="Hneap_0154"
                     /note="BCCT family transporter; Region: BCCT; pfam02028"
                     /db_xref="CDD:251048"
     gene            152452..153762
                     /locus_tag="Hneap_0155"
                     /db_xref="GeneID:8533269"
     CDS             152452..153762
                     /locus_tag="Hneap_0155"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: tgr:Tgr7_0929 major facilitator transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_003262066.1"
                     /db_xref="GI:261854783"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:8533269"
                     /translation="MLKTVVSIQALLLGMAILLAGSGMLSTLLGLRAQQEGMSTTVLG
                     LVMSGFYLGYILGTYLLPSLIRRVGHVRVFAAMAALSASAALLHGLWLNEWLWLTLRV
                     ISGFALLGLYMVIESWLNAQISHYRGQIFGIYMMVSLLALAVGQFLIGIYGVSGLASF
                     MVVALLFALGLVPVALTRATQPVPVEAARLSVRAIYDNAPTGLIGSLLSGTATGALWG
                     LAAVYGAHIGLDAARAALFVALLIFGGALLQWPIGKLSDHYDRRWVLIGLGLAGILSG
                     GVMIAITLISGPGNIADSPLRWALWIGGLLFGGFVFSVYAISVAQTHDRLSNDQVLEA
                     TRTLLLVNGIGALFGPLSAGMFMSWFGANGLIGFIMLVLSVLGLFTYWRIRIDRPVPE
                     DERGEFVVTTRTSAAAADWDPRTPEAGDRLSEQFADELLTTKSG"
     misc_feature    152479..153603
                     /locus_tag="Hneap_0155"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    152482..153564
                     /locus_tag="Hneap_0155"
                     /note="putative MFS family transporter protein;
                     Provisional; Region: PRK03633"
                     /db_xref="CDD:179614"
     misc_feature    order(152515..152517,152524..152532,152536..152541,
                     152590..152592,152599..152604,152611..152613,
                     152623..152628,152632..152637,152773..152778,
                     152785..152790,152797..152802,152809..152811,
                     152842..152847,152854..152859,152875..152877,
                     153076..153078,153085..153090,153097..153102,
                     153109..153111,153151..153153,153163..153165,
                     153175..153177,153184..153186,153196..153198,
                     153373..153375,153382..153387,153394..153396,
                     153406..153411,153418..153420,153451..153456,
                     153463..153468,153475..153480,153487..153489)
                     /locus_tag="Hneap_0155"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(153774..155000)
                     /locus_tag="Hneap_0156"
                     /db_xref="GeneID:8533270"
     CDS             complement(153774..155000)
                     /locus_tag="Hneap_0156"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: afr:AFE_1977 fosmidomycin resistance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_003262067.1"
                     /db_xref="GI:261854784"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:8533270"
                     /translation="MSTTLTDTPQPVSPAAPVETQYRVLGAISVSHFLNDLMQSLMIS
                     IYPLFKSNFDLSFAQIGLITLCFQLTASILQPLIGQAIDRRPMPYSLVLGMGFTFSGL
                     ITLAFAPSYGFLLAGAAMVGIGSSIFHPESSRVARMASGKRPGLAQSIFQVGGNGGSA
                     AGPLLAALIVIPHGQVSISWFSAAALLAMVVLFFVGRWATVQHRKPKTARHLPPVDLS
                     RSMRLWILFGLLTLMFSKFLYLASMNNYLTFYLMHRFELPVQSAQLHLFILLFAVAAG
                     TLMGGPIGDRIGRQRVIWLSILGVAPFTLLLPHMGLEVQSILLLVIGFVLASAFPAMV
                     VYAQELFPNRIGAVSGLFFGFAFGTAGIGAALLGQFADHFGIDTLIFYCSFLPLIGVI
                     ALLLPDLREVPASSPT"
     misc_feature    complement(153813..154928)
                     /locus_tag="Hneap_0156"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(153909..154919)
                     /locus_tag="Hneap_0156"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(153921..153923,153930..153935,
                     153942..153947,153954..153959,153987..153989,
                     153996..154001,154011..154013,154020..154025,
                     154032..154034,154170..154172,154182..154184,
                     154191..154193,154203..154205,154215..154217,
                     154257..154259,154266..154271,154278..154283,
                     154290..154292,154524..154526,154542..154547,
                     154554..154559,154593..154595,154599..154604,
                     154611..154616,154623..154628,154764..154769,
                     154773..154778,154788..154790,154797..154802,
                     154809..154811,154860..154865,154869..154877,
                     154884..154886))
                     /locus_tag="Hneap_0156"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            155248..156309
                     /locus_tag="Hneap_0157"
                     /db_xref="GeneID:8533271"
     CDS             155248..156309
                     /locus_tag="Hneap_0157"
                     /inference="protein motif:PFAM:PF01476"
                     /note="PFAM: peptidoglycan-binding lysin domain; TPR
                     repeat-containing protein; hypothetical protein;
                     SMART: peptidoglycan-binding LysM; Tetratricopeptide
                     repeat;
                     KEGG: azo:azo0897 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding lysin domain-containing
                     protein-containing protein"
                     /protein_id="YP_003262068.1"
                     /db_xref="GI:261854785"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002482"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR018392"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="GeneID:8533271"
                     /translation="MRASMVFSFRTMLLVTLLTLGAVSISGCAQVQDFGKMLKNAQTS
                     SATPSSASDAATGVGQKKSADKPAPSLSLKQIMYLIENGEHAQARAALETFLKNDPKN
                     PMARNLQKQLTIDPAKALGPAVSTYTVQPGDTLGGLAAKFLGNPMDFVILGRYNDIKR
                     GRDLQVGQTIKIPSKKKLKALPDEPQTIKANEPTAETPAVIPATSEGAESSTSTEKPA
                     LPASESQTVNSTVVKSNTLVKPISPAEEAKALAAQQAGLAAMQKNQLEEAAKDFSRAL
                     AIDPSLELAKTRAAQVQQKRVQQYHEAALVAYRKQHLDEAIALWDKALALDPNYEPAL
                     GYRARAQELKRRLGQLNQQ"
     misc_feature    155623..155763
                     /locus_tag="Hneap_0157"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     misc_feature    156025..156294
                     /locus_tag="Hneap_0157"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    156025..156231
                     /locus_tag="Hneap_0157"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    order(156049..156051,156061..156063,156070..156072,
                     156157..156159,156193..156195,156205..156207,
                     156214..156216,156259..156261)
                     /locus_tag="Hneap_0157"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(156148..156153,156157..156162,156169..156174,
                     156250..156255,156262..156267,156274..156279)
                     /locus_tag="Hneap_0157"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            complement(156405..158078)
                     /locus_tag="Hneap_0158"
                     /db_xref="GeneID:8533272"
     CDS             complement(156405..158078)
                     /locus_tag="Hneap_0158"
                     /inference="protein motif:PFAM:PF00069"
                     /note="PFAM: serine/threonine protein kinase-related;
                     tyrosine protein kinase; histidine kinase HAMP region
                     domain protein;
                     SMART: serine/threonine protein kinase; tyrosine protein
                     kinase; histidine kinase HAMP region domain protein;
                     KEGG: azo:azo0898  serine/threonine protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="YP_003262069.1"
                     /db_xref="GI:261854786"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="GeneID:8533272"
                     /translation="MSKMFGRFEIQGELGRGAMAIIYRGYDPKIERTLAIKTLRPEFS
                     AHAEYRERFLTEAKAAGTLNHPHIVTIFDVGEVDGIPFIAMELLTGMTLGQFGESHPE
                     GIPPGTLVELAIQIADALDFAHRHGVVHQDIKPENIILQHDQLNIKMMDFGIARIIRD
                     ADAPSSKGARAFLSGTPQYMSPEQITDQPIDGRSDLYSLGVVLFELLAGHRPYQDDDH
                     WVVWQKVLKDPLPTLRPLNPRTPPDLIELVNTLLAKDPDGRYQSAAGVAADLRSIAQR
                     MNEGTERWLSSSVIPLRIRWPLLMALVVAVAMVLGMIWVYHKQNNVITELAYDYGFSL
                     SEWVAVQTAEDLLLQDKLALQSWVDSMSHNREIVYMAIRGDKGQIEAQTRGDQLVARM
                     AAQLKEDHVVLSRGDLRVYAVQQDAGAPFYVFETPITYQNHTIGQLRIGLTTDALATA
                     NRTTLLTLLTWFAIVLLVVVAGTYWLTRRLQMPLDAVSNALDQIKMGRLEHRIRMHRR
                     DDFERLFAAYNAMADVLEARQLQRDASQIEQDLPLGVDKHLATVKDPVE"
     misc_feature    complement(157299..158057)
                     /locus_tag="Hneap_0158"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    complement(157461..158039)
                     /locus_tag="Hneap_0158"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(157545..157556,157617..157619,
                     157626..157628,157662..157664,157668..157673,
                     157677..157679,157683..157685,157797..157799,
                     157803..157805,157815..157826,157872..157874,
                     157968..157970,157974..157976,158013..158015,
                     158025..158039))
                     /locus_tag="Hneap_0158"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(157626..157628,157662..157664,
                     157668..157673,157677..157679,157683..157685,
                     157803..157805,157815..157826,157872..157874,
                     157968..157970,157974..157976,158013..158015,
                     158025..158039))
                     /locus_tag="Hneap_0158"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(157545..157556,157617..157619,
                     157671..157673,157677..157679,157683..157685,
                     157797..157799,157803..157805,158025..158027))
                     /locus_tag="Hneap_0158"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(157545..157556,157611..157631))
                     /locus_tag="Hneap_0158"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(<156465..156692)
                     /locus_tag="Hneap_0158"
                     /note="Methyl-accepting chemotaxis protein [Cell motility
                     and secretion / Signal transduction mechanisms]; Region:
                     Tar; COG0840"
                     /db_xref="CDD:223910"
     misc_feature    complement(156498..156632)
                     /locus_tag="Hneap_0158"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(156504..156509,156516..156521,
                     156525..156530,156537..156542,156546..156551,
                     156597..156599,156603..156608,156615..156620,
                     156624..156629))
                     /locus_tag="Hneap_0158"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     gene            complement(158292..158810)
                     /locus_tag="Hneap_0159"
                     /db_xref="GeneID:8533273"
     CDS             complement(158292..158810)
                     /locus_tag="Hneap_0159"
                     /inference="protein motif:PFAM:PF00498"
                     /note="PFAM: Forkhead-associated protein;
                     SMART: Forkhead-associated protein;
                     KEGG: azo:azo0899 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FHA domain-containing protein"
                     /protein_id="YP_003262070.1"
                     /db_xref="GI:261854787"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="GeneID:8533273"
                     /translation="MENVQYQTKPQYAGTQGTLLVAKNDDRIHSLDETEQPAHINLDQ
                     PALIGLTPPFINQRFTLRQGKTTIGRRADNNIVLADGSVSSLHAWIIEDNGQYRVMNI
                     LSTNGSFVNDARITEAPLQDGDRIRFGGVELQLHTGLANKKTASSGKNILLAFAAIGI
                     VALVALGWVFMR"
     misc_feature    complement(158403..158678)
                     /locus_tag="Hneap_0159"
                     /note="Forkhead associated domain (FHA); found in
                     eukaryotic and prokaryotic proteins. Putative nuclear
                     signalling domain. FHA domains may bind phosphothreonine,
                     phosphoserine and sometimes phosphotyrosine. In
                     eukaryotes, many FHA domain-containing proteins...;
                     Region: FHA; cd00060"
                     /db_xref="CDD:238017"
     misc_feature    complement(158412..>158654)
                     /locus_tag="Hneap_0159"
                     /note="FOG: FHA domain [Signal transduction mechanisms];
                     Region: COG1716"
                     /db_xref="CDD:224630"
     misc_feature    complement(order(158490..158498,158556..158561,
                     158565..158567,158601..158603))
                     /locus_tag="Hneap_0159"
                     /note="phosphopeptide binding site; other site"
                     /db_xref="CDD:238017"
     gene            complement(159004..159393)
                     /locus_tag="Hneap_0160"
                     /db_xref="GeneID:8533274"
     CDS             complement(159004..159393)
                     /locus_tag="Hneap_0160"
                     /EC_number="1.7.1.13"
                     /inference="protein motif:TFAM:TIGR03139"
                     /note="KEGG: aeh:Mlg_0678 GTP cyclohydrolase I;
                     TIGRFAM: 7-cyano-7-deazaguanine reductase;
                     PFAM: GTP cyclohydrolase I/nitrile oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="7-cyano-7-deazaguanine reductase"
                     /protein_id="YP_003262071.1"
                     /db_xref="GI:261854788"
                     /db_xref="InterPro:IPR016856"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="GeneID:8533274"
                     /translation="MSTQPSKTLETFPNPFPDRDYTIHMTIPEFTCLCPKTGQPDFAT
                     ITLDFVPDQLCVELKSLKTYMWSFREEGGFHEAMTNGILNDLVAAISPRFMRVTGEWN
                     VRGGIYTNVVVEHRQPGWTPAPKIDLP"
     misc_feature    complement(159037..159378)
                     /locus_tag="Hneap_0160"
                     /note="7-cyano-7-deazaguanine reductase; Provisional;
                     Region: PRK13258"
                     /db_xref="CDD:237320"
     gene            159531..163034
                     /locus_tag="Hneap_0161"
                     /db_xref="GeneID:8533275"
     CDS             159531..163034
                     /locus_tag="Hneap_0161"
                     /inference="protein motif:TFAM:TIGR02168"
                     /note="TIGRFAM: chromosome segregation protein SMC;
                     PFAM: SMC domain protein;
                     KEGG: tgr:Tgr7_2026 chromosome segregation SMC protein"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein SMC"
                     /protein_id="YP_003262072.1"
                     /db_xref="GI:261854789"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR011890"
                     /db_xref="GeneID:8533275"
                     /translation="MRLTRLYLAGFKSFAAPTEILLPAERVAIVGPNGCGKSNLIDAI
                     RWVLGESSAKQLRGQSLDDVIFAGSGQRPAASQAVVELSFDNSARRLSGPFGAYDQIV
                     ICRSLGRDGQSRYSINQTRVRRRDVVDLFLGTGVGARSYSVIEQGQINRVVDAKPEDL
                     RAYLEETAGISLYRERRRETESRIQQTQDNLSRLSDIADELGRQKTQLERQARTAERY
                     RELQKKRRRQVVEQAAVQVVLTERANAALDAEWQTAQAHMTTVAERMAQVELRCAQED
                     EARTSAQSDLQQVQARQYQLGAEQAQLQGRLGELAARIESAEQQRQDDLAQRTRLEAA
                     CTRLQAELSRLAEERRTLESQRQQAAEQRAKAQAELRAADTHLNEMRAEWARSHDDLA
                     RPQQDLAAAKAEHAALLRQLQRLETERASVTSRDFTEPMAASIQQIQDAETRMGALEQ
                     SHSAGEVVLAEQQTVLAELSDRAAAMQKEAQTLRQNADALQAERRGLERALAAHQTSK
                     DDAPRAERLIQRLAKAHADAWWGHALGAGIEAACVDDLDALMVAWRADQIPATGWWVA
                     PDSQRSEPKSDLEQKRSPSDALAPWLRDWQHTRHPAPSLNEALAQRHTLPSGHCFVLA
                     DGWQVGRHWIGRGGSDQAAVRLAQQTRLAELQQAGTEAETTAEQAQIEYQRIQNQLAQ
                     QRKQVERLVAEQHQFEQQRQRLHWSLEDLRRKYQQLKQQQADRAANVARMEAEHKQLS
                     ADRGQLEDTIRRLEQIVAQARSARDAFNARQQTAEQTVQVLRRQAGEAGQALQQLERT
                     VDRNQHQFEQAQQSLARDEAQMVQIDQRLAQFADRLDGLITQQSERQAEFTALSARQH
                     EIAQAEKAALALVHEHTQAVQTAGVERHETQVALEKARAAVQALELQRAQLAVREDHA
                     GEALTLALDQWRDDQQSLDAEAIKRLADIPNIAEAQAAELSTLEQQIARLGAVNLTAI
                     EAFAEAEARKSELDGQIEDVQAALDQLQEAIRTLDKQTRAQFRSVFDAVNARIGPLFV
                     QLFGGGEARLELSGADDLDAGVLLFAKPPGKKVTQLSLLSGGERALTAVALIFALFEL
                     NPAPFCILDEVDAPLDEANVGRFCAMVSAMSDRVQFLFVTHNKTTMASASALVGVTMR
                     EAGVSRIVSVDVDRAVQLLES"
     misc_feature    159534..163004
                     /locus_tag="Hneap_0161"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:233757"
     misc_feature    159537..>159806
                     /locus_tag="Hneap_0161"
                     /note="ATP-binding cassette domain of barmotin, a member
                     of the SMC protein family; Region: ABC_SMC_barmotin;
                     cd03278"
                     /db_xref="CDD:213245"
     misc_feature    159621..159644
                     /locus_tag="Hneap_0161"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213245"
     misc_feature    order(159630..159635,159639..159647)
                     /locus_tag="Hneap_0161"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213245"
     misc_feature    161526..161807
                     /locus_tag="Hneap_0161"
                     /note="Sensor protein DegS; Region: DegS; pfam05384"
                     /db_xref="CDD:147523"
     misc_feature    <162705..162986
                     /locus_tag="Hneap_0161"
                     /note="ATP-binding cassette domain of barmotin, a member
                     of the SMC protein family; Region: ABC_SMC_barmotin;
                     cd03278"
                     /db_xref="CDD:213245"
     misc_feature    162735..162764
                     /locus_tag="Hneap_0161"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213245"
     misc_feature    162807..162824
                     /locus_tag="Hneap_0161"
                     /note="Walker B; other site"
                     /db_xref="CDD:213245"
     misc_feature    162831..162842
                     /locus_tag="Hneap_0161"
                     /note="D-loop; other site"
                     /db_xref="CDD:213245"
     misc_feature    162903..162923
                     /locus_tag="Hneap_0161"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213245"
     gene            163039..164034
                     /locus_tag="Hneap_0162"
                     /db_xref="GeneID:8533276"
     CDS             163039..164034
                     /locus_tag="Hneap_0162"
                     /inference="protein motif:TFAM:TIGR02205"
                     /note="KEGG: pay:PAU_01407 cell division protein zipa
                     homolog;
                     TIGRFAM: cell division protein ZipA;
                     PFAM: ZipA FtsZ-binding region;
                     SMART: ZipA FtsZ-binding region"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZipA"
                     /protein_id="YP_003262073.1"
                     /db_xref="GI:261854790"
                     /db_xref="InterPro:IPR007449"
                     /db_xref="InterPro:IPR011919"
                     /db_xref="GeneID:8533276"
                     /translation="MEWLRWIFLAAGVLALAGIVWVYLRHKSEQAVELGSGRTEANLD
                     DPIDVRIRAQEDARAKSADITLDSALDEAINEGIIGQVKVKERVDPVITPATEPHEVE
                     PEPLRWQHPTFTRKNEPEPIDVDDALGLADAEGVIGAVRRKMLDDVPETTGSLFRRRQ
                     TPHFSYQEKQDSSSDHAELEAPSSAQSTQKNIKQNMGRDADPVVLPLLVASTDGAVFP
                     GDRVENLIEEIGFEYGALSIYHYPGELGETLFSLMNGVKPGTFDRGNSASFATPVLAL
                     FMQLPLDGPSESLILDQMIDIARDIADQLGGEVLDDQRLPLTSESIDRYREQLNS"
     misc_feature    163039..164025
                     /locus_tag="Hneap_0162"
                     /note="Cell division protein [Cell division and chromosome
                     partitioning]; Region: ZipA; COG3115"
                     /db_xref="CDD:225657"
     misc_feature    163642..164025
                     /locus_tag="Hneap_0162"
                     /note="ZipA C-terminal domain. ZipA, a membrane-anchored
                     protein, is one of at least nine essential gene products
                     necessary for assembly of the septal ring which mediates
                     cell division in E.coli. ZipA and FtsA directly bind FtsZ,
                     a homolog of eukaryotic...; Region: ZipA; cl12038"
                     /db_xref="CDD:264519"
     misc_feature    order(163648..163650,163654..163656,163744..163746,
                     163750..163752,163795..163797,163801..163809,
                     163861..163863,163867..163869,163978..163980)
                     /locus_tag="Hneap_0162"
                     /note="FtsZ protein binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:238142"
     gene            164040..166097
                     /locus_tag="Hneap_0163"
                     /db_xref="GeneID:8533277"
     CDS             164040..166097
                     /locus_tag="Hneap_0163"
                     /EC_number="6.5.1.2"
                     /inference="protein motif:TFAM:TIGR00575"
                     /note="KEGG: tgr:Tgr7_2024 DNA ligase (NAD(+));
                     TIGRFAM: DNA ligase, NAD-dependent;
                     PFAM: NAD-dependent DNA ligase adenylation; BRCT domain
                     protein; helix-hairpin-helix motif; zinc-finger
                     NAD-dependent DNA ligase C4-type; NAD-dependent DNA ligase
                     OB-fold;
                     SMART: NAD-dependent DNA ligase ; BRCT domain protein;
                     DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase"
                     /protein_id="YP_003262074.1"
                     /db_xref="GI:261854791"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR001679"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR004149"
                     /db_xref="InterPro:IPR004150"
                     /db_xref="InterPro:IPR013839"
                     /db_xref="InterPro:IPR013840"
                     /db_xref="InterPro:IPR018239"
                     /db_xref="GeneID:8533277"
                     /translation="MASSLPDLFSAPSEDGDRARLLALRDEIERHNFRYYVLDDPEIS
                     DAAFDRLMRELQQIESAHPEWITPDSPTQRVGSPTFTTRFAPVTHHQAMLSLDNVFSV
                     EEWDAFTQRIQDRLKRDAPLVFAAEPKFDGLAINLIYRQGQLVQAATRGDGQTGEDVT
                     LNVRTIAAIPQQLPDSLLSCDLLEVRGEIVMSHKAFAALNAAADARGDKRFVNPRNAA
                     AGSLRQKDPRITAKRQLQFFAYGVGAVDGADLPDSQLGLLDWLADLGFTVSEWRRRCE
                     GRDEVLAYQQEMSARRSQLDYDIDGVVFKINAQSEQDALGFVAKAPRWAIAFKFPAEE
                     ATSRVHAVDFQVGRTGALTPVARIDPVFVGGVTVSNITLHNIDEITRKDIRIGDTVVV
                     RRAGDVIPEVVRVLPELRPADARLVALPATCPVCGSEVVRAEGEAIARCSGGLFCPAQ
                     RREAIKHFASRKAMNIDGLGEKWIELLLEHKLVEHVDDLFHLTVPQVLTLPRMGEKSA
                     QNLVDALSAAKQTTLPRFLYALGIREVGEVTAAGLAAHFRNLDALNAATLEDLQAVPD
                     VGPVVAQHVFTFLRQPHNQEVIRNLIDAGVHWPAIVATDANALPLAGRTYVLTGTLVG
                     MSREEAGERLKALGAKVSGSVSSKTTAVIAGSEAGSKLTKANDLGVPVLDETDLQKLL
                     RNL"
     misc_feature    164091..166094
                     /locus_tag="Hneap_0163"
                     /note="NAD-dependent DNA ligase LigA; Validated; Region:
                     ligA; PRK07956"
                     /db_xref="CDD:236137"
     misc_feature    164094..165035
                     /locus_tag="Hneap_0163"
                     /note="NAD+ dependent DNA ligase adenylation domain. DNA
                     ligases catalyze the crucial step of joining the breaks in
                     duplex DNA during DNA replication, repair and
                     recombination, utilizing either ATP or NAD(+) as a
                     cofactor, but using the same basic reaction...; Region:
                     LIGANc; cd00114"
                     /db_xref="CDD:238062"
     misc_feature    order(164325..164327,164418..164420,164424..164426,
                     164487..164489,164601..164603,164757..164759,
                     164946..164948,164952..164954)
                     /locus_tag="Hneap_0163"
                     /note="nucleotide binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238062"
     misc_feature    order(164424..164426,164430..164435)
                     /locus_tag="Hneap_0163"
                     /note="K-X-D-G motif; other site"
                     /db_xref="CDD:238062"
     misc_feature    164424..164426
                     /locus_tag="Hneap_0163"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238062"
     misc_feature    165042..165284
                     /locus_tag="Hneap_0163"
                     /note="NAD-dependent DNA ligase OB-fold domain; Region:
                     DNA_ligase_OB; pfam03120"
                     /db_xref="CDD:145978"
     misc_feature    165303..165386
                     /locus_tag="Hneap_0163"
                     /note="NAD-dependent DNA ligase C4 zinc finger domain;
                     Region: DNA_ligase_ZBD; pfam03119"
                     /db_xref="CDD:251739"
     misc_feature    165408..165584
                     /locus_tag="Hneap_0163"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     misc_feature    165612..165803
                     /locus_tag="Hneap_0163"
                     /note="Helix-hairpin-helix motif; Region: HHH_2;
                     pfam12826"
                     /db_xref="CDD:257328"
     misc_feature    165876..166088
                     /locus_tag="Hneap_0163"
                     /note="Breast Cancer Suppressor Protein (BRCA1),
                     carboxy-terminal domain. The BRCT domain is found within
                     many DNA damage repair and cell cycle checkpoint proteins.
                     The unique diversity of this domain superfamily allows
                     BRCT modules to interact forming homo...; Region: BRCT;
                     cd00027"
                     /db_xref="CDD:237994"
     misc_feature    order(165921..165923,165933..165935,165942..165944,
                     165951..165953,165957..165959)
                     /locus_tag="Hneap_0163"
                     /note="Dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:237994"
     misc_feature    order(166068..166070,166080..166082)
                     /locus_tag="Hneap_0163"
                     /note="BRCT sequence motif; other site"
                     /db_xref="CDD:237994"
     gene            166146..167123
                     /locus_tag="Hneap_0164"
                     /db_xref="GeneID:8533278"
     CDS             166146..167123
                     /locus_tag="Hneap_0164"
                     /EC_number="2.5.1.30"
                     /inference="protein motif:PRIAM:2.5.1.30"
                     /note="PFAM: polyprenyl synthetase;
                     KEGG: dar:Daro_0658 polyprenyl synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="trans-hexaprenyltranstransferase"
                     /protein_id="YP_003262075.1"
                     /db_xref="GI:261854792"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="GeneID:8533278"
                     /translation="MPNMTVDQIRELAAPDMARVNTVIQAKLASDVALINQLSQYIIG
                     AGGKRFRPMVLMLAAQALGGTSPWAAQMAAVVELIHTATLLHDDVVDESTLRRGRDTA
                     NALFGNAASVLTGDFLYSRAFEMMVEVQEPRVMAILAQATNRIAEGEVLQLMNMGDAD
                     VSEDRYVDVIVRKTATLFAAATQLAAVLEGQPEEVEAALTAYGLHLGTAFQLIDDVLD
                     YTGDEAHTGKHVGDDLAEGKPTLPLIIAMQRGDEATVAMIRRAITEQDARDIEAICSA
                     IEHTGALAYTAHRAQAEADRAKQAIAAVPDSPFKEALLALADAAVVRNH"
     misc_feature    166233..166976
                     /locus_tag="Hneap_0164"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-tail; Region: Trans_IPPS_HT; cd00685"
                     /db_xref="CDD:173833"
     misc_feature    order(166380..166382,166389..166397,166401..166409,
                     166413..166418,166431..166436,166590..166592,
                     166599..166601,166662..166667,166674..166676,
                     166785..166790,166797..166799,166827..166829,
                     166842..166844,166857..166859)
                     /locus_tag="Hneap_0164"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173833"
     misc_feature    166389..166418
                     /locus_tag="Hneap_0164"
                     /note="chain length determination region; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(166404..166409,166416..166418,166431..166436,
                     166599..166601,166662..166664,166785..166790,
                     166797..166799,166827..166829,166842..166844,
                     166857..166859)
                     /locus_tag="Hneap_0164"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(166404..166409,166416..166418,166431..166436,
                     166662..166664,166785..166790)
                     /locus_tag="Hneap_0164"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    order(166404..166409,166416..166418,166431..166436,
                     166599..166601,166662..166664)
                     /locus_tag="Hneap_0164"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(166422..166466,166806..166811,166827..166844,
                     166851..166865)
                     /locus_tag="Hneap_0164"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    order(166785..166790,166797..166799,166827..166829,
                     166842..166844,166857..166859)
                     /locus_tag="Hneap_0164"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173833"
     gene            167157..167233
                     /locus_tag="Hneap_R0002"
                     /note="tRNA-Pro1"
                     /db_xref="GeneID:8533279"
     tRNA            167157..167233
                     /locus_tag="Hneap_R0002"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:8533279"
     gene            complement(167318..167785)
                     /locus_tag="Hneap_0165"
                     /db_xref="GeneID:8533280"
     CDS             complement(167318..167785)
                     /locus_tag="Hneap_0165"
                     /inference="protein motif:PFAM:PF01037"
                     /note="PFAM: transcription regulator, AsnC-type-like;
                     SMART: transcription regulator, AsnC-type;
                     KEGG: tmz:Tmz1t_0193 transcriptional regulator, AsnC
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="asnC family transcriptional regulator"
                     /protein_id="YP_003262076.1"
                     /db_xref="GI:261854793"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR019885"
                     /db_xref="InterPro:IPR019887"
                     /db_xref="InterPro:IPR019888"
                     /db_xref="GeneID:8533280"
                     /translation="MTLDRYDRQILTLLQENGRLSNQELADAIGLSASPCLRRVRALE
                     ESGLILGYRALLDARKLGLNLVALLHISMDQHTPERFAHFEQQVARLPEVIECLLITG
                     QTADYQLKVIVTDMDAYQILLLNQITRIEGVTGVQTSFVLRRVLDKTSLPIPD"
     misc_feature    complement(167327..167785)
                     /locus_tag="Hneap_0165"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    complement(<167624..167776)
                     /locus_tag="Hneap_0165"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(167627..167635,167651..167656,
                     167660..167665,167672..167677,167681..167692,
                     167717..167725,167765..167773))
                     /locus_tag="Hneap_0165"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(167714..167716,167723..167725))
                     /locus_tag="Hneap_0165"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(167354..167581)
                     /locus_tag="Hneap_0165"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     gene            168060..169853
                     /locus_tag="Hneap_0166"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:8533281"
     gene            169850..171724
                     /locus_tag="Hneap_0167"
                     /db_xref="GeneID:8533282"
     CDS             169850..171724
                     /locus_tag="Hneap_0167"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter;
                     SMART: ATPase AAA;
                     KEGG: tgr:Tgr7_0690 ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_003262077.1"
                     /db_xref="GI:261854794"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8533282"
                     /translation="MIQLQSVSLRRGTQLLLENANLTLQPGYRLGLVGRNGTGKSSLL
                     ALLEGKLTPDAGNVDRAGGQRLATVAQEMDDLDVSAVESVLAGDVEYDRISKAIATAE
                     LAEDGMALATLYHDLEAIDGFTARSRAARLLDGLGFAPDAIDRPVRSFSGGWRMRINL
                     ARALLAPSDILLLDEPTNHLDLDAVFWLEQWLINYPGSLVVVSHDRDFLDQVCTHIAH
                     LENKSLTVYTSNYSGFEQMRAERQAQNAALSAKIERERAHLTAFVDRFRAQATKAKQA
                     QSRIKALARLPVLAATHADSTFTFSFRPAPNSPDPLLTMEHLELGYNGKALLKNIDLT
                     VRAGDRIGLLGANGAGKTTLMRVLGGAEKPMAGELFISAGVRVGYYAQHQLEQLDPRD
                     TPMTALERIAGRASTQEVRNFLGGFGFIGDRAFENIEPFSGGEKARLALALLVWQAPN
                     LLLLDEPTNHLDLEMREALAAALQTFEGALVVVSHDRSLIEMVCDNFWRVHDGKVGVF
                     DGDLDDYRRVLTDERRAANAPAKPAETTKPKSESTWRPATKKPAGKPDKRTDKRVAEI
                     EHRLSAVVLALQALDTQLADPDLYAGPDATRANELTSQRQTLAEEHEALELEWLSLND
                     "
     misc_feature    169850..171670
                     /locus_tag="Hneap_0167"
                     /note="putative ABC transporter ATP-binding protein;
                     Provisional; Region: PRK10636"
                     /db_xref="CDD:236729"
     misc_feature    169853..170515
                     /locus_tag="Hneap_0167"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    170498..170755
                     /locus_tag="Hneap_0167"
                     /note="ABC transporter; Region: ABC_tran_2; pfam12848"
                     /db_xref="CDD:257346"
     misc_feature    170786..171361
                     /locus_tag="Hneap_0167"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     gene            171813..172319
                     /locus_tag="Hneap_0168"
                     /db_xref="GeneID:8533283"
     CDS             171813..172319
                     /locus_tag="Hneap_0168"
                     /inference="protein motif:TFAM:TIGR00249"
                     /note="TIGRFAM: phosphohistidine phosphatase SixA;
                     PFAM: phosphoglycerate mutase;
                     KEGG: afw:Anae109_0423  phosphohistidine phosphatase,
                     SixA"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohistidine phosphatase SixA"
                     /protein_id="YP_003262078.1"
                     /db_xref="GI:261854795"
                     /db_xref="InterPro:IPR004449"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="GeneID:8533283"
                     /translation="MDILLIRHAPAEDREQFALTGQADELRPLTPRGIERMQLAVRGL
                     VTLALPIERLITSPLVRAQQTAQIVAPALEIRQFDTEAMLSPQVPNASLIDWLRKQPR
                     VDGLALIGHEPNLSQLAETLLCGSANGCMPLKKGGAILLRFAEGIAAGQGQLIWSLTP
                     GILRTLAD"
     misc_feature    171819..172286
                     /locus_tag="Hneap_0168"
                     /note="Histidine phosphatase domain found in
                     phosphoglycerate mutases and related proteins, mostly
                     phosphatases; contains a His residue which is
                     phosphorylated during the reaction; Region: HP_PGM_like;
                     cd07067"
                     /db_xref="CDD:132718"
     misc_feature    order(171831..171836,171993..171995,172143..172148)
                     /locus_tag="Hneap_0168"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     gene            172415..172978
                     /locus_tag="Hneap_0169"
                     /db_xref="GeneID:8533284"
     CDS             172415..172978
                     /locus_tag="Hneap_0169"
                     /inference="protein motif:PFAM:PF01694"
                     /note="PFAM: rhomboid family protein;
                     KEGG: tgr:Tgr7_0230 membrane protein, rhomboid family"
                     /codon_start=1
                     /transl_table=11
                     /product="rhomboid family protein"
                     /protein_id="YP_003262079.1"
                     /db_xref="GI:261854796"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="GeneID:8533284"
                     /translation="MTDRNQKWLISFLVVAIAVAILLLHGGNELRYDRADILHGQFWR
                     VFTGNFVHANWRHLASDMAGLLIWTALAGYLETRRSYLVLLAGTGLGVGVGLLLLDPH
                     VGWYVGLSGILHGLFAASAIRLLSRKEWLGGFALLAALTLKILWEQRYGDLGTAKLLG
                     VPVLVDAHLYGAVTGAVIVLALLFFRR"
     misc_feature    172502..172954
                     /locus_tag="Hneap_0169"
                     /note="rhomboid family GlyGly-CTERM serine protease;
                     Region: rhom_GG_sort; TIGR03902"
                     /db_xref="CDD:234388"
     gene            173038..174135
                     /locus_tag="Hneap_0170"
                     /db_xref="GeneID:8533285"
     CDS             173038..174135
                     /locus_tag="Hneap_0170"
                     /inference="protein motif:TFAM:TIGR00876"
                     /note="TIGRFAM: transaldolase;
                     PFAM: transaldolase;
                     KEGG: eba:ebA4676 transaldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="transaldolase"
                     /protein_id="YP_003262080.1"
                     /db_xref="GI:261854797"
                     /db_xref="InterPro:IPR001585"
                     /db_xref="InterPro:IPR004732"
                     /db_xref="InterPro:IPR018225"
                     /db_xref="GeneID:8533285"
                     /translation="MSQNDLSVLHSSQGQSLWLDNLSRALLNEGQLAELVQNFGIRGL
                     TSNPSIFKKAIVGSPYYTDDIAALKKQYDDVESVYEHLVVKDIQQACDLLRPIFDESH
                     GEDGWVSWEESPRIAHNATSTVASAERLKKLTDRPNLLIKVPATDEGIEAFELLIARG
                     ISVNVTLMFSLDQVKRVFAAYVRGLKALRASGGAVSRVRAVASLFMSRVDTLVDQQLN
                     EIGTEAALQLRGKAALALGGMAYQHYRDVFEGEAFAELAKFGARSQYLLWASTGTKNP
                     DYSDVLYVENLIAPKTINTLPEATLKAFADHGRIASTLKPRLAEDKKVWDALAGVGID
                     MDGAVGHQLLDEGLDQFAQAFEDLLAAIAQS"
     misc_feature    173083..174108
                     /locus_tag="Hneap_0170"
                     /note="Transaldolase-like proteins from plants and
                     bacteria; Region: Transaldolase_like; cd00955"
                     /db_xref="CDD:188642"
     misc_feature    order(173095..173097,173176..173178,173368..173370,
                     173461..173463,173527..173529,173533..173535,
                     173644..173646,173659..173661)
                     /locus_tag="Hneap_0170"
                     /note="putative active site [active]"
                     /db_xref="CDD:188642"
     misc_feature    173461..173463
                     /locus_tag="Hneap_0170"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188642"
     gene            complement(174196..174966)
                     /locus_tag="Hneap_0171"
                     /db_xref="GeneID:8533286"
     CDS             complement(174196..174966)
                     /locus_tag="Hneap_0171"
                     /inference="protein motif:PFAM:PF08754"
                     /note="PFAM: Domain of unknown function DUF1791;
                     KEGG: tbd:Tbd_1835 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262081.1"
                     /db_xref="GI:261854798"
                     /db_xref="InterPro:IPR014865"
                     /db_xref="GeneID:8533286"
                     /translation="MKHAQQNEHQDTSISVEEINAFIDDELIHEDRQRVREHVKKNPE
                     LTQLICDIDQVQDWIKEAYEIVPEPPHTKANWRIHALLPGALAAMALLSVGALAGWFA
                     SKISSADTDGAHAATMLQANNQIQNVEFASAPTAQTRNVILRLGSDSPRKFTETLNRI
                     EHVMKTSAHQPGFQMEVLANSDGLNFLRADTSPYAKQIEALMKKYPNLHFMVCGTSLK
                     NLEESGQKAALLPNVRVTSSAVEQVAQRIREGWSYSAI"
     misc_feature    complement(174208..174525)
                     /locus_tag="Hneap_0171"
                     /note="DsrE/DsrF-like family; Region: DrsE; cl00672"
                     /db_xref="CDD:260564"
     gene            complement(174963..175553)
                     /locus_tag="Hneap_0172"
                     /db_xref="GeneID:8533287"
     CDS             complement(174963..175553)
                     /locus_tag="Hneap_0172"
                     /inference="protein motif:TFAM:TIGR02937"
                     /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
                     family;
                     PFAM: Sigma-70 region 4 type 2; sigma-70 region 2 domain
                     protein; sigma-70 region 4 domain protein;
                     KEGG: tbd:Tbd_1836 sigma-24 (FecI)"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma-24 subunit"
                     /protein_id="YP_003262082.1"
                     /db_xref="GI:261854799"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR007630"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="InterPro:IPR014284"
                     /db_xref="GeneID:8533287"
                     /translation="MGPSSFFSGSFLFGRLTFNHRLEQLRPRLYRLAFSWCKESYLAE
                     DLVQEAMIRALQKQAQLRDEELLDRWVIRILANQWMDHVRSHVRDENIDDMEQTISTD
                     EHQSPDSVHGRDEMIERVRSAVMRLPEMQRIVVTLVDLEEFSYKEVATTLDLPIGTIM
                     SRLSRGRQSLRNLLIETKNAATEERRKSECHLRRVV"
     misc_feature    complement(175032..175502)
                     /locus_tag="Hneap_0172"
                     /note="RNA polymerase sigma factor, sigma-70 family;
                     Region: sigma70-ECF; TIGR02937"
                     /db_xref="CDD:234065"
     misc_feature    complement(175290..175487)
                     /locus_tag="Hneap_0172"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(175041..175205)
                     /locus_tag="Hneap_0172"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    complement(order(175053..175055,175059..175064,
                     175068..175076,175080..175085,175089..175091,
                     175119..175124,175140..175142,175170..175172))
                     /locus_tag="Hneap_0172"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            175789..176268
                     /locus_tag="Hneap_0173"
                     /db_xref="GeneID:8533288"
     CDS             175789..176268
                     /locus_tag="Hneap_0173"
                     /inference="protein motif:PFAM:PF08754"
                     /note="PFAM: Domain of unknown function DUF1791;
                     KEGG: tgr:Tgr7_2583 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262083.1"
                     /db_xref="GI:261854800"
                     /db_xref="InterPro:IPR014865"
                     /db_xref="GeneID:8533288"
                     /translation="MIRLRQKIVMTALLLGLIGTAPTVMANPAAEPVSQAVQDKPFAE
                     ARVALQISDAAGPKQQLVLNVASNLIKFYGADKVDVEIVAFGPGLRLLFKDNALGDQI
                     QSLAAEGVRFSACANTIAAMSKKLGYEPELNPEARIVPAGIVRLVQLNKAGFFVSRP"
     misc_feature    175924..176256
                     /locus_tag="Hneap_0173"
                     /note="DsrE/DsrF-like family; Region: DrsE; pfam02635"
                     /db_xref="CDD:251438"
     gene            176452..177756
                     /locus_tag="Hneap_0174"
                     /db_xref="GeneID:8533289"
     CDS             176452..177756
                     /locus_tag="Hneap_0174"
                     /inference="protein motif:PFAM:PF07396"
                     /note="PFAM: phosphate-selective porin O and P;
                     KEGG: tcx:Tcr_2159 phosphate-selective porin O and P"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate-selective porin O and P"
                     /protein_id="YP_003262084.1"
                     /db_xref="GI:261854801"
                     /db_xref="InterPro:IPR010870"
                     /db_xref="GeneID:8533289"
                     /translation="MNNNIRILPSAVSKKILIAGLCSGLLIAAPNAFSANWIMLQGTE
                     KPGIAPPVKLWGFIQPTYQKDFSSSYNGKYVPPKLIGPNLDSQSSFNIMRARIGVRGA
                     PFFLDDKVNYFLLTEFGDNAMTDGGRYGSYRPTLTDASVTLNYIKGARIRLGLFKYPG
                     AEEGLQGIGSLNYINYTDVTNQMLLERFPDAGDKNIPPQSTPNADMNAFSNPATGFRD
                     VGVQVFDAFDVGKWEHTYAVMLGNGSGVRMSDGNASKDVYLYWSSAYLFDKKNKGPMS
                     PSVKMFSWYQSGKRTNAYNTAQEQDRKRYGAGVTYLKKPYRVTAEYMWGKGMIYQGAN
                     NPQTLFNDYKANGGYVEGGWFIPNTKWELDLRYDRYQRNVDLPTQTRFSTWTAGVQYH
                     FTPKTRVTLDYAMRRYSSDVVPQNNQLQDVGGRLALQVTAIF"
     misc_feature    176704..177678
                     /locus_tag="Hneap_0174"
                     /note="Phosphate-selective porin O and P; Region:
                     Porin_O_P; cl19535"
                     /db_xref="CDD:267888"
     gene            complement(177803..178861)
                     /locus_tag="Hneap_0175"
                     /db_xref="GeneID:8533290"
     CDS             complement(177803..178861)
                     /locus_tag="Hneap_0175"
                     /inference="protein motif:TFAM:TIGR00254"
                     /note="KEGG: dia:Dtpsy_0071 diguanylate cyclase with GAF
                     sensor;
                     TIGRFAM: diguanylate cyclase;
                     PFAM: GGDEF domain containing protein; GAF domain protein;
                     SMART: GGDEF domain containing protein; GAF domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="GAF sensor-containing diguanylate cyclase"
                     /protein_id="YP_003262085.1"
                     /db_xref="GI:261854802"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="GeneID:8533290"
                     /translation="MTKKAQNTLDPILDRLASVLAKSTDTATLVRPLLELMEHLTGLD
                     SVYLTRIDWSNQVQTIMFTRNCHELVIPEGLEVPLEHTLCRRAIEEQHFFEPDVPKHW
                     ADAHLAIDMGIQTYLSAPVRLADEEIFGTLCALGADSTEISPSTQRIVQLFANLIAHQ
                     IDRERLITHLQADNRAIGELAMTDALTGLPNRYSLRRALKRELANVRRMDQVLHLAFI
                     DLDQFKEINDRHGHDAGDQFLQAIADALRNGLREGDFVARYGGDEFVAFGISKNTAIA
                     ADEAAFAARLSDLTVGRFALASTIIDYPGASIGVVTSTPEDHDIDELIERADQAMYRL
                     KKNRRATRRLSDGGENNT"
     misc_feature    complement(178379..178789)
                     /locus_tag="Hneap_0175"
                     /note="GAF domain; Region: GAF; pfam01590"
                     /db_xref="CDD:250726"
     misc_feature    complement(177845..178318)
                     /locus_tag="Hneap_0175"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(178076..178078,178205..178207))
                     /locus_tag="Hneap_0175"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(178073..178084,178088..178090,
                     178154..178156,178166..178168,178178..178183,
                     178190..178192))
                     /locus_tag="Hneap_0175"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(178010..178012,178100..178102))
                     /locus_tag="Hneap_0175"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(178858..179517)
                     /locus_tag="Hneap_0176"
                     /db_xref="GeneID:8533291"
     CDS             complement(178858..179517)
                     /locus_tag="Hneap_0176"
                     /inference="protein motif:PFAM:PF00578"
                     /note="PFAM: alkyl hydroperoxide reductase/ thiol specific
                     antioxidant/ Mal allergen; redoxin;
                     KEGG: ses:SARI_01884 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase/ thiol specific
                     antioxidant/ Mal allergen"
                     /protein_id="YP_003262086.1"
                     /db_xref="GI:261854803"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="GeneID:8533291"
                     /translation="MTRSAPPDDKHDRTPHGVPDSSGNSPRNSPEKTPETPPEKPPET
                     SPKKRRRWRRWLIEIAVFVGVLLAVRAYMAPAIPTDFADAPLPAITFPTLTNGTTGPG
                     TITLGSNPRPTALVFWATWCGVCHVELPWLNELAKTHRIITVAMQSGSADAVRQYLNK
                     NQLDHLPVINDPDGQIAKKFGVSVTPTLFFIAPDGRIAMAETGITSPWGIRLRLWWLG
                     L"
     misc_feature    complement(178873..179259)
                     /locus_tag="Hneap_0176"
                     /note="TlpA-like family, suppressor for copper sensitivity
                     D protein (ScsD) and actinobacterial DsbE homolog
                     subfamily; composed of ScsD, the DsbE homolog of
                     Mycobacterium tuberculosis (MtbDsbE) and similar proteins,
                     all containing a redox-active CXXC motif; Region:
                     TlpA_like_ScsD_MtbDsbE; cd03011"
                     /db_xref="CDD:239309"
     misc_feature    complement(order(179143..179145,179152..179154))
                     /locus_tag="Hneap_0176"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239309"
     gene            179601..180782
                     /locus_tag="Hneap_0177"
                     /db_xref="GeneID:8533292"
     CDS             179601..180782
                     /locus_tag="Hneap_0177"
                     /EC_number="6.3.2.5"
                     /inference="protein motif:TFAM:TIGR00521"
                     /note="KEGG: tgr:Tgr7_0102 phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate/cysteine ligase;
                     TIGRFAM: phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate/cysteine ligase;
                     PFAM: DNA/pantothenate metabolism flavoprotein domain
                     protein; flavoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate--cysteine ligase"
                     /protein_id="YP_003262087.1"
                     /db_xref="GI:261854804"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="InterPro:IPR005252"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="GeneID:8533292"
                     /translation="MRILVGISGGIAAYKSIILIRRLRDAGAEVRVVLTENAAQFVTP
                     LSLQAVSGQPVRTHLFDPEAEAGMDHIALARWADVIVIAPASADILARMASGMANDLL
                     TTLVLATTAPVTVAPAMNQQMWAHPAVQANLNTLEKRGVRVIGPASGTQACGEVGAGR
                     MVEPEEMATQILRARSCVDWRGKQVVITAGGTREPIDPVRFIANRSSGKMGFAMAAAA
                     REAGAEVTLICGPNGLPAPAGVHRVDVETAVEMQSAVAAVERMDVFIGAAAVADYRVQ
                     TPAEHKLKKSAEFDSLTLTLVKNPDIISEVARRVPKPFVVGFAAETENLQTYAEQKRR
                     AKGMDVICANAVGEGLAFDQPDNALSVIWSGGVHHFERAEKTQLSAHLIELIDKIMSR
                     E"
     misc_feature    179601..180113
                     /locus_tag="Hneap_0177"
                     /note="Flavoprotein; Region: Flavoprotein; cl19190"
                     /db_xref="CDD:267543"
     misc_feature    179604..180770
                     /locus_tag="Hneap_0177"
                     /note="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate synthase; Validated;
                     Region: PRK05579"
                     /db_xref="CDD:235513"
     misc_feature    180138..180686
                     /locus_tag="Hneap_0177"
                     /note="DNA / pantothenate metabolizm flavoprotein; Region:
                     DFP; pfam04127"
                     /db_xref="CDD:252395"
     gene            180787..181272
                     /locus_tag="Hneap_0178"
                     /db_xref="GeneID:8533293"
     CDS             180787..181272
                     /locus_tag="Hneap_0178"
                     /inference="protein motif:TFAM:TIGR00576"
                     /note="TIGRFAM: deoxyuridine 5'-triphosphate
                     nucleotidohydrolase Dut;
                     PFAM: deoxyUTP pyrophosphatase;
                     KEGG: pmr:PMI3154 deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
                     Dut"
                     /protein_id="YP_003262088.1"
                     /db_xref="GI:261854805"
                     /db_xref="InterPro:IPR008180"
                     /db_xref="InterPro:IPR008181"
                     /db_xref="GeneID:8533293"
                     /translation="MPIEQGNKTARPTVEVKWLDARLGDTIPRPDYATSGSAGLDLRA
                     CLAEPMVLNPGQTELIPTGMAIHIEDPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDY
                     QGQLFVSVWNRSAQPFTIDIGERIAQLVVVPVVQVAFETVEEFTPSHRGSGGFGHTGR
                     A"
     misc_feature    180898..181173
                     /locus_tag="Hneap_0178"
                     /note="Trimeric dUTP diphosphatases; Region:
                     trimeric_dUTPase; cd07557"
                     /db_xref="CDD:143638"
     misc_feature    order(180898..180903,180937..180939,180952..180957,
                     180961..180963,181012..181014,181018..181035,
                     181051..181059,181075..181077,181084..181086,
                     181105..181107,181111..181113,181117..181119,
                     181123..181125,181135..181149,181156..181158,
                     181168..181170)
                     /locus_tag="Hneap_0178"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143638"
     misc_feature    order(181024..181032,181075..181083,181090..181092,
                     181102..181107)
                     /locus_tag="Hneap_0178"
                     /note="active site"
                     /db_xref="CDD:143638"
     gene            181310..182197
                     /locus_tag="Hneap_0179"
                     /db_xref="GeneID:8533294"
     CDS             181310..182197
                     /locus_tag="Hneap_0179"
                     /EC_number="2.7.2.8"
                     /inference="protein motif:TFAM:TIGR00761"
                     /note="KEGG: tgr:Tgr7_0104 acetylglutamate kinase;
                     TIGRFAM: acetylglutamate kinase;
                     PFAM: aspartate/glutamate/uridylate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="YP_003262089.1"
                     /db_xref="GI:261854806"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR004662"
                     /db_xref="GeneID:8533294"
                     /translation="MTSYAPEVTAEVLMEALPYIQRLFDKTIVIKFGGNAMVDEALQD
                     AFARDIVLLKQVGLNPVVVHGGGPQINQLLEKLGKQGEFVQGMRVTDRETMDVVQMVL
                     GGLVNKDIVALINRHGGRAVGLTGRDAGLVRARKLKVSRQTAEMLEPEIIDIGHVGEV
                     ASIDPSILNLLESKDFIPVIAPIGVGEDGAAYNINADVVASKIAQVLGAEKLLLLTNT
                     AGVLDKEGKLLTGLSARDVEALIENGTIYGGMLPKIDFALDAVRGGVKTVQIIDGRVP
                     HAVLLELLTDKGVGTLIRS"
     misc_feature    181343..182188
                     /locus_tag="Hneap_0179"
                     /note="AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic
                     (NAGK-C) catalyzes the phosphorylation of the gamma-COOH
                     group of N-acetyl-L-glutamate (NAG) by ATP in the second
                     step of arginine biosynthesis found in some bacteria and
                     photosynthetic organisms using the...; Region: AAK_NAGK-C;
                     cd04250"
                     /db_xref="CDD:239783"
     misc_feature    181343..181372
                     /locus_tag="Hneap_0179"
                     /note="feedback inhibition sensing region; other site"
                     /db_xref="CDD:239783"
     misc_feature    order(181346..181354,181358..181360,181367..181372,
                     181451..181453,181463..181465,181475..181477,
                     181535..181540,181595..181597,181604..181609,
                     181622..181624,181631..181633,181643..181645,
                     181664..181666,181670..181678,181682..181684,
                     181688..181699,181808..181810,181835..181837,
                     182138..182140,182147..182152,182162..182164)
                     /locus_tag="Hneap_0179"
                     /note="homohexameric interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239783"
     misc_feature    order(181400..181402,181409..181414,181892..181894,
                     181955..181963,181973..181975,182042..182044,
                     182048..182050,182054..182059,182066..182068)
                     /locus_tag="Hneap_0179"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239783"
     misc_feature    order(181502..181507,181568..181573,181886..181888,
                     181892..181897)
                     /locus_tag="Hneap_0179"
                     /note="N-acetyl-L-glutamate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239783"
     gene            182291..182836
                     /locus_tag="Hneap_0180"
                     /db_xref="GeneID:8533295"
     CDS             182291..182836
                     /locus_tag="Hneap_0180"
                     /inference="protein motif:PFAM:PF08754"
                     /note="PFAM: Domain of unknown function DUF1791;
                     KEGG: tcx:Tcr_2157 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262090.1"
                     /db_xref="GI:261854807"
                     /db_xref="InterPro:IPR014865"
                     /db_xref="GeneID:8533295"
                     /translation="MHHTKSIQILGLAGLLGLSVVLPVSGYAAPPEHAAHVDVAALTK
                     AANYPEAESIAAIKAKTADVKARYVLQISDADAQKRGMDMKVASHLLKYYGKGKVDVE
                     IVAFGPGLKLLLAENNPQAPMIAKLSAEGVRFSACGNAIHHATQMLGYAPKLVPAARV
                     VPAGIVRVHDLAVAGYFADKP"
     misc_feature    182495..182833
                     /locus_tag="Hneap_0180"
                     /note="DsrE/DsrF-like family; Region: DrsE; cl00672"
                     /db_xref="CDD:260564"
     gene            complement(182847..183512)
                     /locus_tag="Hneap_0181"
                     /db_xref="GeneID:8533296"
     CDS             complement(182847..183512)
                     /locus_tag="Hneap_0181"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: tgr:Tgr7_0105 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262091.1"
                     /db_xref="GI:261854808"
                     /db_xref="GeneID:8533296"
                     /translation="MSSVKIHTGFSSPLPLLPRFRTLCFSHVFVVSITMMCTGFVSVA
                     HADLYRWTTKDGMVHYGDNMPSSQALEGYDLINPATGEVIRHIDRARTPQELAAEAAA
                     KTAEEKKRAEEVAQAQRDRMLLDLYSNTSDLERARKQRLDEIDALIKQNQNALDRANE
                     RSKHAQASSEQKAAFKDVIQLRKNLFDLQERRDETSKRFAEDLQRLEQLQAKGKPLDQ
                     AGK"
     misc_feature    complement(<183306..183413)
                     /locus_tag="Hneap_0181"
                     /note="Domain of unknown function (DUF4124); Region:
                     DUF4124; pfam13511"
                     /db_xref="CDD:257831"
     gene            complement(183708..184925)
                     /locus_tag="Hneap_0182"
                     /db_xref="GeneID:8533297"
     CDS             complement(183708..184925)
                     /locus_tag="Hneap_0182"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: tcx:Tcr_0094 major facilitator transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_003262092.1"
                     /db_xref="GI:261854809"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:8533297"
                     /translation="MTPVHGIRPNAAQFMLQLLQVFLVGSLVGMTRTVLPELAESDFG
                     LTAGSFLALATFVVVFGLVKALLNLFAGSLSDRWGRRRVLIAGWVSALPIPLLILYGP
                     NWGWIILATVFLGINQGLSWSMALNSKLDLTHARQRGLVNGFNEFAGYGGVAIAGMLS
                     ALAVHALGARTGLFIFTLAIIVLALLIALAAVRETRPWAMLHQGNPTIEPIGMRALFA
                     YASWKNRSLLALNQAGMVEKFTDAMVWLFFPVFFMGKGLSLVASGSLIAIYGVVWGAG
                     QLITGPLSDRIGRTIMIVGGMWLCGLGVVAVSLSHSIVLWGLELGLIGIGMAMLYPTL
                     GAAVADQAEPAQRASILGIYRFWRDLGYAVGGLLLGLTAQWSGGILLPFWLVGLSMAA
                     SGLWAAVVANESQ"
     misc_feature    complement(183723..184874)
                     /locus_tag="Hneap_0182"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(183828..184874)
                     /locus_tag="Hneap_0182"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(183840..183842,183849..183854,
                     183861..183866,183873..183878,183909..183911,
                     183918..183923,183933..183935,183942..183947,
                     183954..183956,184095..184097,184107..184109,
                     184116..184118,184128..184130,184140..184142,
                     184179..184181,184188..184193,184200..184205,
                     184212..184214,184467..184469,184485..184490,
                     184497..184502,184536..184538,184545..184550,
                     184557..184562,184569..184574,184710..184715,
                     184719..184724,184734..184736,184743..184748,
                     184755..184757,184806..184811,184815..184823,
                     184830..184832))
                     /locus_tag="Hneap_0182"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            185244..185927
                     /locus_tag="Hneap_0183"
                     /db_xref="GeneID:8533298"
     CDS             185244..185927
                     /locus_tag="Hneap_0183"
                     /inference="protein motif:PFAM:PF00581"
                     /note="PFAM: rhodanese; regulatory protein ArsR;
                     SMART: rhodanese; regulatory protein ArsR;
                     KEGG: tgr:Tgr7_1961 ArsR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="arsR family transcriptional regulator"
                     /protein_id="YP_003262093.1"
                     /db_xref="GI:261854810"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="GeneID:8533298"
                     /translation="MAFKQDLNDQFARMGKVLGSGRRLELLDYLAQAPRSVEQLAEVS
                     GLTVANTSQHLQKMQQAGLVRANRQGKYIIYQLADGEVVTLLNTLHTLADRHLAEVRA
                     LVATHLAPRDALAPITLDELRPHMASGDMTLIDVRPPQEFAAGHLPSAVNIPPDQLAS
                     ALDRLDPKRPVVAYCRGRYCAFSYDAVAALRERGFSARRLAVGFPEWQLAGHPVIYPA
                     TSPTNQASL"
     misc_feature    185286..185513
                     /locus_tag="Hneap_0183"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(185286..185291,185295..185297,185304..185306,
                     185313..185318,185325..185330,185337..185339,
                     185427..185429,185487..185489,185493..185501,
                     185505..185513)
                     /locus_tag="Hneap_0183"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(185289..185294,185304..185312,185349..185357,
                     185382..185393,185397..185402,185409..185414,
                     185418..185423,185439..185447,185460..185468)
                     /locus_tag="Hneap_0183"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(185349..185351,185358..185360)
                     /locus_tag="Hneap_0183"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    185604..185867
                     /locus_tag="Hneap_0183"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    185766..185768
                     /locus_tag="Hneap_0183"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            185924..186892
                     /locus_tag="Hneap_0184"
                     /db_xref="GeneID:8533299"
     CDS             185924..186892
                     /locus_tag="Hneap_0184"
                     /inference="protein motif:PFAM:PF07726"
                     /note="PFAM: ATPase associated with various cellular
                     activities AAA_3; ATPase AAA;
                     KEGG: tgr:Tgr7_0048 ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="YP_003262094.1"
                     /db_xref="GI:261854811"
                     /db_xref="InterPro:IPR011703"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:8533299"
                     /translation="MTEPTAIAALRTHLAHHIVGQAALVDRLLIGLLTGGHLLVEGLP
                     GLAKTTAVKALAEGVHARFKRVQFTPDLLPADLLGNEIYHPETRTFTFEAGPLFNEII
                     LADEINRAPAKVQSALLEAMAERQVTVAGESRKLPALFLVMATQNPLEQSGTYPLPEA
                     QLDRFMLHVSLSYPERQDEYDILARTLAGTLGRDDDEATGLTVDEVLNARADVRAVHC
                     DAALQRWVVDVVAATRAPEKASDALESLAGMVLVGASPRGALAWVQSAQALAWLNGRD
                     FIVPDDLLELAGDVLRHRLILSPKALVSGLSRDAIITRLCAEIPFP"
     misc_feature    185924..186889
                     /locus_tag="Hneap_0184"
                     /note="MoxR-like ATPases [General function prediction
                     only]; Region: COG0714"
                     /db_xref="CDD:223786"
     misc_feature    185978..186442
                     /locus_tag="Hneap_0184"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    186047..186070
                     /locus_tag="Hneap_0184"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(186050..186073,186236..186238,186359..186361)
                     /locus_tag="Hneap_0184"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    186224..186241
                     /locus_tag="Hneap_0184"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    186413..186415
                     /locus_tag="Hneap_0184"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            187055..188128
                     /locus_tag="Hneap_0185"
                     /db_xref="GeneID:8533300"
     CDS             187055..188128
                     /locus_tag="Hneap_0185"
                     /inference="protein motif:PFAM:PF01882"
                     /note="PFAM: protein of unknown function DUF58;
                     KEGG: psa:PST_2395 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262095.1"
                     /db_xref="GI:261854812"
                     /db_xref="InterPro:IPR002881"
                     /db_xref="GeneID:8533300"
                     /translation="MNTLRYLFHSLKNRSTHHAAGEPVDAVAPTSAVIETAWQLGGQL
                     PPLASEQLPAAVWFPGDQRAVRLGQGMDFESLRAYQPGEPSHLIDWRISARTPEPVVR
                     VFREPAQRQCHIVLDTSDSMFFGTRRQLKITQALTVAHLLTAAALHQNLSVALHTPGL
                     ANRVPRHPATSRAALLNQLQEIGQWLAPPATPQPIDWTGFRGRMQGCLPEGQIVIVLS
                     DFQTDFTEDASLMGWLPLAKKQRLMLLSVIDPAERLLPDMGAVTFMAQPPQRLDTHDP
                     AVRAELSERFTRRQSAVRAFCQGVGGLFDEIQTVTDVPALIDGFGELLLTGHSRQSAE
                     QPQHHPVNNAPNRASNRSMGASS"
     misc_feature    <187184..188008
                     /locus_tag="Hneap_0185"
                     /note="Uncharacterized conserved protein (some members
                     contain a von Willebrand factor type A (vWA) domain)
                     [General function prediction only]; Region: COG1721"
                     /db_xref="CDD:224635"
     misc_feature    187262..187519
                     /locus_tag="Hneap_0185"
                     /note="Protein of unknown function DUF58; Region: DUF58;
                     pfam01882"
                     /db_xref="CDD:250938"
     gene            188140..188670
                     /locus_tag="Hneap_0186"
                     /db_xref="GeneID:8533301"
     CDS             188140..188670
                     /locus_tag="Hneap_0186"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262096.1"
                     /db_xref="GI:261854813"
                     /db_xref="GeneID:8533301"
                     /translation="MIHPPDGLPDGAPKGLVDVWMPNAPTAASHAKAMLGHAIEHHAV
                     GIVVWGLLLGVLIGFAIWFWRDWRGRVLRWQIRRLQHLLRRHPDQVPEPLGAALTWAL
                     SKYFQPRYFKASSALDRRALSPDWRTLVMRLDILRFGPKAAHEDWFALLRAMQECSRR
                     NATAAATAQVNRMPHS"
     misc_feature    188182..>188394
                     /locus_tag="Hneap_0186"
                     /note="Protein of unknown function (DUF1295); Region:
                     DUF1295; cl17837"
                     /db_xref="CDD:266872"
     gene            188678..189697
                     /locus_tag="Hneap_0187"
                     /db_xref="GeneID:8533302"
     CDS             188678..189697
                     /locus_tag="Hneap_0187"
                     /inference="protein motif:PFAM:PF00092"
                     /note="PFAM: von Willebrand factor A;
                     SMART: von Willebrand factor A;
                     KEGG: tgr:Tgr7_0051 von Willebrand factor A"
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor A"
                     /protein_id="YP_003262097.1"
                     /db_xref="GI:261854814"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="GeneID:8533302"
                     /translation="MSGFDGMTSLGMTSLGLTSLGMASPWWLLALLPLPWAFAPLKRY
                     LTHRPAAIMLRHPLIVDHQHTPPPARRAGLIVGLWLASYAALVIALTHPVWQGEFLPA
                     PPPARSILLLVDASPSMQAEDFPAGKDRFIARIDAMKQGLLRFIAARPQDRFSVIVVT
                     NSAGTLVPMTTDHAVLDYWIRQLRAGINGSDTALGDGLAMAIRSIAAQSQAGQPAPLL
                     VVWTDGFSTGGLMTPAEALALARAYGIKLFTVNLAPKGSPPDQGQPSLAQLADLTGGK
                     PILASDLAAMNAVTDQIAASVAPKSATPTERRHIPLYAGFVILATALFLWAQILLWRE
                     PEAAS"
     misc_feature    188990..189505
                     /locus_tag="Hneap_0187"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:260163"
     misc_feature    order(189017..189019,189263..189265,189344..189346)
                     /locus_tag="Hneap_0187"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            189700..191658
                     /locus_tag="Hneap_0188"
                     /db_xref="GeneID:8533303"
     CDS             189700..191658
                     /locus_tag="Hneap_0188"
                     /inference="protein motif:PFAM:PF07719"
                     /note="PFAM: hypothetical protein; TPR repeat-containing
                     protein;
                     SMART: Tetratricopeptide repeat;
                     KEGG: tgr:Tgr7_0052 von Willebrand factor A"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262098.1"
                     /db_xref="GI:261854815"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="GeneID:8533303"
                     /translation="MLSSTANIFGLHDVLVWLSQRPLVMPHLAEPLWLGLLLVPLALF
                     IWRWRARQKILNYADESLQHWAMQRASQASTTWAGRLRGRLIPSFWLLFWFSLALTLA
                     GPQVMKAKNEQLATRPPVLFVVDDTAAMSVADVSPNRQSRATALLELLGQALNTHRLG
                     LMIDNGEAGLLLPPTGDANLFAFYLKQLAHLAHPLAVPHPDRAFDWIAQMPDMRGGVV
                     VWLTSGDANSFQGALGSRELAAAQALNKADVRLIAVTVAGAGGPLLKDGLPLKNTQDQ
                     VITSQPAPQRVAELAKLTGGAATQTHTLPQDVAFIRQAVSAVPNRAPDKNSAKAQRSL
                     HELPLMLAWLSLLALAALSLGLKPLNGFVARLLRPNKTKPPIAAFLLVAIHGALMSAL
                     VAGLSFAPSGAWAADKPNHTAATFMSRSADDAEVAAGNRALKAGSYAQAQVAFSAAKG
                     YAARFGAGLAAFRRADYAFAVDQLQMAVTLAHTPTQKAQAAFNLGDALTLAGRYAEAR
                     DAFTYVLSIKPPDETLTAAALTNRGIVQKMLQSFAKNGKNSTRFQGHQAAKYGYFKDP
                     EKSRMDKEIQKSQGASAGSSQASTTATQPTTPFALNAATESSARSKLTLIHDAPAPLL
                     DGLLRQQPYHLPTLTAPGKNQAMPAGAP"
     misc_feature    190054..190626
                     /locus_tag="Hneap_0188"
                     /note="von Willebrand factor type A domain; Region: VWA_2;
                     pfam13519"
                     /db_xref="CDD:257839"
     misc_feature    order(190072..190074,190264..190266,190366..190368)
                     /locus_tag="Hneap_0188"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     misc_feature    <190912..>191331
                     /locus_tag="Hneap_0188"
                     /note="FOG: TPR repeat [General function prediction only];
                     Region: NrfG; COG0457"
                     /db_xref="CDD:223533"
     misc_feature    190984..191259
                     /locus_tag="Hneap_0188"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(190984..190986,191020..191022,191032..191034,
                     191041..191043,191071..191073,191107..191109,
                     191119..191121,191128..191130,191182..191184,
                     191218..191220,191230..191232,191239..191241)
                     /locus_tag="Hneap_0188"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(190987..190992,191062..191067,191071..191076,
                     191083..191088,191173..191178,191185..191190,
                     191197..191202)
                     /locus_tag="Hneap_0188"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            191655..193094
                     /locus_tag="Hneap_0189"
                     /db_xref="GeneID:8533304"
     CDS             191655..193094
                     /locus_tag="Hneap_0189"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: tgr:Tgr7_0053 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262099.1"
                     /db_xref="GI:261854816"
                     /db_xref="GeneID:8533304"
                     /translation="MSWVTCISMPVFWVNIRRFFLLLVFAGGGLMGQPACAFDIPTPQ
                     NQPKTINTTPFGVPQDFGPVTALPPITDLDTQSGAGHLPDGMTVQTRITPMPNATANG
                     FLERAPFLVTLTITDRNKTLASLTLHRPYGEHIQTRRIDIDQQLRSIDGRMANVRVYR
                     FAVTPLAAGDIELKFAEMTFREVGDSATRYAFIPVARTLTVRPLPGFWPAYLPVTPRL
                     AISSEPLPKLAAGQPVDWVLHITGQNLTTYALSKLLDEQLIGTAALGVGHAEIRRATD
                     DKPPADDPLAQTFTVRISLLPDPQGQGDTNGMLPELRLPFIDSTVADPGQHISETVLP
                     ARSISWPAPASARVLDAVQFWWWRVLLLLVVAYGLGYALNDARKRWQRRCQHRAAQVE
                     LAELDTPRAVLHRLRQLTGESSIKGMIERAPNPRFIAALQALDAACYGNSDGPVSENC
                     LDNWPQTHQELVRWLPKVFFNAPRPTASD"
     misc_feature    192648..193049
                     /locus_tag="Hneap_0189"
                     /note="Domain of unknown function (DUF4381); Region:
                     DUF4381; pfam14316"
                     /db_xref="CDD:258491"
     gene            complement(193091..193690)
                     /locus_tag="Hneap_0190"
                     /db_xref="GeneID:8533305"
     CDS             complement(193091..193690)
                     /locus_tag="Hneap_0190"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: tcx:Tcr_0111 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262100.1"
                     /db_xref="GI:261854817"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="GeneID:8533305"
                     /translation="MTKMPTHHRASARRRFSLMLLMTAFFIATPVYAAAQNGGDSDSG
                     VEMVGNVAYVDHLTNLPADFAVMREKKIPMMIFFHASYCGYCVQVDNQFLIPMRLDPE
                     FKGRLLIRRVLVDGDTKYIGLDGKEHDYPHLANKLEVRGVPYILFLAPDGSRITSIQG
                     TAYEFYDYYLSKDINLATDCAKHPNQKKCDGSKNGPGLN"
     misc_feature    complement(193187..193486)
                     /locus_tag="Hneap_0190"
                     /note="Thioredoxin-like domain; Region: Thioredoxin_2;
                     pfam13098"
                     /db_xref="CDD:257499"
     gene            complement(194015..194362)
                     /locus_tag="Hneap_0191"
                     /db_xref="GeneID:8533306"
     CDS             complement(194015..194362)
                     /locus_tag="Hneap_0191"
                     /inference="protein motif:PFAM:PF01355"
                     /note="PFAM: High potential iron-sulfur protein;
                     KEGG: bpr:GBP346_A0154 high-potential iron-sulfur protein"
                     /codon_start=1
                     /transl_table=11
                     /product="high potential iron-sulfur protein"
                     /protein_id="YP_003262101.1"
                     /db_xref="GI:261854818"
                     /db_xref="InterPro:IPR000170"
                     /db_xref="GeneID:8533306"
                     /translation="MSTHHSDSASSPTRRHFLSVAVKSAVLIPMAGMGMARLAVAADL
                     PHLSPSDPTAKALNYVEVASESKSSAYQSGDACDNCALYQGDRKADWGPCAVFPGKDV
                     ASKGWCSSYVKMG"
     misc_feature    complement(194027..194218)
                     /locus_tag="Hneap_0191"
                     /note="High potential iron-sulfur protein; Region: HIPIP;
                     pfam01355"
                     /db_xref="CDD:250556"
     gene            194496..195998
                     /locus_tag="Hneap_0192"
                     /db_xref="GeneID:8533307"
     CDS             194496..195998
                     /locus_tag="Hneap_0192"
                     /inference="protein motif:PFAM:PF02696"
                     /note="PFAM: protein of unknown function UPF0061;
                     KEGG: afr:AFE_0519 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262102.1"
                     /db_xref="GI:261854819"
                     /db_xref="InterPro:IPR003846"
                     /db_xref="GeneID:8533307"
                     /translation="MSFTSKQDDSNWYLEQTLAYAVADLCLPAQADRVPNPRMIAWNE
                     SLAAEMALDLPSEETRAQIFSGNIIPSGAAPSAQAYAGHQFGNFVPLLGDGRALLLGE
                     VIDRHGKRRDIQLKGAGRTPFSRGGDGKAALGPVLREYLVSEAMHALGIPTTRGLAAV
                     TTGETLWRKGEVPGAILTRVAASHIRVGTFEFLAARGGDAVRLKQLADYVIHRHYPTL
                     KDSALPYSALLEAVVDAQANLVARWMSVGFVHGVMNTDNTSIAGETIDYGPCAFMEAY
                     HPKTVFSSIDLQGRYAYGNQPNIARWNLARFAESLLPLIDTDGDAAIAQANAVLADFP
                     GRYSQHWLAAMRPKLGLSSDTGVSDSADTELIHWFLAAMQSERVDFTKGFRQLSTVVR
                     GNVEPLRSLFNGSADFADWLEHWNTRIAQEKGTADERAERMDAVNPVIIPRNHQVEAM
                     IEAAVREGDFSPFHALLAAVTHPFEDRPEWQNYCEPAPASFGPFTTFCGT"
     misc_feature    194583..195995
                     /locus_tag="Hneap_0192"
                     /note="hypothetical protein; Validated; Region: PRK00029"
                     /db_xref="CDD:234583"
     gene            complement(196011..197153)
                     /locus_tag="Hneap_0193"
                     /db_xref="GeneID:8533308"
     CDS             complement(196011..197153)
                     /locus_tag="Hneap_0193"
                     /inference="protein motif:PFAM:PF10129"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: mms:mma_0187 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262103.1"
                     /db_xref="GI:261854820"
                     /db_xref="InterPro:IPR014550"
                     /db_xref="GeneID:8533308"
                     /translation="MSHTPTQPTQTNRLLYLDFLRGLMLIGITLGHFGPTFEWLMWQP
                     LGFFSNAEGFVLLSGTVFGLVYAKLEQRDPASMAVKARKRAWLIYLSHLGLLLFVALY
                     TWATNGWADDWRSHAQFIAEAPALGLILGTLLIYQPPLLDILPMYALFVLIAPGIIRQ
                     LVAGRVWLVLGVSLVIWWLFSQVVGGGHWRTTIADSLGMGFPFQVGEFDPLTWQVLFF
                     FGTALGVLMFQRRLPRQPQIVLALIAMVAVVLFFGLRHELIAMPAFWNPAWVDRHELA
                     WLRLVNIAALIYTFWTLLYLARKVNWPAWARALPKPFACLGRHSLAVFSVHVVLIYLT
                     IPIQMTYPLFWRYVIGLSLILILLALACGLDIRAKRQRQTQLIPVR"
     misc_feature    complement(196128..197117)
                     /locus_tag="Hneap_0193"
                     /note="OpgC protein; Region: OpgC_C; cl17858"
                     /db_xref="CDD:266891"
     gene            197336..197824
                     /locus_tag="Hneap_0194"
                     /db_xref="GeneID:8533309"
     CDS             197336..197824
                     /locus_tag="Hneap_0194"
                     /EC_number="2.3.1.178"
                     /inference="protein motif:TFAM:TIGR02406"
                     /note="KEGG: hha:Hhal_1732 L-2,4-diaminobutyric acid
                     acetyltransferase;
                     TIGRFAM: L-2,4-diaminobutyric acid acetyltransferase;
                     PFAM: GCN5-related N-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-2,4-diaminobutyric acid acetyltransferase"
                     /protein_id="YP_003262104.1"
                     /db_xref="GI:261854821"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR012772"
                     /db_xref="GeneID:8533309"
                     /translation="MTLDYREPRLDDGARIHQMVLEAGTLDVNSAYLYFLLSDHFRDT
                     CVVAESDSVLCGFLTAYRLPRAPDTLFIWQVAVHPDWRGQGMASGLLEALTGRAWFDD
                     IRRVELTISPDNTASQALFRRWAARLDRPLTVSPYLSSELLNAGQDTGHQPEDLYSIA
                     LR"
     misc_feature    197336..197704
                     /locus_tag="Hneap_0194"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    197468..197662
                     /locus_tag="Hneap_0194"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(197558..197566,197594..197599)
                     /locus_tag="Hneap_0194"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            197858..199147
                     /locus_tag="Hneap_0195"
                     /db_xref="GeneID:8533310"
     CDS             197858..199147
                     /locus_tag="Hneap_0195"
                     /inference="protein motif:TFAM:TIGR02407"
                     /note="catalyzes the reversible formation of
                     diaminobutyrate and 2-oxoglutarate from glutamate and
                     L-aspartic beta-semialdehyde"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminobutyrate--2-oxoglutarate
                     aminotransferase"
                     /protein_id="YP_003262105.1"
                     /db_xref="GI:261854822"
                     /db_xref="InterPro:IPR004637"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR012773"
                     /db_xref="GeneID:8533310"
                     /translation="MDIDLFEKYESNVRGYIRSFPTIFTRAKNATVWDHHGKSYIDFF
                     GGAGSLNYGHNDPAVQEAMIDYIQRDGMLNALDKATDAKYHFIKKFQETILLPRGLDY
                     KIQFVGPTGTNAVETALKLARKVKQRSKIVAFTNAYHGHTLGALAVTGNEFYHDDYYG
                     VPLNVTKMPFDQYFDEDDQMDSIDMMRRYYEDGSSGYEVPAGIIVETIQGEGGINVSS
                     IEWLKKLEKMCRDLDILLIIDDIQVGNGRTGNFFSFERAGITPDIITISKSIGTGLPM
                     AIVLMRPEIDQWSPGEHTGTFRGNSLAFIAGATALKRWDNDEFAKEIRRKGEWVEKRF
                     RAIKARFPDHISDVRGLGMIWGIESSIEGFCNEVSREAFEHGLLAETAGATDQVIKFL
                     APLTISQAELDKGLDILEAAIEATAAKHPTTKQEVTA"
     misc_feature    197873..199096
                     /locus_tag="Hneap_0195"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    197918..199111
                     /locus_tag="Hneap_0195"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    order(198185..198193,198269..198274,198278..198280,
                     198473..198475,198572..198574,198578..198583,
                     198659..198661)
                     /locus_tag="Hneap_0195"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(198188..198193,198269..198274,198473..198475,
                     198572..198574,198581..198583,198659..198661)
                     /locus_tag="Hneap_0195"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    198659..198661
                     /locus_tag="Hneap_0195"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            199144..199551
                     /gene="ectC"
                     /locus_tag="Hneap_0196"
                     /db_xref="GeneID:8533311"
     CDS             199144..199551
                     /gene="ectC"
                     /locus_tag="Hneap_0196"
                     /EC_number="4.2.1.108"
                     /inference="protein motif:PRIAM:4.2.1.108"
                     /note="N-acetyldiaminobutyrate dehydratase; catalyzes the
                     formation of the osmoprotectant ecotoine from
                     gamma-N-acetyl-alpha,gamma-diaminobutyric acid"
                     /codon_start=1
                     /transl_table=11
                     /product="L-ectoine synthase"
                     /protein_id="YP_003262106.1"
                     /db_xref="GI:261854823"
                     /db_xref="InterPro:IPR010462"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="GeneID:8533311"
                     /translation="MIVRRLTPDILGTEREVEAENGNWVSRRLVLADDGVGFSFHDTI
                     IRAGTETYIHYANHIEGVYCVSGNGEIHDIANDTTHKISDGMMYLLNNHDRHYLRGGT
                     EDMRLICVFNPPLTGKEVHDENGHYPLLLPGID"
     misc_feature    199144..199530
                     /gene="ectC"
                     /locus_tag="Hneap_0196"
                     /note="L-ectoine synthase; Reviewed; Region: ectC;
                     PRK13290"
                     /db_xref="CDD:183953"
     gene            complement(199779..200633)
                     /locus_tag="Hneap_0197"
                     /db_xref="GeneID:8533312"
     CDS             complement(199779..200633)
                     /locus_tag="Hneap_0197"
                     /inference="protein motif:PFAM:PF00459"
                     /note="PFAM: inositol monophosphatase;
                     KEGG: tcx:Tcr_0995 inositol monophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="YP_003262107.1"
                     /db_xref="GI:261854824"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="GeneID:8533312"
                     /translation="MTSNQPDLPAVDSGLNWSADWPQTCEAMRRIARQHMSMAATEVE
                     TKADGSWVTAVDHAVQAAVQDWLAERFPAIGFLGEEMTDEEQNAAWARCLAGEQALWV
                     VDPLDGTSNFRAGFPVFSLTLTLLQHGRVIAGLVYDPERDELFHARRGSGAFLNETRL
                     DVRTLPALPLARCLAIVDFKRLNKMLACRLAGDAPYASQRSIGSVALDWCWIAAGRVQ
                     VYVHGKQKPWDYAAGQLIALEAGASSAALDGHRDALDDELKLAPRSAVVAVSESLMDE
                     WLAVLLNP"
     misc_feature    complement(199827..200549)
                     /locus_tag="Hneap_0197"
                     /note="Inositol-monophosphatase-like domains. This family
                     of phosphatases is dependent on bivalent metal ions such
                     as Mg++, and many members are inhibited by Li+ (which is
                     thought to displace a bivalent ion in the active site).
                     Substrates include fructose-1; Region: IMPase_like;
                     cd01637"
                     /db_xref="CDD:238815"
     misc_feature    complement(order(199947..199952,200307..200324,
                     200394..200399,200466..200468))
                     /locus_tag="Hneap_0197"
                     /note="active site"
                     /db_xref="CDD:238815"
     gene            complement(200739..201752)
                     /locus_tag="Hneap_0198"
                     /db_xref="GeneID:8533313"
     CDS             complement(200739..201752)
                     /locus_tag="Hneap_0198"
                     /inference="protein motif:SMART:SM00450"
                     /note="SMART: rhodanese;
                     KEGG: pnu:Pnuc_0792 rhodanese"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese"
                     /protein_id="YP_003262108.1"
                     /db_xref="GI:261854825"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="GeneID:8533313"
                     /translation="MRQRCLGKFAFWCFFSFLSCAATQAHATAMLTLPGPVVCAQWLH
                     AHSRDVQIVDVRDDPDSLSTPPIFYTQNGQKHLKRVGGHIPSALSVDFLALRNTHRVD
                     GLSLDFQFPTPAEFQSLMQSICLQSNEPIVIAPTGDSAISLQEGALLALELTVYGVPT
                     SEIALLNGGTHAWITAGFPISTNTIFPASGSHWRAKPARASILAHTADVRRQLDRGGL
                     VLDARPLDQFVGITHSPVVTLPGRIQGATALPAEVMYTRAEDGSWHFLTPEQYRNVLA
                     ALDIEMDSRTKADAIVYCNTGQYAAGAWFILNRIIGDSDIRSYEGSLYNWEHHGLPVV
                     GLK"
     misc_feature    complement(200751..201647)
                     /locus_tag="Hneap_0198"
                     /note="Rhodanese-related sulfurtransferase [Inorganic ion
                     transport and metabolism]; Region: SseA; COG2897"
                     /db_xref="CDD:225450"
     misc_feature    complement(201222..201644)
                     /locus_tag="Hneap_0198"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cl00125"
                     /db_xref="CDD:260205"
     misc_feature    complement(201348..201350)
                     /locus_tag="Hneap_0198"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     misc_feature    complement(200775..201131)
                     /locus_tag="Hneap_0198"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cl00125"
                     /db_xref="CDD:260205"
     misc_feature    complement(200871..200873)
                     /locus_tag="Hneap_0198"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            complement(202045..202794)
                     /locus_tag="Hneap_0199"
                     /db_xref="GeneID:8533314"
     CDS             complement(202045..202794)
                     /locus_tag="Hneap_0199"
                     /inference="protein motif:PFAM:PF09849"
                     /note="PFAM: protein of unknown function DUF2076;
                     KEGG: xfm:Xfasm12_2035 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic ligand-binding sensor protein"
                     /protein_id="YP_003262109.1"
                     /db_xref="GI:261854826"
                     /db_xref="InterPro:IPR018648"
                     /db_xref="GeneID:8533314"
                     /translation="MNAQEHTLLTDLLNKLKEAAPGAAAAKDPEADQLIRDTLAATPD
                     AAYLLVQRHLLLEMSLERAQAELKAIQAKASGSFLGGSIGYAADSRPTQTNAYGQPIG
                     RAEPAAVAATTSQAATSTTRPPFGGGSFLGTAAATATGVLGGALLFQGIEHLMGGGLG
                     GSALAGNQPVEDVTSLTENVYESPADMSADTASGGWDNASMADNGSAFDDPMADPIDP
                     MQSDNSGLFDQGNSGGGLFDGLFGGGDDDWV"
     misc_feature    complement(202141..202794)
                     /locus_tag="Hneap_0199"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3416"
                     /db_xref="CDD:225950"
     misc_feature    complement(202144..202794)
                     /locus_tag="Hneap_0199"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2076); Region: DUF2076; pfam09849"
                     /db_xref="CDD:255603"
     gene            complement(202943..203884)
                     /locus_tag="Hneap_0200"
                     /db_xref="GeneID:8533315"
     CDS             complement(202943..203884)
                     /locus_tag="Hneap_0200"
                     /inference="protein motif:TFAM:TIGR00083"
                     /note="TIGRFAM: riboflavin biosynthesis protein RibF;
                     cytidyltransferase-related domain protein;
                     PFAM: FAD synthetase; riboflavin kinase;
                     KEGG: hip:CGSHiEE_07145 bifunctional riboflavin kinase/FMN
                     adenylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein RibF"
                     /protein_id="YP_003262110.1"
                     /db_xref="GI:261854827"
                     /db_xref="InterPro:IPR002606"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR015864"
                     /db_xref="InterPro:IPR015865"
                     /db_xref="GeneID:8533315"
                     /translation="MQLIRGLCALPAFPDGCVVTLGNFDGVHLGHQAVLRQAADQARE
                     FGLPLVVLIFEPLPREFFAPHAPVARLTRLRERAAFIAELGVVDVLLVHPFNAAFAQS
                     TAEAFVEQVLVDALHARRIVIGDDFRFGKNRQGDFALLEQLGQRFDFSVQAAATWALD
                     GERVSSTRIRSHLTERDVAGAARLLGRPFTLCGRVIHGDKRGRQLGFPTANVALHRRL
                     SPLRGVFAVKTTLPDGAIVNGVANVGTRPTVDGQDARLEVHLFDFDRDIYGQMVRVAF
                     CHPLRDEQKFSSLEALMEQITRDASAARAWHDHAAHP"
     misc_feature    complement(202967..203881)
                     /locus_tag="Hneap_0200"
                     /note="bifunctional riboflavin kinase/FMN
                     adenylyltransferase; Reviewed; Region: PRK05627"
                     /db_xref="CDD:235536"
     misc_feature    complement(203291..203836)
                     /locus_tag="Hneap_0200"
                     /note="FAD synthetase, N-terminal domain of the
                     bifunctional enzyme; Region: FAD_synthetase_N; cd02064"
                     /db_xref="CDD:185679"
     misc_feature    complement(order(203387..203395,203417..203419,
                     203507..203509,203792..203794,203801..203803,
                     203810..203821))
                     /locus_tag="Hneap_0200"
                     /note="active site"
                     /db_xref="CDD:185679"
     misc_feature    complement(202967..203335)
                     /locus_tag="Hneap_0200"
                     /note="Riboflavin kinase; Region: Flavokinase; smart00904"
                     /db_xref="CDD:214901"
     gene            204104..204946
                     /locus_tag="Hneap_0201"
                     /db_xref="GeneID:8533316"
     CDS             204104..204946
                     /locus_tag="Hneap_0201"
                     /EC_number="3.1.21.4"
                     /inference="protein motif:PRIAM:3.1.21.4"
                     /note="PFAM: Restriction endonuclease EcoRV;
                     KEGG: hps:HPSH_07075 type II restriction endonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="type II site-specific deoxyribonuclease"
                     /protein_id="YP_003262111.1"
                     /db_xref="GI:261854828"
                     /db_xref="InterPro:IPR015314"
                     /db_xref="GeneID:8533316"
                     /translation="MNKKSDFEKALKEFVTTLQGYISSEDGQWTIKGFVDMYKNIYTI
                     SSDTKIISKILEIHIFPKLLELSEKHGYKIVLADHQNYYPDISFVDNDDDSVRFAVDF
                     KTTYRQPSKPHLCNGFTLGSHGKYFEDRTSTKNIQFPYGSYSGHYCLGIIYDRVDSRD
                     IDETKIYSLDSLTSITSVVGKFSFFVAEKWRIASDKSGSGNTANIGSINNIADIIEGK
                     GMFSNLGEEWFDDYWMNYKKITVPDGKGGTKKITNLKEFVAYRKGDVSLIVPKQNRTP
                     GKSK"
     misc_feature    204167..204886
                     /locus_tag="Hneap_0201"
                     /note="Restriction endonuclease EcoRV; Region:
                     Endonuc-EcoRV; pfam09233"
                     /db_xref="CDD:117784"
     gene            204946..205860
                     /locus_tag="Hneap_0202"
                     /db_xref="GeneID:8533317"
     CDS             204946..205860
                     /locus_tag="Hneap_0202"
                     /EC_number="2.1.1.72"
                     /inference="protein motif:TFAM:TIGR00571"
                     /note="KEGG: hps:HPSH_07080 adenine-specific DNA metylase;
                     TIGRFAM: DNA adenine methylase;
                     PFAM: D12 class N6 adenine-specific DNA methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA adenine methylase"
                     /protein_id="YP_003262112.1"
                     /db_xref="GI:261854829"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002294"
                     /db_xref="InterPro:IPR012326"
                     /db_xref="InterPro:IPR012327"
                     /db_xref="GeneID:8533317"
                     /translation="MKVSVPPIKSQGIKTKLVPWIKSLVPEKFRGRWVEPFMGTGVVA
                     FNVAPDKALMCDTNPHLINFYSAIKSGAITPEIVRGYLVKEGALLQEKGGEHYYSIRE
                     RFNESHSPLDFLFLNRSGFNGMIRFNRKGWFNIPFCKKPNRFAQAYVTKIVNQVSSVS
                     RLIAAKDFDFKCQSFDETISEAKTGDIIYCDPPYIDRHADYFNSWDESHEISLFKNLS
                     EARCDFILSTWHHNDYRKNEYIESHWNNFNILTKEHFYHVGGSEKNRNPMIEAIVTTI
                     DTKLYEYPEAPKQEQLTLLEPKLHYKSA"
     misc_feature    204958..205692
                     /locus_tag="Hneap_0202"
                     /note="D12 class N6 adenine-specific DNA
                     methyltransferase; Region: MethyltransfD12; cl17344"
                     /db_xref="CDD:266636"
     gene            complement(206010..206315)
                     /locus_tag="Hneap_0203"
                     /db_xref="GeneID:8533318"
     CDS             complement(206010..206315)
                     /locus_tag="Hneap_0203"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: bbt:BBta_6241 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262113.1"
                     /db_xref="GI:261854830"
                     /db_xref="GeneID:8533318"
                     /translation="MIPNALMLSLIARQSLEGELVDQLSELADYPLFLVSNVRGHNDT
                     HHGLSVAEQVEGTAPLIRLSLFTDEPTANRIIDHLRANFRNAGIRWWRIPLATGMID"
     misc_feature    complement(206013..206306)
                     /locus_tag="Hneap_0203"
                     /note="Protein of unknown function (DUF3240); Region:
                     DUF3240; pfam11582"
                     /db_xref="CDD:192778"
     gene            complement(206312..209416)
                     /locus_tag="Hneap_0204"
                     /db_xref="GeneID:8533319"
     CDS             complement(206312..209416)
                     /locus_tag="Hneap_0204"
                     /inference="protein motif:TFAM:TIGR00914"
                     /note="TIGRFAM: heavy metal efflux pump, CzcA family;
                     PFAM: acriflavin resistance protein;
                     KEGG: tgr:Tgr7_3246 heavy metal efflux pump, CzcA family"
                     /codon_start=1
                     /transl_table=11
                     /product="CzcA family heavy metal efflux pump"
                     /protein_id="YP_003262114.1"
                     /db_xref="GI:261854831"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="InterPro:IPR004763"
                     /db_xref="GeneID:8533319"
                     /translation="MLNRLIAFSLAQRLMVLLAAILVAGFGWMAFSTIPIDAYPDISP
                     TQVQIILKAPGVTPTEVETRITAPLETSLLGIPNQTMLRSTSKYGISVITLDFAEGTD
                     IYWARQQVNEALSSARGDLPAGTTGGVAPITTPLGEAFMFTLQSPTLSLTERRHLLDW
                     VIRPALRAVKGVADVNSLGGFVRTFEVIPNPTQLAAQKLTTDDLMRVIEQNNRNDGAG
                     RLDVGEEAWLVRSEGRIKTLDDLGNLVIAQHNGQPIHVRDVATVRIGAITRLGAVTHS
                     GKGETVEGLVLTLRGANARAVVAGVEQRLAEIKPSLPPDLKINVFYNRADLVNAAVHT
                     VSKALLEAVVLVLILLILFLGNLRAAVTVALTLPMAALITFILMKQFGMSANLMSLGG
                     LAIAIGMLVDAAVVVVENTVAHLAEAHKHPNLPRLHIVYRSVREVAAPVFSGILIIML
                     VFLPLLSLQGLEGKLFSPVALTIIFALGASLVLSLTLIPVIASLILGKVTDHEPWLVR
                     QLHRIYEPALNFALKRPLPVVAVAIAGLVVAGLLYTQIGKTFMPSLDEGTIVMQVENL
                     PSTNLGTTIALNTNIQKTLMAKVPEIAQIVGRSGSDELGLDPMGLNDTDTFIILKPKD
                     QWQASSIDEVREKIRAVISTLPGFNFSFTQPIEMRVSEMLTGSRGDLAIKIFGSDLTE
                     INTLSNEIKSVVSAIPGAQDVATTDNEGLLYLNIAVNQAAAARNGLSVNQLEDILRAQ
                     IEGQLAGIVQEGVARTPILIRADALTDAPQKLSSLPIALPNGTVQPLSNLAIVERTTG
                     PVFVTREMGSRFAVVRANVSGRALTDFVADAKNQIAEKVEMPTGYRLEWGGQFENQQR
                     AAARLAIVVPIALGLIFVLLFTTFNSVRQATLVFANIPFALIGGVVALYISGEYLSVP
                     ASVGFIALLGIAVLNGLVLVSYFNQLAAQGLDIEQVVRQGALRRLRPVMMTASIAALG
                     LVPLLFATGPGSEIQRPLAVVVIGGLVTSTLLTLILLPILYKRFGQSSDQRRAQQPLP
                     EAKA"
     misc_feature    complement(206426..209416)
                     /locus_tag="Hneap_0204"
                     /note="Putative silver efflux pump [Inorganic ion
                     transport and metabolism]; Region: COG3696"
                     /db_xref="CDD:226220"
     gene            complement(209416..210552)
                     /locus_tag="Hneap_0205"
                     /db_xref="GeneID:8533320"
     CDS             complement(209416..210552)
                     /locus_tag="Hneap_0205"
                     /inference="protein motif:TFAM:TIGR01730"
                     /note="TIGRFAM: efflux transporter RND family, MFP
                     subunit;
                     KEGG: app:CAP2UW1_4537 efflux transporter RND family, MFP
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="YP_003262115.1"
                     /db_xref="GI:261854832"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:8533320"
                     /translation="MNQHKHTSLTLMRTTALALLAISATVSTNSLAAAEASSPTAITI
                     PDAMRPNLNVKTQPIEFSKQVPVTQGMVTISAASSNQASMQVSAPADGQVMGTLPQVG
                     QAVQAGDILFEIASAQLGDAMAQWQMAKAKVTLAQQNLNRDTALFKDGLIAKKRLEAT
                     RGEAQMASAELKAASARLKAAGADSSAQNGGINLGVRAPITGVITQRMVMPGERVTTG
                     QSLFDITATQDQWWLLAISPNKAPAAGQKAELKIAGCPESASVQLMDLAVDPTNQLIT
                     LRARPNAPCATLRPGQVSTATLWVEQAKPAASLPISALTELDDNTHVFVQRGQNYFSI
                     PVTRVGEADGQAFVTGQFEPGDRVVSSGISQLKALSMGMGMGGE"
     misc_feature    complement(210211..>210309)
                     /locus_tag="Hneap_0205"
                     /note="Biotinyl_lipoyl_domains are present in
                     biotin-dependent carboxylases/decarboxylases, the
                     dihydrolipoyl acyltransferase component (E2) of 2-oxo acid
                     dehydrogenases, and the H-protein of the glycine cleavage
                     system (GCS). These domains transport CO2, acyl; Region:
                     Biotinyl_lipoyl_domains; cl11404"
                     /db_xref="CDD:264355"
     misc_feature    complement(209452..210249)
                     /locus_tag="Hneap_0205"
                     /note="Membrane Fusion Protein cluster 2 (function with
                     RND porters); Region: 8a0102; TIGR00999"
                     /db_xref="CDD:233229"
     misc_feature    complement(209680..209967)
                     /locus_tag="Hneap_0205"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(210549..211913)
                     /locus_tag="Hneap_0206"
                     /db_xref="GeneID:8533321"
     CDS             complement(210549..211913)
                     /locus_tag="Hneap_0206"
                     /inference="similar to AA sequence:KEGG:azo0224"
                     /note="KEGG: azo:azo0224 outer membrane efflux protein"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane efflux protein"
                     /protein_id="YP_003262116.1"
                     /db_xref="GI:261854833"
                     /db_xref="GeneID:8533321"
                     /translation="MSFLIKSTQPAKSGVSFAPSIPPGRKGLGLALIINLSLTLLSGT
                     AWAAAPPQTEPAQKTWAQLINQTEQRIEQNLVTEADRVRFESEQARANGILAGAPVVD
                     GLYRSDRLMSDFGANEMEIGVRLPLRRFGQSDAWRALAEQSALSAKTRTEANRLILLG
                     DLRQMAWDWRRAEVELSTAKERNRIMQRDLAAVTKQLKHGEAAEVDRMSVESRALAVQ
                     EAVTAAQMQLDTIQTRWQQLTGTSQLPLDLGQVTPTEQALLNNPELNTPDGLLAQQPL
                     LRQMASEVGMSTARIEAERAAGAGTPEIGLGVKRDRGDRGVPYDNSLQLTLSIPFGGQ
                     KYRDPALAEMAQQRATAQVALIKNTQQILGEVMALRQRIAAWPSRLTQLDRRAALSEK
                     TLTLKQKALRLGELDWTRLLDFEREAADARLQARLAHIAYQADQSSLKQTLGLMPAAN
                     RDSQ"
     misc_feature    complement(210576..211832)
                     /locus_tag="Hneap_0206"
                     /note="Outer membrane protein [Cell envelope biogenesis,
                     outer membrane / Intracellular trafficking and secretion];
                     Region: TolC; COG1538"
                     /db_xref="CDD:224455"
     misc_feature    complement(211194..>211601)
                     /locus_tag="Hneap_0206"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    complement(210582..211103)
                     /locus_tag="Hneap_0206"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            212094..212882
                     /locus_tag="Hneap_0207"
                     /db_xref="GeneID:8533322"
     CDS             212094..212882
                     /locus_tag="Hneap_0207"
                     /inference="protein motif:PFAM:PF00072"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein;
                     SMART: response regulator receiver;
                     KEGG: mei:Msip34_2112 transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_003262117.1"
                     /db_xref="GI:261854834"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="GeneID:8533322"
                     /translation="MTDTIHDSAISPNAPRILVVDDDPGIQTLLGRYLREQGFDVRVV
                     GSGAEMDIALAADPRVDLLVLDIMLPGEDGLSIARRLDPKTRPPVIMLSARGEDIDRI
                     VGLEIGADDYVPKPFNPRELLARIRAVLRRQRMEPDARGKQDERIRVGDFAIDPQTRQ
                     AFLSDGALDLTHGEWQLLQFFMERPNRVINRDQIMDYLKGYERSAFDRSIDVRITRLR
                     RKIETNPTEPRYLVTIWGEGYLFAPSGRSPRSPDASTAVVGERT"
     misc_feature    212139..212828
                     /locus_tag="Hneap_0207"
                     /note="osmolarity response regulator; Provisional; Region:
                     ompR; PRK09468"
                     /db_xref="CDD:181883"
     misc_feature    212145..212483
                     /locus_tag="Hneap_0207"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(212154..212159,212289..212291,212313..212315,
                     212370..212372,212427..212429,212436..212441)
                     /locus_tag="Hneap_0207"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    212289..212291
                     /locus_tag="Hneap_0207"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(212298..212303,212307..212315)
                     /locus_tag="Hneap_0207"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    212436..212444
                     /locus_tag="Hneap_0207"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    212532..212816
                     /locus_tag="Hneap_0207"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(212604..212606,212661..212666,212718..212720,
                     212727..212729,212751..212756,212790..212792,
                     212805..212807)
                     /locus_tag="Hneap_0207"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            212879..214294
                     /locus_tag="Hneap_0208"
                     /db_xref="GeneID:8533323"
     CDS             212879..214294
                     /locus_tag="Hneap_0208"
                     /inference="protein motif:PFAM:PF02518"
                     /note="PFAM: ATP-binding region ATPase domain protein;
                     histidine kinase HAMP region domain protein; histidine
                     kinase A domain protein;
                     SMART: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein;
                     KEGG: tbd:Tbd_2353 periplasmic sensor signal transduction
                     histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="YP_003262118.1"
                     /db_xref="GI:261854835"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:8533323"
                     /translation="MIRKNRTPRVWSLFSTTALTLIASVSFILVFALSAVTWFAMVPM
                     AKRSADDLAALIVLSAQTWVELPKDAQPLLAAELKDQHGIEIEEIQTLSRQHGTVLPY
                     VRFLHDAVVRRLNACPPNTKDPATGECVYMGILPNNAGYWLELPMADDVLRFEFSPDR
                     VGYRIPFTLGIILIGGIVLTLILALFLTRRLTRPVSQLAEQVSRGLPDAPLPLTGPQE
                     TRVLIDAVNRRSAEVARLLENRTVLLAGISHDLRTPLTRLSLGLALTQDDIEPALQAQ
                     MQADIEQMNRLIAEVLHIARGVSQDSSEPIPLYPWLTRFAAEWEQRDTGIALMVDEAT
                     KMLEIDVATDSLQRILDNLVENAHRYGRPPIILRSVQTEDAQILCVEDEGQGLTVAEI
                     GRLREPFARKDEARSGVTGYGLGLSLAQALAQAQGWTLDLYAPGEHPYTPDGLMPKGL
                     VACLRLPRAVAPVRPLSPRNI"
     misc_feature    213383..213562
                     /locus_tag="Hneap_0208"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    213587..213766
                     /locus_tag="Hneap_0208"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(213605..213607,213617..213619,213629..213631,
                     213638..213640,213650..213652,213659..213661,
                     213707..213709,213716..213718,213728..213730,
                     213737..213739,213749..213751)
                     /locus_tag="Hneap_0208"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    213623..213625
                     /locus_tag="Hneap_0208"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    213914..214177
                     /locus_tag="Hneap_0208"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(213932..213934,213944..213946,213953..213955,
                     214016..214018,214022..214024,214028..214030,
                     214034..214039,214115..214126,214172..214174)
                     /locus_tag="Hneap_0208"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    213944..213946
                     /locus_tag="Hneap_0208"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(214028..214030,214034..214036,214115..214117,
                     214121..214123)
                     /locus_tag="Hneap_0208"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            214686..216095
                     /locus_tag="Hneap_0209"
                     /db_xref="GeneID:8533324"
     CDS             214686..216095
                     /locus_tag="Hneap_0209"
                     /inference="protein motif:TFAM:TIGR00653"
                     /note="TIGRFAM: glutamine synthetase;
                     PFAM: glutamine synthetase catalytic region; glutamine
                     synthetase beta-Grasp;
                     KEGG: mca:MCA1677 glutamine synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="YP_003262119.1"
                     /db_xref="GI:261854836"
                     /db_xref="InterPro:IPR004809"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="GeneID:8533324"
                     /translation="MSVSHAMKMMEENGVKFVDFRFTDTRGKQQHVTYPAGRVDEDSF
                     ESGIMFDGSSIAGWKGINASDMILMPDAGSAVMDPFSEESTMILICDVIEPDTMQGYT
                     RDPRSVAKRAEAYIQASGLADVAYFGPENEFFVFDDVRWGNEMSGSFVKIDSKEAAWN
                     TGKEYEDGNMGHRPGVKGGYFPVPPVDSLHDLRQTMCLVLEDMGQTVEVHHHEVATAG
                     QCEIGVAFNTLVKKADEVQNLKYVLHNVAHSYGKTLTFMPKPMFGDNGSGMHVHQSMA
                     KDGKNLFSGDSYAGLSEMALYYIGGIIKHAHALNAFCNPSTNSYKRLVPHYEAPVKLA
                     YSARNRSASIRIPFVSNPKARRIELRFPDSTANPYLAFAAMLMAGIDGIQNKIHPGEA
                     ASKNLYDLPPEEEKNIPEVAFSLDEALDALEKDREFLKRGDVFSDDLIDAYLELKRGE
                     VQRLRMLPHPVEFEMYYSL"
     misc_feature    214686..216092
                     /locus_tag="Hneap_0209"
                     /note="glutamine synthetase; Provisional; Region: glnA;
                     PRK09469"
                     /db_xref="CDD:181884"
     misc_feature    214725..214970
                     /locus_tag="Hneap_0209"
                     /note="Glutamine synthetase, beta-Grasp domain; Region:
                     Gln-synt_N; pfam03951"
                     /db_xref="CDD:252271"
     misc_feature    214992..215822
                     /locus_tag="Hneap_0209"
                     /note="Glutamine synthetase, catalytic domain; Region:
                     Gln-synt_C; pfam00120"
                     /db_xref="CDD:249604"
     gene            complement(216269..216736)
                     /locus_tag="Hneap_0210"
                     /db_xref="GeneID:8533325"
     CDS             complement(216269..216736)
                     /locus_tag="Hneap_0210"
                     /inference="protein motif:PFAM:PF03073"
                     /note="PFAM: TspO/MBR family protein;
                     KEGG: bpy:Bphyt_6800 TspO and MBR like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TspO and MBR-like protein"
                     /protein_id="YP_003262120.1"
                     /db_xref="GI:261854837"
                     /db_xref="InterPro:IPR004307"
                     /db_xref="GeneID:8533325"
                     /translation="MSSFLVYAISFVLVILVAASGGRFRPDRWYAELKKPVGLPPNWV
                     FPVVWISLYAMMAVAAAWVWLAEPSDLRTAGLIIYAAQLVFNAAWSWLFFGLHRTGLA
                     LIDLLVLITLVSINTWLFVQVDTWAGLLLVPYLIWLLIALYLNASVCWLNRRT"
     misc_feature    complement(216284..216715)
                     /locus_tag="Hneap_0210"
                     /note="TspO/MBR family; Region: TspO_MBR; pfam03073"
                     /db_xref="CDD:251713"
     gene            complement(216936..219419)
                     /locus_tag="Hneap_0211"
                     /db_xref="GeneID:8533326"
     CDS             complement(216936..219419)
                     /locus_tag="Hneap_0211"
                     /inference="protein motif:PFAM:PF10070"
                     /note="PFAM: protein of unknown function DUF2309;
                     KEGG: afe:Lferr_1358 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262121.1"
                     /db_xref="GI:261854838"
                     /db_xref="InterPro:IPR018752"
                     /db_xref="GeneID:8533326"
                     /translation="MTTLTSLQRSEAQRNHIVDLIDKACLRIAPIWPLDSFVAVNPYL
                     GLIDQPFDTVGRYLEQTVGESLFMDHGWFADKIAQGEITDDDLAQAAQQLDPSISLDT
                     IKQQLAVHRQPAPALPLVTNELDRRDAPPVSEFVIEQVSQFMANYYDRGQALWHLPKE
                     ASASLFAQWRRYTLINRSASAVGLKQVRQHLLAVPSDAIDALFWALDQINLPESRLPD
                     YLFTLLKTIGGWASWCRYLHFQAGLHGESQHDLRDLLIIRLVWVALVIKETSSAGRQQ
                     WRAKLNDWFDPAKLVASPSATATASTKAQSSRIDEILLAAAEQAFRRRINAGLNRQPA
                     DAPDQQAERPTVQAAFCIDVRSEVFRRHLEASSPGLETIGFAGFFGLPIDYCRMGESE
                     ARLQNPVLINPAYRAQETGDPAIAQHRHARQSRGAIWKQFKLSAASCFTFVESAGLSY
                     VPRLLADSLGWHRSSLPPDAPGLTPEERARLHPQLVKLDGGALSTQEKVDLAEKVLRG
                     LGLTHTFAPIVLLAGHGSSTTNNPHRAGLDCGACAGQAGDVNARVAVQLLNEAAVRLG
                     LIERGIAIPRDTRFVAALHDTTTDHIELLDLDQSGIESDQLSSLTQALKQAGELTRLE
                     RLVTLEAQVDTVDAEKQATFRGRDWSQVRPEWGLAGNAAFIAAPRWRTRGLDLGGRAF
                     LHDYDWRHDKEFGVLNVIMTAPLIVANWINLQYYGSTVDNLHQGAGNKVLHNVVGGTV
                     GVIEGNGGDLRVGLAMQSLHDGEQWRHEPLRLSAYIEAPIAEIDKIIAGHDMLNALIN
                     NRWMHILHIDDNGIPHRRHAHGDWRPEPI"
     misc_feature    complement(217017..219362)
                     /locus_tag="Hneap_0211"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2309); Region: DUF2309; pfam10070"
                     /db_xref="CDD:255733"
     gene            complement(219465..221120)
                     /locus_tag="Hneap_0212"
                     /db_xref="GeneID:8533327"
     CDS             complement(219465..221120)
                     /locus_tag="Hneap_0212"
                     /EC_number="1.6.99.5"
                     /inference="protein motif:PRIAM:1.6.99.5"
                     /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
                     KEGG: afe:Lferr_1359 NADH/ubiquinone/plastoquinone
                     (complex I)"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase (quinone)"
                     /protein_id="YP_003262122.1"
                     /db_xref="GI:261854839"
                     /db_xref="InterPro:IPR001750"
                     /db_xref="InterPro:IPR003916"
                     /db_xref="GeneID:8533327"
                     /translation="MTIEFSHTTGLLLLAMPALLLMAAVIKPKQGAAYARAYRQRVQW
                     TSFAAFGLALLAVVSFLFARQQNLMLGAGSLPAGLGLLALSIQVNGLTLVLASLVSFV
                     LSVIARYSVQYLDGDPQQARFFRLLAVTGGFFLLVVISGNLGLFTLAIIATGFGLHRL
                     LSFYADRPRAIMATHKKSIFSRTADALLLAATVLIGHQIGSLEFSQISAYVHAQDHLS
                     IALHVAAWLIVLAAILKSAQFPFHGWLIQVMEAPTPVSALMHAGVVYSGAIIVLRTSE
                     LLAADGTALLLLALIGLMTLAIGSLVMLTQSAIKSSLAWSTAAQLGFMMLELGLGLFG
                     LALLHLVGHSLYKAHAFLSSGSMTDHLRQAKVLKNRPISVVAWFTTVIVSGLFTLGIA
                     AAMGLSIDQEPMLPAVLTIIALATAQLMLKALSHGTWREILVAAGAAIAMTGVYVFLH
                     EVFITGFADTLAATPQRAPLLDLLLMAITIITFLFVAWLQGPGKTLMSPERQFALFVH
                     LNNGLYLDRWVERLAFRFWPEKVGRAPKKSCAVIPPNPSGIEP"
     misc_feature    complement(219537..221015)
                     /locus_tag="Hneap_0212"
                     /note="NADH dehydrogenase subunit L; Provisional; Region:
                     PRK08168"
                     /db_xref="CDD:236171"
     misc_feature    complement(219930..220703)
                     /locus_tag="Hneap_0212"
                     /note="NADH-Ubiquinone/plastoquinone (complex I), various
                     chains; Region: Oxidored_q1; pfam00361"
                     /db_xref="CDD:201180"
     gene            221411..222358
                     /locus_tag="Hneap_0213"
                     /db_xref="GeneID:8533328"
     CDS             221411..222358
                     /locus_tag="Hneap_0213"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: LysR substrate-binding; regulatory protein
                     LysR;
                     KEGG: tcx:Tcr_0852 LysR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003262123.1"
                     /db_xref="GI:261854840"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:8533328"
                     /translation="MTDAATLGARKLLRHATLRQVEVFESVARHVSFTRAAEELHLTQ
                     PSVSAQVKSLAEVVGEPLYEQVGRRIYLTDAGQIVERSCREVIDILSNAEMSLSELNG
                     MRKGRLRLSVITTAKYFAPLALGDFSLQYPDIDLELVISNRDTLLKRIEDNRSDLYVM
                     GQLPRTRLDLEVIPFAPNPLVVIAHRDHILAKERNISMERIAQESFIMREPGSGIRHK
                     VEEHFARHQQSIKTRLVLDGNEAIKHAVAGRLGISVVSAHALNLENSQEPLVKLDVQS
                     FPLQSMWNIVYPRGKALSVVARQFLSFLKIHGGDYLHIG"
     misc_feature    221459..222325
                     /locus_tag="Hneap_0213"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    221462..221641
                     /locus_tag="Hneap_0213"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    221729..222322
                     /locus_tag="Hneap_0213"
                     /note="The C-terminal substrate binding of LysR-type
                     transcriptional regulator (CbbR) of RubisCO operon, which
                     is involved in the carbon dioxide fixation, contains the
                     type 2 periplasmic binding fold; Region:
                     PBP2_CbbR_RubisCO_like; cd08419"
                     /db_xref="CDD:176111"
     misc_feature    order(221771..221776,221780..221785,221792..221794,
                     221804..221806,221810..221830,222107..222124,
                     222140..222145,222149..222154)
                     /locus_tag="Hneap_0213"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176111"
     gene            222448..222801
                     /locus_tag="Hneap_0214"
                     /db_xref="GeneID:8533329"
     CDS             222448..222801
                     /locus_tag="Hneap_0214"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: bld:BLi00515 YdzA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262124.1"
                     /db_xref="GI:261854841"
                     /db_xref="GeneID:8533329"
                     /translation="MTGTYPEKAQPSASRLLRHLNVMTLVEGASLIALVLIAVPIKYG
                     LDFPLAVKVVGPIHGALFVWTMGVLLVSVIAGRLAISKGAGVFLAALIPFGGLWSHRL
                     LDRELAHHEPKSPVK"
     misc_feature    222496..222765
                     /locus_tag="Hneap_0214"
                     /note="Domain of unknown function (DUF3817); Region:
                     DUF3817; pfam12823"
                     /db_xref="CDD:257325"
     gene            223050..223448
                     /locus_tag="Hneap_0215"
                     /db_xref="GeneID:8533330"
     CDS             223050..223448
                     /locus_tag="Hneap_0215"
                     /inference="protein motif:PFAM:PF00472"
                     /note="PFAM: class I peptide chain release factor;
                     KEGG: bbr:BB3074 peptidyl-tRNA hydrolase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="class I peptide chain release factor"
                     /protein_id="YP_003262125.1"
                     /db_xref="GI:261854842"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="GeneID:8533330"
                     /translation="MTISIDVNDVEFTAIRSQGAGGQHVNKVSTAIHLRFDIRASALP
                     DEAKEKLLAVSDSRISRDGVIVIKAQRFNSQDKNRADALARLQALVAQALRPVKPRKP
                     TKPTRGAQLKRLAKKVQRGQTKLLRGRVVE"
     misc_feature    223053..223439
                     /locus_tag="Hneap_0215"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09256"
                     /db_xref="CDD:181730"
     gene            223467..224009
                     /locus_tag="Hneap_0216"
                     /db_xref="GeneID:8533331"
     CDS             223467..224009
                     /locus_tag="Hneap_0216"
                     /inference="protein motif:PFAM:PF07152"
                     /note="PFAM: YaeQ family protein;
                     KEGG: hch:HCH_00909 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="YaeQ family protein"
                     /protein_id="YP_003262126.1"
                     /db_xref="GI:261854843"
                     /db_xref="InterPro:IPR009822"
                     /db_xref="GeneID:8533331"
                     /translation="MAQKATVYKVDLDISDMDRSYYLSHHLTLALHPSETESRMMFRL
                     LAFALNAQEALQFTRGLSADDEPDIWLKDLTGAIDLWIEVGLPDERRLRKACGRAKQV
                     LVYAYGDRAVSVWWAKSAREFARLDNLRVFSIDDESLDGLTALIGRGMHLSVSIQDGD
                     IWFSDGEGNVPITVRSLQPA"
     misc_feature    223470..223985
                     /locus_tag="Hneap_0216"
                     /note="YaeQ protein; Region: YaeQ; pfam07152"
                     /db_xref="CDD:254081"
     gene            224238..225791
                     /locus_tag="Hneap_0217"
                     /db_xref="GeneID:8533332"
     CDS             224238..225791
                     /locus_tag="Hneap_0217"
                     /inference="protein motif:PFAM:PF03190"
                     /note="PFAM: protein of unknown function DUF255;
                     KEGG: chu:CHU_2821 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262127.1"
                     /db_xref="GI:261854844"
                     /db_xref="InterPro:IPR004879"
                     /db_xref="GeneID:8533332"
                     /translation="MKRYTRWVGLFSVLLLLPQWAQAADIHWQPYGPAVFAKAKAENR
                     LILLDMVAVWCHWCHVMEDKTYSDPAVANEINAHFVAVRVDHDARPDLAERYRNYAWP
                     ATIILRPDGGEVLRKAGYIPPERMMKLLHQAEQLPVLAPEPEQVADAAPSSGDPLSST
                     VRNMLIRNHLSLNDPVLGGLKLPQKFLVEGEVRWDMYLAAHGDKQAKKRAIAYLNAAL
                     KLIDPVFGGAYQYSTHGDWQHPHFEKIMSVQADYLRVYSQAYTQFGDDRYRQAIAAIA
                     GYLNQFLSAPDGGFHPSQDADLVQGEKANTYFAKDRAARLAEGVPRVDPHQYTAQTAM
                     AIEGLLDAYHATGDRQYFFRAMAGLDWVLRHRRLDDVGFKHDAKDVAGPYLIDNLYMA
                     RVYLALYRITQTPMWLTQAEQLGDWISTHFTRSEGGLFSAVPDGTPVLPVPQVDQNLQ
                     AAGFYLGLAQASRKRHYLETATNILAYLARPAVASARSSNAGILLYDAQRDALAKSLP
                     KKTKDAPAS"
     misc_feature    224301..225722
                     /locus_tag="Hneap_0217"
                     /note="Highly conserved protein containing a thioredoxin
                     domain [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG1331"
                     /db_xref="CDD:224250"
     misc_feature    224301..>224618
                     /locus_tag="Hneap_0217"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     misc_feature    224835..>225542
                     /locus_tag="Hneap_0217"
                     /note="AGE domain; N-acyl-D-glucosamine 2-epimerase
                     domain; Responsible for intermediate epimerization during
                     biosynthesis of N-acetylneuraminic acid. Catalytic
                     mechanism is believed to be via nucleotide elimination and
                     readdition and is ATP modulated. AGE is...; Region: AGE;
                     cl00183"
                     /db_xref="CDD:260241"
     misc_feature    order(224859..224861,224880..224882,225015..225017,
                     225054..225056)
                     /locus_tag="Hneap_0217"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238153"
     gene            226041..227918
                     /locus_tag="Hneap_0218"
                     /db_xref="GeneID:8533333"
     CDS             226041..227918
                     /locus_tag="Hneap_0218"
                     /inference="protein motif:PFAM:PF05787"
                     /note="PFAM: protein of unknown function DUF839;
                     KEGG: tcx:Tcr_0864 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262128.1"
                     /db_xref="GI:261854845"
                     /db_xref="InterPro:IPR008557"
                     /db_xref="GeneID:8533333"
                     /translation="MNKNILALAIAGVFSLGLAGCNSSDDTTASATPEPANPAPTGTT
                     LATPTGAAQNEFMVATDFTVPGYTSNLNGASDTLQTAAVDAAKTQPFGFHKLVATGYE
                     DNNETFGWIKDKDKKGLVFADGSKYICNGTNQGVGSGLDNSSLIKQADGSLRLVAQFE
                     CQVGAMYTAGIDQDAVTGALSMKPNSLQFIDQSSEFGGYTHCAGMVTPWNTHLGSEEY
                     EPNARLDSQTSVGKTDDTFYNATFPFWTGSVDSAQNNDPATGMNPYFYGWIPEVKADG
                     TGFTKHYSMGRVSHELAYVMPDQKTAYLSDDGTNDGFYKFVADKAGDLSAGTLYAAKF
                     TQTDATAGGKFTLSWISLGHADDATIRAEVAKRPVFDDLFATATPDATTNACPADFTR
                     INTEAGLECLQIKTGMDEIASRLETRRYAAMMGATTELRKTEGITFDAATKTMYVAIS
                     SIERGMEDGYSTVKKTDKYDKGGNNDIRLPANTCGAVYALPVDTNYNATAWNVVIAGT
                     PTTYDANSPYTNNYCDVNGIANPDNINMIPDTSLLMIGEDSGAHINNVYWAYDLDTKS
                     LKRVLTVPKGAEVTSTFWYQFGNFAYLSVVGQHPLKKESTATPDQKQTLLGYIGPFVK
                     N"
     misc_feature    <226626..227840
                     /locus_tag="Hneap_0218"
                     /note="Bacterial protein of unknown function (DUF839);
                     Region: DUF839; pfam05787"
                     /db_xref="CDD:253386"
     gene            228104..229846
                     /locus_tag="Hneap_0219"
                     /db_xref="GeneID:8533334"
     CDS             228104..229846
                     /locus_tag="Hneap_0219"
                     /inference="similar to AA sequence:KEGG:TERTU_3358"
                     /note="KEGG: ttu:TERTU_3358  lipoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_003262129.1"
                     /db_xref="GI:261854846"
                     /db_xref="GeneID:8533334"
                     /translation="MRRSVDKTILITSLVALPFLLANCGGSGTDTAKTTTSDGAADKT
                     VVSLNSDAMLNPAAYIPPQCYTQTRDETGAFAGKSSNPCFACHNMGKEPNYTNDADLQ
                     LTYAMPAFAQKNNWSNLFIDRRPEIAAIDDAKILEYVRQDNYHDAAGLVALQRVLNAP
                     LPAGWDANGDGKWNGYIPDAYFSFDETGFDHAPDGSYTGWRAFAYAAFLGTFWPTNGS
                     TDDVLIRLASAFREKTDGTFDLTIYTVNLAIMQAMIQRQNVPIAAVDERIFGVDLNRD
                     GQLGTATQITYDWSPTEGRNMQYVGLAGEHLAQGQVHIAAGLYPEGTEFIHTVRYLDP
                     VGGEVGIGMSARMKEVRYAVKRGWNNFAQLKSYADGEVLEDMRFPDRLRRFVGNIETG
                     LQNGTGWYYAGFIEDKQGDLRPQSKEELSACMGCHSALSVTTDSSFAFPRKLNADQAD
                     GWYHWTQRAKGLNGLPEPQYANGVYEYTHYLDINHAGDEFRENKEVIAKFYGTGSTLI
                     PAEVDALHHDIGTLLLPSKERAIALDKAYYLIVQEQSFNKGRDAIIEPPVNIHKTVGE
                     DEATGVNEIYLIPR"
     gene            229934..232051
                     /locus_tag="Hneap_0220"
                     /db_xref="GeneID:8533335"
     CDS             229934..232051
                     /locus_tag="Hneap_0220"
                     /inference="protein motif:PFAM:PF00801"
                     /note="PFAM: PKD domain containing protein;
                     SMART: PKD domain containing protein;
                     KEGG: ttu:TERTU_2148 PKD domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PKD domain-containing protein"
                     /protein_id="YP_003262130.1"
                     /db_xref="GI:261854847"
                     /db_xref="InterPro:IPR000601"
                     /db_xref="GeneID:8533335"
                     /translation="MKRLFLFVFALVLSLGHLPIVNATTFFSEDFASKSLGQMTTVNV
                     ASNANWVYGSYQGDDFAKMNGYGADVASDDWLLTPQITLPAGAAANLFYTTIKGFDGP
                     ALQAMISTDYDGSGTPTAVQAATWTTLGGALPTNTTGYSSATSSGPVDLSAYADQKVT
                     IAFHYTSTGTVSGAAATWEVLDVQVGDGGAAPSVAASASETSVLTQTPLTFNAKINGG
                     TPPLQAVWQFSDGLTQTGAQVQHQFLNPGDYTATVTVTDANGLSATSAPVNVTALKPQ
                     AYVLPEPKGTLRVATFNTYLNRTVEGELAADLGAGDAQAAAVAEIIQRVRPDVILLNE
                     FDYDPSGDALDLFERRYLAIGQNGAHSIQYPYHYVAPVNTGVQSGKDLDHNGTPGDPG
                     DAFGFGSFPGQYGMVILSMYPIEADKVRTFQKFLWKDMPNALLPKNPDGSSYYTPAEL
                     DVFRLSSKSHWDVPVYVNGKTLHILASHPTPPVFDDGTLGVDKDVVDWNGTRNHDEIR
                     LWADYIDPAKSGYIVDDKGGKGGLSANARFVIVGDENADPKKGDSTNKAILQLLDNPL
                     VTDTDPTSIGALDNTDARFGASADDTIEDGLRLDYVLPSTFGVTVDQGQVFWPGRTYD
                     LSRLTGFQTVISSDHRMNWQDMTLNVTAVDDVMPSEPAPDSGNTATSNDGGSGAVGPW
                     ALLLLTGPLLLARIIRRKHNNPA"
     misc_feature    230540..230743
                     /locus_tag="Hneap_0220"
                     /note="polycystic kidney disease I (PKD) domain; similar
                     to other cell-surface modules, with an IG-like fold;
                     domain probably functions as a ligand binding site in
                     protein-protein or protein-carbohydrate interactions; a
                     single instance of the repeat is...; Region: PKD; cd00146"
                     /db_xref="CDD:238084"
     misc_feature    230801..231850
                     /locus_tag="Hneap_0220"
                     /note="Endonuclease/Exonuclease/phosphatase family;
                     Region: Exo_endo_phos; pfam03372"
                     /db_xref="CDD:251907"
     gene            complement(232259..233416)
                     /locus_tag="Hneap_0221"
                     /db_xref="GeneID:8533336"
     CDS             complement(232259..233416)
                     /locus_tag="Hneap_0221"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: sfr:Sfri_3579  integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262131.1"
                     /db_xref="GI:261854848"
                     /db_xref="GeneID:8533336"
                     /translation="MQRLSFRSVLRASLPPIDTWAPRNTRYSSFPRKLEPRKINKLDS
                     RIRGNDGFFELPTYRLAALFCLLFFIGHSTFAATLPAIVDEASGLTRSPQHVGVYWTH
                     NDNINLPASSKKGVPLLFAINNDGKLLGTLKLDGVRQRDWEAITHLDLDGNPTLVIGD
                     IGDNRGTWPDYRLWFVPEPVALKTNITQRPTAIIRFRYSDQVPAPRRQGGFSGGHDAE
                     SLVFDAEHREFLILTKREKSARLFAIPLTSRVNLSDGKPISAQEKKAAVVTARFIANL
                     PTLPAPDLVSWLLHPFTSPYADQPTAMALTPDGHLLAILTYSAVYYFYRRAKEDWPTA
                     LQKPFASVSLPSIEQWEGASFSADGKKLVIVHEGRGENTVTILQAPWALKN"
     misc_feature    complement(<232937..233191)
                     /locus_tag="Hneap_0221"
                     /note="SdiA-regulated; Region: SdiA-regulated; cl19046"
                     /db_xref="CDD:267399"
     misc_feature    complement(order(232988..232990,232994..232996,
                     233108..233110,233156..233158))
                     /locus_tag="Hneap_0221"
                     /note="putative active site [active]"
                     /db_xref="CDD:197380"
     gene            complement(233428..233628)
                     /locus_tag="Hneap_0222"
                     /db_xref="GeneID:8533337"
     CDS             complement(233428..233628)
                     /locus_tag="Hneap_0222"
                     /inference="similar to AA sequence:KEGG:CAP2UW1_0811"
                     /note="KEGG: app:CAP2UW1_0811 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262132.1"
                     /db_xref="GI:261854849"
                     /db_xref="GeneID:8533337"
                     /translation="MKTNVGSIDKILRIVVGLALIALSVFKPEVVGYWGYIGIIPLLT
                     GLFNFCPAYTLLGLNTKGKSAE"
     misc_feature    complement(233437..233628)
                     /locus_tag="Hneap_0222"
                     /note="Protein of unknown function (DUF2892); Region:
                     DUF2892; pfam11127"
                     /db_xref="CDD:256306"
     gene            complement(233704..234051)
                     /locus_tag="Hneap_0223"
                     /db_xref="GeneID:8533338"
     CDS             complement(233704..234051)
                     /locus_tag="Hneap_0223"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: xop:PXO_00888 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262133.1"
                     /db_xref="GI:261854850"
                     /db_xref="GeneID:8533338"
                     /translation="MDQRTSPFFSRFARNLSAIGIGVALVMGAQVASADELVMRPDIN
                     QAKPGSTYYVHGLSMNQITKKFGQPSRKLAPDPAKGTKYQPPITRWVYPEFTVYFEHG
                     HAIHLVKHHKRPK"
     gene            234504..235751
                     /locus_tag="Hneap_0224"
                     /db_xref="GeneID:8533339"
     CDS             234504..235751
                     /locus_tag="Hneap_0224"
                     /inference="protein motif:TFAM:TIGR02212"
                     /note="TIGRFAM: lipoprotein releasing system,
                     transmembrane protein, LolC/E family;
                     PFAM: protein of unknown function DUF214;
                     KEGG: tgr:Tgr7_1365 lipoprotein releasing system,
                     transmembrane protein, LolC/E family"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein releasing system transmembrane
                     protein LolC/E family"
                     /protein_id="YP_003262134.1"
                     /db_xref="GI:261854851"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="InterPro:IPR011925"
                     /db_xref="GeneID:8533339"
                     /translation="MFRSFEWLIGLRYTRAKRRNRFVSFISATSIIGITLGVTALIVV
                     ISVMNGFQDELRHRILGMTAHATISENGQALQDWRSLAKKVQNEPDVMASAPYVQAEA
                     MLSAQPNVSGAIIRGIEPKYEDAVTDIGKHMVAGSLSDLKPGGFGIVLGEALAQSLGV
                     AVGDKLMLITANVAVTPVGGLLRQRQFTVVGIFKVGMYEYDRGSAFIDLKDAQALFRM
                     GDGVTGLRLKLDDMFRAPWVARDLNLKLGNPYWTTDWTQANGNFFRAVQTERTVMFII
                     LSLIVAVAAFNIVSTLVMVVTDKRGDIAILRTLGASPGSIMRIFLISGTVIGLIGTLI
                     GVGFGVLIASNVETIVPWIEHLTGTQFMPADVYYISEVPSRLDWNDVWHVGLMAFGLS
                     FLATIYPAWSASRVQPAEALRYE"
     misc_feature    234513..235748
                     /locus_tag="Hneap_0224"
                     /note="lipoprotein releasing system, transmembrane
                     protein, LolC/E family; Region: lolCE; TIGR02212"
                     /db_xref="CDD:233781"
     misc_feature    234555..235196
                     /locus_tag="Hneap_0224"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:257236"
     misc_feature    235323..235727
                     /locus_tag="Hneap_0224"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            235744..236451
                     /locus_tag="Hneap_0225"
                     /db_xref="GeneID:8533340"
     CDS             235744..236451
                     /locus_tag="Hneap_0225"
                     /inference="protein motif:TFAM:TIGR02211"
                     /note="KEGG: mpt:Mpe_A2747  lipoprotein releasing system
                     ATP-binding ABC transporter;
                     TIGRFAM: lipoprotein releasing system, ATP-binding
                     protein;
                     PFAM: ABC transporter;
                     SMART: ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein releasing system, ATP-binding
                     protein"
                     /protein_id="YP_003262135.1"
                     /db_xref="GI:261854852"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011924"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:8533340"
                     /translation="MNKPSQAAPTPDIVLETRHLHRTYREGDLVVPVLKGIDLAVKKG
                     EMLAIVGASGSGKSSLLQLMGGLDKPTGGEVWLAGHLLSTQSEAARGTLRNRHLGFVY
                     QAHHLLPEFSALDNVAMPLLIRRLPRVEAHARARGMLEAVGLGARGEHRPGELSGGER
                     QRVAIARALVTEPAVVLADEPTGNLDSHSSDSVFNAMVSLNQRFGTAIVLVTHDNQLA
                     ELMQRVLVMHDGVLKPR"
     misc_feature    235783..236445
                     /locus_tag="Hneap_0225"
                     /note="lipoprotein releasing system, ATP-binding protein;
                     Region: LolD_lipo_ex; TIGR02211"
                     /db_xref="CDD:131266"
     misc_feature    235786..236439
                     /locus_tag="Hneap_0225"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    235894..235917
                     /locus_tag="Hneap_0225"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    order(235903..235908,235912..235920,236050..236052,
                     236278..236283,236380..236382)
                     /locus_tag="Hneap_0225"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    236041..236052
                     /locus_tag="Hneap_0225"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    236206..236235
                     /locus_tag="Hneap_0225"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    236266..236283
                     /locus_tag="Hneap_0225"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    236290..236301
                     /locus_tag="Hneap_0225"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    236368..236388
                     /locus_tag="Hneap_0225"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            236581..238059
                     /locus_tag="Hneap_0226"
                     /db_xref="GeneID:8533341"
     CDS             236581..238059
                     /locus_tag="Hneap_0226"
                     /inference="protein motif:PFAM:PF04853"
                     /note="PFAM: neutral invertase;
                     KEGG: tgr:Tgr7_0707 neutral invertase"
                     /codon_start=1
                     /transl_table=11
                     /product="neutral invertase"
                     /protein_id="YP_003262136.1"
                     /db_xref="GI:261854853"
                     /db_xref="InterPro:IPR006937"
                     /db_xref="GeneID:8533341"
                     /translation="MAQKNPDSCFQNPKYAGFSPALDDAYRLIDSALIYYQGQIVGTV
                     ASTDHTAPAVNYSDCFVRDFFSAGLIMLLEGRADIVRAFLHVIMQLRGQQEALEGQQI
                     APGVLPASFRVHRDADGEETIIADFGDRAIGRVAPVDSMMWWAALLRAYVRYTGDEAF
                     AHTPEIQRMLRMILSLCLQSRFEVFPTLLVPDGSFMIDRRMGVNGHPLEIQALFDMTL
                     CCADLLVPEEGSQWLIDLAHRRRVVLRQYLQRYYWLDMDVLNRIYRFSTEMFGEDVEN
                     LFNIYPESIPEWLPEWLPDGAGYFVGNLGPGRVDFRFFSQGNLLMLVSDLALPEQVKG
                     LMNLIDLRWNDLIGRMPMKLVYPAIKTHEWRLITGSDPKNIPLSYHNGGNWPVLIWPF
                     VAAAIKAGRYDMASRAWAEAEERLLKDNWPEYYDGRTGRLVGRRSNVRQVWSATGLLL
                     ARHFLDEPDVLNRLGFAPQPPDDPELMGAQWTPQGTQHGGPR"
     misc_feature    236650..237954
                     /locus_tag="Hneap_0226"
                     /note="Alkaline and neutral invertase; Region:
                     Glyco_hydro_100; pfam12899"
                     /db_xref="CDD:257387"
     gene            238056..240410
                     /locus_tag="Hneap_0227"
                     /db_xref="GeneID:8533342"
     CDS             238056..240410
                     /locus_tag="Hneap_0227"
                     /inference="protein motif:TFAM:TIGR02472"
                     /note="TIGRFAM: sucrose-phosphate synthase;
                     PFAM: sucrose-6F-phosphate phosphohydrolase; glycosyl
                     transferase group 1;
                     KEGG: tgr:Tgr7_0708 sucrose-phosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose-phosphate synthase"
                     /protein_id="YP_003262137.1"
                     /db_xref="GI:261854854"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR006380"
                     /db_xref="InterPro:IPR012822"
                     /db_xref="GeneID:8533342"
                     /translation="MNDTPAHAKERPAETRPEPMIEPKIESTVESSAEGRKPGLYIVL
                     ISVHGLIRGSELELGRDADTGGQTLYVVELARALAKHPVVSRVDLFTRLVRDDRVSAD
                     YAQPEESLADAPNARIVRVPAGPDEYLPKEQLWDHLDSLSDHALDYIRQTGLKPALVH
                     SHYADAGYVGMRLSLQLGVPLAHTGHSLGRVKRQRLLASGESAKVIEQKYALSRRIRV
                     EEEVLAASSLVVVSTQDEIETQYGLYDWADPSRMEVIPPGVDLTRFDPKITGPMPIAD
                     ELARFLREPDKPAILALSRPDERKNIATLVHAYGRNPALQDVANLVIVAGNRDDIRDM
                     DPGSRQVLTEILLLIDRYDLYGKVAYPRHHQSQDVPDFYRWTAQTRGVFINPALTEPF
                     GLTLIEAAACGLPILATEDGGPRDIIRACKNGELINPLDAEGMGEQLLALLTDTARWD
                     SYARNGIKGVRHHYTWPAHAEQYFETLASMPLHQQTSAPAGASETAAHAASTPMTADR
                     MILIDDRILNTDIDVAALRELIGLLRRHRRQVAYGLVSDRPRHDILALLKKQGLVVPD
                     VLITRGGTQIHYGARLSRDKGWSRHISYSWQGDRVYELLAETPGVRLSGRSHQGLYAV
                     HAYIDDPDVFAGLNELADAFHQADISARLTALNEREFLVTPQRASKGFAIRYLAAQHD
                     IALMNMLVVGSAEADSDLLGGNVLSAQLCAEPDEECVVQGADNSIYCPSASGVAGIRA
                     AMDFYDFLGECRAPSTDPEAGGANDEPKPATAASGPASSKEDEV"
     misc_feature    238173..239486
                     /locus_tag="Hneap_0227"
                     /note="sucrose-phosphate synthase, putative,
                     glycosyltransferase domain; Region: sucr_P_syn_N;
                     TIGR02472"
                     /db_xref="CDD:131525"
     misc_feature    238176..239480
                     /locus_tag="Hneap_0227"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. The sucrose-phosphate
                     synthases in this family may be unique to plants and
                     photosynthetic bacteria. This enzyme catalyzes the
                     synthesis of sucrose 6-phosphate from fructose...; Region:
                     GT1_Sucrose_synthase; cd03800"
                     /db_xref="CDD:99973"
     misc_feature    order(238251..238253,238932..238940,239160..239162,
                     239238..239240)
                     /locus_tag="Hneap_0227"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99973"
     misc_feature    239601..240296
                     /locus_tag="Hneap_0227"
                     /note="sucrose phosphate synthase, sucrose
                     phosphatase-like domain, bacterial; Region:
                     sucr_syn_bact_C; TIGR02471"
                     /db_xref="CDD:131524"
     gene            240407..241288
                     /locus_tag="Hneap_0228"
                     /db_xref="GeneID:8533343"
     CDS             240407..241288
                     /locus_tag="Hneap_0228"
                     /inference="protein motif:TFAM:TIGR01484"
                     /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
                     PFAM: sucrose-6F-phosphate phosphohydrolase; Haloacid
                     dehalogenase domain protein hydrolase type 3;
                     KEGG: noc:Noc_2718 HAD family hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase"
                     /protein_id="YP_003262138.1"
                     /db_xref="GI:261854855"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR006380"
                     /db_xref="InterPro:IPR013200"
                     /db_xref="GeneID:8533343"
                     /translation="MTSTDITPSAILLCCDLDRTLIPNGAQPESPEARARLRALCAHP
                     DIHLVMVSGRHIELVLEAIDQWDLPQPDYIIGDVGTTIYTHPEPEEGPPDSWAMWRSW
                     AAELGPDWGGMTHNDITDLFRDIEAIKPQPIDRQGVFKASYFVDIDANSEILEAELVR
                     RLWQLGVNARLIWSVDEAAHTGLLDVLPASASKLHAIEFLSATQKYPMAHTVFAGDSG
                     NDLEVLGSHIQSVLVANAPEDVRARALALAESADVAHSLYLARGGLFGMNGNYSAGVL
                     EGLAHFLPETLPWMELE"
     misc_feature    240410..>240634
                     /locus_tag="Hneap_0228"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     misc_feature    240440..241252
                     /locus_tag="Hneap_0228"
                     /note="Sucrose-6F-phosphate phosphohydrolase; Region:
                     S6PP; pfam05116"
                     /db_xref="CDD:253018"
     gene            241531..242199
                     /locus_tag="Hneap_0229"
                     /db_xref="GeneID:8533344"
     CDS             241531..242199
                     /locus_tag="Hneap_0229"
                     /inference="protein motif:COG:COG0668"
                     /note="KEGG: afr:AFE_1549 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Small-conductance mechanosensitive channel-like
                     protein"
                     /protein_id="YP_003262139.1"
                     /db_xref="GI:261854856"
                     /db_xref="GeneID:8533344"
                     /translation="MSGLDQFFLALGQWLKEWQALVPFFLLLIFGGGSVLLAQRFLRR
                     HFNRMVSHAPISPGTLLILRRAISLSLWAVLALLLLRQAGVNVDGIWTMLASMLAVIG
                     VGLLAVWTMVSNITASLFIWIWRPYELGETIEMLPNNVKGRAVDRSLMFTTLREADGT
                     LLMIPNNQFFQNVTRRWPNRTRVTDYEAWEAERNLGAAEYASHPASPNPAVPDSSPKD
                     DVVT"
     misc_feature    241780..>242046
                     /locus_tag="Hneap_0229"
                     /note="Mechanosensitive ion channel; Region: MS_channel;
                     pfam00924"
                     /db_xref="CDD:250229"
     misc_feature    <241810..>242082
                     /locus_tag="Hneap_0229"
                     /note="Small-conductance mechanosensitive channel [Cell
                     envelope biogenesis, outer membrane]; Region: MscS;
                     COG0668"
                     /db_xref="CDD:223740"
     gene            242272..242757
                     /locus_tag="Hneap_0230"
                     /db_xref="GeneID:8533345"
     CDS             242272..242757
                     /locus_tag="Hneap_0230"
                     /inference="protein motif:PFAM:PF00114"
                     /note="PFAM: fimbrial protein pilin;
                     KEGG: xcb:XC_1059 pilin"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein pilin"
                     /protein_id="YP_003262140.1"
                     /db_xref="GI:261854857"
                     /db_xref="InterPro:IPR001082"
                     /db_xref="InterPro:IPR001120"
                     /db_xref="InterPro:IPR012902"
                     /db_xref="GeneID:8533345"
                     /translation="MLTVSGHKVIPAHHERGFTLIELMITIAIIGILASIALFAYQDY
                     IIRAQVSEGVTLVSGPELALAEWTGGHPNFPNSGNPGNNTSLGLAAPGSISGSYVQSV
                     AVINGGKIELTYGNKANAAIAGAAKKCTLSPLTSAPGAIRWQVDSCGFNSRYLPQAWR
                     P"
     misc_feature    242314..242610
                     /locus_tag="Hneap_0230"
                     /note="Tfp pilus assembly protein, major pilin PilA [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: PilA; COG4969"
                     /db_xref="CDD:227304"
     misc_feature    242314..242385
                     /locus_tag="Hneap_0230"
                     /note="prepilin-type N-terminal cleavage/methylation
                     domain; Region: IV_pilin_GFxxxE; TIGR02532"
                     /db_xref="CDD:213719"
     misc_feature    242410..242751
                     /locus_tag="Hneap_0230"
                     /note="Pilin (bacterial filament); Region: Pilin;
                     pfam00114"
                     /db_xref="CDD:249599"
     gene            243082..244044
                     /locus_tag="Hneap_0231"
                     /db_xref="GeneID:8533346"
     CDS             243082..244044
                     /locus_tag="Hneap_0231"
                     /inference="protein motif:TFAM:TIGR02070"
                     /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
                     transglycosylase;
                     PFAM: glycosyl transferase family 51;
                     KEGG: mei:Msip34_2489 monofunctional biosynthetic
                     peptidoglycan transglycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="monofunctional biosynthetic peptidoglycan
                     transglycosylase"
                     /protein_id="YP_003262141.1"
                     /db_xref="GI:261854858"
                     /db_xref="InterPro:IPR001264"
                     /db_xref="InterPro:IPR011812"
                     /db_xref="GeneID:8533346"
                     /translation="MQNQEQALSIHPLFSKGDIFSSGVILIPVKIKQNSVRVMQKLSF
                     FAIFYGTALIHAQYSNFIITALLMDHPFRKIPYASPMPSTKKSRRPIRRLIFLLFALA
                     LLVFVLVQAWFYVQVWQLRTHNPQTTAFMRERLALIQAVNPKAKLDYHWVNYAAIAPI
                     AKRAVVASEDDRFMEHYGFDWTGIQDAFEKNLAEGEFAAGGSTISQQLARNLFLSPSK
                     NLWRKGEEAIITLMLETTLGKRRILELYLNVVEWGNLLYGIDAASHYYFHKSPAALTP
                     HEAAFLAAMLPNPRFYQDNPGSRGLQKRIRAVEGRMNYSRIPPQ"
     misc_feature    243409..244038
                     /locus_tag="Hneap_0231"
                     /note="monofunctional biosynthetic peptidoglycan
                     transglycosylase; Provisional; Region: mtgA; PRK00056"
                     /db_xref="CDD:234603"
     misc_feature    243448..>244017
                     /locus_tag="Hneap_0231"
                     /note="Membrane carboxypeptidase (penicillin-binding
                     protein) [Cell envelope biogenesis, outer membrane];
                     Region: MrcB; COG0744"
                     /db_xref="CDD:223815"
     gene            244073..245356
                     /locus_tag="Hneap_0232"
                     /db_xref="GeneID:8533347"
     CDS             244073..245356
                     /locus_tag="Hneap_0232"
                     /inference="protein motif:TFAM:TIGR03026"
                     /note="TIGRFAM: nucleotide sugar dehydrogenase;
                     PFAM: UDP-glucose/GDP-mannose dehydrogenase;
                     UDP-glucose/GDP-mannose dehydrogenase dimerisation;
                     UDP-glucose/GDP-mannose dehydrogenase;
                     KEGG: bpt:Bpet4030 polysaccharide biosynthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide sugar dehydrogenase"
                     /protein_id="YP_003262142.1"
                     /db_xref="GI:261854859"
                     /db_xref="InterPro:IPR001732"
                     /db_xref="InterPro:IPR014026"
                     /db_xref="InterPro:IPR014027"
                     /db_xref="InterPro:IPR017476"
                     /db_xref="GeneID:8533347"
                     /translation="MKSKEAAEPIIAVIGLGYVGLPLAVEFGKIRPVIGFDVDATRID
                     QLKSGHDRTREVEPDELQNARHLSYTVDPADLRKASLFIVTVPTPIDAHKRPDLSPLI
                     KASETVGRALKRGDIVIYESTVYPGATEEDCVPVLEQYSGLRFNHDFYCGYSPERINP
                     GDKTHRLPAIKKVTAGSTPAVAEAVDALYRQIITAGTHPAPSIRVAEAAKVIENTQRD
                     VNIALINELAILFGKLGLDTQAVLEAAGSKWNFLPFRPGLVGGHCIGVDPYYLTHKAQ
                     QVGHHPEMILAGRRINDGMGAYVAGQLIKAMLKKGITVQGARVLVLGLTFKENCPDLR
                     NTRVIDVITELKDYGLTVDVHDPWADAACARHEYGLELTATPPSNTYEAIVLAVAHRE
                     FRTLGAPAIHALGKEQHVLYDLKHLFHADEADIRL"
     misc_feature    244103..245353
                     /locus_tag="Hneap_0232"
                     /note="Vi polysaccharide biosynthesis protein TviB;
                     Provisional; Region: PRK15182"
                     /db_xref="CDD:185104"
     misc_feature    244103..244627
                     /locus_tag="Hneap_0232"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family, NAD
                     binding domain; Region: UDPG_MGDP_dh_N; pfam03721"
                     /db_xref="CDD:252123"
     misc_feature    244679..244957
                     /locus_tag="Hneap_0232"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family,
                     central domain; Region: UDPG_MGDP_dh; pfam00984"
                     /db_xref="CDD:250272"
     misc_feature    245030..245326
                     /locus_tag="Hneap_0232"
                     /note="UDP binding domain; Region: UDPG_MGDP_dh_C;
                     smart00984"
                     /db_xref="CDD:214954"
     gene            245635..245952
                     /locus_tag="Hneap_0233"
                     /db_xref="GeneID:8533348"
     CDS             245635..245952
                     /locus_tag="Hneap_0233"
                     /inference="similar to AA sequence:KEGG:Mlg_0863"
                     /note="KEGG: aeh:Mlg_0863 DNA polymerase subunit beta"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_003262143.1"
                     /db_xref="GI:261854860"
                     /db_xref="GeneID:8533348"
                     /translation="MIEPHIMRLTPAVQHTIKTTAAEVFGAEAKISLFGSRTDDTRKG
                     GDIDLLVELPSPQSEVQRKRLSFVARLQQRLGDQPIDVLIVQPNTQKQAIHEVAQATS
                     IPL"
     misc_feature    245683..245949
                     /locus_tag="Hneap_0233"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    order(245734..245742,245746..245748,245767..245772,
                     245776..245778,245869..245871,245875..245877)
                     /locus_tag="Hneap_0233"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    order(245734..245742,245746..245748,245767..245772,
                     245776..245778)
                     /locus_tag="Hneap_0233"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    order(245770..245772,245776..245778,245875..245877)
                     /locus_tag="Hneap_0233"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    order(245869..245871,245875..245877)
                     /locus_tag="Hneap_0233"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     gene            245949..246482
                     /locus_tag="Hneap_0234"
                     /db_xref="GeneID:8533349"
     CDS             245949..246482
                     /locus_tag="Hneap_0234"
                     /inference="similar to AA sequence:KEGG:Tgr7_1983"
                     /note="KEGG: tgr:Tgr7_1983 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262144.1"
                     /db_xref="GI:261854861"
                     /db_xref="GeneID:8533349"
                     /translation="MNTNQLSDRARFLATLRIVAKESAHLEWSQQRLFSQPITPAWVE
                     ALDTHPELAERLEAFVSRYGRLQDTIADKLLPRWLRALAERPGSQIEVLNRAEQLGVL
                     EDVSQWLEARQLRNTLIHEYMEDSATFAENIQLAEQYSHLLLATYQRIHNDAATRLNI
                     APHELPEHTGYPQHDRP"
     misc_feature    246111..246398
                     /locus_tag="Hneap_0234"
                     /note="Nucleotidyltransferase substrate binding protein
                     like; Region: NTase_sub_bind; cl17552"
                     /db_xref="CDD:266744"
     gene            246469..247197
                     /locus_tag="Hneap_0235"
                     /db_xref="GeneID:8533350"
     CDS             246469..247197
                     /locus_tag="Hneap_0235"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: methyltransferase type 11; methyltransferase
                     type 12;
                     KEGG: chl:Chy400_1643 methyltransferase type 11"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_003262145.1"
                     /db_xref="GI:261854862"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:8533350"
                     /translation="MIAPKLRRLLGGLRQTPLHPQWLVFKDTRQQKQRIAKRIQGRLL
                     DIGCGEKPLTPFLSAGVNYIGLDYPPTVAKGYSGKADVFGDGQRLPFADASFDCITIL
                     DVMEHLPNPEAAFGEMLRVLKPGGILISQTPFLYPLHDLPHDFQRWTGEGLSQFTQRH
                     PADLIERHHHSKPLETAAILTNLALAKGMLDSLHAKHPGLLLLPLVILLVPIINLAGW
                     AFARLLPDEGFMPLGYTAVFKKRA"
     misc_feature    246592..246861
                     /locus_tag="Hneap_0235"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(246604..246624,246667..246672,246718..246726,
                     246772..246774)
                     /locus_tag="Hneap_0235"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            247194..248333
                     /locus_tag="Hneap_0236"
                     /db_xref="GeneID:8533351"
     CDS             247194..248333
                     /locus_tag="Hneap_0236"
                     /inference="protein motif:PFAM:PF00534"
                     /note="PFAM: glycosyl transferase group 1;
                     KEGG: scl:sce3582 glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_003262146.1"
                     /db_xref="GI:261854863"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:8533351"
                     /translation="MKLLIVTTSYPDDSDGAAAAGVFVRDFALALVEQGHQVSVIAPS
                     QTSRITDENNVRVQRFAVPKLPLSLLKPHDPRDWTAIIHTLRQGQHHVNHICATYRPD
                     YIFALWALPSGAWARQASRRYGVPYGTWALGSDIWSLGKIPLIRQGLRHVLRHAAHRY
                     ADGLQLAQDVTDISGLNCDFLPSARRLLVTNPRTIASTPPYRLAFLGRWHPNKGIDLL
                     LEVLEQLTDNDWQRIEHLRIFGGGAMHAQVHQHCARLIALGRPIEIGGFLDQSAASEL
                     LNWTDFVLIPSRIESIPVIFSDAMQARRPVIAMPTGDLPALLNEHGCGEVAADISAAA
                     FAFALRKALQSNASEYASGTQSACARFDIAESARRFTRNIELRSQ"
     misc_feature    247194..248171
                     /locus_tag="Hneap_0236"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    247200..248165
                     /locus_tag="Hneap_0236"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            248330..249076
                     /locus_tag="Hneap_0237"
                     /db_xref="GeneID:8533352"
     CDS             248330..249076
                     /locus_tag="Hneap_0237"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: methyltransferase type 11; methyltransferase
                     type 12;
                     KEGG: vcj:VCD_003094 3-demethylubiquinone-9
                     3-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_003262147.1"
                     /db_xref="GI:261854864"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:8533352"
                     /translation="MSEFTTPTTDPRWGADKRNIKAEQIAHILENLGRVKLEQSNVLD
                     IGCGSGGIAAHLAPRVQSMTGMDPEPWPRWDIWLEAHPNLKFMQGSVESNSLEPHSFD
                     VIICNQVYEHVPDPQALIQLIARLIKPEGIVYFAGPNLLFPIEPHVFWPFVHWIPREL
                     AIKIMKAFRAKYIDYLDAYSTHYWKLKSWLSPQFEIKNAIPFLIRETHPVIKDKKTLT
                     SHIPSSVLSILTPLTPGFVFLLKPRENVMK"
     misc_feature    248450..248734
                     /locus_tag="Hneap_0237"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(248462..248482,248528..248533,248594..248602,
                     248648..248650)
                     /locus_tag="Hneap_0237"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     misc_feature    <248618..>248875
                     /locus_tag="Hneap_0237"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4627"
                     /db_xref="CDD:226975"
     gene            249073..249999
                     /locus_tag="Hneap_0238"
                     /db_xref="GeneID:8533353"
     CDS             249073..249999
                     /locus_tag="Hneap_0238"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: rop:ROP_39630 hypothetical membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262148.1"
                     /db_xref="GI:261854865"
                     /db_xref="GeneID:8533353"
                     /translation="MSWRKKPIWLILAALITLGSFIWLVLLLKDGFIQIMEQGMSLNT
                     PALALSWILAVAATFITSQIFFNIMQASGARFSSFHEACELNFTAQVMRHLPGRFFGV
                     AYQVVKAKHVANTAEWICGNIAIILLSTWLALVFSSIILIALEKNMALAFMILISTLS
                     APFIIYGINLLLGHFSSKNQKIEKFIKIFHAVPKALFSAKGRRALAWGTISWCVYAMA
                     WAAFGEALPLESWHDGLILGALYTLAWAIGFFSLITPSGLGVRELAFALLASSYPPEI
                     LLFVSVAARLGLMLADFVLGIVFLVTAKREIL"
     gene            249996..250550
                     /locus_tag="Hneap_0239"
                     /db_xref="GeneID:8533354"
     CDS             249996..250550
                     /locus_tag="Hneap_0239"
                     /inference="protein motif:COG:COG0110"
                     /note="KEGG: rha:RHA1_ro06420 acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase (isoleucine patch
                     superfamily)-like protein"
                     /protein_id="YP_003262149.1"
                     /db_xref="GI:261854866"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="GeneID:8533354"
                     /translation="MTLKAVEMTLNTLGCIAIRNAMHPKLRSWLLRLFGANVGINVRI
                     HSCRFMNFELGFKNLKFDDGVYIGTDVLIDCACTLNIGKNTTISARSALITHSDPGTR
                     QGNAIAKIYPARKTGVFIGNDCWIGVGAIVLDGSVINDRCLVAAGSVVTGSTLDKESL
                     YAGSPAVFKKKLNFNSEKSSSHSL"
     misc_feature    250167..250499
                     /locus_tag="Hneap_0239"
                     /note="Maltose O-acyltransferase (MAT)-like: This family
                     is composed of maltose O-acetyltransferase, galactoside
                     O-acetyltransferase (GAT), xenobiotic acyltransferase
                     (XAT) and similar proteins. MAT and GAT catalyze the
                     CoA-dependent acetylation of the...; Region: LbH_MAT_like;
                     cd04647"
                     /db_xref="CDD:100053"
     misc_feature    order(250185..250187,250191..250193,250215..250217,
                     250245..250247,250251..250253,250269..250271,
                     250287..250295,250362..250364,250368..250370,
                     250377..250379,250434..250436,250485..250487)
                     /locus_tag="Hneap_0239"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100053"
     misc_feature    order(250191..250193,250197..250199,250287..250289,
                     250293..250295,250368..250370,250374..250379,
                     250392..250394,250428..250433,250446..250451,
                     250479..250484,250488..250490)
                     /locus_tag="Hneap_0239"
                     /note="active site"
                     /db_xref="CDD:100053"
     misc_feature    order(250191..250193,250197..250199,250287..250289)
                     /locus_tag="Hneap_0239"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100053"
     misc_feature    order(250287..250289,250293..250295,250368..250370,
                     250374..250379,250392..250394,250422..250424,
                     250428..250433,250446..250451,250473..250475,
                     250479..250484,250488..250490)
                     /locus_tag="Hneap_0239"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100053"
     gene            complement(250516..251679)
                     /locus_tag="Hneap_0240"
                     /db_xref="GeneID:8533355"
     CDS             complement(250516..251679)
                     /locus_tag="Hneap_0240"
                     /EC_number="2.6.1.50"
                     /inference="protein motif:PRIAM:2.6.1.50"
                     /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
                     aromatic amino acid beta-eliminating lyase/threonine
                     aldolase;
                     KEGG: drt:Dret_0280 glutamine--scyllo-inositol
                     transaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine--scyllo-inositol transaminase"
                     /protein_id="YP_003262150.1"
                     /db_xref="GI:261854867"
                     /db_xref="InterPro:IPR000653"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="GeneID:8533355"
                     /translation="MPEKQPFIVFGAPQIEQDEIDEVVDSMRASWLGTGPKVARFERE
                     FAAYKGMQPDHVAATNSCTAALHISMLAAGLKPGDEVITTALTFCATVNAIIHTGATP
                     VLVDVDPLTMNIDPQAVEAAITPRTRAILPVHFAGRSCDMDTLMRIARKHDLKVIEDC
                     AHAIETEYHGQKAGTFGDFGCFSFYATKNITTGEGGMVLAQDEHDIARIKVLALHGMS
                     KDAWHRFGDAGYKHYLVTEAGFKYNMMDIQAAIGIHQLARIEHNWKKRQALWTNYQSA
                     FADLPVTRPQDAETDTRHAYHLYTLLIDEQRAGISRDAFLEHMTHAGIGVGVHYLSIP
                     EHPYYQQHFGWRPEDYPNAMRIGRQTVSLPLSAKIDDAIAERVIKSVMTTFQN"
     misc_feature    complement(250537..251625)
                     /locus_tag="Hneap_0240"
                     /note="3-amino-5-hydroxybenzoic acid synthase family
                     (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate
                     (PLP)-dependent aspartate aminotransferase superfamily
                     (fold I). The members of this CD are involved in various
                     biosynthetic pathways for secondary...; Region: AHBA_syn;
                     cd00616"
                     /db_xref="CDD:99740"
     misc_feature    complement(order(250693..250695,251116..251121,
                     251131..251133,251194..251196,251203..251205,
                     251491..251496))
                     /locus_tag="Hneap_0240"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99740"
     misc_feature    complement(order(251116..251118,251131..251133,
                     251194..251196,251203..251205,251419..251421,
                     251491..251496))
                     /locus_tag="Hneap_0240"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99740"
     misc_feature    complement(251116..251118)
                     /locus_tag="Hneap_0240"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99740"
     gene            complement(251829..252212)
                     /locus_tag="Hneap_0241"
                     /db_xref="GeneID:8533356"
     CDS             complement(251829..252212)
                     /locus_tag="Hneap_0241"
                     /inference="similar to AA sequence:KEGG:NAMH_1673"
                     /note="KEGG: nam:NAMH_1673 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262151.1"
                     /db_xref="GI:261854868"
                     /db_xref="GeneID:8533356"
                     /translation="MPLDEQKYIALTDDEVEHIDQFLFRFSKLQDSMGQKLFKSILMF
                     LEEDVEDKPFIDILNQLEKLHLIESANDWRTLREDRNELAHQYENEPEPMSAAINRVY
                     ERRELLVAIYHRLKSAYSKANGVDS"
     gene            complement(252310..252606)
                     /locus_tag="Hneap_0242"
                     /db_xref="GeneID:8533357"
     CDS             complement(252310..252606)
                     /locus_tag="Hneap_0242"
                     /inference="protein motif:PFAM:PF01909"
                     /note="PFAM: DNA polymerase subunit beta;
                     KEGG: gem:GM21_2611 DNA polymerase subunit beta"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase subunit beta"
                     /protein_id="YP_003262152.1"
                     /db_xref="GI:261854869"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="GeneID:8533357"
                     /translation="MRFTHKEASSIKEAFQDVFQEGTILLFGSRVDDNKKGGDIDLYI
                     QLSHPLSPREQLERKAQFKLKLYEALGEQKIDIVIAKDQQRSIEKSALKTGVPL"
     misc_feature    complement(252313..252579)
                     /locus_tag="Hneap_0242"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(252379..252381,252385..252387,
                     252484..252486,252490..252495,252520..252528))
                     /locus_tag="Hneap_0242"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(252484..252486,252490..252495,
                     252520..252528))
                     /locus_tag="Hneap_0242"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(252379..252381,252484..252486,
                     252490..252492))
                     /locus_tag="Hneap_0242"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(252379..252381,252385..252387))
                     /locus_tag="Hneap_0242"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     gene            252670..252822
                     /locus_tag="Hneap_0243"
                     /db_xref="GeneID:8533358"
     CDS             252670..252822
                     /locus_tag="Hneap_0243"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262153.1"
                     /db_xref="GI:261854870"
                     /db_xref="GeneID:8533358"
                     /translation="MGYIEIPVIRRFRESRNLEKSWRWILTNAGMTGFSSFPMMILLE
                     LRLMRS"
     gene            complement(252850..253179)
                     /locus_tag="Hneap_0244"
                     /db_xref="GeneID:8533359"
     CDS             complement(252850..253179)
                     /locus_tag="Hneap_0244"
                     /inference="protein motif:TFAM:TIGR02385"
                     /note="TIGRFAM: addiction module toxin, RelE/StbE family;
                     PFAM: plasmid stabilization system;
                     KEGG: gdj:Gdia_1758 addiction module toxin, RelE/StbE
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="RelE/StbE family addiction module toxin"
                     /protein_id="YP_003262154.1"
                     /db_xref="GI:261854871"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="InterPro:IPR012753"
                     /db_xref="GeneID:8533359"
                     /translation="MTKSDASPSATRYRLKFLPEALDEWNALDGSIKELLRKLLKKRL
                     NEPHTPGAQLHGDLRGCYKIKLRKQGYRLVYSVEDNVLVVLVLAIDKREDMAAYHSAL
                     DRLISGQ"
     misc_feature    complement(252898..253146)
                     /locus_tag="Hneap_0244"
                     /note="Cytotoxic translational repressor of
                     toxin-antitoxin stability system [Translation, ribosomal
                     structure and biogenesis / Cell division and chromosome
                     partitioning]; Region: RelE; COG2026"
                     /db_xref="CDD:224937"
     gene            complement(253166..253417)
                     /locus_tag="Hneap_0245"
                     /db_xref="GeneID:8533360"
     CDS             complement(253166..253417)
                     /locus_tag="Hneap_0245"
                     /inference="protein motif:TFAM:TIGR01552"
                     /note="TIGRFAM: prevent-host-death family protein;
                     PFAM: protein of unknown function DUF172;
                     KEGG: eba:ebA5970 antitoxin of toxin-antitoxin stability
                     system"
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="YP_003262155.1"
                     /db_xref="GI:261854872"
                     /db_xref="InterPro:IPR003756"
                     /db_xref="InterPro:IPR006442"
                     /db_xref="GeneID:8533360"
                     /translation="MDAIYADYSISMTEFKKNPAHVLRTAGEKPVAVLNHNRPAFYMV
                     SPKLFEAIAEELSDKNLLELARQRLMRKDSAIEVDIDQI"
     misc_feature    complement(<253238..253417)
                     /locus_tag="Hneap_0245"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; cl09153"
                     /db_xref="CDD:263731"
     gene            complement(253598..253858)
                     /locus_tag="Hneap_0246"
                     /db_xref="GeneID:8533361"
     CDS             complement(253598..253858)
                     /locus_tag="Hneap_0246"
                     /inference="protein motif:TFAM:TIGR02116"
                     /note="TIGRFAM: addiction module toxin, Txe/YoeB family;
                     PFAM: Addiction module toxin Txe/YoeB;
                     KEGG: sde:Sde_1844 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Txe/YoeB family addiction module toxin"
                     /protein_id="YP_003262156.1"
                     /db_xref="GI:261854873"
                     /db_xref="InterPro:IPR009614"
                     /db_xref="GeneID:8533361"
                     /translation="MKLTFSSKAWDDYLYWQQTDKTILKRINTLIKEIQRDPFDGIGK
                     PEPLKYSLTGYWSRRINDEHRLVYKISNDYLFIAQLCYQYEY"
     misc_feature    complement(253607..253846)
                     /locus_tag="Hneap_0246"
                     /note="Plasmid encoded toxin Txe; Region: Plasmid_Txe;
                     cl17389"
                     /db_xref="CDD:247943"
     gene            complement(253855..254106)
                     /locus_tag="Hneap_0247"
                     /db_xref="GeneID:8533362"
     CDS             complement(253855..254106)
                     /locus_tag="Hneap_0247"
                     /inference="protein motif:TFAM:TIGR01552"
                     /note="TIGRFAM: prevent-host-death family protein;
                     PFAM: protein of unknown function DUF172;
                     KEGG: sde:Sde_1845 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="YP_003262157.1"
                     /db_xref="GI:261854874"
                     /db_xref="InterPro:IPR003756"
                     /db_xref="InterPro:IPR006442"
                     /db_xref="GeneID:8533362"
                     /translation="MNAISYTAARANFAKTMEKVCNDHHPIIITRKQEAPVVMISLED
                     YQAMEETAYLLRAPANARRLLESMAELEAGKGTERELIE"
     misc_feature    complement(253858..254106)
                     /locus_tag="Hneap_0247"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; cl09153"
                     /db_xref="CDD:263731"
     gene            complement(254253..254816)
                     /locus_tag="Hneap_0248"
                     /db_xref="GeneID:8533363"
     CDS             complement(254253..254816)
                     /locus_tag="Hneap_0248"
                     /inference="protein motif:PFAM:PF05685"
                     /note="PFAM: protein of unknown function DUF820;
                     KEGG: dia:Dtpsy_2541 protein of unknown function DUF820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262158.1"
                     /db_xref="GI:261854875"
                     /db_xref="InterPro:IPR008538"
                     /db_xref="GeneID:8533363"
                     /translation="MSTPAAHLPTISVTDYLNGEEHSEIRHEYIDGQVYAMSGASRRH
                     GLIATSLSLLLGPKAREKKCQLFIADMKVRLTISGKDIFYYPDLALNCDPDDRESHYS
                     RTPCLIIEVLSETTERIDRREKMLAYQTLPSLQEYVLVAQDYMQIEIYRRRADWLPEV
                     HTEGTFTIECLDLNTSVAEVYQDIEGF"
     misc_feature    complement(254298..254744)
                     /locus_tag="Hneap_0248"
                     /note="Domain of unknown function (DUF820). This family
                     consists of hypothetical proteins that are greatly
                     expanded in cyanobacteria. The proteins are found
                     sporadically in other bacteria. They have been predicted
                     to belong to the PD-(D/E)xK superfamily of...; Region:
                     DUF820; cd06260"
                     /db_xref="CDD:99749"
     misc_feature    complement(order(254433..254435,254445..254447,
                     254487..254489,254556..254558,254685..254687))
                     /locus_tag="Hneap_0248"
                     /note="putative active site [active]"
                     /db_xref="CDD:99749"
     gene            complement(254854..255018)
                     /locus_tag="Hneap_0249"
                     /db_xref="GeneID:8533364"
     CDS             complement(254854..255018)
                     /locus_tag="Hneap_0249"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262159.1"
                     /db_xref="GI:261854876"
                     /db_xref="GeneID:8533364"
                     /translation="MSPPTQTHTFMLDDFLIREAVEPLRHKLDATLSMPWQNGETLNL
                     SLTQVYQDIN"
     gene            complement(255234..256067)
                     /locus_tag="Hneap_0250"
                     /db_xref="GeneID:8533365"
     CDS             complement(255234..256067)
                     /locus_tag="Hneap_0250"
                     /EC_number="2.3.1.117"
                     /inference="protein motif:TFAM:TIGR00965"
                     /note="TIGRFAM:
                     2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase;
                     KEGG: tcx:Tcr_1289
                     2,3,4,5-tetrahydropyridine-2,6-carboxylate
                     N-succinyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase"
                     /protein_id="YP_003262160.1"
                     /db_xref="GI:261854877"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005664"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="GeneID:8533365"
                     /translation="MTDLNALKNTIETAFEDRASITPAEAPQAVRDAVNTVLGMLDAG
                     QLRVAERRGVGDWVVNEWLKKAVLLSFRLNPNEVVQGGDLRYFDKVPTKFANWNQAQF
                     EEAGIRVVPNAVARRGSFIAKGAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNV
                     HLSGGVGIGGVLEPLQASPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTKI
                     YDRETGEVSYGRIPAGSVVVSGNLPSKCGKYSLYCAVIVKKVDAKTLSKVGINALLRD
                     I"
     misc_feature    complement(255243..256058)
                     /locus_tag="Hneap_0250"
                     /note="2,3,4,5-tetrahydropyridine-2,6-carboxylate
                     N-succinyltransferase; Provisional; Region: dapD;
                     PRK11830"
                     /db_xref="CDD:236996"
     misc_feature    complement(255849..256055)
                     /locus_tag="Hneap_0250"
                     /note="Tetrahydrodipicolinate N-succinyltransferase
                     N-terminal; Region: THDPS_N_2; pfam14805"
                     /db_xref="CDD:258942"
     misc_feature    complement(255339..255752)
                     /locus_tag="Hneap_0250"
                     /note="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP)
                     N-succinyltransferase (also called THP
                     succinyltransferase): THDP N-succinyltransferase catalyzes
                     the conversion of tetrahydrodipicolinate and succinyl-CoA
                     to N-succinyltetrahydrodipicolinate and CoA; Region:
                     LbH_THP_succinylT; cd03350"
                     /db_xref="CDD:100041"
     misc_feature    complement(order(255339..255341,255345..255356,
                     255435..255437,255489..255491,255495..255497,
                     255573..255575,255621..255629,255675..255677,
                     255681..255683,255729..255734,255741..255746))
                     /locus_tag="Hneap_0250"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100041"
     misc_feature    complement(order(255444..255449,255480..255482,
                     255495..255503,255540..255542,255549..255554,
                     255558..255560,255579..255581,255585..255587,
                     255612..255614,255633..255635,255669..255671,
                     255684..255686,255720..255722,255744..255746))
                     /locus_tag="Hneap_0250"
                     /note="active site"
                     /db_xref="CDD:100041"
     misc_feature    complement(order(255552..255554,255612..255614,
                     255633..255635,255669..255671,255684..255686,
                     255720..255722,255744..255746))
                     /locus_tag="Hneap_0250"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100041"
     misc_feature    complement(order(255444..255449,255480..255482,
                     255495..255503,255540..255542,255558..255560,
                     255576..255581))
                     /locus_tag="Hneap_0250"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100041"
     gene            complement(256158..257315)
                     /locus_tag="Hneap_0251"
                     /db_xref="GeneID:8533366"
     CDS             complement(256158..257315)
                     /locus_tag="Hneap_0251"
                     /inference="protein motif:PFAM:PF04966"
                     /note="PFAM: carbohydrate-selective porin OprB;
                     KEGG: afr:AFE_2522 carbohydrate-selective porin, OprB
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate-selective porin OprB"
                     /protein_id="YP_003262161.1"
                     /db_xref="GI:261854878"
                     /db_xref="InterPro:IPR007049"
                     /db_xref="GeneID:8533366"
                     /translation="MSRLPSYVTILLIVLVIPPILGSGAWATEFILNRPAPTAASHPL
                     PLDESQIFSLHGHWDTDWVNNLSGGIRRGNALDSVAVGGFTLKGDRLGLPNSVFNFSL
                     MATRVGDANAELIGADTNPSNIEGNRNRLVLNTAFWQQDWLNSPHIGLNTRLGVFDLS
                     AEFDSTDGAAQLLNSSFGLDPTITDNFAASTFPKNGTGLVTSIASAIDPDTAPFALKV
                     GLIQGDVNQQTHPFTQGVLNIAEGQWRPSKGTAIKLGGWQKRGNGLHDLRGGYLSAET
                     PLSSEQHQHISGFIRASFASGMGAQTNGANRYLGAGLNWQAPFAHRPDDYLTLGAATL
                     HLNHGGDHERLLEAAYIMQITPRIFLQPDVQYIQQNNQPDTWVAIVRLHLE"
     misc_feature    complement(256164..256994)
                     /locus_tag="Hneap_0251"
                     /note="Carbohydrate-selective porin, OprB family; Region:
                     OprB; cl17816"
                     /db_xref="CDD:266858"
     gene            complement(257371..258576)
                     /locus_tag="Hneap_0252"
                     /db_xref="GeneID:8533367"
     CDS             complement(257371..258576)
                     /locus_tag="Hneap_0252"
                     /inference="protein motif:TFAM:TIGR03538"
                     /note="TIGRFAM: succinyldiaminopimelate transaminase;
                     PFAM: aminotransferase class I and II;
                     KEGG: ppu:PP_1588 succinyldiaminopimelate transaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyldiaminopimelate transaminase"
                     /protein_id="YP_003262162.1"
                     /db_xref="GI:261854879"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR019878"
                     /db_xref="GeneID:8533367"
                     /translation="MNPDLTRLHPYPFEKLAELKAGISPATSDKPIALSIGEPQHAPP
                     AVAMRAMADSLGGLSRYPLTKGERSLRETIGHWLTRRFALEPGLVDPDRHVLPVAGTR
                     EALFSFAQAVVARPEDPAAPRPVVLMPNPFYQIYEGAALLAGAEPYYYPTTSDTDFLP
                     DFAAIPAEIWARAQLIYVCSPGNPSGAVIDRARIKTLFDLADRHDVIIAADECYSEIY
                     FDEDAPPVGFIQAAHELGRSDFNRLVIFHSLSKRSNLPGLRSGFVAGDAEILARYLKY
                     RTYHGCALSLPVQMTSIAAWNDEVHVHENRQHYREKFDAVLDILAPVLPVQRPDAGFY
                     LWTDVGGDERSFARDLFAEQAVTVLPGRFLSRPVESNDPGVGFVRMALVAELIDCVDA
                     AQRIRAFLS"
     misc_feature    complement(257377..258576)
                     /locus_tag="Hneap_0252"
                     /note="succinyldiaminopimelate transaminase; Provisional;
                     Region: PRK09147"
                     /db_xref="CDD:236393"
     misc_feature    complement(257383..258483)
                     /locus_tag="Hneap_0252"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(257800..257802,257824..257829,
                     257833..257835,257935..257937,258028..258030,
                     258178..258180,258271..258279))
                     /locus_tag="Hneap_0252"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(257704..257706,257713..257715,
                     257800..257808,257956..257958,258148..258150,
                     258268..258270))
                     /locus_tag="Hneap_0252"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(257824..257826)
                     /locus_tag="Hneap_0252"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            258629..259018
                     /locus_tag="Hneap_0253"
                     /db_xref="GeneID:8533368"
     CDS             258629..259018
                     /locus_tag="Hneap_0253"
                     /inference="protein motif:PFAM:PF00903"
                     /note="PFAM: glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: tgr:Tgr7_1155 glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_003262163.1"
                     /db_xref="GI:261854880"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR018146"
                     /db_xref="GeneID:8533368"
                     /translation="MNQTAAIELLGVDHVSVVVADVNAALPFYRQVLGLRLIDRPELG
                     FPGAWLKLSNGVDLHLLQLPNPDPVANRPAHGGRDRHVALQVRATEPFAQRLAALNWP
                     FTRSHSGRDALFCRDADGNAWELVARN"
     misc_feature    258662..259003
                     /locus_tag="Hneap_0253"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_9; cd07245"
                     /db_xref="CDD:176669"
     misc_feature    order(258662..258676,258680..258682,258722..258727,
                     258731..258733,258773..258775,258782..258787,
                     258797..258799,258866..258889,258899..258904,
                     258911..258913,258998..259003)
                     /locus_tag="Hneap_0253"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176669"
     misc_feature    order(258668..258670,258869..258871,258998..259000)
                     /locus_tag="Hneap_0253"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176669"
     gene            complement(258946..259746)
                     /locus_tag="Hneap_0254"
                     /db_xref="GeneID:8533369"
     CDS             complement(258946..259746)
                     /locus_tag="Hneap_0254"
                     /inference="protein motif:PFAM:PF03724"
                     /note="PFAM: protein of unknown function DUF306 Meta and
                     HslJ;
                     KEGG: dsh:Dshi_3147 protein of unknown function DUF306
                     MetA and HslJ"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262164.1"
                     /db_xref="GI:261854881"
                     /db_xref="InterPro:IPR005184"
                     /db_xref="GeneID:8533369"
                     /translation="MQNKKYLNISAVLVLAVGMFAGLTACSASKPVPPDNHTSQIALD
                     WAGGYYSALAKESNGQPDGAVSLWLAPNGGYRLDLENIKGIPRQSYTGKVKWIEGKEV
                     DLRGAPPEYARWLVQENQLRNATKGWAAKHVPALVAALALPDQWTLTELAGDQSDLTQ
                     KPPELTFNMAQRVFGFDGCNRLMGRYQLDADGKLSFKPLAGTRMACMQPTPERAFLAM
                     LEKVADAKIQGETLEFFAADGKKLAQFRATSSQALPSASRQNNASRPE"
     misc_feature    complement(259051..259314)
                     /locus_tag="Hneap_0254"
                     /note="META domain; Region: META; pfam03724"
                     /db_xref="CDD:252126"
     gene            complement(259763..260512)
                     /locus_tag="Hneap_0255"
                     /db_xref="GeneID:8533370"
     CDS             complement(259763..260512)
                     /locus_tag="Hneap_0255"
                     /inference="protein motif:PFAM:PF01656"
                     /note="PFAM: cobyrinic acid ac-diamide synthase;
                     KEGG: tgr:Tgr7_3056 ParaA family ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid ac-diamide synthase"
                     /protein_id="YP_003262165.1"
                     /db_xref="GI:261854882"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="GeneID:8533370"
                     /translation="MAQIIALYSVKGGVGKTASVVNLAALSAMQGRKVLLWDLDPQGS
                     ASWYLQAEPESAPKLQQLLKVKSIAEGIRPTLHRNLSVLPSDQRYHDIEHALAEKKDA
                     GFRIAKLLDGLSEYFDEIWIDTPPGITLLGDNVLRAADLVLVPVVPTHLSERTWFQLK
                     SHLASEKIKPGRLAGFLSMVDRRRSLHRDFYAAHRIDMPELFDADIPYAAIIEQMGED
                     QTPVVFSHARHPAAQAFFKLWKQIDHVLAKF"
     misc_feature    complement(259787..260512)
                     /locus_tag="Hneap_0255"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(259982..260503)
                     /locus_tag="Hneap_0255"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(260462..260482)
                     /locus_tag="Hneap_0255"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(260144..260146,260462..260464))
                     /locus_tag="Hneap_0255"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            complement(260589..262061)
                     /locus_tag="Hneap_0256"
                     /db_xref="GeneID:8533371"
     CDS             complement(260589..262061)
                     /locus_tag="Hneap_0256"
                     /inference="protein motif:TFAM:TIGR01818"
                     /note="KEGG: yen:YE0025 nitrogen regulation protein NR(I);
                     TIGRFAM: nitrogen regulation protein NR(I);
                     PFAM: sigma-54 factor interaction domain-containing
                     protein; helix-turn-helix Fis-type; response regulator
                     receiver; ATPase associated with various cellular
                     activities AAA_5;
                     SMART: response regulator receiver; ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family nitrogen metabolism transcriptional
                     regulator NtrC"
                     /protein_id="YP_003262166.1"
                     /db_xref="GI:261854883"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010114"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR020441"
                     /db_xref="GeneID:8533371"
                     /translation="MMTLNPSQQSSKNAAKIWVVDDDHSIRWVLERALKSAGFTVESF
                     ESAAMLRARLRTSTPDVLFSDIRMPGEDGLSLLSSLQNSHPELPIIIITAHSDLDSAV
                     GAFEGGAFDYLPKPFDIDDAVRLAQRALSSRQPQAAETTAEASTTADAQTDLIGNAPA
                     MQEIFRAIGRLARSNVTVLINGESGTGKELVARALHQHSLRRQGPFVALNTAAIPKDL
                     LESELFGHEKGAFTGAAGQRVGRFEQAHGGTLFLDEIGDMPMDLQTRLLRVLADGQFY
                     RVGGTQLIRTDVRIVAATHQRLEDRVASGQFREDLFHRLNVIRLKLPALRERREDIPQ
                     LLRFFLQRAAQELGVPIKSIHQQALAQLARYDWPGNVRELENTARWLTVMAPGHEIGI
                     EDLPDNLHQSSTPGAALGDDALLTQWTGDLKRWADARLAAGDQDLLAIAGPAFERTLL
                     KAALHFTGGHKQQAAALIGWGRNTVTRKLKELADIDDDTE"
     misc_feature    complement(260616..262013)
                     /locus_tag="Hneap_0256"
                     /note="nitrogen regulation protein NR(I); Region: ntrC;
                     TIGR01818"
                     /db_xref="CDD:233585"
     misc_feature    complement(261672..262007)
                     /locus_tag="Hneap_0256"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(261714..261719,261726..261728,
                     261783..261785,261843..261845,261867..261869,
                     261996..262001))
                     /locus_tag="Hneap_0256"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(261867..261869)
                     /locus_tag="Hneap_0256"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(261843..261851,261855..261860))
                     /locus_tag="Hneap_0256"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(261711..261719)
                     /locus_tag="Hneap_0256"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(261108..261599)
                     /locus_tag="Hneap_0256"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(261495..261518)
                     /locus_tag="Hneap_0256"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(261177..261179,261303..261305,
                     261492..261515))
                     /locus_tag="Hneap_0256"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(261300..261317)
                     /locus_tag="Hneap_0256"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(261120..261122)
                     /locus_tag="Hneap_0256"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(260616..260735)
                     /locus_tag="Hneap_0256"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(262058..263203)
                     /locus_tag="Hneap_0257"
                     /db_xref="GeneID:8533372"
     CDS             complement(262058..263203)
                     /locus_tag="Hneap_0257"
                     /inference="protein motif:PFAM:PF02518"
                     /note="PFAM: ATP-binding region ATPase domain protein;
                     histidine kinase A domain protein;
                     SMART: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein;
                     KEGG: tgr:Tgr7_3261 signal transduction histidine kinase,
                     nitrogen specific, NtrB"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen specific signal transduction histidine
                     kinase NtrB"
                     /protein_id="YP_003262167.1"
                     /db_xref="GI:261854884"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="GeneID:8533372"
                     /translation="MTKPEIKMPIRTARLADALTTAIVVLDAQDKLLYINSAGEQFWD
                     VSYGVLLKQGFAPFFEQNPILAKAVAEARLTEQVVTLREAELVSIHGQTHIADCAITP
                     SPDISGADILLELADIERHMRITRDAQLHAMQISTRQLVRGLAHELKNPLGGLQGAAQ
                     LLERELPNADLREFTQIILNESSRLKNLIDRMLGPNNRPQMQRINIHEPLEQVRRLLS
                     IEAEETLLQEPLQWHFDFDPSIPDVLADRDQLIQVLLNLSRNALQAMSENDTNNPTLR
                     FKTRVLRRFTIHQTLHRLVLRIDVENNGPPVPDTLVESLFLPMVSGRAHGSGLGLSIA
                     QTIAEQHQGLIEFKQKPGAVRFSLILPLSQSLPGQDTQGQHHQETPP"
     misc_feature    complement(262112..263155)
                     /locus_tag="Hneap_0257"
                     /note="Signal transduction histidine kinase, nitrogen
                     specific [Signal transduction mechanisms]; Region: NtrB;
                     COG3852"
                     /db_xref="CDD:226370"
     misc_feature    complement(262625..262792)
                     /locus_tag="Hneap_0257"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(262628..262630,262640..262642,
                     262649..262651,262661..262663,262670..262672,
                     262682..262684,262730..262732,262739..262741,
                     262751..262753,262760..262762,262772..262774,
                     262784..262786))
                     /locus_tag="Hneap_0257"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(262766..262768)
                     /locus_tag="Hneap_0257"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(262124..262456)
                     /locus_tag="Hneap_0257"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(262136..262138,262142..262144,
                     262157..262159,262163..262165,262211..262222,
                     262283..262288,262292..262294,262298..262300,
                     262304..262306,262415..262417,262424..262426,
                     262436..262438))
                     /locus_tag="Hneap_0257"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(262424..262426)
                     /locus_tag="Hneap_0257"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(262214..262216,262220..262222,
                     262286..262288,262292..262294))
                     /locus_tag="Hneap_0257"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(263446..264264)
                     /locus_tag="Hneap_0258"
                     /db_xref="GeneID:8533373"
     CDS             complement(263446..264264)
                     /locus_tag="Hneap_0258"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: SORBIDRAFT_04g004330; hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262168.1"
                     /db_xref="GI:261854885"
                     /db_xref="GeneID:8533373"
                     /translation="MRTAHLPRTAHFASTILLMSAFFSLSLAPMAAEAETIYKYTNSK
                     GEVVFTDQPTKGAQKLNIIPPPVIPLTPINLPPTTTPATESVKPATNTEASKSPAPLI
                     PSLQMQPPGSSSTADTNPSKPAAANPPEYNQITPAPAKTTTNAPQIIRQSLPETQPSS
                     PAIPPQERNGHYQSLIITEPKAGPVTARDGGTIFVQTKLSPVLDQSVGDRMRIVIDGN
                     IRVDDSTGQRFMISDLTPGTHAIIAIVMRKGKNIFQSNPVVIDLKQGTDGNAQK"
     misc_feature    complement(264058..264201)
                     /locus_tag="Hneap_0258"
                     /note="Domain of unknown function (DUF4124); Region:
                     DUF4124; pfam13511"
                     /db_xref="CDD:257831"
     gene            complement(264454..265569)
                     /locus_tag="Hneap_0259"
                     /db_xref="GeneID:8533374"
     CDS             complement(264454..265569)
                     /locus_tag="Hneap_0259"
                     /EC_number="4.1.1.21"
                     /inference="protein motif:TFAM:TIGR01161"
                     /note="KEGG: rrs:RoseRS_1820 phosphoribosylaminoimidazole
                     carboxylase ATPase;
                     TIGRFAM: phosphoribosylaminoimidazole carboxylase, ATPase;
                     PFAM: ATP-dependent carboxylate-amine ligase domain
                     protein ATP-grasp"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase ATPase
                     subunit"
                     /protein_id="YP_003262169.1"
                     /db_xref="GI:261854886"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR005875"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="GeneID:8533374"
                     /translation="MRTPSPDPTPDQAHIGVIGAGQLGQMLALSGISLGLSFTFLDPS
                     AQAPAGRLGRHIQAEYDDELALEQLAVECDAITLEFENVPVSAVASIARHNQIHPGER
                     PLSIAQDRVHEKRFFESLGIPVAKYHAIDSFEDLKSAVADLGYPCILKTRRLGYDGKG
                     QVVVRHSDDLEPAWASIRGNPSILEQMIPFTREVSIISVRSTRGECAFYPVSENQHRS
                     GILHRTEIHMDDPAQERAEEYARHVLDGLDYVGVLAIEFFEHQGRLVANEMAPRVHNS
                     GHWSQNGAVTSQFENHLRAILGWPLGSTACTGHSIMINLVGIIPPRAPILALPGVHLH
                     DYGKEPRTGRKLGHINIVADTKESCRKYATLIEQMIG"
     misc_feature    complement(264460..265533)
                     /locus_tag="Hneap_0259"
                     /note="phosphoribosylaminoimidazole carboxylase ATPase
                     subunit; Reviewed; Region: PRK06019"
                     /db_xref="CDD:235674"
     misc_feature    complement(264718..265221)
                     /locus_tag="Hneap_0259"
                     /note="ATP-grasp domain; Region: ATP-grasp; pfam02222"
                     /db_xref="CDD:251165"
     gene            complement(265585..266127)
                     /locus_tag="Hneap_0260"
                     /db_xref="GeneID:8533375"
     CDS             complement(265585..266127)
                     /locus_tag="Hneap_0260"
                     /EC_number="4.1.1.21"
                     /inference="protein motif:TFAM:TIGR01162"
                     /note="KEGG: xop:PXO_01312 phosphoribosylaminoimidazole
                     carboxylase, catalytic subunit;
                     TIGRFAM: phosphoribosylaminoimidazole carboxylase,
                     catalytic subunit;
                     PFAM: 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
                     (AIR) carboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase
                     catalytic subunit"
                     /protein_id="YP_003262170.1"
                     /db_xref="GI:261854887"
                     /db_xref="InterPro:IPR000031"
                     /db_xref="GeneID:8533375"
                     /translation="MSEQPLAPIAPNHPSPLVGVVMGSRSDWETMQHACATLTTLQIP
                     FEAEVVSAHRTPDRLFQYAETAIERGLRVIIGGAGGAAHLPGMLAAKTRLPVLGVPVQ
                     SKSLSGWDSMLSIVQMPAGIPVGTLAIGRAGAVNAALLAAAQLAVHDADLAQRLDAYR
                     HAQTKTVLAGTDPRTPPPSF"
     misc_feature    complement(265606..266088)
                     /locus_tag="Hneap_0260"
                     /note="Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase
                     [Nucleotide transport and metabolism]; Region: PurE;
                     COG0041"
                     /db_xref="CDD:223119"
     gene            complement(266124..266546)
                     /locus_tag="Hneap_0261"
                     /db_xref="GeneID:8533376"
     CDS             complement(266124..266546)
                     /locus_tag="Hneap_0261"
                     /inference="protein motif:PFAM:PF04247"
                     /note="PFAM: invasion gene expression up-regulator SirB;
                     KEGG: pna:Pnap_1330 invasion gene expression up-regulator,
                     SirB"
                     /codon_start=1
                     /transl_table=11
                     /product="invasion gene expression up-regulator SirB"
                     /protein_id="YP_003262171.1"
                     /db_xref="GI:261854888"
                     /db_xref="InterPro:IPR007360"
                     /db_xref="GeneID:8533376"
                     /translation="MTIAQISVHIHGLAVVLSLIGFILRGIWMLKDSPRLKARWVKIT
                     PHIVDTVLLVSALIASYLMFWRYGVNPDYVTVMIVGLIVYIVLGLFALRLGKTKAIRA
                     SAWVLAIAVFLYISAAGTLKTATPFLSAPTTTASVSAR"
     misc_feature    complement(266175..266522)
                     /locus_tag="Hneap_0261"
                     /note="Invasion gene expression up-regulator, SirB;
                     Region: SirB; pfam04247"
                     /db_xref="CDD:252479"
     gene            complement(266669..267649)
                     /locus_tag="Hneap_0262"
                     /db_xref="GeneID:8533377"
     CDS             complement(266669..267649)
                     /locus_tag="Hneap_0262"
                     /inference="protein motif:PFAM:PF03595"
                     /note="PFAM: C4-dicarboxylate transporter/malic acid
                     transport protein;
                     KEGG: maq:Maqu_0374 C4-dicarboxylate transporter/malic
                     acid transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate transporter/malic acid
                     transport protein"
                     /protein_id="YP_003262172.1"
                     /db_xref="GI:261854889"
                     /db_xref="InterPro:IPR004695"
                     /db_xref="GeneID:8533377"
                     /translation="MSESSTADNAHSRLAHMPISMFGMVMGMAGFAIAMHKGEQLVQW
                     SHATSTIFTYVTFGLFGILALAYLAKFVKYPGEVRAEFNHVVRLSFFPAISINLILLS
                     IIALSFNKTLALWLWSIGTPLQLLFTLIILSNWIHHEKFQIHHSNPAWFIPIVGNILV
                     PITGAALGYIQISWFFFSIGVIFWIVLLTILMNRYFFHAPTPSKLMPTLFIMIAPPAV
                     GFISWHALHPSGLDDMGHILYNFALFITLLLFFQAKRFVTIPFGLPFWAYTFPIAAMT
                     IATLIMHQITGLIFYAYLGGFLFVFLTLLIAYLLVKTARAMWAGEICVPE"
     misc_feature    complement(266711..267604)
                     /locus_tag="Hneap_0262"
                     /note="Tellurite-resistance/Dicarboxylate Transporter
                     (TDT) family includes SLAC1 (Slow Anion Channel-Associated
                     1); Region: TDT_SLAC1_like; cd09323"
                     /db_xref="CDD:187763"
     misc_feature    complement(266840..266842)
                     /locus_tag="Hneap_0262"
                     /note="gating phenylalanine in ion channel; other site"
                     /db_xref="CDD:187763"
     gene            267796..268461
                     /locus_tag="Hneap_0263"
                     /db_xref="GeneID:8533378"
     CDS             267796..268461
                     /locus_tag="Hneap_0263"
                     /inference="similar to AA sequence:KEGG:Mlg_1271"
                     /note="KEGG: aeh:Mlg_1271  integral membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein"
                     /protein_id="YP_003262173.1"
                     /db_xref="GI:261854890"
                     /db_xref="GeneID:8533378"
                     /translation="MNVPDGLISSDLLWLNWLLFIALMGLGVYRSPWRALLHAPQRLN
                     LIAASVVFLAMLWLFSSSALPGLSLHFLGLTVVTLVVGWPLALVVGGVTLLLLSLAGQ
                     MAFSGIGLDMLGMVVPPVLVTALINAGAQKLLPANYFIYLFVNSFLSAILGAMAAALA
                     SASLMLVFGIYTWDVLTSSYFPLLPIQWVPEAMINTMIILGLTLLRPDWVITFDDQRY
                     FKN"
     misc_feature    267814..268458
                     /locus_tag="Hneap_0263"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3235"
                     /db_xref="CDD:225775"
     gene            268701..269039
                     /locus_tag="Hneap_0264"
                     /db_xref="GeneID:8533379"
     CDS             268701..269039
                     /locus_tag="Hneap_0264"
                     /inference="protein motif:PFAM:PF00034"
                     /note="PFAM: cytochrome C class I;
                     KEGG: tgr:Tgr7_3091 cytochrome c class I"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C class I"
                     /protein_id="YP_003262174.1"
                     /db_xref="GI:261854891"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:8533379"
                     /translation="MKKLTVLMLAAGLMTSGAAMAAGDAAAGKTLYDASCASCHGMQA
                     QGQGMFPKLAGLTSERIKTTLVAFKSGDTATLKKEGLGGPNSAIMAPNAAGLSEQDMD
                     NLSAYIATLK"
     misc_feature    268785..269036
                     /locus_tag="Hneap_0264"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            complement(269152..269865)
                     /locus_tag="Hneap_0265"
                     /db_xref="GeneID:8533380"
     CDS             complement(269152..269865)
                     /locus_tag="Hneap_0265"
                     /inference="protein motif:TFAM:TIGR02135"
                     /note="TIGRFAM: phosphate transporter regulatory protein
                     PhoU;
                     PFAM: PhoU family protein;
                     KEGG: noc:Noc_2395 phosphate transporter PhoU"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate uptake regulator PhoU"
                     /protein_id="YP_003262175.1"
                     /db_xref="GI:261854892"
                     /db_xref="InterPro:IPR008170"
                     /db_xref="GeneID:8533380"
                     /translation="MDSYNGTPHTLTRYDEDINALRTMLMNMGGVAEQHFADALAYLL
                     DGDAERGARALKQDYEINRMESSIDELAIQIIARYSPMANDLRTIMSVVKAITDLERI
                     GDKSEKMARIAEEIGPILRHTDFIGHLRVMGRIVGGMMHDALDAFIRLDAIAAEEIIR
                     RDTHVNEEYNAVHRVLLKYMNENPNSADVGLRILSCMRAIERVGDHCTNIAEYVIFQQ
                     KGDDVRHSNISKEKQRTQI"
     misc_feature    complement(269191..269865)
                     /locus_tag="Hneap_0265"
                     /note="transcriptional regulator PhoU; Provisional;
                     Region: PRK11115"
                     /db_xref="CDD:182974"
     misc_feature    complement(269527..269793)
                     /locus_tag="Hneap_0265"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     misc_feature    complement(269224..269481)
                     /locus_tag="Hneap_0265"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     gene            270053..272128
                     /locus_tag="Hneap_0266"
                     /db_xref="GeneID:8533381"
     CDS             270053..272128
                     /locus_tag="Hneap_0266"
                     /EC_number="2.7.4.1"
                     /inference="protein motif:PRIAM:2.7.4.1"
                     /note="PFAM: polyphosphate kinase;
                     KEGG: tgr:Tgr7_2466 polyphosphate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase"
                     /protein_id="YP_003262176.1"
                     /db_xref="GI:261854893"
                     /db_xref="InterPro:IPR003414"
                     /db_xref="GeneID:8533381"
                     /translation="MTETSLTPVAPVFINRELSLIAFNRRVLELAQDVSLPLLERLKF
                     LCISSSNLDELFEVRIGSLTQQIRVGLNRPDDSGLTPGEQLDQVYTAAHSLVADQYHT
                     LNDEVIPALAEEGIHFLRRTHWNEAQSLWVKQFFRRELLPLLTPLGLDPSHPFPRILN
                     KSLNFVVSLEGTDDYGREAWMAIVQAPRALPRIIRMDEEASGTSSSFVFLSSIIHAHV
                     HELFPGMTVTGCYQFRVTRNSDLAVAVDDDDDLLKTLQGGLFERNYGDAVRLEVADNC
                     PQEMIDFLCDRFKLNNQAVFQVHGPVNLNRLMALYGLVNRPDLKDEPFTPKLKKEFSS
                     EANIFETIEQRGAVLLHHPYESFMPVVEFVRQAASDPKVVAIKMTLYRTGRDSAIVDA
                     LEAAARAGKEVTAVVELRARFDEEANIDITTRLQKAGAYVAYGIVGYKTHAKMTLVLR
                     RDGSRLKRFVHMGTGNYHPGTARIYTDFGLLTDDRFLGDDVNKLFMQLTGLGRGMRLK
                     RILQSPFTLHSGMLDRIEREIEHAQAGRKALIRAKMNALIDRQIIEALYRASQAGVQI
                     DLIIRGVCCIQPGIAGLSENIRVRSVMGRFLEHPRVFYFLNDGDDELFLSSADWMPRN
                     FFVRVETCFPIDAPEIKARVINEAFERYLADNTGAWSLEADGQYHRVKRHHNAKPRSA
                     QQSLLDDLT"
     misc_feature    270089..272125
                     /locus_tag="Hneap_0266"
                     /note="polyphosphate kinase; Provisional; Region:
                     PRK05443"
                     /db_xref="CDD:235469"
     misc_feature    270089..270412
                     /locus_tag="Hneap_0266"
                     /note="Polyphosphate kinase N-terminal domain; Region:
                     PP_kinase_N; pfam13089"
                     /db_xref="CDD:257492"
     misc_feature    270428..271048
                     /locus_tag="Hneap_0266"
                     /note="Polyphosphate kinase middle domain; Region:
                     PP_kinase; pfam02503"
                     /db_xref="CDD:251338"
     misc_feature    271061..271552
                     /locus_tag="Hneap_0266"
                     /note="Catalytic domain of phospholipase D superfamily
                     proteins; Region: PLDc_SF; cl15239"
                     /db_xref="CDD:265651"
     misc_feature    order(271376..271378,271382..271384,271442..271444,
                     271448..271450,271481..271483)
                     /locus_tag="Hneap_0266"
                     /note="putative active site [active]"
                     /db_xref="CDD:197200"
     misc_feature    271376..271378
                     /locus_tag="Hneap_0266"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197200"
     misc_feature    271571..272062
                     /locus_tag="Hneap_0266"
                     /note="Catalytic C-terminal domain, second repeat, of
                     Pseudomonas aeruginosa polyphosphate kinase 1 and similar
                     proteins; Region: PLDc_PaPPK1_C2_like; cd09168"
                     /db_xref="CDD:197265"
     misc_feature    order(271574..271582,271838..271858,271895..271903,
                     271931..271945,271949..271951,271958..271960,
                     271967..271972,271979..271984,271994..271996)
                     /locus_tag="Hneap_0266"
                     /note="putative domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197265"
     misc_feature    order(271763..271765,271841..271843,271847..271849,
                     271853..271855,271901..271903,271907..271909,
                     271934..271936,271940..271942)
                     /locus_tag="Hneap_0266"
                     /note="putative active site [active]"
                     /db_xref="CDD:197265"
     misc_feature    271847..271849
                     /locus_tag="Hneap_0266"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197265"
     gene            complement(272175..273347)
                     /locus_tag="Hneap_0267"
                     /db_xref="GeneID:8533382"
     CDS             complement(272175..273347)
                     /locus_tag="Hneap_0267"
                     /EC_number="2.7.2.11"
                     /inference="protein motif:TFAM:TIGR01027"
                     /note="KEGG: tgr:Tgr7_3209 glutamate 5-kinase;
                     TIGRFAM: glutamate 5-kinase;
                     PFAM: aspartate/glutamate/uridylate kinase; PUA domain
                     containing protein;
                     SMART: PUA domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate 5-kinase"
                     /protein_id="YP_003262177.1"
                     /db_xref="GI:261854894"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="InterPro:IPR019797"
                     /db_xref="GeneID:8533382"
                     /translation="MVERDANPAMGVDTGVDLRAHLKTDRRWVIKIGSAMVTGNGAGL
                     DLSAIDRWAEQIAAMRAEGREVVIVTSGAVAEGMARLGWPERPSALPELQAAAAVGQM
                     GLVQAYADVLLRHGIHTAQILLTHDDLSNRQRYLNARSTLRTLLDLGVVPVVNENDTV
                     ATDEIRFGDNDTLAALVANLVEADVLVILTDQLGLFDADPRKNPSARLLTEVTAGDPA
                     LETMASPEGGRLGRGGMYTKVMAAKRAAQSGAATVVASGATPHVLLQLAAGTSGVGTV
                     FQPAQTRLAARKQWLAGQLRARGTVRVDTGAAAALRQGGRSLLPIGVLEVTGEFTRGD
                     LVRIVDEAGTDLGRGLINYGSTHAKRLCRQPSNAIAELLGFAEEDELIHRDNLILL"
     misc_feature    complement(272178..273293)
                     /locus_tag="Hneap_0267"
                     /note="gamma-glutamyl kinase; Provisional; Region:
                     PRK05429"
                     /db_xref="CDD:235460"
     misc_feature    complement(272517..273269)
                     /locus_tag="Hneap_0267"
                     /note="AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes
                     glutamate-dependent ATP cleavage; G5K transfers the
                     terminal phosphoryl group of ATP to the gamma-carboxyl
                     group of glutamate, in the first and controlling step of
                     proline (and, in mammals, ornithine)...; Region:
                     AAK_G5K_ProB; cd04242"
                     /db_xref="CDD:239775"
     misc_feature    complement(order(272634..272636,272646..272648,
                     272652..272654,272760..272765,272772..272780,
                     273243..273245))
                     /locus_tag="Hneap_0267"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239775"
     misc_feature    complement(order(272868..272873,272877..272879,
                     272907..272909,272916..272918,272934..272939,
                     272979..272981,272985..272987,273054..273056,
                     273066..273068,273156..273158,273165..273170))
                     /locus_tag="Hneap_0267"
                     /note="homotetrameric interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239775"
     misc_feature    complement(273111..273134)
                     /locus_tag="Hneap_0267"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:239775"
     misc_feature    complement(order(272841..272843,272874..272876,
                     273129..273131))
                     /locus_tag="Hneap_0267"
                     /note="putative allosteric binding site; other site"
                     /db_xref="CDD:239775"
     misc_feature    complement(272229..272453)
                     /locus_tag="Hneap_0267"
                     /note="PUA domain; Region: PUA; pfam01472"
                     /db_xref="CDD:250644"
     gene            complement(273354..274481)
                     /locus_tag="Hneap_0268"
                     /db_xref="GeneID:8533383"
     CDS             complement(273354..274481)
                     /locus_tag="Hneap_0268"
                     /inference="protein motif:TFAM:TIGR02729"
                     /note="TIGRFAM: GTP-binding protein Obg/CgtA;
                     PFAM: GTP1/OBG sub domain protein; GTP-binding protein
                     HSR1-related;
                     KEGG: ppg:PputGB1_0722 GTPase ObgE"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein Obg/CgtA"
                     /protein_id="YP_003262178.1"
                     /db_xref="GI:261854895"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006074"
                     /db_xref="InterPro:IPR006169"
                     /db_xref="InterPro:IPR014100"
                     /db_xref="GeneID:8533383"
                     /translation="MKFVDEAKVKVKAGDGGNGVIGFRREKYVPYGGPDGGDGGDGGS
                     VYFLGDANLNTLADFRFVRHYEAQRGENGSGSNMTGAKGADLWVRVPLGTVVHDIDTG
                     EILGEVLDPAQPLLVAQGGWHGLGNARFKSSTNRAPRQKTEGTPGDERRLLLELRVLA
                     DVGLLGMPNAGKSTLIRAISQAKPKVADYPFTTLHPNLGVVAPEPHRSFVVADIPGLI
                     EGAAEGAGLGHQFLRHLARTNLLLHIVDVAPLDEADPIESVAIIEEELVRYDESHQTH
                     SAERPRWLILNKIDQWLEEERSEQINLLTQRFRHELDFKGPIFAISALEKQGTTALVW
                     AIMEFMEAARAADQAAAAEAAKAPVVPPAKFDNPDLEWTEE"
     misc_feature    complement(273459..274475)
                     /locus_tag="Hneap_0268"
                     /note="Obg family GTPase CgtA; Region: Obg_CgtA;
                     TIGR02729"
                     /db_xref="CDD:233986"
     misc_feature    complement(274038..274475)
                     /locus_tag="Hneap_0268"
                     /note="GTP1/OBG; Region: GTP1_OBG; pfam01018"
                     /db_xref="CDD:110047"
     misc_feature    complement(273465..274004)
                     /locus_tag="Hneap_0268"
                     /note="Obg GTPase; Region: Obg; cd01898"
                     /db_xref="CDD:206685"
     misc_feature    complement(273963..273986)
                     /locus_tag="Hneap_0268"
                     /note="G1 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(order(273513..273518,273612..273614,
                     273618..273623,273960..273977))
                     /locus_tag="Hneap_0268"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206685"
     misc_feature    complement(273894..273941)
                     /locus_tag="Hneap_0268"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(273903..273905)
                     /locus_tag="Hneap_0268"
                     /note="G2 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(273834..273845)
                     /locus_tag="Hneap_0268"
                     /note="G3 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(order(273768..273806,273813..273836))
                     /locus_tag="Hneap_0268"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(273612..273623)
                     /locus_tag="Hneap_0268"
                     /note="G4 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    complement(273510..273518)
                     /locus_tag="Hneap_0268"
                     /note="G5 box; other site"
                     /db_xref="CDD:206685"
     gene            complement(274634..274891)
                     /gene="rpmA"
                     /locus_tag="Hneap_0269"
                     /db_xref="GeneID:8533384"
     CDS             complement(274634..274891)
                     /gene="rpmA"
                     /locus_tag="Hneap_0269"
                     /inference="protein motif:TFAM:TIGR00062"
                     /note="involved in the peptidyltransferase reaction during
                     translation"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="YP_003262179.1"
                     /db_xref="GI:261854896"
                     /db_xref="InterPro:IPR001684"
                     /db_xref="InterPro:IPR018261"
                     /db_xref="GeneID:8533384"
                     /translation="MAHKKAAGSTRNGRDSESKRLGVKRYGGQVISAGSIIVRQRGTQ
                     FHPGANVGCGRDYTLFALTDGAVKFEVKGDKSRRFVSIVPV"
     misc_feature    complement(274643..274891)
                     /gene="rpmA"
                     /locus_tag="Hneap_0269"
                     /note="50S ribosomal protein L27; Validated; Region: rpmA;
                     PRK05435"
                     /db_xref="CDD:235464"
     gene            complement(274945..275256)
                     /locus_tag="Hneap_0270"
                     /db_xref="GeneID:8533385"
     CDS             complement(274945..275256)
                     /locus_tag="Hneap_0270"
                     /inference="protein motif:TFAM:TIGR00061"
                     /note="TIGRFAM: ribosomal protein L21;
                     PFAM: ribosomal protein L21;
                     KEGG: avn:Avin_40790 ribosomal protein L21"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="YP_003262180.1"
                     /db_xref="GI:261854897"
                     /db_xref="InterPro:IPR001787"
                     /db_xref="InterPro:IPR018258"
                     /db_xref="GeneID:8533385"
                     /translation="MYAVVVTGGKQYRVEPGEWLRVEKLEGEEGSAVTLDRVLMIADG
                     DAIKVGAPALAGASVTAEIIGQGRGKKVDIIKFRRRKHHRKHQGHRQAYTEIKITSIN
                     G"
     misc_feature    complement(274948..275256)
                     /locus_tag="Hneap_0270"
                     /note="50S ribosomal protein L21; Validated; Region: rplU;
                     PRK05573"
                     /db_xref="CDD:235510"
     gene            275425..275892
                     /locus_tag="Hneap_0271"
                     /db_xref="GeneID:8533386"
     CDS             275425..275892
                     /locus_tag="Hneap_0271"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262181.1"
                     /db_xref="GI:261854898"
                     /db_xref="GeneID:8533386"
                     /translation="MKVVAKFSRLINTLFMKYRRLISSIMLLLAVWLPLDNALAGAVV
                     QGCPMMSHAFERGLHTTFMPNADQSTSDGATDAPHCPMMHMATDNTSSSSGHDQCSNG
                     CTHCGLCLLLGGVALQLNAPAIPVTPVLPHKIISSLPATHTSVSAPLFRPPIA"
     gene            276080..278050
                     /locus_tag="Hneap_0272"
                     /db_xref="GeneID:8533387"
     CDS             276080..278050
                     /locus_tag="Hneap_0272"
                     /inference="protein motif:TFAM:TIGR01480"
                     /note="TIGRFAM: copper-resistance protein, CopA family;
                     PFAM: multicopper oxidase type 3; multicopper oxidase type
                     1; multicopper oxidase type 2;
                     KEGG: bpt:Bpet4591 copper resistance protein A precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="CopA family copper-resistance protein"
                     /protein_id="YP_003262182.1"
                     /db_xref="GI:261854899"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR001287"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR006376"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="GeneID:8533387"
                     /translation="MPIKSAFQANTRPINSSRRIFIQGLVAGGVMAALGLNPAEAATI
                     NGRRQPPSLRGTEFDLVIDERPVNFTGQPRTAMTINGSIPGPTLRWREGDVVTLRVTN
                     RLKVSTSLHWHGIILPFEMDGVPGLTYEGIAPGTTFTYRFRVAQSGTYWYHSHTGFQE
                     QNAVYGAIVIDPAQSDRVAYDQDHVVMLNDWTDASPDFIFNRLKTADGYYNYVKPDLM
                     DLIRQSEKMGFGKAVEDRLMWDKMRMSPRDLLDVTGATYTYLMNGNTPAGDWTALFRP
                     GERIRLRFINGSSMSYFDVRIPGLKMTVVAADGQDVHPVTVDEFRIGVAEIYDVIVEP
                     VADQAYCIFAQSLDRSGYARGTLTPHVDLRAPIPPMDPVPTLSMADMGMAMSGMDMGD
                     TDMSAMHMGNHAKDNSGVGSMGGMDMSQQKPMAGMTHDQTSQHGTSGMKMDNHAMKGM
                     ADRQPDGAAHGAMSHNPMDLPGLHNRNLKDGTLKIDWHPKTEHGVGVGMRAQQVSMSL
                     SDPGAGLRNNGRKVLTYGDLRGIDGPISQQEPARGIELHLTGNMDRYIWGFNGVSYRD
                     AAPIELKYGETVRIVLINDTMMNHPIHLHGMWSELENDRGEYLARKHTLSVAPGHAIS
                     YRVNANAIGRWAYHCHLLYHMNAGMFREVRVV"
     misc_feature    276116..278044
                     /locus_tag="Hneap_0272"
                     /note="copper-resistance protein, CopA family; Region:
                     copper_res_A; TIGR01480"
                     /db_xref="CDD:233432"
     misc_feature    276248..276592
                     /locus_tag="Hneap_0272"
                     /note="The first cupredoxin domain of CopA copper
                     resistance protein family; Region: CuRO_1_CopA; cd13848"
                     /db_xref="CDD:259917"
     misc_feature    order(276251..276253,276263..276268,276329..276331,
                     276344..276346,276398..276400,276416..276418,
                     276515..276532,276536..276538,276557..276565,
                     276572..276580,276584..276586)
                     /locus_tag="Hneap_0272"
                     /note="putative Domain 2 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259917"
     misc_feature    order(276410..276412,276416..276418,276425..276427,
                     276491..276496,276536..276538,276542..276544,
                     276548..276550,276557..276562)
                     /locus_tag="Hneap_0272"
                     /note="putative Domain 3 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259917"
     misc_feature    order(276410..276412,276416..276418,276536..276538,
                     276542..276544)
                     /locus_tag="Hneap_0272"
                     /note="trinuclear Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259917"
     misc_feature    <276599..276769
                     /locus_tag="Hneap_0272"
                     /note="ScaI restriction endonuclease; Region: RE_ScaI;
                     pfam09569"
                     /db_xref="CDD:118105"
     misc_feature    276809..277150
                     /locus_tag="Hneap_0272"
                     /note="The second cupredoxin domain of  CopA copper
                     resistance protein family; Region: CuRO_2_CopA; cd13874"
                     /db_xref="CDD:259942"
     misc_feature    order(276812..276823,276833..276835,276851..276853,
                     276860..276871,276890..276892,276920..276922,
                     276926..276928,276932..276934,277001..277009,
                     277052..277054,277058..277060,277124..277126,
                     277130..277135)
                     /locus_tag="Hneap_0272"
                     /note="putative Domain 1 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259942"
     misc_feature    order(276947..276949,276953..276955,276989..276994,
                     276998..277012,277016..277024,277028..277030,
                     277040..277042,277046..277063)
                     /locus_tag="Hneap_0272"
                     /note="putative Domain 3 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259942"
     misc_feature    277703..278044
                     /locus_tag="Hneap_0272"
                     /note="The third cupredoxin domain of CopA copper
                     resistance protein family; Region: CuRO_3_CopA; cd13896"
                     /db_xref="CDD:259963"
     misc_feature    order(277748..277750,277844..277846,277850..277852,
                     277910..277921,277925..277927,277931..277933,
                     277991..277999,278003..278011)
                     /locus_tag="Hneap_0272"
                     /note="putative Domain 2 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259963"
     misc_feature    order(277847..277849,277994..277996,278009..278011,
                     278024..278026)
                     /locus_tag="Hneap_0272"
                     /note="Type 1 (T1) Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259963"
     misc_feature    order(277856..277858,277862..277867,277910..277912,
                     277919..277921,277976..277987,277991..277993,
                     277997..277999,278003..278008,278027..278029,
                     278033..278035)
                     /locus_tag="Hneap_0272"
                     /note="putative Domain 1 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259963"
     misc_feature    order(277856..277858,277862..277864,277991..277993,
                     277997..277999)
                     /locus_tag="Hneap_0272"
                     /note="trinuclear Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259963"
     gene            278073..278897
                     /locus_tag="Hneap_0273"
                     /db_xref="GeneID:8533388"
     CDS             278073..278897
                     /locus_tag="Hneap_0273"
                     /inference="protein motif:PFAM:PF05275"
                     /note="PFAM: copper resistance B precursor;
                     KEGG: tbd:Tbd_1325 copper resistance protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance B"
                     /protein_id="YP_003262183.1"
                     /db_xref="GI:261854900"
                     /db_xref="InterPro:IPR007939"
                     /db_xref="GeneID:8533388"
                     /translation="MKTIPTFLPPVATLLLAVTTSLAQAAGYETSANNSGHYQAPSLA
                     QQRADVAAMVAQSARHETHSPLIYKVMIDRLERDFGNKGNYSQFEGQAYIGTDTNKLW
                     LKGEGKRLGGKTEDADIEAYYSHAIAAFWDAQIGMRHDFSAGSIPSRNWLGFGVQGLA
                     PYKFDTSATAYVGNEGRTALRLSSEYDFFITQRLIFWPGVELNLYGKNDPERNIGRGL
                     ADSRLVLRLRYEIRREIAPYVGIQWTNKYGQTASYARTNGEATSDMQLIAGLRLWW"
     misc_feature    278262..278894
                     /locus_tag="Hneap_0273"
                     /note="Copper resistance protein B precursor (CopB);
                     Region: CopB; pfam05275"
                     /db_xref="CDD:253126"
     gene            279022..279285
                     /locus_tag="Hneap_0274"
                     /db_xref="GeneID:8533389"
     CDS             279022..279285
                     /locus_tag="Hneap_0274"
                     /inference="protein motif:PFAM:PF09851"
                     /note="PFAM: protein of unknown function DUF2078,
                     membrane;
                     KEGG: rxy:Rxyl_3081 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262184.1"
                     /db_xref="GI:261854901"
                     /db_xref="InterPro:IPR018649"
                     /db_xref="GeneID:8533389"
                     /translation="MPFFNEHWGMGAGFGGFGLIFMLLGVVVMALVVFAILRLLTGSN
                     RPGPTDREDRRALSILEKRFANGEIDEAEYNERRRILEGRDRS"
     misc_feature    <279076..279267
                     /locus_tag="Hneap_0274"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3462"
                     /db_xref="CDD:225993"
     misc_feature    279184..279270
                     /locus_tag="Hneap_0274"
                     /note="Short C-terminal domain; Region: SHOCT; pfam09851"
                     /db_xref="CDD:255605"
     gene            279331..281040
                     /locus_tag="Hneap_0275"
                     /db_xref="GeneID:8533390"
     CDS             279331..281040
                     /locus_tag="Hneap_0275"
                     /EC_number="1.3.3.5"
                     /inference="protein motif:PRIAM:1.3.3.5"
                     /note="PFAM: multicopper oxidase type 3; multicopper
                     oxidase type 1; multicopper oxidase type 2;
                     KEGG: xau:Xaut_2898 bilirubin oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="bilirubin oxidase"
                     /protein_id="YP_003262185.1"
                     /db_xref="GI:261854902"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="GeneID:8533390"
                     /translation="MSHDFSNKYPNKPVPAAQQDMAIDSPKRRHALKTLVQGAATVLT
                     GVALTEQITTSAQAQAMGMMGGMMGGMPGQNQSASISSGLFTHPMPIPPQLKGEADSS
                     GVRTYALNVMAGQHSELVPGLKTATWGYNGAILGPTIRVPQGKPVRFDISNGLDQSTT
                     VHWHGAHVPGHADGGPHNLIAAGKQTSVSFSLNQPAATLWYHPHPDGRTGPQVYAGLA
                     GFLLVDDGLDARLGMPHTYGVDDFPVVIQDRRITETGQLDYMDSMMDIMGMKGDRFLV
                     NGVEQPFVAVPGQWIRLRLLNGSNARIYNLCFADERPFHVVASDAGLLEQPVKRTELV
                     LAPAERAEIMVDLNDMQGKKLVLRSDSAKVIPGLNRMPMATDGYDKGRFDLLEFRVGA
                     PTAKTGHLPERMASIPTLKADAPIRKFTLQDMNMGKMRRMMMGGGLQSDNKSTGPGGM
                     SMGIGGRHLFSINDQYMNPKVINERVKLGSTEIWHVANDGMMAHPFHIHGISFQVLSR
                     DGAQPPAYERGWKDVVLVHSGQTVQLIARFDQPAGDDHPFMYHCHILEHEDNGMMGQF
                     TVS"
     misc_feature    279592..281037
                     /locus_tag="Hneap_0275"
                     /note="multicopper oxidase; Provisional; Region: PRK10965"
                     /db_xref="CDD:236810"
     misc_feature    279643..280005
                     /locus_tag="Hneap_0275"
                     /note="The first Cupredoxin domain of the multicopper
                     oxidase CueO, the cell division protein FtsP, and similar
                     proteins; Region: CuRO_1_CueO_FtsP; cd04232"
                     /db_xref="CDD:259894"
     misc_feature    order(279697..279711,279730..279735,279742..279744,
                     279820..279825,279916..279930,279958..279963,
                     279967..279975,279988..279990,279994..279996)
                     /locus_tag="Hneap_0275"
                     /note="Domain 2 interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259894"
     misc_feature    order(279814..279816,279820..279825,279829..279843,
                     279847..279849,279856..279861,279928..279930,
                     279934..279936,279940..279942,279946..279960,
                     279967..279969)
                     /locus_tag="Hneap_0275"
                     /note="Domain 3 interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259894"
     misc_feature    order(279814..279816,279820..279822,279934..279936,
                     279940..279942)
                     /locus_tag="Hneap_0275"
                     /note="trinuclear Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259894"
     misc_feature    280048..280503
                     /locus_tag="Hneap_0275"
                     /note="The second Cupredoxin domain of the multicopper
                     oxidase CueO, the cell division protein FtsP, and similar
                     proteins; Region: CuRO_2_CueO_FtsP; cd13867"
                     /db_xref="CDD:259935"
     misc_feature    order(280054..280065,280075..280077,280147..280149,
                     280156..280167,280177..280179,280204..280206,
                     280210..280212,280216..280218,280288..280296,
                     280342..280344,280348..280350,280480..280482,
                     280486..280491)
                     /locus_tag="Hneap_0275"
                     /note="Domain 1 interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259935"
     misc_feature    order(280231..280233,280237..280239,280276..280281,
                     280285..280299,280306..280314,280318..280320,
                     280330..280332,280336..280353)
                     /locus_tag="Hneap_0275"
                     /note="Domain 3 interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259935"
     misc_feature    280693..281034
                     /locus_tag="Hneap_0275"
                     /note="The third Cupredoxin domain of the multicopper
                     oxidase CueO, the cell division protein FtsP, and similar
                     proteins; Region: CuRO_3_CueO_FtsP; cd13890"
                     /db_xref="CDD:259957"
     misc_feature    order(280693..280695,280708..280710,280804..280809,
                     280813..280815,280834..280836,280876..280881,
                     280888..280899,280903..280905,280987..281001,
                     281008..281010)
                     /locus_tag="Hneap_0275"
                     /note="Domain 2 interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259957"
     misc_feature    order(280729..280731,280735..280737,280819..280821,
                     280825..280827,280831..280836,280894..280896,
                     280948..280950,280966..280977,280981..280983,
                     280987..280989,280993..280998,281002..281007,
                     281017..281019)
                     /locus_tag="Hneap_0275"
                     /note="Domain 1 interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259957"
     misc_feature    order(280810..280812,280984..280986,280999..281001,
                     281014..281016)
                     /locus_tag="Hneap_0275"
                     /note="Type 1 (T1) Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259957"
     misc_feature    order(280819..280821,280825..280827,280981..280983,
                     280987..280989)
                     /locus_tag="Hneap_0275"
                     /note="trinuclear Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259957"
     gene            281209..282558
                     /locus_tag="Hneap_0276"
                     /db_xref="GeneID:8533391"
     CDS             281209..282558
                     /locus_tag="Hneap_0276"
                     /inference="protein motif:PFAM:PF02321"
                     /note="PFAM: outer membrane efflux protein;
                     KEGG: kko:Kkor_1300 outer membrane efflux protein"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane efflux protein"
                     /protein_id="YP_003262186.1"
                     /db_xref="GI:261854903"
                     /db_xref="InterPro:IPR003423"
                     /db_xref="GeneID:8533391"
                     /translation="MPFLSPSPWCLTRWVLTRSLMPIQHSLRTLGMLLIVILALSGLA
                     QAGQNTSGRSEQPVFSISPDATLSLQEAEQLAVQNDQGLAAAVATESAETSSAKAADQ
                     LPDPEISLGVSSLPLDTFSFTQTPMTTTEVSISQSLPPGDTLAQRALAADAKIQAATA
                     NIAVQQQILRREVGRFWLTVYRDQQTLALLAQEKSLYQRLLRSAQTAYSTGRARATDL
                     VRLQVRLAELDDRIDRQRGSTAATKARLARWIGARAQQDWPTALPSALTTLPEGSVEH
                     QPEIKALQANLAEARAQTGEARAAFKPKFGVSLGYGIKAGNQPDTVSVGVSMSLPLFT
                     GERQAPLLAAAQKRQQARQLALESRAADFHAEAQSLNADVDSLTSRIDRYDRQILPKL
                     RQVATLAQNQFGSGSGDFTAIIDAEQAEITGRQQRLDLTIDRAQRLIDLRYLLENPA"
     misc_feature    281407..282543
                     /locus_tag="Hneap_0276"
                     /note="Outer membrane protein [Cell envelope biogenesis,
                     outer membrane / Intracellular trafficking and secretion];
                     Region: TolC; COG1538"
                     /db_xref="CDD:224455"
     misc_feature    281413..281961
                     /locus_tag="Hneap_0276"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    282004..282543
                     /locus_tag="Hneap_0276"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            282555..284438
                     /locus_tag="Hneap_0277"
                     /db_xref="GeneID:8533392"
     CDS             282555..284438
                     /locus_tag="Hneap_0277"
                     /inference="protein motif:TFAM:TIGR01730"
                     /note="TIGRFAM: efflux transporter RND family, MFP
                     subunit;
                     PFAM: secretion protein HlyD;
                     KEGG: saz:Sama_3474 heavy metal efflux system protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="YP_003262187.1"
                     /db_xref="GI:261854904"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:8533392"
                     /translation="MKSSKNKIRLIAVVSTGMAAGAGALIWAHTPINFIRPVLAEATQ
                     SPSASSSQGDQTHKATTAGTDAKFVTKYTCPMHPQIIEDHPGTCPICGMDLVAKQFPA
                     KSSDQSAAPASADTSHDHAGHAAATAAPSSSGPKAEKSTSDAKFVTKYTCPMHPQIIE
                     DHPGTCPICGMDLVAKQFPAKSSDQSAAPASADASHDHAGHTETAATAAPSSSGPKAE
                     KSASDAKFVTKYTCPMHPQIIEDHPGNCPICGMTLVPKLFPAGTKDNTGSAAAKTEQT
                     APAPVASNSAPLPEVAVPQRTLRDMNVVMARAQWRNLTRQIHSVGLVALDENRLSHVH
                     PRASGWVETLNVRALGDTVKKGETLLTVYSPDILSAEKDFLVAQKSGMSEMRDAARDR
                     LRLLNVPESVIEQIARTGKVARTIPVLAPQSGYISVINLRDGMYVTPNLDMFTIADAS
                     KIWVQVEVLPRDMEQVAVGQPAEMTVDGVPGRVWKGTVDFIYPELDPKSRTLKVRLVF
                     DNPDGVLKPNQFAEVGIRGVAQADVLTVPTTAVIPTPQGARVVRKNADGSFQPVRVEV
                     GQSADGWTQITAGLSPDDTVVASGQFLIDSESAIQASFARMTGTAQPADDAAPAASGH
                     HNH"
     misc_feature    283149..284375
                     /locus_tag="Hneap_0277"
                     /note="copper/silver efflux system membrane fusion protein
                     CusB; Provisional; Region: PRK09783"
                     /db_xref="CDD:236625"
     misc_feature    283806..284105
                     /locus_tag="Hneap_0277"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            284451..287723
                     /locus_tag="Hneap_0278"
                     /db_xref="GeneID:8533393"
     CDS             284451..287723
                     /locus_tag="Hneap_0278"
                     /inference="protein motif:TFAM:TIGR00914"
                     /note="TIGRFAM: heavy metal efflux pump, CzcA family;
                     PFAM: acriflavin resistance protein;
                     KEGG: cps:CPS_4858 cation efflux system protein CusA"
                     /codon_start=1
                     /transl_table=11
                     /product="CzcA family heavy metal efflux pump"
                     /protein_id="YP_003262188.1"
                     /db_xref="GI:261854905"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="InterPro:IPR004763"
                     /db_xref="GeneID:8533393"
                     /translation="MLKAVIDASINNRVLVLLLAAILAVVGWYSWKATPLDAIPDLSD
                     TQVIIKTTYPGQSPQVVQDQVTYPLTTALLAVPGSTAVRGYSFYGDSYIYVTFKDGTN
                     LYWARSRVLEYLNQARSSLPAGVEPQLGPDATGVGWVYEYALTDPSGQMNLSQLTTLQ
                     NWFLKFQLQTVSGVSEVATVGGMVREYQIVVDPDRLRAFGVSLATLRKAVADANKEVG
                     GGVLELGGAEYMVTSRGYLKSVADIERIPVGVTQSGTPILVRDLGTVRLGPAPRRGVA
                     DLDGKGEVVGGIIVMRSGENARQVIDAVKTKIEHLKPSLPKGVEIVPVYDRSGVINRA
                     VDTLSSKLVEEFLVVALVCAIFLWHLRSALVAIIGLPLGVLMAFIVMHAQGINANIMS
                     LGGIAIAIGAMVDAAIVMIENAHRHLVAWRETHGSPPKGDDHWRLIAQSAGEVGPALF
                     FSLLIITLSFIPVFTLQAQEGRMFAPLAFTKTYAMAAAAGLAITLIPVLMGYFIRGRI
                     PREEANPLNRFLIALYRPVLHTVLRFPKTLMAISLIFVLSAVLPLAGVGGYLAPLKWV
                     GSSAWQLHVSDWQNDWAKRWASTFSFAPKIAELGRGLGSEFMPTLDEGDLLYMPTTAP
                     GLSIGDARLLLQQVDALIAEEPVVKSVFGKIGRADTATDPAPLTMIETTIQFKPKSEW
                     PAGMTLQKVIDNLNQKIQFPGLNNAWVMPIKTRIDMQTTGIQTPVGVKITGPDLHQID
                     RIGKQVEAVLQTVPGTQTAYADRTNGGRYIEITPDRIKAARFGLNIGEIQDVISSAVG
                     GVEVTQTVEGLERFPVSIRYPRADRDSVSKLKDLPIVTPTGATVALGQIATVQVTDGP
                     PMIRSEDSRPAGFVFVTTQGVDLGSYVNNARRIVDAKVKLPPGYAISWTGQYQYLQRA
                     TERLKQVVPLTLAIIFVLLFLIFRHGGKASLIMVTLPFALVGGFWLLWALGFELSIAV
                     AVGFIALAGVAAEFGVVMLIYLDHAIEDRRRAGRLNTRTDLRDAIMEGAVLRVRPKAM
                     TVAVILAGLIPILVGHGTGSEVMSRIAAPMIGGMITAPLLSMLLLPAVYWLWQRRHLP
                     AG"
     misc_feature    284451..287708
                     /locus_tag="Hneap_0278"
                     /note="Putative silver efflux pump [Inorganic ion
                     transport and metabolism]; Region: COG3696"
                     /db_xref="CDD:226220"
     misc_feature    <287097..287720
                     /locus_tag="Hneap_0278"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            287821..288228
                     /locus_tag="Hneap_0279"
                     /db_xref="GeneID:8533394"
     CDS             287821..288228
                     /locus_tag="Hneap_0279"
                     /inference="similar to AA sequence:KEGG:CAP2UW1_0994"
                     /note="KEGG: app:CAP2UW1_0994 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262189.1"
                     /db_xref="GI:261854906"
                     /db_xref="GeneID:8533394"
                     /translation="MATAINGLRGMTDAMLQECKAQGIKDVDQLTDALASPAARKQWA
                     DKLGETTQDVLAIANRADLSRINGVGGVFSDLLEASGVDTVKELAHRRPDNLHEKMAQ
                     VNADKTLATRTPTEAECAEWVEQAKALGGKITY"
     misc_feature    287845..288207
                     /locus_tag="Hneap_0279"
                     /note="Domain of unknown function (DUF4332); Region:
                     DUF4332; pfam14229"
                     /db_xref="CDD:258421"
     gene            complement(288319..288597)
                     /locus_tag="Hneap_0280"
                     /db_xref="GeneID:8533395"
     CDS             complement(288319..288597)
                     /locus_tag="Hneap_0280"
                     /inference="similar to AA sequence:KEGG:Neut_1816"
                     /note="KEGG: net:Neut_1816 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262190.1"
                     /db_xref="GI:261854907"
                     /db_xref="GeneID:8533395"
                     /translation="MSFALKQTRRFARAYKKLHDQVAADVDIAAAVVAANPSVGERKK
                     GDLADLFVYKFHSHNQLYLLGYTLDEAVRLIYLEAIGPHENFYRDIKR"
     gene            complement(288597..288824)
                     /locus_tag="Hneap_0281"
                     /db_xref="GeneID:8533396"
     CDS             complement(288597..288824)
                     /locus_tag="Hneap_0281"
                     /inference="similar to AA sequence:KEGG:Neut_1817"
                     /note="KEGG: net:Neut_1817 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262191.1"
                     /db_xref="GI:261854908"
                     /db_xref="GeneID:8533396"
                     /translation="MTSTSIRIDQTLYEQARSEALTEHRSIAGQVEYWAKVGRAALDN
                     PDLPVSFIAESLVSLAEPREEATAFIPRKSC"
     misc_feature    complement(288606..288818)
                     /locus_tag="Hneap_0281"
                     /note="Protein of unknown function (DUF3423); Region:
                     DUF3423; pfam11903"
                     /db_xref="CDD:152339"
     gene            complement(288905..289603)
                     /locus_tag="Hneap_0282"
                     /db_xref="GeneID:8533397"
     CDS             complement(288905..289603)
                     /locus_tag="Hneap_0282"
                     /inference="similar to AA sequence:KEGG:Tgr7_2923"
                     /note="KEGG: tgr:Tgr7_2923 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262192.1"
                     /db_xref="GI:261854909"
                     /db_xref="GeneID:8533397"
                     /translation="MPADMTFWAALLVGFFGGVHCIGMCGGIVGALTFGLPPEKRATP
                     GQLLPYLLAYNLARISSYVIAGAIAGLIGAFGLSLIPMQHAQLYLLMVAGGFMVLMGL
                     YVGGWWFGLTRIERVGSRLWRYIEPLGRRLMPVKTPKQALLLGFVWGWLPCGLVYSVL
                     IWALSAGSATQGALLMLGFGLGTLPNLLLMGAFAAQLSALTRKKWVRWIAGGAVLGFG
                     LYTIGSAIWNIQVS"
     misc_feature    complement(288944..289579)
                     /locus_tag="Hneap_0282"
                     /note="Cytochrome C biogenesis protein transmembrane
                     region; Region: DsbD_2; pfam13386"
                     /db_xref="CDD:257712"
     gene            289695..293879
                     /locus_tag="Hneap_0283"
                     /db_xref="GeneID:8533398"
     CDS             289695..293879
                     /locus_tag="Hneap_0283"
                     /inference="protein motif:TFAM:TIGR01967"
                     /note="KEGG: tgr:Tgr7_0254 ATP-dependent helicase HrpA;
                     TIGRFAM: ATP-dependent helicase HrpA;
                     PFAM: helicase-associated domain protein; protein of
                     unknown function DUF1605; helicase;
                     SMART: DEAD-like helicase ; helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase HrpA"
                     /protein_id="YP_003262193.1"
                     /db_xref="GI:261854910"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR010222"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:8533398"
                     /translation="MNSTLNEPQDAAAPQSAPLSTEPADIIDFLRANLAELPLVDQPA
                     LSRRLAGAERALQQNRLDAGRLAELVTAFEASAALLTERRSAELNIDYPAELPVSGQR
                     EAIMDLIRAHPVVIVAGETGSGKTTQLPKMLLELGFGVKGQIGHTQPRRIAARNVASR
                     LAEELGVTGAGVVGYKVRFSDQTRASSRVAVMTDGILLAEIHSDPDLLRYDALIIDEA
                     HERSLNIDFLLGIVRRLLDRRPDFRLVITSATIDTARFARHFAGTDASGEPQPAPVIT
                     VAGRSFPVEYRYRSLTAPQNDNDTETEEERDLPAAVVAAVDELHAEAQTTGGGDILVF
                     LPGEREIRECAHRLGRHGLRHTEILPLFARLSAAEQQRIFAQHTGRRIVLTTNVAETS
                     LTVPGILYVIDSGLARIARYSPRSRVQKLAVEAISQASANQRAGRCGRIAPGVCIRLF
                     DEADYAGRPAFTDPEILRTNLASVVLRMIELRLGEPEHFPFIEPPDSRQLAGARRLLF
                     ELGALDERQRITPLGRQLARLPVDPTLGRMVLSNLSKADATSVDILIVVAFLSIQDPR
                     ERPADHAQAADQAQQAFRLADSDFAGILALWDQWHTVVRHENQRKRRDWAKKHFLSYN
                     RLLEWHDLFGQLREQADEIGRVKLPDPLPLPVMTDGDEAPLRARLDALHQAMLPGLLA
                     QIGLRDEATRTDKNTPKDSRDQRGKKQRTPTIYIGANNRRFQIFPGSQLAKTQPKWLM
                     SAEIVETTRVYARMNATINPRWIEDMAAHLTTREYSEPRWDQRGGRVAAFETVKLFGL
                     PIVTKRRIDFGRIDPLGARAIFIRAALVEGEFDSGLKFWRHNQALIDEIREIEARNRR
                     PDLLIDDQTLFDFYETHLPAEVYDAHTLVRWLKTITPKQPDVLCMTRDDLLAREPVEL
                     DPAGFPDRLSMGAFSLPLAYHFAPGSADDGVTLRLPLAALKQIDADRASHLIPGLRRE
                     KIEALIRSLPKADRRHFVPAPEFAASVNERVSVDRGGLPAQVAEQLARMTGHKITADA
                     FDERRLEPHLRMRFALIDAKQTDPDKQIIDADRDLSALRARHAAAAERALVERTRHRL
                     ERDDLIDWSFGELPESLTVEELGAELTAYPALIDQGDCAEVRLFDAPERAVLAHRSGV
                     VRLMLIALGEQIRHLSQYLKQERSLDPARLQYSQWSNTRPLPAFGLTLPQRRDAAFDQ
                     ALIARSIAKLAVDALPFIRDESTFRARVERLKPQLDDTVRRLAAQIRTIFAQHQALRA
                     KLKGRLPLSQIEAAREIAEQFDLLFYPGMIWNTPQTLLDNLPRYLTAAEKRLEKIDRH
                     PERDRMLRVQFMPVCARVTDKITATAPTPEAFAALNQLHEQLEEWRVATFAQELARKG
                     APGAKEIEQAIKQLSH"
     misc_feature    289782..293867
                     /locus_tag="Hneap_0283"
                     /note="ATP-dependent helicase HrpA; Region: DEAH_box_HrpA;
                     TIGR01967"
                     /db_xref="CDD:233659"
     misc_feature    290034..290447
                     /locus_tag="Hneap_0283"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    290058..290072
                     /locus_tag="Hneap_0283"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    290340..290351
                     /locus_tag="Hneap_0283"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    <290676..291041
                     /locus_tag="Hneap_0283"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(290700..290711,290778..290783,290850..290858)
                     /locus_tag="Hneap_0283"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(290874..290876,290991..290993,291003..291005,
                     291012..291014)
                     /locus_tag="Hneap_0283"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    291201..291476
                     /locus_tag="Hneap_0283"
                     /note="Helicase associated domain (HA2); Region: HA2;
                     pfam04408"
                     /db_xref="CDD:252575"
     misc_feature    291597..292004
                     /locus_tag="Hneap_0283"
                     /note="Oligonucleotide/oligosaccharide-binding (OB)-fold;
                     Region: OB_NTP_bind; pfam07717"
                     /db_xref="CDD:254381"
     misc_feature    292047..293870
                     /locus_tag="Hneap_0283"
                     /note="Domain of unknown function (DUF3418); Region:
                     DUF3418; pfam11898"
                     /db_xref="CDD:256710"
     gene            294221..295990
                     /locus_tag="Hneap_0284"
                     /db_xref="GeneID:8533399"
     CDS             294221..295990
                     /locus_tag="Hneap_0284"
                     /inference="similar to AA sequence:KEGG:Pcar_0163"
                     /note="KEGG: pca:Pcar_0163 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262194.1"
                     /db_xref="GI:261854911"
                     /db_xref="GeneID:8533399"
                     /translation="MNQEWILQTKETRRAFSNATWVPLRASINDEKGNVKNIGYISEY
                     FGCGSAAFPPENRKLVEERLGWSDIGIGHTVAPYAYEDGYYASIDQFQYNDKEPIGVN
                     LVFEHPQPVVGGKQLILNPDLVVALRLIKEGTNWVRPEENFVVVARESFDDKGEHRLI
                     EIKREFLVDYLAARNLSLRLSYYRQRVENVPLLKGSEYANLKEHREERDGGRFELLIR
                     GINDVFGGGWAMFRAWRTDVDEDEDAPVMGPEDDHNTDHESSKGHRGGYEGVRVEGEF
                     WRDEWVEHQSQSIRVRGDTDINLPQFIAETDGKRMSSSELDNEDIGRWLWFRSSVVTD
                     LLGHRGFALKWYTAETGAICSTSGYATHFGINSADLLTVYAYDIARLPAWEQHIWAAH
                     NVAPDGKVSGELLSAQVKTEPASTHAVEEMLFGSMRLLEQGFRDKFGIDLFSHDIDDE
                     SAMQQISRFHSRDQASLLRLAKELVRVFSDRLNISDLRKLSTHAEKERLGSNKLLQDV
                     LSQKVGADKARQVFAEIAGAYDMRVGDAHPTGSKVADAIKLAGIDQSRSHLRQGEQLI
                     HNFGRAVWFIGKCLFGQPEPRES"
     gene            296366..296713
                     /locus_tag="Hneap_0285"
                     /db_xref="GeneID:8533400"
     CDS             296366..296713
                     /locus_tag="Hneap_0285"
                     /inference="similar to AA sequence:KEGG:VV1848"
                     /note="KEGG: vvy:VV1848 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262195.1"
                     /db_xref="GI:261854912"
                     /db_xref="GeneID:8533400"
                     /translation="MAFSEFELKKHEKMLKAYIEKHRPPAHIRNEIDLGYRQAGQSVE
                     IFEIRSRWDNPKEKMENPVAKATYVKTQDIWKIYWQRADQKWHSYVPHPTVKSLEAFL
                     KVVEDDECACFYG"
     misc_feature    296537..296704
                     /locus_tag="Hneap_0285"
                     /note="Protein of unknown function (DUF3024); Region:
                     DUF3024; pfam11225"
                     /db_xref="CDD:256365"
     gene            complement(296954..297256)
                     /locus_tag="Hneap_0286"
                     /db_xref="GeneID:8533401"
     CDS             complement(296954..297256)
                     /locus_tag="Hneap_0286"
                     /inference="protein motif:PFAM:PF05016"
                     /note="PFAM: plasmid stabilization system;
                     KEGG: vvu:VV1_2525 plasmid stabilization element ParE"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization system"
                     /protein_id="YP_003262196.1"
                     /db_xref="GI:261854913"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="GeneID:8533401"
                     /translation="MGKFSLSHSAKADLRGIARFTEKHWGRAQRLHYLKGLDETFKIL
                     ADSPTLGNACDYIETGVRKYPFQSHVVFYECLSNEEILVVRMLHKNMDVHQAVFPA"
     misc_feature    complement(296960..297256)
                     /locus_tag="Hneap_0286"
                     /note="Plasmid stabilization system protein [General
                     function prediction only]; Region: ParE; COG3668"
                     /db_xref="CDD:226194"
     gene            complement(297256..297495)
                     /locus_tag="Hneap_0287"
                     /db_xref="GeneID:8533402"
     CDS             complement(297256..297495)
                     /locus_tag="Hneap_0287"
                     /inference="protein motif:TFAM:TIGR02606"
                     /note="TIGRFAM: addiction module antidote protein, CC2985
                     family;
                     PFAM: protein of unknown function UPF0156;
                     KEGG: vvu:VV1_2526 transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="CopG/Arc/MetJ family addiction module antidote
                     protein"
                     /protein_id="YP_003262197.1"
                     /db_xref="GI:261854914"
                     /db_xref="InterPro:IPR005360"
                     /db_xref="GeneID:8533402"
                     /translation="MAKNTSVSLGNHFDQFIAAQLSKGRYGSATEVVRAGLRLLENEE
                     QKLETLRQLIAEGRASGTAEYNYEKFMAELDNELS"
     misc_feature    complement(297265..297495)
                     /locus_tag="Hneap_0287"
                     /note="Uncharacterized protein family (UPF0156); Region:
                     RHH_2; cl17383"
                     /db_xref="CDD:247937"
     gene            complement(297650..298324)
                     /locus_tag="Hneap_0288"
                     /db_xref="GeneID:8533403"
     CDS             complement(297650..298324)
                     /locus_tag="Hneap_0288"
                     /inference="protein motif:PFAM:PF10099"
                     /note="PFAM: anti-sigma-K factor RskA;
                     KEGG: bur:Bcep18194_C6587 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma-K factor RskA"
                     /protein_id="YP_003262198.1"
                     /db_xref="GI:261854915"
                     /db_xref="InterPro:IPR018764"
                     /db_xref="GeneID:8533403"
                     /translation="MNESTEHIEYVLGLLDEPTDRLTERAIKASPEQRRAVTNWSLII
                     SDHLLSQCESRPLLGWVWSRIERQLDHQAQDVGSALLRWRMAAAIVAMIGIGLLVGVF
                     VPNKPTMQADSIAMMPMAQGQSAMWEAKADTTTQQLQVTCLTNADQEINKQAVLWLIT
                     PQGQTVAVGSLPMKKGESVTVRPALWSNTIAQTKLAISLEPTGKPIGNKPVGPVVWQG
                     DWSKAS"
     misc_feature    complement(297665..298144)
                     /locus_tag="Hneap_0288"
                     /note="Anti-sigma-K factor rskA; Region: RskA; pfam10099"
                     /db_xref="CDD:255753"
     gene            complement(298326..298949)
                     /locus_tag="Hneap_0289"
                     /db_xref="GeneID:8533404"
     CDS             complement(298326..298949)
                     /locus_tag="Hneap_0289"
                     /inference="protein motif:TFAM:TIGR02937"
                     /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
                     family;
                     PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4
                     type 2; sigma-70 region 4 domain protein;
                     KEGG: xca:xccb100_2963 RNA polymerase sigma factor"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma-24 subunit"
                     /protein_id="YP_003262199.1"
                     /db_xref="GI:261854916"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR007630"
                     /db_xref="InterPro:IPR013249"
                     /db_xref="InterPro:IPR014284"
                     /db_xref="GeneID:8533404"
                     /translation="MSMKPNRSNKDRNQDDDQLTQWLQATAAGDRSAFQKLYQRTSGP
                     LYGLCLRILKEEGRAQECVQDVFLAVWQQAGRFDSARAQPMTWLAAIAHHRAISLLRR
                     FNREITTADWADFLALADAPLLSPEGHQGGSADGDPHDWQLMDREAMTRCLEALRAEP
                     RQAIHKAFWFGHTYQEIADELSTSLSTVKSWIRRALINLKSCLGLVN"
     misc_feature    complement(298341..298913)
                     /locus_tag="Hneap_0289"
                     /note="RNA polymerase sigma factor; Provisional; Region:
                     PRK12534"
                     /db_xref="CDD:183576"
     misc_feature    complement(298632..298841)
                     /locus_tag="Hneap_0289"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(298350..298514)
                     /locus_tag="Hneap_0289"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    complement(order(298362..298364,298368..298373,
                     298377..298385,298389..298394,298398..298400,
                     298428..298433,298449..298451,298479..298481))
                     /locus_tag="Hneap_0289"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            299368..299625
                     /locus_tag="Hneap_0290"
                     /db_xref="GeneID:8533405"
     CDS             299368..299625
                     /locus_tag="Hneap_0290"
                     /inference="similar to AA sequence:KEGG:PSPA7_1836"
                     /note="KEGG: pap:PSPA7_1836 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262200.1"
                     /db_xref="GI:261854917"
                     /db_xref="GeneID:8533405"
                     /translation="MKTRTLKAAVIASTALSAALVAGTALANPFVSQHGASLVKVSDA
                     SCGANMKKSDSSCGANMKKSDSSCGANMKKSDSSCGANMKK"
     gene            299957..300805
                     /locus_tag="Hneap_0291"
                     /db_xref="GeneID:8533406"
     CDS             299957..300805
                     /locus_tag="Hneap_0291"
                     /inference="protein motif:PFAM:PF05114"
                     /note="PFAM: protein of unknown function DUF692;
                     KEGG: saz:Sama_1305 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262201.1"
                     /db_xref="GI:261854918"
                     /db_xref="InterPro:IPR007801"
                     /db_xref="GeneID:8533406"
                     /translation="MITDAKHVLVGVGLRRGSLMQQIETDHPDLDFLEVAPENWMRLG
                     GAVKRQFESLLERYPLYLHGLSLSIGGPAPLDVDFLKSLRAFIDRYQPVLYSEHLSFC
                     TDNAHLYDLMPIPFTRVAMRHVVERIHRAQDILGQRLTLENVSYYTAPDAEMNELEFL
                     TEILQQADCDLLLDVNNVYVNSVNHRYDPVAFLDALPVERVRYLHVAGHLQLSPDLIV
                     DTHGAAVADPVWDLLAHTYTRFGAVPTLLERDFDIPPLADLMQEVAQIRRVAAGAHNK
                     VLEPVA"
     misc_feature    299984..300775
                     /locus_tag="Hneap_0291"
                     /note="hypothetical protein; Provisional; Region:
                     PRK05409"
                     /db_xref="CDD:235447"
     gene            300802..301551
                     /locus_tag="Hneap_0292"
                     /db_xref="GeneID:8533407"
     CDS             300802..301551
                     /locus_tag="Hneap_0292"
                     /inference="protein motif:PFAM:PF09836"
                     /note="PFAM: protein of unknown function DUF2063;
                     KEGG: abo:ABO_1517 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262202.1"
                     /db_xref="GI:261854919"
                     /db_xref="InterPro:IPR018640"
                     /db_xref="GeneID:8533407"
                     /translation="MNTDFLTLQSQFTAFIRNPEHAPVPEGCDPERMKLYHQLFFNNF
                     DGILENTFDRTRAHLADEQWQVLVKLFFSSVPQHSPYLVDVPARFLEFLQEQNTVPLA
                     EALLELAAFEATLHECRMAEDITLPQAPQTQAEDVFDGAWQPHPQGVLFESAYPVNQA
                     DFPLDEAPAQPTLLWIQRDDAGVVQIYNLSAASARWLVLLDAHAGATPNVSLAQLAQE
                     LNVEPDSLAEFACAQLADWIADGVLIPALSH"
     misc_feature    300820..301545
                     /locus_tag="Hneap_0292"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2063); Region: DUF2063; cl01262"
                     /db_xref="CDD:260863"
     gene            301556..304075
                     /locus_tag="Hneap_0293"
                     /db_xref="GeneID:8533408"
     CDS             301556..304075
                     /locus_tag="Hneap_0293"
                     /inference="protein motif:PFAM:PF03190"
                     /note="PFAM: protein of unknown function DUF255;
                     KEGG: hch:HCH_06582 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262203.1"
                     /db_xref="GI:261854920"
                     /db_xref="InterPro:IPR004879"
                     /db_xref="GeneID:8533408"
                     /translation="MQRHRNCWIKVFVRLALASTVLIVPVTVPAANTQPTQAEQQITR
                     PQVDWPVLPTALQKKLNKALADQAQQNGQSTRDYHTRWLNADGLPMFTNRLILSDSPY
                     LLEHAHNPINWYAYGPEALAAAKAQNKPLFISIGYASCHWCHVMARESFESPAVAREL
                     NRHFIAVKVDRQQQPALDHRYQIAVALVNQGQSGWPASVFALPDGRPFFTQLYQPEPS
                     FLATLNNVHHVWQTKRPEVTNDAVKLTALMRQVLDQQAKAAKLDDSVLARTVNALTAQ
                     FDPFQGGFGDGAKFPQATRLLFLLDWLAREQAHLSHPNAAGGVSTAQTKALQSELVLT
                     LNHMARGGLFDQIGGGFFRYSTTPDWQVPHFEKMAYYQAMLAQTYLKAGLVLGNARDW
                     RVAERTLDFVIRDMSAADGGFIAALSADSAVSHRAGAAKEEGYFYTWTPKEIAEALPH
                     YEALLAERYWSITASGTVDGRSVPHQGDAAVQATMAKDEGMSLPALTAKMVAIRAKLE
                     SARKRRPAPGRDDNRILSWNGLLIEALADGGRVLGVPRFIAAAQKAAEFIDTNMRLPD
                     KTLAHSYNRGVASGRANLADHADFALGLVALYDATGKNHWLRAAQKQAQIIMQDFAAA
                     NGGYYDHKALHTKADSDVLNLPSRPIDDGAEPAGNAQALALQLALAARTDDATYQEAA
                     ERMLASFSGLIVRDPTDFTGLLAGLSDLRHGSVGSLAFAGKGNVRIEAARTAKHTAEV
                     RLHYTAPWHSNAHDASPGLIPTAITVSPDAFVRQIDYPQGEKVKLAFSDQPLNLYTGT
                     QVLDIKLNPHVSGPMRIRVQIQACSDATCLAPEDLAIWLPL"
     misc_feature    301820..303805
                     /locus_tag="Hneap_0293"
                     /note="Highly conserved protein containing a thioredoxin
                     domain [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG1331"
                     /db_xref="CDD:224250"
     misc_feature    301829..302302
                     /locus_tag="Hneap_0293"
                     /note="Protein of unknown function, DUF255; Region:
                     Thioredox_DsbH; pfam03190"
                     /db_xref="CDD:251787"
     gene            complement(304266..304814)
                     /locus_tag="Hneap_0294"
                     /db_xref="GeneID:8533409"
     CDS             complement(304266..304814)
                     /locus_tag="Hneap_0294"
                     /inference="protein motif:PFAM:PF04116"
                     /note="PFAM: fatty acid hydroxylase;
                     KEGG: mlo:mll1880 fatty acid hydroxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid hydroxylase"
                     /protein_id="YP_003262204.1"
                     /db_xref="GI:261854921"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="GeneID:8533409"
                     /translation="MSLLSFKLGKVAYTVDLAVYLVAPFLAVASLFYFSEKREAIPIL
                     AAALLGFVGWTLLEYILHRFVLHHLSPFKEWHGEHHHNPTEAMGTPTLLSLLLIVGII
                     FLPSVYLAGWQIGGGFAMGLLLGYSIYTWLHHGEHHWRGHNKWFRNLKRAHAIHHYGH
                     NEHNFGVVTSFWDRVFGTYTRK"
     misc_feature    complement(304281..>304688)
                     /locus_tag="Hneap_0294"
                     /note="Fatty acid hydroxylase superfamily; Region:
                     FA_hydroxylase; cl01132"
                     /db_xref="CDD:260804"
     gene            305082..305684
                     /locus_tag="Hneap_0295"
                     /db_xref="GeneID:8533410"
     CDS             305082..305684
                     /locus_tag="Hneap_0295"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: let-526; LEThal ; K11653 AT-rich interactive
                     domain-containing   protein 1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262205.1"
                     /db_xref="GI:261854922"
                     /db_xref="GeneID:8533410"
                     /translation="MKFRQTMIVVIAMAPFFPMTSWAEDATVYQCKDKNGTVIFSGTP
                     CGSDAKERVITAPNAGTGGDTKGIKELASQYDQRQAQERKEAAKIAAARAAAQARAQA
                     EQPLPSNEPEIIGYPVTGYYPGYVPNNGVSWGLNVSGDGWSAGISTRPPHDGHAHHRP
                     PRPHPNPPPIPYVYKNPGISGQFPGGAPGSSGSNFQPVRP"
     misc_feature    305136..>305264
                     /locus_tag="Hneap_0295"
                     /note="Domain of unknown function (DUF4124); Region:
                     DUF4124; pfam13511"
                     /db_xref="CDD:257831"
     gene            complement(305666..306682)
                     /locus_tag="Hneap_0296"
                     /db_xref="GeneID:8533411"
     CDS             complement(305666..306682)
                     /locus_tag="Hneap_0296"
                     /inference="protein motif:PFAM:PF01636"
                     /note="PFAM: aminoglycoside phosphotransferase;
                     KEGG: har:HEAR0365 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="YP_003262206.1"
                     /db_xref="GI:261854923"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="GeneID:8533411"
                     /translation="MSQRSPNTADERTLALLVFVRSHFPDAPPPAIASSDASARRYWR
                     LRLTNGDTRIIMDAPPPGEDIRPFIEMQERLTVAGVAVPNIFERDTGQGFLVLEDLGD
                     CTFFQWRHGHSIDAVNARLEEAVRLLAPVAQTQTADLPRFDTATLNREMDLFVDWYSA
                     QYHDTPFNAEQTARWQRLRDEISARLQTMPQGFVHRDYHSRNLMVQDDRLVAIDFQDA
                     VRGPRPYDLVSLLRDSYIDWPEELVSKLQAVFWQQCPPDLREIWPLEQMRNDFAWVAV
                     QRHLKVLGIFARLSIRDVKHGYLKDLPLTWKHLHKALAQLPELSGLAELIAPLGPKDQ
                     GRTG"
     misc_feature    complement(305669..306658)
                     /locus_tag="Hneap_0296"
                     /note="Predicted phosphotransferase related to Ser/Thr
                     protein kinases [General function prediction only];
                     Region: COG3178"
                     /db_xref="CDD:225719"
     misc_feature    complement(305900..306583)
                     /locus_tag="Hneap_0296"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     gene            306894..307613
                     /locus_tag="Hneap_0297"
                     /db_xref="GeneID:8533412"
     CDS             306894..307613
                     /locus_tag="Hneap_0297"
                     /EC_number="3.1.2.6"
                     /inference="protein motif:PRIAM:3.1.2.6"
                     /note="PFAM: beta-lactamase;
                     KEGG: cyh:Cyan8802_1589 hydroxyacylglutathione hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyacylglutathione hydrolase"
                     /protein_id="YP_003262207.1"
                     /db_xref="GI:261854924"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="GeneID:8533412"
                     /translation="MAIFKQLFDEATSTFTYLIADEHTRSALLIDPVHEQYERDRALL
                     DELGLSLKYVLETHVHADHITGGGRLRHETDALFIVGKGTGLDCADRLVADGETIEMD
                     SITIQVIATPGHTDGCTSYRWEDRLFTGDTILIDACGRTDFQQGSPERLYQSIQKLLA
                     FADETLIYPAHDYNGKRVSSVGQEKTINPYIAGLNEAAFVAKMRALNLPKPKRIDVAV
                     PANSLCGGADVPRQPGETEAA"
     misc_feature    306900..307583
                     /locus_tag="Hneap_0297"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; cl00446"
                     /db_xref="CDD:260426"
     gene            307610..308758
                     /locus_tag="Hneap_0298"
                     /db_xref="GeneID:8533413"
     CDS             307610..308758
                     /locus_tag="Hneap_0298"
                     /inference="protein motif:PFAM:PF07992"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     KEGG: tcx:Tcr_1381 sulfide-quinone reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_003262208.1"
                     /db_xref="GI:261854925"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:8533413"
                     /translation="MNSVANITVIGAGFGAVTAIKTLRKSNPSARITLIAPEPTMQYY
                     PSLIWVPAELRSRDDIMVDLKPLLARLDVIYQPGRVVGVEGSGRRVLVEQGGETIGVD
                     NDGLIVASGGRFIKKLPGIEHAITVCEGIDAAERIRDRLAAMTGGTIAIGFGGNPNEP
                     SAVRGGPMFEMLFGIDRLLRKQGRRDQFKIVFFNPSNRPGNRLGESAVDNLLARMKKF
                     NIEARLGAKMLRFEADKVVTEAGEFAADLILFMPGMTGPTWLEHAPFPKSPGGMIQAE
                     ATTRVVGFEKVYVVGDSGSYPAPDWAPKQAHMADLMAVAAAHNLLAEQAGKPANQTFK
                     WELICVMDMLDRAVLVFRNEKRQFITPPCRLLHYAKRLFEWWYLRSIR"
     misc_feature    307625..308485
                     /locus_tag="Hneap_0298"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox_2; pfam07992"
                     /db_xref="CDD:254568"
     gene            complement(308958..310787)
                     /locus_tag="Hneap_0299"
                     /db_xref="GeneID:8533414"
     CDS             complement(308958..310787)
                     /locus_tag="Hneap_0299"
                     /inference="protein motif:TFAM:TIGR01389"
                     /note="KEGG: afr:AFE_2194 ATP-dependent DNA helicase RecQ;
                     TIGRFAM: ATP-dependent DNA helicase RecQ; ATP-dependent
                     DNA helicase, RecQ family;
                     PFAM: RQC domain; DEAD/DEAH box helicase; helicase domain
                     protein; HRDC domain protein;
                     SMART: DEAD-like helicase ; helicase domain protein; HRDC
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="YP_003262209.1"
                     /db_xref="GI:261854926"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR006293"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="InterPro:IPR018329"
                     /db_xref="InterPro:IPR018982"
                     /db_xref="GeneID:8533414"
                     /translation="MNPNVISSPLHILNTVFGYPAFRGPQAEVIDTVMSGRDALVLMP
                     TGGGKSLCYQVPALALSGTAIVVSPLIALMQDQVAALRQAGVAAAFLNSTQTGEEAQL
                     VRKQLRAGTLDLLYVAPERLLNADTLSLLRDASINLIAIDEAHCVSQWGHDFRPEYIR
                     LGELGQYFPDIPRIALTATADGTTQQEILYRLGLNNARVFISSFDRPNIRYHIAQNHA
                     GSARDALLRFIRDNHANEAGIVYCLSRKRVEEIAAWLSDQGLTALAYHAGLPATQREQ
                     TLRRFLDEDGVIVVATIAFGMGIDKPDVRFVAHLNLPKSIEAYYQETGRAGRDGLPAE
                     AWMRYGLQDVITLRQMMSESNADEAIKRIEQHKLDAMLGLSESTACRRQTLLGYFGEQ
                     STEPCGNCDNCLTPPQMWDATLPARQALSTVHRTGQRFGVNYLIDVLRGKTDERITQL
                     GHDKLSVFGVGHAHTIDIWRGIFRQLIAQGYLSVDTEGFGGLALCERCRPLLRGEESL
                     WLRQITKPVKISRKTRDRPDFVSDEESELWEALRACRKRLATERGVPPYTIFHDASLL
                     DMLHARPTTLDAFTDISGVGAHKRDTYGAAFLSVIAPFVRRTR"
     misc_feature    complement(308985..310754)
                     /locus_tag="Hneap_0299"
                     /note="ATP-dependent DNA helicase RecQ; Region: recQ;
                     TIGR01389"
                     /db_xref="CDD:130456"
     misc_feature    complement(310251..310679)
                     /locus_tag="Hneap_0299"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(310638..310652)
                     /locus_tag="Hneap_0299"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(310353..310364)
                     /locus_tag="Hneap_0299"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(309777..310166)
                     /locus_tag="Hneap_0299"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(309906..309914,309987..309992,
                     310050..310061))
                     /locus_tag="Hneap_0299"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(309804..309806,309813..309815,
                     309825..309827,309888..309890))
                     /locus_tag="Hneap_0299"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    complement(309282..309557)
                     /locus_tag="Hneap_0299"
                     /note="This DNA-binding domain is found in the RecQ
                     helicase among others and has a helix-turn-helix
                     structure; Region: RQC; smart00956"
                     /db_xref="CDD:214936"
     misc_feature    complement(308985..309188)
                     /locus_tag="Hneap_0299"
                     /note="HRDC domain; Region: HRDC; pfam00570"
                     /db_xref="CDD:249966"
     gene            310900..311427
                     /locus_tag="Hneap_0300"
                     /db_xref="GeneID:8533415"
     CDS             310900..311427
                     /locus_tag="Hneap_0300"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hha:Hhal_2006 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262210.1"
                     /db_xref="GI:261854927"
                     /db_xref="GeneID:8533415"
                     /translation="MAWLSYLQLVIFRVGPEDMPAGWHATTWAFIWFLVTGSMMVFAD
                     RAAGESLQAALGQSFFDNVLNAVLVAGYAWGWLVIRKHPERLAQLLTALYAALGVLSL
                     VLAALWWLMPITPGKAPTNGWWIIVLFVWDVLVVGQIFRRALDWGAALGALISLGYFI
                     LAGVGVVWAHALVFG"
     gene            311494..312861
                     /locus_tag="Hneap_0301"
                     /db_xref="GeneID:8533416"
     CDS             311494..312861
                     /locus_tag="Hneap_0301"
                     /inference="protein motif:TFAM:TIGR01081"
                     /note="TIGRFAM: UDP-N-acetylmuramate;
                     PFAM: Mur ligase middle domain protein; cytoplasmic
                     peptidoglycan synthetase domain protein;
                     KEGG: tgr:Tgr7_2447
                     UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-
                     diaminopimelate ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="YP_003262211.1"
                     /db_xref="GI:261854928"
                     /db_xref="InterPro:IPR000713"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR005757"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="GeneID:8533416"
                     /translation="MKKIHILGIAGTFMGSLAQLAKAMGFEVSGRDLAIYPPMSDQLA
                     QAGIPVQTDMNAPLPQDAEIIVGNVMRRDMPVIDELLSGFFRYRSGPQWLGEEVLCDK
                     FVLGVAGTHGKTTTSSMLAWILEQAGMAPGFLIGGVPGNFGVSARLGETPFFVIEADE
                     YDTAFFDKRSKFLHYRPRGVILNNLEFDHADIFPDLAAIERQFAHFLRLVPNKGLVVM
                     ADATPALERVVEQGCWSPIERFGARDSAQPWRLVGEAIWLEGQHLGDMPANIIGRHNR
                     LNALAALALARFAGVPPEQGLNALAGFVGVARRLQNRGTVAGVTVFDDFAHHPTAIIE
                     TIAALREQQSASPHSGRLIAVVDPRSNTMRAGVHQHQLAEALAGADLVVFHSPANLGW
                     SPREALASLGTRIRFSPTVDAVLTDVLALAQPDDKILVMSNGSFDGVHQRLLDALAAR
                     TASIG"
     misc_feature    311500..>311643
                     /locus_tag="Hneap_0301"
                     /note="Mur ligase family, catalytic domain; Region:
                     Mur_ligase; pfam01225"
                     /db_xref="CDD:250458"
     misc_feature    311503..312837
                     /locus_tag="Hneap_0301"
                     /note="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase; Region: mpl; TIGR01081"
                     /db_xref="CDD:130153"
     misc_feature    311812..312315
                     /locus_tag="Hneap_0301"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     misc_feature    312409..312687
                     /locus_tag="Hneap_0301"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:251584"
     gene            312896..313486
                     /locus_tag="Hneap_0302"
                     /db_xref="GeneID:8533417"
     CDS             312896..313486
                     /locus_tag="Hneap_0302"
                     /inference="protein motif:PFAM:PF02190"
                     /note="PFAM: peptidase S16;
                     SMART: peptidase S16 lon domain protein;
                     KEGG: tgr:Tgr7_2427 peptidase S16, lon domain-containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S16"
                     /protein_id="YP_003262212.1"
                     /db_xref="GI:261854929"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="GeneID:8533417"
                     /translation="MKDVTLLPLFPLHTVLFPGGHLPLRIFETRYIDMVRTCLREGRP
                     FGVVLLKQGSEVRQSDDDLSEFYDVGAGAVIVDTDLGTDGMLHIETQGQGRFRVLRSW
                     SERDGLFRAEVEWLPEATIVTRSNADERLRDFLLRIMEDAAPPYPNALFDDPVWVVYR
                     LLERLPVKLEDRQRVLGAERLDLTVRHLSAMIAAFE"
     misc_feature    312914..313438
                     /locus_tag="Hneap_0302"
                     /note="ATP-dependent protease La (LON) domain; Region:
                     LON; cl19481"
                     /db_xref="CDD:267834"
     gene            313660..314040
                     /locus_tag="Hneap_0303"
                     /db_xref="GeneID:8533418"
     CDS             313660..314040
                     /locus_tag="Hneap_0303"
                     /inference="protein motif:TFAM:TIGR01068"
                     /note="TIGRFAM: thioredoxin;
                     PFAM: thioredoxin domain;
                     KEGG: tbd:Tbd_0223 thioredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="YP_003262213.1"
                     /db_xref="GI:261854930"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="GeneID:8533418"
                     /translation="MTIHEATFANIDNLIKENDILIIDFWAPWCGPCRSFAPVFEAAA
                     EANPSVAFAKANTEAEQQLGAYFQIRSIPTLMIFREQILLFNQAGALPASALDELIGK
                     VKELDMDVVRQEIEKAESESQQQQ"
     misc_feature    313684..313959
                     /locus_tag="Hneap_0303"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    order(313747..313749,313756..313758)
                     /locus_tag="Hneap_0303"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            314071..314985
                     /locus_tag="Hneap_0304"
                     /db_xref="GeneID:8533419"
     CDS             314071..314985
                     /locus_tag="Hneap_0304"
                     /inference="protein motif:PFAM:PF03547"
                     /note="PFAM: hypothetical protein;
                     KEGG: tgr:Tgr7_2425 auxin efflux carrier"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262214.1"
                     /db_xref="GI:261854931"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="GeneID:8533419"
                     /translation="MFSVIAQMAFTIGLGVLWRYYPVGGLTADRARIALTTSVYYFFL
                     PALVLDVLWRAPLGVDTFKIMLAAATGVLVSMAAMFLAARFMTLTRGQLGALVLAASF
                     PNATYMGLPLLSSLYGDAGKAIAIQYDLFACTPLLLSVGLLLAARLGQHDEVVHPIKS
                     LLLVPPLWAAIFGAVFNLIGLPQPDWAQGFLGRMGGAVVPIMLLALGMSLRLSTLTPR
                     HLWRVSPALLIQIILMPLVVLAVVTALHLTGDLRVAVVLEAATPVMILGLVLCDRFGL
                     DTEMYATTATASILLVLVTLPLWHYLLV"
     misc_feature    314071..314982
                     /locus_tag="Hneap_0304"
                     /note="Predicted permeases [General function prediction
                     only]; Region: COG0679"
                     /db_xref="CDD:223751"
     gene            315048..315608
                     /locus_tag="Hneap_0305"
                     /db_xref="GeneID:8533420"
     CDS             315048..315608
                     /locus_tag="Hneap_0305"
                     /inference="protein motif:PFAM:PF00254"
                     /note="PFAM: peptidylprolyl isomerase FKBP-type;
                     KEGG: mca:MCA0081 peptidyl-prolyl cis-trans isomerase,
                     FKBP-type"
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidylprolyl isomerase"
                     /protein_id="YP_003262215.1"
                     /db_xref="GI:261854932"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="GeneID:8533420"
                     /translation="MQIEKNVVARLNYVLKDDDGAIIDATQTRVFEYIHGFGNLIPAL
                     ENQLSGKKEGDRCQITIEPEDAYGLHDETAVIKVPRSRFDPAVELVEGNMVETLGPEG
                     RIEMLILSVDGDEVTVDLNHPLAGLRLHFDVEVGGLRMGHPDEIKHGRVHPGGHHLMV
                     GDSTYMGDWEGGPEVDSTKEQGETRG"
     misc_feature    315048..315518
                     /locus_tag="Hneap_0305"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
                     Region: FKBP_C; cl19519"
                     /db_xref="CDD:267872"
     misc_feature    315048..315518
                     /locus_tag="Hneap_0305"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerases 2
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: SlpA; COG1047"
                     /db_xref="CDD:223976"
     gene            315601..317409
                     /locus_tag="Hneap_0306"
                     /db_xref="GeneID:8533421"
     CDS             315601..317409
                     /locus_tag="Hneap_0306"
                     /inference="protein motif:PFAM:PF05299"
                     /note="PFAM: peptidase M61 domain protein;
                     KEGG: noc:Noc_1493 peptidase M61"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M61 domain-containing protein"
                     /protein_id="YP_003262216.1"
                     /db_xref="GI:261854933"
                     /db_xref="InterPro:IPR007963"
                     /db_xref="GeneID:8533421"
                     /translation="MVEAVANLPTVHYRLDFSRAHMRYIGVCLSLPSGNAASGAAAWQ
                     LSLPAWIPGSYLIRDFAKNLVGMKARTVTGQPVAITPLDQQTWQLPTCDQAIEVRFEV
                     YCADFSVRTAHVDPDHAFFNGSSVFLRVHGLEQQPHSVCLEGAPAHWRVATTLPEVAV
                     DDLGFGDYRADDYEALIDFPVEMGVFEVVRWVSAGVPHRMVFSHPHPKTDFARIAQDV
                     SRICSTEIDFFGEAPFSRYLFLVALDRQGFGGLEHRDSTALIFPRDDLPLMGETEVTP
                     AYQRFLSLCAHEYFHSWNVKRIRPDAFTQLPLARPAHTRLLWLFEGFTSYLDDWMVRR
                     AGLITESAYLDALAQTINRAVRGKGWSRQTLEESSFYAWTRFYQQDENAVNAIVSYYT
                     RGALVAMMLDLQLRLCGGSLAAVMREIWREFGAKPLPEGAAIERFIERVGELSLGDFF
                     EQALRGTEPLEFAALLARFGVNAEPVAESALSSVDAGAVIGGDDPRVAKVQVVFEDRP
                     AAQAGLVSGDEIIAVDGLATSGADWGNRICRYQAGDAVQLTGFRQGRLHQWTLVLSEP
                     VLNQWRLRLASELTAVEPEALLRRRDWLAASPSARS"
     misc_feature    315730..317406
                     /locus_tag="Hneap_0306"
                     /note="Predicted protease with the C-terminal PDZ domain
                     [General function prediction only]; Region: COG3975"
                     /db_xref="CDD:226483"
     misc_feature    <316156..316974
                     /locus_tag="Hneap_0306"
                     /note="Peptidase Gluzincin family (thermolysin-like
                     proteinases, TLPs) includes peptidases M1, M2, M3, M4,
                     M13, M32 and M36 (fungalysins); Region: GluZincin;
                     cl14813"
                     /db_xref="CDD:265459"
     misc_feature    316432..316794
                     /locus_tag="Hneap_0306"
                     /note="M61 glycyl aminopeptidase; Region: Peptidase_M61;
                     pfam05299"
                     /db_xref="CDD:114047"
     misc_feature    317095..317298
                     /locus_tag="Hneap_0306"
                     /note="PDZ domain, also called DHR (Dlg homologous region)
                     or GLGF (after a conserved sequence motif). Many PDZ
                     domains bind C-terminal polypeptides, though binding to
                     internal (non-C-terminal) polypeptides and even to lipids
                     has been demonstrated; Region: PDZ; cl00117"
                     /db_xref="CDD:260201"
     gene            317409..318233
                     /locus_tag="Hneap_0307"
                     /db_xref="GeneID:8533422"
     CDS             317409..318233
                     /locus_tag="Hneap_0307"
                     /inference="protein motif:TFAM:TIGR00121"
                     /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase;
                     PFAM: biotin/lipoate A/B protein ligase;
                     KEGG: vcj:VCD_001305 biotin-protein ligase/biotin operon
                     repressor"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin--acetyl-CoA-carboxylase ligase"
                     /protein_id="YP_003262217.1"
                     /db_xref="GI:261854934"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /db_xref="GeneID:8533422"
                     /translation="MVPFDFHALRLRLDERAFVEQAAAVVLPSVDSTSDYLRAHWPDQ
                     AEAGASWSICVAQTQTAGRGRHGHHWRSEPGSGLWFSCAVPVVPCTAEVVPPLSLVVA
                     SELIRVLNAVGFEIGLKWPNDLWCHDSKVGGLLVEQMGVGVARYWLIGIGINWLAPTH
                     LPQDKTGVVPSVTGLFEEGELSSIDREALAEQLIMVAIHAARHPESWSESMRRANHWN
                     ALLGRRVQLWHAGEAGETGLAGDIKLNGELGFVSDVGDFRSIGGSISVRLVQDEGC"
     misc_feature    317484..317870
                     /locus_tag="Hneap_0307"
                     /note="Biotin/lipoate A/B protein ligase family; Region:
                     BPL_LplA_LipB; pfam03099"
                     /db_xref="CDD:251729"
     misc_feature    317487..318209
                     /locus_tag="Hneap_0307"
                     /note="Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme
                     metabolism]; Region: BirA; COG0340"
                     /db_xref="CDD:223417"
     gene            318234..319001
                     /locus_tag="Hneap_0308"
                     /db_xref="GeneID:8533423"
     CDS             318234..319001
                     /locus_tag="Hneap_0308"
                     /inference="protein motif:TFAM:TIGR00671"
                     /note="TIGRFAM: transcriptional activator, Baf family;
                     PFAM: Bvg accessory factor;
                     KEGG: maq:Maqu_0703 Baf family transcriptional activator"
                     /codon_start=1
                     /transl_table=11
                     /product="Baf family transcriptional regulator"
                     /protein_id="YP_003262218.1"
                     /db_xref="GI:261854935"
                     /db_xref="InterPro:IPR000276"
                     /db_xref="InterPro:IPR004619"
                     /db_xref="GeneID:8533423"
                     /translation="MKCYIDAGNTRIKWQIGPKGKAKALAWSEKSQWLEQMSSSSGKK
                     QTISKFVVATVSSESLRQWLAETLAENFANVPVQWLKSRARCCGVKLAYPEVSQFGVD
                     RFCALVATRQRCPDQAVLVINAGTAITVDYIAPTGQHEGGIIMPSLAAMKAGLNALAP
                     NLSDRREPHESGVGAQTAWLATNTADALQLGRQWMLVSALSQTINAMRAHAAPCSLAV
                     VVGGGDAIAVQAMIDPAAHVVENLVLEGVKILARQRE"
     misc_feature    318234..318995
                     /locus_tag="Hneap_0308"
                     /note="Type III pantothenate kinase; Region: Pan_kinase;
                     cl17198"
                     /db_xref="CDD:266548"
     gene            319074..319149
                     /locus_tag="Hneap_R0003"
                     /note="tRNA-Thr1"
                     /db_xref="GeneID:8533424"
     tRNA            319074..319149
                     /locus_tag="Hneap_R0003"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:8533424"
     gene            319250..319334
                     /locus_tag="Hneap_R0004"
                     /note="tRNA-Tyr1"
                     /db_xref="GeneID:8533425"
     tRNA            319250..319334
                     /locus_tag="Hneap_R0004"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:8533425"
     gene            319388..319461
                     /locus_tag="Hneap_R0005"
                     /note="tRNA-Gly1"
                     /db_xref="GeneID:8533426"
     tRNA            319388..319461
                     /locus_tag="Hneap_R0005"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:8533426"
     gene            319485..319560
                     /locus_tag="Hneap_R0006"
                     /note="tRNA-Thr2"
                     /db_xref="GeneID:8533427"
     tRNA            319485..319560
                     /locus_tag="Hneap_R0006"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:8533427"
     gene            319633..320823
                     /locus_tag="Hneap_0309"
                     /db_xref="GeneID:8533428"
     CDS             319633..320823
                     /locus_tag="Hneap_0309"
                     /inference="protein motif:TFAM:TIGR00485"
                     /note="TIGRFAM: translation elongation factor Tu; small
                     GTP-binding protein;
                     PFAM: protein synthesis factor GTP-binding; elongation
                     factor Tu domain protein; elongation factor Tu domain 2
                     protein;
                     KEGG: tgr:Tgr7_2338 elongation factor Tu"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor Tu"
                     /protein_id="YP_003262219.1"
                     /db_xref="GI:261854936"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="GeneID:8533428"
                     /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITKVMAEAHGGAS
                     LGYDQIDKAPEEKARGITINTSHVEYESDARHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDPELLELVEMEIRDLLSK
                     YEFPGDDTPIVTGSALKALEGDTSDIGVPSVIKLVKAMDDYFPEPERAVDGTFLMPVE
                     DVFSISGRGTVVTGRIERGIVKVGEEVEIVGIRDTTKTTVTGVEMFRKLLDQGMAGDN
                     VGILLRGTKRDDVERGQVLCKPGSIKPHTKFEAEVYILGKDEGGRHTPFFNGYRPQFY
                     FRTTDVTGSCVLPEGTEMVMPGDNVAMTVSLIAPIAMEDGLRFAIREGGRTVGAGVVS
                     KIIE"
     misc_feature    319633..320820
                     /locus_tag="Hneap_0309"
                     /note="elongation factor Tu; Reviewed; Region: PRK00049"
                     /db_xref="CDD:234596"
     misc_feature    319663..320247
                     /locus_tag="Hneap_0309"
                     /note="Elongation Factor Tu (EF-Tu) GTP-binding proteins;
                     Region: EF_Tu; cd01884"
                     /db_xref="CDD:206671"
     misc_feature    319687..319710
                     /locus_tag="Hneap_0309"
                     /note="G1 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    order(319690..319692,319696..319698,319708..319713,
                     319720..319722,319729..319734,319744..319746,
                     319828..319833,319885..319890,319957..319962,
                     319966..319977,319984..319986,320077..320079,
                     320089..320091,320167..320172)
                     /locus_tag="Hneap_0309"
                     /note="GEF interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    order(319696..319713,319771..319773,320038..320043,
                     320047..320049,320152..320160)
                     /locus_tag="Hneap_0309"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    319798..319830
                     /locus_tag="Hneap_0309"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206671"
     misc_feature    319816..319818
                     /locus_tag="Hneap_0309"
                     /note="G2 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    319873..319884
                     /locus_tag="Hneap_0309"
                     /note="G3 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    319879..319935
                     /locus_tag="Hneap_0309"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206671"
     misc_feature    320038..320049
                     /locus_tag="Hneap_0309"
                     /note="G4 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    320152..320160
                     /locus_tag="Hneap_0309"
                     /note="G5 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    320269..320529
                     /locus_tag="Hneap_0309"
                     /note="EFTU_II: Elongation factor Tu domain II. Elongation
                     factors Tu (EF-Tu) are three-domain GTPases with an
                     essential function in the elongation phase of mRNA
                     translation. The GTPase center of EF-Tu is in the
                     N-terminal domain (domain I), also known as the...;
                     Region: EFTU_II; cd03697"
                     /db_xref="CDD:239668"
     misc_feature    320536..320805
                     /locus_tag="Hneap_0309"
                     /note="Domain III of elongation factor (EF) Tu. Ef-Tu
                     consists of three structural domains, designated I, II and
                     III. Domain III adopts a beta barrel structure. Domain III
                     is involved in binding to both charged tRNA and binding to
                     elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707"
                     /db_xref="CDD:239678"
     misc_feature    order(320572..320574,320578..320586,320638..320640,
                     320758..320766,320794..320796)
                     /locus_tag="Hneap_0309"
                     /note="Antibiotic Binding Site [chemical binding]; other
                     site"
                     /db_xref="CDD:239678"
     gene            320906..320981
                     /locus_tag="Hneap_R0007"
                     /note="tRNA-Trp1"
                     /db_xref="GeneID:8533429"
     tRNA            320906..320981
                     /locus_tag="Hneap_R0007"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:8533429"
     gene            321067..321441
                     /locus_tag="Hneap_0310"
                     /db_xref="GeneID:8533430"
     CDS             321067..321441
                     /locus_tag="Hneap_0310"
                     /inference="protein motif:TFAM:TIGR00964"
                     /note="TIGRFAM: preprotein translocase, SecE subunit;
                     PFAM: protein secE/sec61-gamma protein;
                     KEGG: aeh:Mlg_0445 preprotein translocase subunit SecE"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="YP_003262220.1"
                     /db_xref="GI:261854937"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR005807"
                     /db_xref="GeneID:8533430"
                     /translation="MSEKAVEPARSSGLESAKIGLAIVLLLGGVAAFYWLSKEPLFVR
                     VASLLVPLLLAAAVLYATAVGRSIWRFAFDSRVEVRKMVWPTRQETTQTTLVVVLLIV
                     VISLFLWGVDSLLAWIVRSIAG"
     misc_feature    321163..321438
                     /locus_tag="Hneap_0310"
                     /note="preprotein translocase subunit SecE; Reviewed;
                     Region: secE; PRK05740"
                     /db_xref="CDD:235587"
     gene            321454..321987
                     /locus_tag="Hneap_0311"
                     /db_xref="GeneID:8533431"
     CDS             321454..321987
                     /locus_tag="Hneap_0311"
                     /inference="protein motif:TFAM:TIGR00922"
                     /note="KEGG: tgr:Tgr7_2336 NusG antitermination factor;
                     TIGRFAM: transcription termination/antitermination factor
                     NusG;
                     PFAM: NGN domain protein; KOW domain protein;
                     SMART: NGN domain protein; KOW domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NusG antitermination factor"
                     /protein_id="YP_003262221.1"
                     /db_xref="GI:261854938"
                     /db_xref="InterPro:IPR001062"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR006645"
                     /db_xref="InterPro:IPR015869"
                     /db_xref="GeneID:8533431"
                     /translation="MAMRWYVVQAFSQFENSVKKALEERIEREGLQSLFGEILVPSEE
                     VVEMRDGVKRRSERKFYPGYVLVQIDMTDEAWHLVNSVPRVLGFVGDSGGKPTPISSK
                     EAEAIMTRVKDSTDKPKPKTLFDVGEMVRVCDGPFNDFTGVVEEVNYEKSRLHVAVSI
                     FGRSTPVELGFDQVAKT"
     misc_feature    321454..321981
                     /locus_tag="Hneap_0311"
                     /note="transcription antitermination protein NusG;
                     Validated; Region: nusG; PRK05609"
                     /db_xref="CDD:180161"
     misc_feature    321463..321786
                     /locus_tag="Hneap_0311"
                     /note="Bacterial N-Utilization Substance G (NusG)
                     N-terminal (NGN) domain, subgroup 1; Region: NGN_Bact_1;
                     cd09891"
                     /db_xref="CDD:193580"
     misc_feature    order(321472..321474,321574..321576,321634..321636,
                     321643..321645,321649..321651,321748..321750,
                     321772..321774)
                     /locus_tag="Hneap_0311"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193580"
     misc_feature    321814..321981
                     /locus_tag="Hneap_0311"
                     /note="NusG contains an NGN domain at its N-terminus and
                     KOW motif at its C-terminus; Region: KOW_NusG; cd06091"
                     /db_xref="CDD:240515"
     misc_feature    order(321850..321864,321871..321873,321907..321909,
                     321934..321942,321946..321957,321967..321972)
                     /locus_tag="Hneap_0311"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     misc_feature    321850..321861
                     /locus_tag="Hneap_0311"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     gene            322062..322493
                     /locus_tag="Hneap_0312"
                     /db_xref="GeneID:8533432"
     CDS             322062..322493
                     /locus_tag="Hneap_0312"
                     /inference="protein motif:TFAM:TIGR01632"
                     /note="KEGG: aci:ACIAD0302 50S ribosomal protein L11;
                     TIGRFAM: ribosomal protein L11;
                     PFAM: ribosomal protein L11;
                     SMART: ribosomal protein L11"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="YP_003262222.1"
                     /db_xref="GI:261854939"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /db_xref="InterPro:IPR020441"
                     /db_xref="GeneID:8533432"
                     /translation="MAKKVTGYIKLQVKAGQANPSPPIGPALGQKGVNIMAFCKEFNA
                     ATQTLEQGSPIPVVITVYADKSFTFIMKTPPVSFLLKKTAGIKAGSAVPNKTKVGTLT
                     RQQIEDIAKIKQPDLTAKDMEAMVRTIAGSARSMGLNVEGL"
     misc_feature    322062..322487
                     /locus_tag="Hneap_0312"
                     /note="50S ribosomal protein L11; Validated; Region: rplK;
                     PRK00140"
                     /db_xref="CDD:234661"
     misc_feature    322086..322481
                     /locus_tag="Hneap_0312"
                     /note="Ribosomal protein L11. Ribosomal protein L11,
                     together with proteins L10 and L7/L12, and 23S rRNA, form
                     the L7/L12 stalk on the surface of the large subunit of
                     the ribosome. The homologous eukaryotic cytoplasmic
                     protein is also called 60S ribosomal...; Region:
                     Ribosomal_L11; cd00349"
                     /db_xref="CDD:100101"
     misc_feature    order(322089..322091,322149..322151,322284..322292,
                     322302..322304,322323..322325,322398..322400,
                     322413..322421,322431..322433,322440..322445,
                     322452..322457,322461..322469)
                     /locus_tag="Hneap_0312"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100101"
     misc_feature    order(322089..322091,322233..322235,322239..322250,
                     322260..322262,322266..322271,322401..322406,
                     322413..322418)
                     /locus_tag="Hneap_0312"
                     /note="L7/L12 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(322137..322139,322149..322151)
                     /locus_tag="Hneap_0312"
                     /note="putative thiostrepton binding site; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(322341..322343,322350..322352)
                     /locus_tag="Hneap_0312"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     gene            322493..323188
                     /locus_tag="Hneap_0313"
                     /db_xref="GeneID:8533433"
     CDS             322493..323188
                     /locus_tag="Hneap_0313"
                     /inference="protein motif:TFAM:TIGR01169"
                     /note="TIGRFAM: ribosomal protein L1;
                     PFAM: ribosomal protein L1;
                     KEGG: tgr:Tgr7_2334 50S ribosomal protein L1"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="YP_003262223.1"
                     /db_xref="GI:261854940"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR005878"
                     /db_xref="GeneID:8533433"
                     /translation="MAKLTKRQKAIAAKVNANQPYAAADAFNLLKEVSTVKFVEAVDV
                     SVHLGVDPRRSDQMVRGATVLPNGTGKSVRVAVFAQGANAEAAKAAGADIVGFEDLAA
                     EIKQGRMDFDVVIATPDAMRVVGQLGQVLGPRGLMPNPKVGTVAVDAAMAVKNAKAGQ
                     VRYRTEKGGIIHCTIGKVNFTPEALTENLNALLADLNKAKPAASKGIYMKRVSVSSTM
                     GPGLLVDLASLAV"
     misc_feature    322559..323158
                     /locus_tag="Hneap_0313"
                     /note="Ribosomal protein L1.  The L1 protein, located near
                     the E-site of the ribosome, forms part of the L1 stalk
                     along with 23S rRNA.  In bacteria and archaea, L1
                     functions both as a ribosomal protein that binds rRNA, and
                     as a translation repressor that binds...; Region:
                     Ribosomal_L1; cd00403"
                     /db_xref="CDD:238235"
     misc_feature    order(322598..322606,322613..322615,322619..322621,
                     322625..322627,322631..322633,322994..322996,
                     323000..323002,323006..323008,323144..323149,
                     323153..323155)
                     /locus_tag="Hneap_0313"
                     /note="mRNA/rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238235"
     gene            323424..323951
                     /locus_tag="Hneap_0314"
                     /db_xref="GeneID:8533434"
     CDS             323424..323951
                     /locus_tag="Hneap_0314"
                     /inference="protein motif:PFAM:PF00466"
                     /note="PFAM: ribosomal protein L10;
                     KEGG: tgr:Tgr7_2333 50S ribosomal protein L10"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="YP_003262224.1"
                     /db_xref="GI:261854941"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR002363"
                     /db_xref="GeneID:8533434"
                     /translation="MALTIDQKQLIVAEVTEVAGKALSAIGAEYSGLTVSQMTQMRVK
                     ARESGVYLRVIKNTLARRAMADTPFSCMSEALTGPLVLAFSMEDPGAAARLMKDYAKD
                     FAKLEIKVVALGGQLLSVADVDRVASLPTRDEALSQLLAVMKAPIGKLARTLNEVPGK
                     LVRTVAAVRDQKQAA"
     misc_feature    323433..323903
                     /locus_tag="Hneap_0314"
                     /note="Ribosomal protein L10 family, L10 subfamily;
                     composed of bacterial 50S ribosomal protein and eukaryotic
                     mitochondrial 39S ribosomal protein, L10. L10 occupies the
                     L7/L12 stalk of the ribosome. The N-terminal domain (NTD)
                     of L10 interacts with L11 protein...; Region:
                     Ribosomal_L10; cd05797"
                     /db_xref="CDD:240223"
     misc_feature    order(323445..323450,323457..323459,323589..323600,
                     323607..323609)
                     /locus_tag="Hneap_0314"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240223"
     misc_feature    order(323691..323693,323760..323762,323769..323771,
                     323817..323819,323826..323831,323838..323843,
                     323847..323864,323868..323876,323883..323888,
                     323892..323897,323901..323903)
                     /locus_tag="Hneap_0314"
                     /note="Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240223"
     gene            323983..324360
                     /locus_tag="Hneap_0315"
                     /db_xref="GeneID:8533435"
     CDS             323983..324360
                     /locus_tag="Hneap_0315"
                     /inference="protein motif:TFAM:TIGR00855"
                     /note="TIGRFAM: ribosomal protein L7/L12;
                     PFAM: ribosomal protein L7/L12;
                     KEGG: mca:MCA1065 50S ribosomal protein L7/L12"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="YP_003262225.1"
                     /db_xref="GI:261854942"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="GeneID:8533435"
                     /translation="MAISKDDILEAISNMSVMEVVDLISAMEEKFGVSAAAAVAVAGP
                     AAAGPAAAVEEKTEFDVVLKSFGANKVGVIKAVRELTGLGLKEAKDMVEGAPATIKEG
                     ASAADAEAMKAKLTEAGAEVEVK"
     misc_feature    323989..324354
                     /locus_tag="Hneap_0315"
                     /note="Ribosomal protein L7/L12. Ribosomal protein L7/L12
                     refers to the large ribosomal subunit proteins L7 and L12,
                     which are identical except that L7 is acetylated at the N
                     terminus. It is a component of the L7/L12 stalk, which is
                     located at the surface of...; Region: Ribosomal_L7_L12;
                     cd00387"
                     /db_xref="CDD:100102"
     misc_feature    order(323989..323991,324028..324036,324043..324048,
                     324055..324057,324064..324066,324109..324111,
                     324115..324123,324151..324156,324217..324219,
                     324223..324228,324232..324234,324238..324243,
                     324283..324288,324292..324294,324301..324303)
                     /locus_tag="Hneap_0315"
                     /note="core dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100102"
     misc_feature    order(323998..324000,324007..324009,324019..324021,
                     324058..324060,324073..324075)
                     /locus_tag="Hneap_0315"
                     /note="peripheral dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100102"
     misc_feature    order(324040..324042,324049..324054,324064..324066,
                     324073..324075)
                     /locus_tag="Hneap_0315"
                     /note="L10 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(324190..324195,324202..324207,324214..324216,
                     324235..324240,324247..324249)
                     /locus_tag="Hneap_0315"
                     /note="L11 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(324193..324195,324205..324207,324214..324216,
                     324235..324240,324247..324249)
                     /locus_tag="Hneap_0315"
                     /note="putative EF-Tu interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(324193..324195,324202..324207,324214..324216)
                     /locus_tag="Hneap_0315"
                     /note="putative EF-G interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     gene            324553..328719
                     /locus_tag="Hneap_0316"
                     /db_xref="GeneID:8533436"
     CDS             324553..328719
                     /locus_tag="Hneap_0316"
                     /EC_number="2.7.7.6"
                     /inference="protein motif:TFAM:TIGR02013"
                     /note="KEGG: aeh:Mlg_0451 DNA-directed RNA polymerase
                     subunit beta;
                     TIGRFAM: DNA-directed RNA polymerase subunit beta;
                     PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
                     domain 7; RNA polymerase Rpb2 domain 3; RNA polymerase
                     subunit beta; DNA-directed RNA polymerase subunit beta,
                     external 1 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="YP_003262226.1"
                     /db_xref="GI:261854943"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR010243"
                     /db_xref="InterPro:IPR019462"
                     /db_xref="GeneID:8533436"
                     /translation="MSYSFTEKKRIRKEFGHRADILPVPYLLATQVESYKSFLQSGVP
                     AKGRTNAGLHAALSSVFPIRSHSGNAEIAYVDYYFGEPAFDVRECQIRGLSYGAPLRV
                     KMRLVIYDRDAPAGSKVVKDIREQDVYLGEIPLMTESGTFVINGTERVIVSQLHRSPG
                     VFFDHDKGKTSSSKKILFSARIIPYRGSWLDFEFDQKDILYARIDRRRKIPASIILRA
                     LGYTNQNMLDIFFDHDEFHIDKDGGLALTLVADRLKGTDAAFDIDINGENLIKTGKRI
                     TARHVRELVAAKVTSLPVPVDFVVGRVLASDVIDTSTGEVLAQGNEELTTELVAKLAK
                     AGITQFKTLYFNDVDRGPFMSLTLRADPSTTPLEAMVEIYKMMRPGEPPTKDSAEALF
                     HGLFFTEDRYDLSEVGRMKFNRRIEREGDVGPGVLYDGKYFTTRAAQGDEAAKQLLKE
                     QGGVSDILDVMKELIDIRNGNGKTDDIDHLGNRRIRSVGEMTENVFRIGLVRVERAVK
                     ERLTQAESEGLTPQDLINAKPVAAAIKEFFGSSQLSQFMDQNNPLSEITHKRRISALG
                     PGGLTRERAGFEVRDVHTTHYGRVCPIETPEGPNIGLINSLATYARTNGYGFLETPYR
                     TVKDGVVSKEVDWLSAYEEEKFTIAQANAPLDDNGVLQGNLISVRRAGEFMLASPEEI
                     QYMDVSPKQIVSIAASIIPFLEHDDANRALMGSNMQRQAVPTLRADKPLVGTGMERVV
                     ATDSGSCVVARRGGVVDRVDAARVVVRVNAEEASQGDVGVDIYNLTKYTRSNQNTCIN
                     QTPLVKAGDVIAKGDVLADGPSVDMGELALGQNILCAFMPWNGYNFEDSILLSERVVR
                     EDRLTTIHVEELNCIARDTKLGAEEITADIPNVAESLLNKLDAAGVVHVGAEVRPGDI
                     LVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPPGMEGTVIDVRVFTRDGIE
                     KDSRARAIEEADLEAVRKDLKDRMRIIEGDILARVKSVLVNQVAVGGPGVKAGSKITA
                     AQLEKIEPSKWLEIRVEGEEAAQAMEEYIAQLAQAQVDIDKRFEDKKKKIQQGDDLAP
                     GVLKMVKVYVAVKRRIQPGDKLAGRHGNKGVVSMIVPEEDMPYMENGQPVDICLNPLG
                     VPSRMNIGQILETHLGFAARGLGVKIEEMLKLERAKALIELRAFLDKVYNYKSDKPVD
                     LDALSDDELIELARNLKKGVPMATPVFDGAVEDEIKYMLELAGLPTSGQVQLYDGRSG
                     EPFERTTTVGYMYMLKLNHLVDDKMHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVW
                     ALEAYGAAYTLQEMLTVKSDDVNGRNKMYKNIVDGDLKMDAGMPESFNVLLKEIRSLA
                     INVELEQGKE"
     misc_feature    324553..328716
                     /locus_tag="Hneap_0316"
                     /note="DNA-directed RNA polymerase subunit beta; Reviewed;
                     Region: rpoB; PRK00405"
                     /db_xref="CDD:234749"
     misc_feature    324631..328704
                     /locus_tag="Hneap_0316"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cd00653"
                     /db_xref="CDD:238353"
     misc_feature    order(324826..324828,327133..327135,327244..327246,
                     327250..327252,327262..327270,327274..327276)
                     /locus_tag="Hneap_0316"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(326284..326286,326290..326298,326302..326304,
                     326311..326313,326326..326328,326608..326610,
                     326662..326670,326674..326676,327058..327069,
                     327076..327078,327082..327090,327901..327903,
                     327907..327909,327913..327915,327979..327981,
                     327985..327987,327994..327996,328003..328005,
                     328018..328020,328030..328032,328243..328245,
                     328324..328326,328348..328356,328360..328362,
                     328399..328401,328408..328416,328420..328425,
                     328486..328494,328504..328506,328510..328515,
                     328519..328521,328525..328542,328546..328563,
                     328573..328575,328642..328644,328654..328656,
                     328660..328662,328666..328671,328675..328677,
                     328681..328692,328696..328698,328702..328704)
                     /locus_tag="Hneap_0316"
                     /note="RPB1 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    326419..326616
                     /locus_tag="Hneap_0316"
                     /note="RNA polymerase beta subunit external 1 domain;
                     Region: RNA_pol_Rpb2_45; pfam10385"
                     /db_xref="CDD:255954"
     misc_feature    order(326734..326739,327043..327045,327049..327051,
                     327112..327114,327121..327123,327928..327930,
                     327967..327969,328210..328215,328219..328221,
                     328312..328314,328363..328365)
                     /locus_tag="Hneap_0316"
                     /note="RPB10 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(327076..327078,327118..327120,327925..327927,
                     328330..328332)
                     /locus_tag="Hneap_0316"
                     /note="RPB11 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(327118..327123,327133..327135,327847..327849,
                     327853..327855,327928..327936,327943..327945,
                     327949..327954,328327..328350,328354..328356)
                     /locus_tag="Hneap_0316"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            328797..333002
                     /locus_tag="Hneap_0317"
                     /db_xref="GeneID:8533437"
     CDS             328797..333002
                     /locus_tag="Hneap_0317"
                     /inference="protein motif:TFAM:TIGR02386"
                     /note="KEGG: tgr:Tgr7_2330 DNA-directed RNA polymerase
                     subunit beta';
                     TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
                     PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
                     domain 5; RNA polymerase Rpb1 domain 3; RNA polymerase
                     subunit alpha; RNA polymerase Rpb1 domain 4;
                     SMART: RNA polymerase I subunit A domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="YP_003262227.1"
                     /db_xref="GI:261854944"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR012754"
                     /db_xref="GeneID:8533437"
                     /translation="MKELLNLMSREVTDDDFDGIRISLSSPEMIRSWSYGEVKKPETI
                     NYRTFKPERDGLFCAKIFGPVRDYECLCGKYKRLKHRGVVCEKCGVEVTLSKVRRERM
                     GHIELACPVAHIWYLKSLPSRIGLLLDMTLRDIERVLYFEAFVITDPGMTTLNKGDLL
                     TDEMYIDAIEQFGDEFEADMGAEAIQKLLKDIDLDQQILTLRDELASTGSETKIKRLS
                     KRLKLIEAFKESGNRPEWMVLTQLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLIEINAPDIILRNEKRMLQESVDSLLDNGRRGRAVTGTNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVIVVGPTLRLHQCGLPKKMALELFKPFIFGKLHRRGLAT
                     TIKAAKKLVEREGPEVWDVLEEVIREHPVLLNRAPTLHRLGIQAFEPILIEGKAIQLH
                     PLVCSAYNADFDGDQMAVHVPLSLEAQAEARALMMSTNNVLSPANGDPVIVPSQDIVL
                     GIYYMTRAKVNGRGEGMVFADLDEVQRAYDNHQVELGAQIKVRVNDWIRYDDGTAESV
                     RHILETTVGRALLYKALPEGVPFEQINKDMGKKAISALLNYVYRQLGLKDTVLFADQL
                     MYTGFRYATRSGISICSDDMLVPPSKPAELAKAEAEVGEIQNQYSQGLVTEKERYNKV
                     VDIWSRANDQISRAMMEQLGTEKVVDREGNTVKQSSFNAIFMMADSGARGSAAQIRQL
                     AGMRGLMTKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDIVITIDDCGTQSPGLKVTAVIEGGDVVQGLGARILGRTTSQDVLMPGSDE
                     VLVPSGTVINEVLVARLEESGVDEVWVRTPIGCESRHGICQKCYGRDLARGNLVNIGE
                     SVGVIAAQSIGEPGTQLTMRTFHIGGAASRSASASSVQNKAAGVVRLHNLKTVKNRDN
                     DLVAVTRSGELGMIDDQGRERERYKIPYGAVIRVKEGEKVAGGTTLATWDPHTHPVVS
                     EMQGQARFSDFVDGQSVKSDTDEITGLSSQVVIDPKHRNSAAKELRPAIALIDDAGEP
                     VCLAGTDIPAFYVLPAGAIIGIEDGAAVQVGDIIARIPQESSKTRDITGGLPRVADLF
                     EARKPKEPAILAEYTGTISFGKETKGKQRLVITDEHGEAHEELIPKYRVINVFEGEHV
                     ARGEVIADGELTPHDILRLRGIPDLAAYIIKEIQDVYRLQGVIISDKHIEVIVRQMLR
                     KVEISEPGDSGYLRGDQVDKARLLEENRMLEQAGKFAAKFDPMLLGITKASLVTESFI
                     SAASFQETTRVLTDSSTRGARDELRGLKENVIVGRLIPAGTGLAHHQERRRRRHLTMD
                     SANALFMDSDSSDARVDEGENVS"
     misc_feature    328827..332900
                     /locus_tag="Hneap_0317"
                     /note="DNA-directed RNA polymerase subunit beta';
                     Provisional; Region: PRK00566"
                     /db_xref="CDD:234794"
     misc_feature    328839..331235
                     /locus_tag="Hneap_0317"
                     /note="Largest subunit (beta') of bacterial DNA-dependent
                     RNA polymerase (RNAP), N-terminal domain; Region:
                     RNAP_beta'_N; cd01609"
                     /db_xref="CDD:259845"
     misc_feature    order(328839..328865,328869..328871,328881..328883,
                     328890..328901,328935..328937,328941..328943,
                     328992..328994,329025..329027,329082..329087,
                     329091..329102,329133..329135,329139..329141,
                     329511..329513,329523..329525,329529..329531,
                     329538..329543,329547..329549,329553..329555,
                     329562..329567,329715..329717,329775..329777,
                     329784..329789,329805..329867,329871..329873,
                     329907..329912,329919..329924,329931..329936,
                     329940..329945,329988..329990,330066..330068,
                     330078..330080,330087..330092,330096..330101,
                     330129..330134,330147..330149,330174..330182,
                     330189..330191,330201..330224,330231..330233,
                     330243..330248,330261..330263,330303..330311,
                     330318..330320,330330..330332,330345..330347,
                     330681..330686,330690..330725,330951..330953,
                     330969..330971,330987..330989,331002..331004,
                     331011..331016,331026..331028,331041..331046,
                     331065..331067,331083..331106,331110..331115,
                     331122..331127,331131..331139,331143..331151,
                     331155..331160,331188..331190,331197..331199)
                     /locus_tag="Hneap_0317"
                     /note="beta and beta' interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259845"
     misc_feature    order(328920..328928,328932..328934,328989..328991,
                     328995..328997,329025..329027,329031..329033,
                     329079..329081,329214..329219,329547..329552,
                     329559..329561,329571..329588,329595..329597,
                     329604..329606,329616..329621,329628..329630,
                     329634..329645,329655..329681,329685..329690,
                     329697..329699,329730..329732,329760..329762,
                     329769..329771,329796..329801,329985..329987,
                     329991..329996)
                     /locus_tag="Hneap_0317"
                     /note="beta' and sigma factor interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(329004..329006,329010..329012,329049..329051,
                     329058..329060)
                     /locus_tag="Hneap_0317"
                     /note="Zn-binding [ion binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(329157..329159,329727..329729,329796..329798,
                     329811..329813,329832..329834,329850..329852,
                     330069..330077,330174..330176,330180..330182,
                     330186..330188,331164..331169,331176..331181)
                     /locus_tag="Hneap_0317"
                     /note="active site region [active]"
                     /db_xref="CDD:259845"
     misc_feature    order(330174..330176,330180..330182,330186..330188)
                     /locus_tag="Hneap_0317"
                     /note="catalytic site [active]"
                     /db_xref="CDD:259845"
     misc_feature    331518..332885
                     /locus_tag="Hneap_0317"
                     /note="Largest subunit (beta') of Bacterial DNA-dependent
                     RNA polymerase (RNAP), C-terminal domain; Region:
                     RNAP_beta'_C; cd02655"
                     /db_xref="CDD:132721"
     misc_feature    order(331518..331520,331527..331532,331536..331538,
                     332877..332879)
                     /locus_tag="Hneap_0317"
                     /note="Rpb1 (beta') - Rpb6 (omega) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(331548..331550,331560..331562,332817..332819,
                     332835..332837,332853..332855,332862..332867,
                     332877..332879)
                     /locus_tag="Hneap_0317"
                     /note="Rpb1 (beta') - Rpb2 (beta) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(331593..331616,331830..331832)
                     /locus_tag="Hneap_0317"
                     /note="G-loop; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(332241..332243,332727..332729,332772..332777)
                     /locus_tag="Hneap_0317"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:132721"
     gene            333122..333499
                     /locus_tag="Hneap_0318"
                     /db_xref="GeneID:8533438"
     CDS             333122..333499
                     /locus_tag="Hneap_0318"
                     /inference="protein motif:TFAM:TIGR00981"
                     /note="TIGRFAM: ribosomal protein S12;
                     PFAM: ribosomal protein S12/S23;
                     KEGG: avn:Avin_06190 30S ribosomal protein S12"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="YP_003262228.1"
                     /db_xref="GI:261854945"
                     /db_xref="InterPro:IPR005679"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="GeneID:8533438"
                     /translation="MATVNQLVRKPRKRLVEKTKVPALEGCPQRRGVCTRVYTTTPKK
                     PNSALRKVARVRLTSGFEVTGYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHVVRGSL
                     DTQGVDKRRQGRSKYGAKRPKAK"
     misc_feature    333128..333451
                     /locus_tag="Hneap_0318"
                     /note="S12-like family, 30S ribosomal protein S12
                     subfamily; S12 is located at the interface of the large
                     and small ribosomal subunits of prokaryotes, chloroplasts
                     and mitochondria, where it plays an important role in both
                     tRNA and ribosomal subunit...; Region: Ribosomal_S12;
                     cd03368"
                     /db_xref="CDD:239466"
     misc_feature    order(333131..333136,333140..333145,333152..333157)
                     /locus_tag="Hneap_0318"
                     /note="S17 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239466"
     misc_feature    333131..333133
                     /locus_tag="Hneap_0318"
                     /note="S8 interaction site; other site"
                     /db_xref="CDD:239466"
     misc_feature    order(333155..333163,333197..333199,333203..333208,
                     333212..333214,333257..333262,333266..333274,
                     333293..333295,333317..333319,333326..333331,
                     333368..333373,333383..333388,333449..333451)
                     /locus_tag="Hneap_0318"
                     /note="16S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    order(333248..333253,333383..333385)
                     /locus_tag="Hneap_0318"
                     /note="streptomycin interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    333251..333256
                     /locus_tag="Hneap_0318"
                     /note="23S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    order(333254..333271,333329..333355)
                     /locus_tag="Hneap_0318"
                     /note="aminoacyl-tRNA interaction site (A-site)
                     [nucleotide binding]; other site"
                     /db_xref="CDD:239466"
     gene            333527..333997
                     /locus_tag="Hneap_0319"
                     /db_xref="GeneID:8533439"
     CDS             333527..333997
                     /locus_tag="Hneap_0319"
                     /inference="protein motif:TFAM:TIGR01029"
                     /note="TIGRFAM: ribosomal protein S7;
                     PFAM: ribosomal protein S7;
                     KEGG: aeh:Mlg_0454 30S ribosomal protein S7"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="YP_003262229.1"
                     /db_xref="GI:261854946"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005717"
                     /db_xref="GeneID:8533439"
                     /translation="MPRRREVPKREILPDPKYGNVTVAKFINMIMLSGKKSVAESILY
                     GAMTIAEAKGKGHPVELVERALENVAPAVEVKSRRVGGANYQVPVEVRAVRRSSLAMR
                     WLIDAARKRGEKTMAAKLAGELMDAAESRGSAVKKREDTHRMAEANKAFAHFRW"
     misc_feature    333527..333994
                     /locus_tag="Hneap_0319"
                     /note="30S ribosomal protein S7; Validated; Region:
                     PRK05302"
                     /db_xref="CDD:235398"
     gene            334015..336114
                     /locus_tag="Hneap_0320"
                     /db_xref="GeneID:8533440"
     CDS             334015..336114
                     /locus_tag="Hneap_0320"
                     /inference="protein motif:TFAM:TIGR00484"
                     /note="TIGRFAM: translation elongation factor G; small
                     GTP-binding protein;
                     PFAM: protein synthesis factor GTP-binding; elongation
                     factor G domain protein; elongation factor Tu domain 2
                     protein; elongation factor G domain IV;
                     KEGG: pay:PAU_00341 elongation factor g (ef-g)"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor G"
                     /protein_id="YP_003262230.1"
                     /db_xref="GI:261854947"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004540"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="GeneID:8533440"
                     /translation="MARTTPLERYRNFGIMAHIDAGKTTTTERILFYTGVSHKIGEVH
                     DGAATMDWMEQEQERGITITSAATTAFWGGMDKQFEPHRFNIIDTPGHVDFTIEVERS
                     LRVLDGAVFVLCAVGGVQPQSETVWRQANKYSVPRLAFVNKMDRSGADFYRVMEQLKK
                     RLGANPLPVVLPIGAEEGFEGVIDLLRMKAIYWNTEDMGLTYDEKEIPAELLEKAKTY
                     RSQMMEAAAEANEEVMEKYLETGDLTDDEIVSGLRQRTLNNEIIPALCGTAFKNKGVQ
                     KMLDAVIDYLPSPTQVPPIKGELPDGTPSVRKTGDNEPFSALAFKIMSDPFVGSLTFF
                     RVYSGVVNAGDGVLNSTKGNKERLGRILQMHANSREEIKEVRAGDIAAAVGLKNVITG
                     DTLCDLANPIILERMIFPEPVISVAVEPKTKGDQEKMGMALGRLAQEDPSFRVFTDEE
                     SGQTIIAGMGELHLEILVDRMRREFKVEANIGKPQVAYRETIRGTVEQDGKFVRQSGG
                     RGQYGHVKIRIEPLEVGGGYEFVNGIVGGVVPREYIPAVDKGIQEQIKNGVIAGYPVV
                     DVKVTLFDGSYHEVDSNEMAFKIAGSMAFKEGAVKANPVLLEPMMKVEVETPEDYMGD
                     VIGDLNRRRGMIQGMEDTVGGGKQVKAEVPLSEMFGYATDLRSATQGRATYSMEFARY
                     GEAPKNVADAVIKGKSA"
     misc_feature    334015..336111
                     /locus_tag="Hneap_0320"
                     /note="elongation factor G; Reviewed; Region: PRK00007"
                     /db_xref="CDD:234569"
     misc_feature    334048..334881
                     /locus_tag="Hneap_0320"
                     /note="Elongation factor G (EF-G) family involved in both
                     the elongation and ribosome recycling phases of protein
                     synthesis; Region: EF-G; cd01886"
                     /db_xref="CDD:206673"
     misc_feature    334063..334086
                     /locus_tag="Hneap_0320"
                     /note="G1 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    order(334066..334068,334072..334074,334084..334089,
                     334096..334098,334105..334110,334210..334215,
                     334288..334293,334360..334365,334471..334473,
                     334483..334485)
                     /locus_tag="Hneap_0320"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206673"
     misc_feature    order(334072..334074,334078..334089,334438..334443,
                     334447..334449,334816..334824)
                     /locus_tag="Hneap_0320"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206673"
     misc_feature    334153..334212
                     /locus_tag="Hneap_0320"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206673"
     misc_feature    334198..334200
                     /locus_tag="Hneap_0320"
                     /note="G2 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    334276..334287
                     /locus_tag="Hneap_0320"
                     /note="G3 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    334282..334338
                     /locus_tag="Hneap_0320"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206673"
     misc_feature    334438..334449
                     /locus_tag="Hneap_0320"
                     /note="G4 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    334816..334824
                     /locus_tag="Hneap_0320"
                     /note="G5 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    334957..335205
                     /locus_tag="Hneap_0320"
                     /note="EFG_mtEFG_II: this subfamily represents the domain
                     II of elongation factor G (EF-G) in bacteria and, the
                     C-terminus of mitochondrial Elongation factor G1 (mtEFG1)
                     and G2 (mtEFG2)_like proteins found in eukaryotes. During
                     the process of peptide synthesis...; Region: EFG_mtEFG_II;
                     cd04088"
                     /db_xref="CDD:239755"
     misc_feature    335239..335460
                     /locus_tag="Hneap_0320"
                     /note="Elongation Factor G, domain II; Region: EFG_II;
                     pfam14492"
                     /db_xref="CDD:258632"
     misc_feature    335476..335823
                     /locus_tag="Hneap_0320"
                     /note="EFG_mtEFG1_IV: domains similar to domain IV of the
                     bacterial translational elongation factor (EF) EF-G.
                     Included in this group is a domain of mitochondrial
                     Elongation factor G1 (mtEFG1) proteins homologous to
                     domain IV of EF-G. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG1_IV; cd01434"
                     /db_xref="CDD:238715"
     misc_feature    335836..336072
                     /locus_tag="Hneap_0320"
                     /note="EFG_mtEFG_C: domains similar to the C-terminal
                     domain of the bacterial translational elongation factor
                     (EF) EF-G.  Included in this group is the C-terminus of
                     mitochondrial Elongation factor G1 (mtEFG1) and G2
                     (mtEFG2) proteins. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG_C; cd03713"
                     /db_xref="CDD:239683"
     gene            336147..337337
                     /locus_tag="Hneap_0321"
                     /db_xref="GeneID:8533441"
     CDS             336147..337337
                     /locus_tag="Hneap_0321"
                     /inference="protein motif:TFAM:TIGR00485"
                     /note="TIGRFAM: translation elongation factor Tu; small
                     GTP-binding protein;
                     PFAM: protein synthesis factor GTP-binding; elongation
                     factor Tu domain protein; elongation factor Tu domain 2
                     protein;
                     KEGG: tgr:Tgr7_2338 elongation factor Tu"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor Tu"
                     /protein_id="YP_003262231.1"
                     /db_xref="GI:261854948"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="GeneID:8533441"
                     /translation="MSKEKFERNKPHVNVGTIGHVDHGKTTLTAAITKVMAEMHGGAS
                     LGYDQIDKAPEEKARGITINTSHVEYESDTRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADMVDDPELLELVEMEIRDLLSK
                     YEFPGDDTPIVTGSALKALEGDTSDIGVPSVIKLVKAMDDYFPEPERAVDGTFLMPVE
                     DVFSISGRGTVVTGRIERGIVKVGEEVEIVGIRDTTKTTVTGVEMFRKLLDQGMAGDN
                     VGILLRGTKRDDVERGQVLCKPGSIKPHTKFEAEVYILGKDEGGRHTPFFNGYRPQFY
                     FRTTDVTGSCVLPEGTEMVMPGDNVAMTVSLIAPIAMEDGLRFAIREGGRTVGAGVVS
                     KIIE"
     misc_feature    336147..337334
                     /locus_tag="Hneap_0321"
                     /note="elongation factor Tu; Reviewed; Region: PRK00049"
                     /db_xref="CDD:234596"
     misc_feature    336177..336761
                     /locus_tag="Hneap_0321"
                     /note="Elongation Factor Tu (EF-Tu) GTP-binding proteins;
                     Region: EF_Tu; cd01884"
                     /db_xref="CDD:206671"
     misc_feature    336201..336224
                     /locus_tag="Hneap_0321"
                     /note="G1 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    order(336204..336206,336210..336212,336222..336227,
                     336234..336236,336243..336248,336258..336260,
                     336342..336347,336399..336404,336471..336476,
                     336480..336491,336498..336500,336591..336593,
                     336603..336605,336681..336686)
                     /locus_tag="Hneap_0321"
                     /note="GEF interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    order(336210..336227,336285..336287,336552..336557,
                     336561..336563,336666..336674)
                     /locus_tag="Hneap_0321"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    336312..336344
                     /locus_tag="Hneap_0321"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206671"
     misc_feature    336330..336332
                     /locus_tag="Hneap_0321"
                     /note="G2 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    336387..336398
                     /locus_tag="Hneap_0321"
                     /note="G3 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    336393..336449
                     /locus_tag="Hneap_0321"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206671"
     misc_feature    336552..336563
                     /locus_tag="Hneap_0321"
                     /note="G4 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    336666..336674
                     /locus_tag="Hneap_0321"
                     /note="G5 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    336783..337043
                     /locus_tag="Hneap_0321"
                     /note="EFTU_II: Elongation factor Tu domain II. Elongation
                     factors Tu (EF-Tu) are three-domain GTPases with an
                     essential function in the elongation phase of mRNA
                     translation. The GTPase center of EF-Tu is in the
                     N-terminal domain (domain I), also known as the...;
                     Region: EFTU_II; cd03697"
                     /db_xref="CDD:239668"
     misc_feature    337050..337319
                     /locus_tag="Hneap_0321"
                     /note="Domain III of elongation factor (EF) Tu. Ef-Tu
                     consists of three structural domains, designated I, II and
                     III. Domain III adopts a beta barrel structure. Domain III
                     is involved in binding to both charged tRNA and binding to
                     elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707"
                     /db_xref="CDD:239678"
     misc_feature    order(337086..337088,337092..337100,337152..337154,
                     337272..337280,337308..337310)
                     /locus_tag="Hneap_0321"
                     /note="Antibiotic Binding Site [chemical binding]; other
                     site"
                     /db_xref="CDD:239678"
     gene            337343..337654
                     /locus_tag="Hneap_0322"
                     /db_xref="GeneID:8533442"
     CDS             337343..337654
                     /locus_tag="Hneap_0322"
                     /inference="protein motif:TFAM:TIGR01049"
                     /note="TIGRFAM: ribosomal protein S10;
                     PFAM: ribosomal protein S10;
                     KEGG: mca:MCA2373 ribosomal protein S10"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="YP_003262232.1"
                     /db_xref="GI:261854949"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR005731"
                     /db_xref="GeneID:8533442"
                     /translation="MASQTIRIRLKSFDHRLIDRSAAEIVDTARRSGARVKGPIPLPS
                     RKERFTVLVSPHVNKDARDQYELRTHKRVLDIIEPTDRTVDLLMQLDLAAGVDVQIRL
                     N"
     misc_feature    337343..337648
                     /locus_tag="Hneap_0322"
                     /note="30S ribosomal protein S10; Reviewed; Region: rpsJ;
                     PRK00596"
                     /db_xref="CDD:179076"
     gene            337802..338446
                     /locus_tag="Hneap_0323"
                     /db_xref="GeneID:8533443"
     CDS             337802..338446
                     /locus_tag="Hneap_0323"
                     /inference="protein motif:TFAM:TIGR03625"
                     /note="TIGRFAM: 50S ribosomal protein L3;
                     PFAM: ribosomal protein L3;
                     KEGG: tau:Tola_0099 ribosomal protein L3"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="YP_003262233.1"
                     /db_xref="GI:261854950"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="InterPro:IPR019927"
                     /db_xref="GeneID:8533443"
                     /translation="MSLGVVGRKVGMTRVFDDAGVSTPVTVIEVEPNRVTQLKTPEVD
                     GYTAVQVTTGTRRASRVTKAMAGHYAKAETASGRMSTEFRISADELAGFQPGAEITVS
                     IFDGVEKVDVAGQSKGKGFAGTVKRYNFRTQDATHGNSRSHRVPGSIGQNQTPGRVFP
                     GKKMSGHMGDERVSSLGLKVVRVDVERGLILVKGAVPGSTGGDVIVRPSVKIKG"
     misc_feature    337802..338443
                     /locus_tag="Hneap_0323"
                     /note="50S ribosomal protein L3; Validated; Region: rplC;
                     PRK00001"
                     /db_xref="CDD:234564"
     gene            338455..339063
                     /locus_tag="Hneap_0324"
                     /db_xref="GeneID:8533444"
     CDS             338455..339063
                     /locus_tag="Hneap_0324"
                     /inference="protein motif:PFAM:PF00573"
                     /note="PFAM: ribosomal protein L4/L1e;
                     KEGG: hha:Hhal_0857 ribosomal protein L4/L1e"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="YP_003262234.1"
                     /db_xref="GI:261854951"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="GeneID:8533444"
                     /translation="MELQVKDGAAISVSEQIFDRSYNEGLIHQAVVAFMAGARSGTKR
                     QLTRSEVSGGGKKPWNQKGSGRARAGTTRSPIWRTGGVTFAARPRNFEQKINRKAYRV
                     AMASIFSELVRQDRLIVVESLTVSSPKTREVLGLVKNLGIQGGRTLFVAEAFDEHFFL
                     GSRNVIELGYLTADMLDPVSLVGAERVVITRAAVKMVEEWLS"
     misc_feature    338455..339060
                     /locus_tag="Hneap_0324"
                     /note="50S ribosomal protein L4; Provisional; Region:
                     rplD; PRK05319"
                     /db_xref="CDD:235404"
     gene            339060..339353
                     /locus_tag="Hneap_0325"
                     /db_xref="GeneID:8533445"
     CDS             339060..339353
                     /locus_tag="Hneap_0325"
                     /inference="protein motif:PFAM:PF00276"
                     /note="PFAM: ribosomal protein L25/L23;
                     KEGG: smt:Smal_0758 50S ribosomal protein L23"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L25"
                     /protein_id="YP_003262235.1"
                     /db_xref="GI:261854952"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="GeneID:8533445"
                     /translation="MMREKLFDVLRSPLVTEKTARANQENQYAFRVATTATKAEIKAA
                     VEQLFSVNVMAVQTLNVAGKARRFRGVAGRRADWKKAYVTLAEGQAIDLGQAN"
     misc_feature    339078..339338
                     /locus_tag="Hneap_0325"
                     /note="50S ribosomal protein L23; Reviewed; Region: rplW;
                     PRK05738"
                     /db_xref="CDD:235586"
     gene            339383..340207
                     /locus_tag="Hneap_0326"
                     /db_xref="GeneID:8533446"
     CDS             339383..340207
                     /locus_tag="Hneap_0326"
                     /inference="protein motif:TFAM:TIGR01171"
                     /note="TIGRFAM: ribosomal protein L2;
                     PFAM: ribosomal protein L2;
                     KEGG: avn:Avin_06280 50S ribosomal protein L2"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="YP_003262236.1"
                     /db_xref="GI:261854953"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR005880"
                     /db_xref="GeneID:8533446"
                     /translation="MALKIAKPTSPGRRSVIEIDRSHLYKGAPYAPLLEKKSNTGGRN
                     NLGRITTRHIGGGHKQHYRLVDFKRVKDGIPATVERIEYDPNRTAHIALIMYADGERA
                     YILAPRGVVPGQVVLSGVEAPIRAGNCLPMRNIPIGSTIHAVELKPGKGAQIARSAGA
                     AVQLVAREGAYVTLRLRSGETRKVLAECRATLGEVSNHEHSLRSLGKAGATRWRGIRP
                     TVRGVVMNPVDHPHGGGEGRTSGGRHPVTPWGVPTKGYKTRTNKRTDKLIVRRRSK"
     misc_feature    339383..340204
                     /locus_tag="Hneap_0326"
                     /note="50S ribosomal protein L2; Validated; Region: rplB;
                     PRK09374"
                     /db_xref="CDD:236488"
     misc_feature    339506..339736
                     /locus_tag="Hneap_0326"
                     /note="Ribosomal Proteins L2, RNA binding domain; Region:
                     Ribosomal_L2; pfam00181"
                     /db_xref="CDD:249659"
     misc_feature    339752..340138
                     /locus_tag="Hneap_0326"
                     /note="Ribosomal Proteins L2, C-terminal domain; Region:
                     Ribosomal_L2_C; pfam03947"
                     /db_xref="CDD:202823"
     gene            340232..340507
                     /locus_tag="Hneap_0327"
                     /db_xref="GeneID:8533447"
     CDS             340232..340507
                     /locus_tag="Hneap_0327"
                     /inference="protein motif:TFAM:TIGR01050"
                     /note="TIGRFAM: ribosomal protein S19;
                     PFAM: ribosomal protein S19/S15;
                     KEGG: ttu:TERTU_0912 ribosomal protein S19"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="YP_003262237.1"
                     /db_xref="GI:261854954"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005732"
                     /db_xref="GeneID:8533447"
                     /translation="MPRSLKKGPFVDHHLLKKVEEAAAANNRRPIKTWSRRSMILPDF
                     IGLTIAVHNGRQHIPVLVNENMVGHKLGEFAPTRTYRGHVADKKAKR"
     misc_feature    340232..340504
                     /locus_tag="Hneap_0327"
                     /note="30S ribosomal protein S19; Reviewed; Region: rpsS;
                     PRK00357"
                     /db_xref="CDD:178985"
     gene            340517..340849
                     /locus_tag="Hneap_0328"
                     /db_xref="GeneID:8533448"
     CDS             340517..340849
                     /locus_tag="Hneap_0328"
                     /inference="protein motif:TFAM:TIGR01044"
                     /note="TIGRFAM: ribosomal protein L22;
                     PFAM: ribosomal protein L22/L17;
                     KEGG: vcj:VCD_001772 50S ribosomal protein L22p (L17e)"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="YP_003262238.1"
                     /db_xref="GI:261854955"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="GeneID:8533448"
                     /translation="MQATALHRYARISPQKARLVADLVRGQGVAQAIETLTFSDKKGA
                     DLIKKVLESAIANAENNEGADVDRLRIATIMVDEGPVLKRFRARAKGRGARILKKTSH
                     ILVTVSER"
     misc_feature    340523..340837
                     /locus_tag="Hneap_0328"
                     /note="Ribosomal protein L22/L17e.  L22 (L17 in
                     eukaryotes) is a core protein of the large ribosomal
                     subunit.  It is the only ribosomal protein that interacts
                     with all six domains of 23S rRNA, and is one of the
                     proteins important for directing the proper...; Region:
                     Ribosomal_L22; cd00336"
                     /db_xref="CDD:238205"
     misc_feature    order(340523..340528,340592..340600,340604..340609,
                     340613..340618,340679..340696,340721..340738,
                     340832..340837)
                     /locus_tag="Hneap_0328"
                     /note="putative translocon binding site; other site"
                     /db_xref="CDD:238205"
     misc_feature    order(340532..340534,340538..340540,340547..340549,
                     340553..340561,340568..340570,340580..340582,
                     340589..340591,340673..340675,340685..340687,
                     340694..340696,340733..340735,340739..340747,
                     340751..340753,340760..340762,340796..340813)
                     /locus_tag="Hneap_0328"
                     /note="protein-rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238205"
     gene            340860..341534
                     /locus_tag="Hneap_0329"
                     /db_xref="GeneID:8533449"
     CDS             340860..341534
                     /locus_tag="Hneap_0329"
                     /inference="protein motif:TFAM:TIGR01009"
                     /note="KEGG: tgr:Tgr7_2318 ribosomal protein S3;
                     TIGRFAM: ribosomal protein S3;
                     PFAM: ribosomal protein S3- domain protein; KH type 2
                     domain protein; ribosomal protein S3 domain;
                     SMART: KH domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="YP_003262239.1"
                     /db_xref="GI:261854956"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR005704"
                     /db_xref="InterPro:IPR008282"
                     /db_xref="InterPro:IPR018280"
                     /db_xref="GeneID:8533449"
                     /translation="MGQKVHPVGFRLGISSDWTSRWYADSKLFPVQLNQDVRTRAFIK
                     DKLKEASVSRIQIERPARSASVTIHTARPGIVIGRKGEDIERLRGEIAPMLGVDRNAV
                     KLSVEEIRKPELDAQLVAESIAQQLERRIMFRRAMKRAVQTSMRLGAGGIKVNVSGRL
                     GGAEIARNEWYREGRVPLHTLRADIDYGFAEAQTTYGVIGVKVWIFKGEVFGVPGNRD
                     GKAATA"
     misc_feature    340860..341531
                     /locus_tag="Hneap_0329"
                     /note="30S ribosomal protein S3; Reviewed; Region: rpsC;
                     PRK00310"
                     /db_xref="CDD:234722"
     misc_feature    340863..341195
                     /locus_tag="Hneap_0329"
                     /note="K homology RNA-binding (KH) domain of the
                     prokaryotic 30S small ribosomal subunit protein S3. S3  is
                     part of the head region of the 30S ribosomal subunit and
                     is believed to interact with mRNA as it threads its way
                     from the latch into the channel.  The KH...; Region:
                     30S_S3_KH; cd02412"
                     /db_xref="CDD:239095"
     misc_feature    341091..341102
                     /locus_tag="Hneap_0329"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239095"
     misc_feature    341223..341474
                     /locus_tag="Hneap_0329"
                     /note="Ribosomal protein S3, C-terminal domain; Region:
                     Ribosomal_S3_C; pfam00189"
                     /db_xref="CDD:249666"
     gene            341566..341979
                     /locus_tag="Hneap_0330"
                     /db_xref="GeneID:8533450"
     CDS             341566..341979
                     /locus_tag="Hneap_0330"
                     /inference="protein motif:TFAM:TIGR01164"
                     /note="TIGRFAM: ribosomal protein L16;
                     PFAM: ribosomal protein L10e/L16;
                     KEGG: mmw:Mmwyl1_4269 50S ribosomal protein L16"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="YP_003262240.1"
                     /db_xref="GI:261854957"
                     /db_xref="InterPro:IPR000114"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="GeneID:8533450"
                     /translation="MLLPKRTKFRKQFRGKNRGIATTGNKVSFGEFGLKSLERGEITS
                     RQIESARRAISRHVKRGGKIWIRIFPDTPITKKPLEVRMGKGKGSVEYWVAKIQPGKM
                     LYEIEGVTEDIARQAFSLASAKLPVKTTFVTRVLM"
     misc_feature    341632..341961
                     /locus_tag="Hneap_0330"
                     /note="Ribosomal_L16_L10e: L16 is an essential protein in
                     the large ribosomal subunit of bacteria, mitochondria, and
                     chloroplasts. Large subunits that lack L16 are defective
                     in peptidyl transferase activity, peptidyl-tRNA hydrolysis
                     activity, association with...; Region: Ribosomal_L16_L10e;
                     cd01433"
                     /db_xref="CDD:238714"
     misc_feature    order(341632..341634,341638..341643,341650..341652,
                     341698..341703,341710..341712,341719..341721,
                     341731..341733,341740..341742,341758..341766,
                     341770..341772,341776..341778,341788..341793,
                     341812..341826,341866..341868,341920..341925,
                     341932..341937)
                     /locus_tag="Hneap_0330"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238714"
     misc_feature    341677..341682
                     /locus_tag="Hneap_0330"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(341713..341721,341728..341733)
                     /locus_tag="Hneap_0330"
                     /note="putative antibiotic binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(341740..341742,341749..341754,341758..341760,
                     341884..341886)
                     /locus_tag="Hneap_0330"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(341806..341811,341818..341823)
                     /locus_tag="Hneap_0330"
                     /note="L27 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238714"
     gene            341979..342176
                     /locus_tag="Hneap_0331"
                     /db_xref="GeneID:8533451"
     CDS             341979..342176
                     /locus_tag="Hneap_0331"
                     /inference="protein motif:TFAM:TIGR00012"
                     /note="TIGRFAM: ribosomal protein L29;
                     PFAM: ribosomal protein L29;
                     KEGG: csa:Csal_0429 50S ribosomal protein L29P"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="YP_003262241.1"
                     /db_xref="GI:261854958"
                     /db_xref="InterPro:IPR001854"
                     /db_xref="InterPro:IPR018254"
                     /db_xref="GeneID:8533451"
                     /translation="MSKITNELREKSPEGLREELLAIKREQFNLRMQKATGQESKSHL
                     IREARKNVARIKTILTEKEQG"
     misc_feature    341994..342164
                     /locus_tag="Hneap_0331"
                     /note="Ribosomal L29 protein/HIP.  L29 is a protein of the
                     large ribosomal Subunit. A homolog, called heparin/heparan
                     sulfate interacting protein (HIP), has also been
                     identified in mammals.  L29 is located on the surface of
                     the large ribosomal subunit, where it...; Region:
                     Ribosomal_L29_HIP; cd00427"
                     /db_xref="CDD:238243"
     misc_feature    order(341994..341996,342003..342005,342105..342107,
                     342135..342140,342144..342149,342159..342161)
                     /locus_tag="Hneap_0331"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238243"
     misc_feature    order(341994..342002,342006..342008,342018..342023,
                     342027..342032,342039..342044,342051..342056,
                     342063..342065,342072..342077,342099..342101,
                     342108..342110,342120..342122,342129..342134,
                     342141..342146,342153..342155)
                     /locus_tag="Hneap_0331"
                     /note="putative translocon interaction site; other site"
                     /db_xref="CDD:238243"
     misc_feature    order(342042..342044,342054..342056,342063..342065,
                     342075..342077,342120..342122)
                     /locus_tag="Hneap_0331"
                     /note="signal recognition particle (SRP54) interaction
                     site; other site"
                     /db_xref="CDD:238243"
     misc_feature    order(342060..342062,342069..342074)
                     /locus_tag="Hneap_0331"
                     /note="L23 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238243"
     misc_feature    342081..342086
                     /locus_tag="Hneap_0331"
                     /note="trigger factor interaction site; other site"
                     /db_xref="CDD:238243"
     gene            342178..342447
                     /locus_tag="Hneap_0332"
                     /db_xref="GeneID:8533452"
     CDS             342178..342447
                     /locus_tag="Hneap_0332"
                     /inference="protein motif:TFAM:TIGR03635"
                     /note="TIGRFAM: 30S ribosomal protein S17;
                     PFAM: ribosomal protein S17;
                     KEGG: msu:MS2039 30S ribosomal protein S17"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="YP_003262242.1"
                     /db_xref="GI:261854959"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR019979"
                     /db_xref="InterPro:IPR019984"
                     /db_xref="GeneID:8533452"
                     /translation="MSTETNENVIRTRVGRVTSDKMDKSITVAIERRVKHPLYGKFIT
                     KTTKLHVHDEDNQSRVGDSVEIRESRPISKTKSWTLVRVITRAAV"
     misc_feature    342196..342438
                     /locus_tag="Hneap_0332"
                     /note="30S ribosomal protein S17; Reviewed; Region: rpsQ;
                     PRK05610"
                     /db_xref="CDD:235532"
     gene            342460..342828
                     /locus_tag="Hneap_0333"
                     /db_xref="GeneID:8533453"
     CDS             342460..342828
                     /locus_tag="Hneap_0333"
                     /inference="protein motif:TFAM:TIGR01067"
                     /note="TIGRFAM: ribosomal protein L14;
                     PFAM: ribosomal protein L14b/L23e;
                     KEGG: tbd:Tbd_0415 50S ribosomal protein L14"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="YP_003262243.1"
                     /db_xref="GI:261854960"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR005745"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="GeneID:8533453"
                     /translation="MIQMQTILDSADNSGAKKIQCIKVLGGSHRRYAGIGDIIKVSIK
                     DAIPRGRVKKGDVYNAVVVRTAKGVRRADGSLIRFDGNAAVLLNAKLEPIGTRIFGPV
                     TRELRGEKFMKIVSLAPEVI"
     misc_feature    342460..342825
                     /locus_tag="Hneap_0333"
                     /note="50S ribosomal protein L14; Validated; Region: rplN;
                     PRK05483"
                     /db_xref="CDD:180117"
     gene            342839..343162
                     /locus_tag="Hneap_0334"
                     /db_xref="GeneID:8533454"
     CDS             342839..343162
                     /locus_tag="Hneap_0334"
                     /inference="protein motif:TFAM:TIGR01079"
                     /note="KEGG: tgr:Tgr7_2313 ribosomal protein L24;
                     TIGRFAM: ribosomal protein L24;
                     PFAM: KOW domain protein;
                     SMART: KOW domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="YP_003262244.1"
                     /db_xref="GI:261854961"
                     /db_xref="InterPro:IPR003256"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR005825"
                     /db_xref="GeneID:8533454"
                     /translation="MRKIRQGDEVVVIAGKDKGRRGTVLRVINDGARVVVENINKVKK
                     HMKPNPMLGQTGGIIEMEKSIDISNVMLFNPASEKGDRVGFKHLEDGTKVRFFKSNGE
                     VVDTK"
     misc_feature    342857..343054
                     /locus_tag="Hneap_0334"
                     /note="KOW motif of Ribosomal Protein L26; Region:
                     KOW_RPL26; cd06089"
                     /db_xref="CDD:240513"
     misc_feature    order(342878..342886,342920..342922,342965..342970,
                     343037..343042)
                     /locus_tag="Hneap_0334"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240513"
     gene            343174..343713
                     /locus_tag="Hneap_0335"
                     /db_xref="GeneID:8533455"
     CDS             343174..343713
                     /locus_tag="Hneap_0335"
                     /inference="protein motif:PFAM:PF00281"
                     /note="PFAM: ribosomal protein L5;
                     KEGG: pag:PLES_06771 50S ribosomal protein L5"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="YP_003262245.1"
                     /db_xref="GI:261854962"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="GeneID:8533455"
                     /translation="MARLQELYTSTYLPQLKEKLGLDNVMAVPKLTKITLNMGLGDSA
                     RDKKVIDSAVDEMAAISGQKPVVTYARKSIAGFKLREGMPLGVKVTLRGSTMYEFFDR
                     LIQISVPRIRDFRGLNPKSFDGRGNYSMGVKEQIIFPEIDYDKIDQIRGMDITITTTA
                     QNDDQARALLECFGFPFRR"
     misc_feature    343174..343707
                     /locus_tag="Hneap_0335"
                     /note="50S ribosomal protein L5; Validated; Region: rplE;
                     PRK00010"
                     /db_xref="CDD:178791"
     misc_feature    343243..343413
                     /locus_tag="Hneap_0335"
                     /note="Ribosomal protein L5; Region: Ribosomal_L5;
                     pfam00281"
                     /db_xref="CDD:109342"
     misc_feature    343423..343707
                     /locus_tag="Hneap_0335"
                     /note="ribosomal L5P family C-terminus; Region:
                     Ribosomal_L5_C; pfam00673"
                     /db_xref="CDD:250045"
     gene            343725..344030
                     /locus_tag="Hneap_0336"
                     /db_xref="GeneID:8533456"
     CDS             343725..344030
                     /locus_tag="Hneap_0336"
                     /inference="protein motif:PFAM:PF00253"
                     /note="PFAM: ribosomal protein S14;
                     KEGG: tgr:Tgr7_2311 30S ribosomal protein S14"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="YP_003262246.1"
                     /db_xref="GI:261854963"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="GeneID:8533456"
                     /translation="MAKKSMLNREEQRQKLSARYQAKRDQLRAVLNDPNADFDAKMQA
                     SAALSKLPRDSSVCRQVRRCAITGRPKGVYRKFALGRNKLRQLAMSGEIPGLRKASW"
     misc_feature    343725..344027
                     /locus_tag="Hneap_0336"
                     /note="30S ribosomal protein S14; Reviewed; Region: rpsN;
                     PRK08881"
                     /db_xref="CDD:181574"
     gene            344043..344435
                     /locus_tag="Hneap_0337"
                     /db_xref="GeneID:8533457"
     CDS             344043..344435
                     /locus_tag="Hneap_0337"
                     /inference="protein motif:PFAM:PF00410"
                     /note="PFAM: ribosomal protein S8;
                     KEGG: asa:ASA_4073 ribosomal protein S8"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="YP_003262247.1"
                     /db_xref="GI:261854964"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="GeneID:8533457"
                     /translation="MSMSDPISDMLTRIRNAQNARKPNVSMPSSKFKQAIAKVLKEEG
                     YIGDFQVSGDAKPTLSIALKYFQGKPVIDMIKRVSKPGFRVYKNADELPTVIGGLGVA
                     ILSTSQGVMPDREARRQNIGGEVICLVS"
     misc_feature    344046..344429
                     /locus_tag="Hneap_0337"
                     /note="30S ribosomal protein S8; Validated; Region: rpsH;
                     PRK00136"
                     /db_xref="CDD:234658"
     gene            344449..344976
                     /locus_tag="Hneap_0338"
                     /db_xref="GeneID:8533458"
     CDS             344449..344976
                     /locus_tag="Hneap_0338"
                     /inference="protein motif:TFAM:TIGR03654"
                     /note="TIGRFAM: ribosomal protein L6;
                     PFAM: ribosomal protein L6, alpha-beta domain;
                     KEGG: pen:PSEEN0505 50S ribosomal protein L6"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="YP_003262248.1"
                     /db_xref="GI:261854965"
                     /db_xref="InterPro:IPR002358"
                     /db_xref="InterPro:IPR019906"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="GeneID:8533458"
                     /translation="MSRVAKKPVAIPKGVEVKLNGQVISFKGPKGQLELTLHKSVSVD
                     MAANELRFEPESDQFIAMAGTMRALANNNIQGVSAGFEMKLQLVGVGYRAQVQGSTLN
                     LALGFSHPINFAIPAGITIETPSQTEIIIRGADRQKVGQVASNIRGYRPPEPYKGKGV
                     KYHDEVIFRKEAKKK"
     misc_feature    344449..344973
                     /locus_tag="Hneap_0338"
                     /note="50S ribosomal protein L6; Validated; Region: rplF;
                     PRK05498"
                     /db_xref="CDD:235495"
     misc_feature    344710..344934
                     /locus_tag="Hneap_0338"
                     /note="Ribosomal protein L6; Region: Ribosomal_L6;
                     pfam00347"
                     /db_xref="CDD:249789"
     gene            344986..345342
                     /locus_tag="Hneap_0339"
                     /db_xref="GeneID:8533459"
     CDS             344986..345342
                     /locus_tag="Hneap_0339"
                     /inference="protein motif:TFAM:TIGR00060"
                     /note="TIGRFAM: ribosomal protein L18;
                     PFAM: ribosomal protein L18P/L5E;
                     KEGG: cja:CJA_0715 ribosomal protein L18"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="YP_003262249.1"
                     /db_xref="GI:261854966"
                     /db_xref="InterPro:IPR004389"
                     /db_xref="InterPro:IPR005484"
                     /db_xref="GeneID:8533459"
                     /translation="MNEKSQNRLRRARRTRAKIVRLGVHRLTVYRTAQHTYAQIFTPD
                     GATVVASSSTLHPGVIEAGKHGGNIDAAKRVGEMVAKAALAKGITNVAFDRSGFIFHG
                     RIKALAESARESGLQF"
     misc_feature    345037..345333
                     /locus_tag="Hneap_0339"
                     /note="Ribosomal L18/L5e:  L18 (L5e) is a ribosomal
                     protein found in the central protuberance (CP) of the
                     large subunit. L18 binds 5S rRNA and induces a
                     conformational change that stimulates the binding of L5 to
                     5S rRNA. Association of 5S rRNA with 23S rRNA...; Region:
                     Ribosomal_L18_L5e; cd00432"
                     /db_xref="CDD:238246"
     misc_feature    order(345037..345039,345262..345264,345271..345273,
                     345319..345321)
                     /locus_tag="Hneap_0339"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238246"
     misc_feature    order(345037..345042,345046..345048,345061..345063,
                     345073..345090,345094..345096,345100..345102,
                     345121..345129,345136..345138,345259..345261,
                     345292..345294)
                     /locus_tag="Hneap_0339"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    345040..345045
                     /locus_tag="Hneap_0339"
                     /note="L27 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    345277..345279
                     /locus_tag="Hneap_0339"
                     /note="L5 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     gene            345354..345869
                     /locus_tag="Hneap_0340"
                     /db_xref="GeneID:8533460"
     CDS             345354..345869
                     /locus_tag="Hneap_0340"
                     /inference="protein motif:TFAM:TIGR01021"
                     /note="TIGRFAM: ribosomal protein S5;
                     PFAM: ribosomal protein S5 ; ribosomal protein S5 domain
                     protein;
                     KEGG: tgr:Tgr7_2307 30S ribosomal protein S5"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="YP_003262250.1"
                     /db_xref="GI:261854967"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR005712"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="GeneID:8533460"
                     /translation="MSRNSNEVATDGLIEKLVAVNRVAKVVKGGRIFSFTALTVVGDG
                     EGRVGFGYGKAKEVPAAIQKAMDRAKRNMVDVPLRDGTLHYSTVGHHGAAQVFMKPAS
                     EGTGVIAGGAMRAVFEAVGVRNVLAKCIGTRNHMNVIRATVNGLQSISSPEMIASKRG
                     KRVEEIVGSAS"
     misc_feature    345354..345857
                     /locus_tag="Hneap_0340"
                     /note="30S ribosomal protein S5; Validated; Region: rpsE;
                     PRK00550"
                     /db_xref="CDD:234790"
     misc_feature    345387..345587
                     /locus_tag="Hneap_0340"
                     /note="Ribosomal protein S5, N-terminal domain; Region:
                     Ribosomal_S5; pfam00333"
                     /db_xref="CDD:144065"
     misc_feature    345615..345833
                     /locus_tag="Hneap_0340"
                     /note="Ribosomal protein S5, C-terminal domain; Region:
                     Ribosomal_S5_C; pfam03719"
                     /db_xref="CDD:252121"
     gene            345866..346057
                     /locus_tag="Hneap_0341"
                     /db_xref="GeneID:8533461"
     CDS             345866..346057
                     /locus_tag="Hneap_0341"
                     /inference="protein motif:TFAM:TIGR01308"
                     /note="TIGRFAM: ribosomal protein L30;
                     PFAM: ribosomal protein L30;
                     KEGG: aeh:Mlg_0476 50S ribosomal protein L30P"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="YP_003262251.1"
                     /db_xref="GI:261854968"
                     /db_xref="InterPro:IPR000517"
                     /db_xref="InterPro:IPR005996"
                     /db_xref="GeneID:8533461"
                     /translation="MSQPAMIRVKLIRSTIGRLASHKACVKGLGLRRMNHEVEVMDTP
                     ENRGMINKIEYLLEVQESK"
     misc_feature    345884..346045
                     /locus_tag="Hneap_0341"
                     /note="Ribosomal protein L30, which is found in eukaryotes
                     and prokaryotes but not in archaea, is one of the smallest
                     ribosomal proteins with a molecular mass of about 7kDa.
                     L30 binds the 23SrRNA as well as the 5S rRNA and is one of
                     five ribosomal proteins that...; Region: Ribosomal_L30;
                     cd01658"
                     /db_xref="CDD:100100"
     misc_feature    order(345902..345907,345911..345916,345920..345928,
                     345935..345940,345947..345955,345959..345961,
                     345968..345970,345983..345988,345995..346003,
                     346007..346012)
                     /locus_tag="Hneap_0341"
                     /note="23S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100100"
     gene            346057..346485
                     /locus_tag="Hneap_0342"
                     /db_xref="GeneID:8533462"
     CDS             346057..346485
                     /locus_tag="Hneap_0342"
                     /inference="protein motif:TFAM:TIGR01071"
                     /note="TIGRFAM: ribosomal protein L15;
                     PFAM: ribosomal protein L15;
                     KEGG: pin:Ping_3505 ribosomal protein L15"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="YP_003262252.1"
                     /db_xref="GI:261854969"
                     /db_xref="InterPro:IPR001196"
                     /db_xref="InterPro:IPR005749"
                     /db_xref="GeneID:8533462"
                     /translation="MRLNTLSPADGSRKERTRVGRGVGSGLGKTAGRGHKGQKSRSGG
                     FHKTGFEGGQMPIQRRLPKMGFRSLRALASAEIRTSELNKLDGVVSLETLKAAGLIRN
                     DVRFVKIMLSGEVTKPVQVQGIRVSKGALSAIVAAGGKAE"
     misc_feature    346057..346482
                     /locus_tag="Hneap_0342"
                     /note="50S ribosomal protein L15; Reviewed; Region: rplO;
                     PRK05592"
                     /db_xref="CDD:235523"
     gene            346489..347823
                     /locus_tag="Hneap_0343"
                     /db_xref="GeneID:8533463"
     CDS             346489..347823
                     /locus_tag="Hneap_0343"
                     /inference="protein motif:TFAM:TIGR00967"
                     /note="TIGRFAM: preprotein translocase, SecY subunit;
                     PFAM: SecY protein;
                     KEGG: tgr:Tgr7_2304 preprotein translocase subunit SecY"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="YP_003262253.1"
                     /db_xref="GI:261854970"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="GeneID:8533463"
                     /translation="MALSNAGVASLAGAGRLTELRQRIFFVIMVLVVYRIGTFIPLPG
                     IDVDVMRTLFTQHSGGILGMMNMFSGGALSRMSLFALGVMPYISASIIVQLLSSVLPS
                     LERIKKEGEAGRRKITQYTRYGTLGLGLVQALGVSIALQGQSVGGQSLVYTPGFGFLF
                     VATMTLLTGTMLLVWLGEQITERGVGNGISLIIFAGIVAGLPTAIGGTAELVRTGELG
                     VITLLILAVLIVAVTAFVVFVERGQRRITVNYARRQQGRGMAGQQSSHLPLKLNMAGV
                     IPPIFASSIILFPATLGNWLGQQENMAWLRSVSTALSPGQPLYVGLYATAIIFFCFFY
                     TALVFNSRETADNLKRSGAFVPGIRPGEHTARYIDKVLTRLTFWGALYITAVCLLPEF
                     LILYWNVPFYFGGTSLLIIVVVLMDFMAQVQSHLVSHQYDSLVRKAHFKSGL"
     misc_feature    346516..347793
                     /locus_tag="Hneap_0343"
                     /note="preprotein translocase subunit SecY; Reviewed;
                     Region: secY; PRK09204"
                     /db_xref="CDD:236412"
     misc_feature    346717..347745
                     /locus_tag="Hneap_0343"
                     /note="SecY translocase; Region: SecY; pfam00344"
                     /db_xref="CDD:249786"
     gene            347900..348256
                     /locus_tag="Hneap_0344"
                     /db_xref="GeneID:8533464"
     CDS             347900..348256
                     /locus_tag="Hneap_0344"
                     /inference="protein motif:TFAM:TIGR03631"
                     /note="TIGRFAM: 30S ribosomal protein S13;
                     PFAM: ribosomal protein S13;
                     KEGG: tgr:Tgr7_2302 30S ribosomal protein S13"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="YP_003262254.1"
                     /db_xref="GI:261854971"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR019980"
                     /db_xref="GeneID:8533464"
                     /translation="MARIAGINIPVQKHVVIALTSIYGIGTTRAQAICQASGVEPSRK
                     VRDLSESEVEALRAEVAKFIVEGDLRRDVSMNIKRLMDLGCYRGLRHRRGLPLRGQRT
                     RTNARTRKGPRRLVKR"
     misc_feature    347900..348250
                     /locus_tag="Hneap_0344"
                     /note="30S ribosomal protein S13; Validated; Region: rpsM;
                     PRK05179"
                     /db_xref="CDD:235358"
     gene            348299..348688
                     /locus_tag="Hneap_0345"
                     /db_xref="GeneID:8533465"
     CDS             348299..348688
                     /locus_tag="Hneap_0345"
                     /inference="protein motif:TFAM:TIGR03632"
                     /note="TIGRFAM: 30S ribosomal protein S11;
                     PFAM: ribosomal protein S11;
                     KEGG: ppg:PputGB1_0506 30S ribosomal protein S11"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="YP_003262255.1"
                     /db_xref="GI:261854972"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR018102"
                     /db_xref="InterPro:IPR019981"
                     /db_xref="GeneID:8533465"
                     /translation="MAKSNAPARKKIKRVVTDAVAHVHASFNNTIVTITDRQGNALSW
                     ATSGGSGFRGSRKSTPFAAQVAAERAGEAAKAYGVKNIDVEIKGPGPGRESTIRALNS
                     VGFKVGVITDVTPIPHNGCRPPKKRRV"
     misc_feature    348302..348685
                     /locus_tag="Hneap_0345"
                     /note="30S ribosomal protein S11; Validated; Region:
                     PRK05309"
                     /db_xref="CDD:180007"
     gene            348702..349325
                     /locus_tag="Hneap_0346"
                     /db_xref="GeneID:8533466"
     CDS             348702..349325
                     /locus_tag="Hneap_0346"
                     /inference="protein motif:TFAM:TIGR01017"
                     /note="KEGG: eic:NT01EI_3571 30S ribosomal protein S4
                     (BS4);
                     TIGRFAM: ribosomal protein S4;
                     PFAM: ribosomal protein S4; RNA-binding S4 domain protein;
                     SMART: RNA-binding S4 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="YP_003262256.1"
                     /db_xref="GI:261854973"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005709"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="GeneID:8533466"
                     /translation="MARYLGPKCKLSRREGTDLFLKSGVRSHEDKCHHDRAPGQHGAA
                     RKQKVSEYGVQLREKQKLRRIYGVLERQFANYFKKAAQLKGSTGENLLQLLECRLDNV
                     VYRMGFGSTRSESRQLVSHRAITVNGEVVNIASYQVAANDVVAVRESSRKQQRIKDSL
                     EIAAQRPDVSWISVDAAKMEGVFKSAPSRDELPAEINESLVVELYSK"
     misc_feature    348702..349322
                     /locus_tag="Hneap_0346"
                     /note="30S ribosomal protein S4; Validated; Region: rpsD;
                     PRK05327"
                     /db_xref="CDD:235411"
     misc_feature    348705..348989
                     /locus_tag="Hneap_0346"
                     /note="Ribosomal protein S4/S9 N-terminal domain; Region:
                     Ribosomal_S4; pfam00163"
                     /db_xref="CDD:249643"
     misc_feature    348993..349172
                     /locus_tag="Hneap_0346"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(348993..348995,349029..349034,349038..349043,
                     349047..349052,349059..349064,349068..349070,
                     349089..349112,349116..349118)
                     /locus_tag="Hneap_0346"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     gene            349342..350337
                     /locus_tag="Hneap_0347"
                     /db_xref="GeneID:8533467"
     CDS             349342..350337
                     /locus_tag="Hneap_0347"
                     /inference="protein motif:TFAM:TIGR02027"
                     /note="KEGG: avn:Avin_06500 DNA-directed RNA polymerase,
                     alpha subunit;
                     TIGRFAM: DNA-directed RNA polymerase, subunit alpha;
                     PFAM: RNA polymerase insert; RNA polymerase subunit alpha
                     domain protein; RNA polymerase dimerisation;
                     SMART: RNA polymerase RpoA/D/Rpb3-type"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="YP_003262257.1"
                     /db_xref="GI:261854974"
                     /db_xref="InterPro:IPR011260"
                     /db_xref="InterPro:IPR011261"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011263"
                     /db_xref="InterPro:IPR011773"
                     /db_xref="GeneID:8533467"
                     /translation="MQLGSTELLKPRLVDVQVLDATRARVVLEPLERGFGYTLGNALR
                     RILLSSIPGVAVTEAEIEGVVHEYTTIEGVHEDVLEILLNLKGLSVMLHGRDEAMLSI
                     KKTGAGAITAADIKADHAVEIINPEHHIATLNDQGSLVMTFKVTRGKGYVPASARREE
                     AGGQIGRLLVDASFSPLRRVSYSVERARVEQRTDLDSLVLDIETNGSISAEDAIRQAA
                     GILVDQLSVFVDLKAEKVEPVVEQAPAVDPVLLRPVDDLELTVRSANCLKAENIYYIG
                     DLIQRTEIELLKTPNLGKKSLTEIKDVLAKQGLSLGQRLENWPPAELLNLAESKI"
     misc_feature    349357..350280
                     /locus_tag="Hneap_0347"
                     /note="DNA-directed RNA polymerase subunit alpha;
                     Provisional; Region: PRK05182"
                     /db_xref="CDD:235359"
     misc_feature    349381..350025
                     /locus_tag="Hneap_0347"
                     /note="N-terminal domain of the Alpha subunit of Bacterial
                     RNA polymerase; Region: RNAP_alpha_NTD; cd06928"
                     /db_xref="CDD:132904"
     misc_feature    order(349381..349383,349387..349389,349423..349425,
                     349432..349434,349438..349446,349453..349455,
                     349465..349467,349474..349479,349489..349491,
                     349993..349995,350002..350007,350011..350016,
                     350020..350025)
                     /locus_tag="Hneap_0347"
                     /note="alphaNTD homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132904"
     misc_feature    order(349414..349416,349450..349452,349462..349464,
                     349471..349476,349537..349539,349543..349545,
                     349549..349551,349555..349566,349579..349581,
                     349597..349599,349741..349743,349792..349794,
                     349852..349854,349858..349860,349876..349884,
                     349888..349899,349927..349929,349936..349938,
                     349942..349944)
                     /locus_tag="Hneap_0347"
                     /note="alphaNTD - beta interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:132904"
     misc_feature    order(349543..349545,349579..349581,349588..349590,
                     349597..349602,349789..349794,349798..349800,
                     349858..349860,349873..349878,349903..349905)
                     /locus_tag="Hneap_0347"
                     /note="alphaNTD - beta' interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:132904"
     misc_feature    350083..350259
                     /locus_tag="Hneap_0347"
                     /note="Bacterial RNA polymerase, alpha chain C terminal
                     domain; Region: RNA_pol_A_CTD; pfam03118"
                     /db_xref="CDD:251738"
     gene            350367..350747
                     /locus_tag="Hneap_0348"
                     /db_xref="GeneID:8533468"
     CDS             350367..350747
                     /locus_tag="Hneap_0348"
                     /inference="protein motif:TFAM:TIGR00059"
                     /note="TIGRFAM: ribosomal protein L17;
                     PFAM: ribosomal protein L17;
                     KEGG: msu:MS2022 50S ribosomal protein L17"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="YP_003262258.1"
                     /db_xref="GI:261854975"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="GeneID:8533468"
                     /translation="MRHRLSGRQLGRNSAQRNALMRSLTNSLIEHELIKTTLPKAKEL
                     RRFAEPLITLAKDDSVHARRMAFAQTRNKEVVGKLFSDLGPRFKARAGGYVRILKCGN
                     RAGDNAPMAYVEFVQRGDAASVAE"
     misc_feature    350376..350714
                     /locus_tag="Hneap_0348"
                     /note="50S ribosomal protein L17; Validated; Region: rplQ;
                     PRK05591"
                     /db_xref="CDD:235522"
     gene            350881..351531
                     /locus_tag="Hneap_0349"
                     /db_xref="GeneID:8533469"
     CDS             350881..351531
                     /locus_tag="Hneap_0349"
                     /inference="similar to AA sequence:KEGG:Tcr_0940"
                     /note="KEGG: tcx:Tcr_0940 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262259.1"
                     /db_xref="GI:261854976"
                     /db_xref="GeneID:8533469"
                     /translation="MSVSNKIRGIRHSALALGVVLGLMSVGTYAEDAPAAPAAQPAMP
                     TLSPEQMELMKDFQQTRQEIGALEQKLQGIEAEAYKKNPKLGKQRDGLRDSIKNAMSD
                     KNFDAQAEYDELKALVTKIQGMKENDPERAKDIQKFREGQQAFEQRQAKAFQDPKIQK
                     QSEKLRNDVRAAMIKVDPKAKDMFADLDAKEKHMRDLQEKAMKMHGSEQMAPAPSK"
     gene            complement(351594..353633)
                     /locus_tag="Hneap_0350"
                     /db_xref="GeneID:8533470"
     CDS             complement(351594..353633)
                     /locus_tag="Hneap_0350"
                     /inference="protein motif:TFAM:TIGR00631"
                     /note="KEGG: cja:CJA_2425 excinuclease ABC subunit B;
                     TIGRFAM: excinuclease ABC subunit B;
                     PFAM: helicase; UvrB/UvrC protein; type III restriction
                     protein res subunit;
                     SMART: DEAD-like helicase ; helicase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit B"
                     /protein_id="YP_003262260.1"
                     /db_xref="GI:261854977"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001943"
                     /db_xref="InterPro:IPR004807"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="GeneID:8533470"
                     /translation="MQDTRFTLVTDYQPAGDQPAAIARLVEGLQDGLAQQTLLGVTGS
                     GKTFTIANVIDRLQRPALVLAPNKTLAAQLYGELKGFFPNNAVEYFVSYYDYYQPEAY
                     VPASDTFIEKDASVNEHIEQMRLSATKALLERRDVIIVATVSSIYGLGDPDAYLKMIL
                     HLVRGEKADQRQILRRLAEMQYTRNDMEFRRGTYRVRGDVIDIHPSESDDEGVRVELF
                     DDEIEQISLFDPLTGAIRRRLPRFTIYPSSHYVTPRERILAAVESIKDELTQQLDHLN
                     AENKLVEAQRLAQRTRFDIEMMYELGYCNGIENYSRYLSGRHPGEPPPCLYDYLPPDA
                     LLIIDESHVTVPQLGAMYKGDRSRKETLVNFGFRLPSALDNRPLKFDEFERMMPQTIH
                     VSATPGPYEGSHSAQVVEQVVRPTGLIDPQIEIRPVASQVDDVLSEIRDRASRRERVL
                     ITTLTKRMAEDLADYLAEHDVRVRYLHSDVDTVERVEIIRDLRLGLFDALIGINLLRE
                     GLDIPEVSLVAIFDADKEGFLRSERSLIQTIGRAARNLHGKAILYADRITDAMRKAID
                     ETDRRRAKQIEHNLEQGITPKGIDKRVDDILQSGDYKIPGSRGASQRSRKMALVAEAA
                     SDFSVTMSSEQILKQIKEREAKMYRLAKDLEFEAAAHIRDEIHRLQEQLIAADAK"
     misc_feature    complement(351603..353627)
                     /locus_tag="Hneap_0350"
                     /note="excinuclease ABC subunit B; Provisional; Region:
                     PRK05298"
                     /db_xref="CDD:235395"
     misc_feature    complement(<353196..353546)
                     /locus_tag="Hneap_0350"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(353493..353507)
                     /locus_tag="Hneap_0350"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(351975..352376)
                     /locus_tag="Hneap_0350"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(352119..352127,352200..352205,
                     352263..352274))
                     /locus_tag="Hneap_0350"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(352002..352004,352011..352013,
                     352023..352025,352101..352103))
                     /locus_tag="Hneap_0350"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    complement(351849..351980)
                     /locus_tag="Hneap_0350"
                     /note="Ultra-violet resistance protein B; Region: UvrB;
                     pfam12344"
                     /db_xref="CDD:256994"
     misc_feature    complement(351618..351722)
                     /locus_tag="Hneap_0350"
                     /note="UvrB/uvrC motif; Region: UVR; pfam02151"
                     /db_xref="CDD:251123"
     gene            353784..356195
                     /locus_tag="Hneap_0351"
                     /db_xref="GeneID:8533471"
     CDS             353784..356195
                     /locus_tag="Hneap_0351"
                     /EC_number="3.1.13.1"
                     /inference="protein motif:TFAM:TIGR02063"
                     /note="KEGG: mca:MCA1976 ribonuclease R;
                     TIGRFAM: ribonuclease R; VacB and RNase II family 3'-5'
                     exoribonuclease;
                     PFAM: ribonuclease II; ribonuclease B OB region domain;
                     RNA binding S1 domain protein;
                     SMART: Cold shock protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease R"
                     /protein_id="YP_003262261.1"
                     /db_xref="GI:261854978"
                     /db_xref="InterPro:IPR001900"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR004476"
                     /db_xref="InterPro:IPR011129"
                     /db_xref="InterPro:IPR011805"
                     /db_xref="InterPro:IPR013223"
                     /db_xref="GeneID:8533471"
                     /translation="MSQETVSDPQAAQEAEKYDNPVASREFILQLLSEQDGPLTLNRL
                     ISHLEYDGDDERIEGLSRRMRAMERDGQVIRNRRGGYVPVTHAELVRGRVLGHRDGFG
                     FLVPDDGGDDVFLSPRVMRALLNGDRAVVQVTGLDRRGRREGNLVEVIERANAEIVGR
                     LVLEAGIAFVVPDHARITQDILVPMTDLMGARDGQIVRVALVEQPTLRHKPVGKVVEV
                     LGDHMSPGMEIDVAINSHGIPHEWPEEVLAAIDGLNPEVEESHKSGRVDLRSMPLVTI
                     DGADSKDFDDAVFCQAAPEGFRLLVAIADVSHYVNVGSALDREGFNRATSVYFPGRVL
                     PMLPEVLSNGLCSLNPAVDRLCLCADMLINNEGHIAKFRFFEGVMKSAARLTYDTVAK
                     VLVDQDAEARAAHAHLLEPLETLHGVYKVLRSARERRGAIDFDTVETKIVFGEGRKIE
                     AIVPYERNDAHKIIEECMIAANVAAGRFVADHKIPALYRVHDRPTAEKITDLRAMLAE
                     KGLSLGGGDQPSPKDFNALLSQVQGRADFLTIQTMILRSLKQAVYSPDNLGHFGLAHE
                     FYAHFTSPIRRYPDLMVHRAIRHLLRTGAPDRFPYNHDEMVIIGEHCSNNERRADEAT
                     RDATDWLKCEFMLDKVGEVFEGRVASVLGFGLFVELKDFFVEGLLHITALTKDYYHFD
                     PVTLSLRGERSGRVYALNDAITVRVARVDLDERKIDFVLPDDDEALSESSGDARSEPR
                     DDQESDEDDAAKKKRKPRRRRRKKPAGDAPAGDDDENADSDDDGSDTSSAPESEPGDA
                     EESRK"
     misc_feature    353853..355946
                     /locus_tag="Hneap_0351"
                     /note="ribonuclease R; Region: RNase_R; TIGR02063"
                     /db_xref="CDD:233703"
     misc_feature    353859..354023
                     /locus_tag="Hneap_0351"
                     /note="Ribonuclease R winged-helix domain; Region: HTH_12;
                     pfam08461"
                     /db_xref="CDD:117038"
     misc_feature    354057..354230
                     /locus_tag="Hneap_0351"
                     /note="Ribonuclease B OB domain; Region: OB_RNB;
                     pfam08206"
                     /db_xref="CDD:254660"
     misc_feature    order(354090..354092,354123..354125)
                     /locus_tag="Hneap_0351"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    354576..355559
                     /locus_tag="Hneap_0351"
                     /note="This domain is the catalytic domain of ribonuclease
                     II; Region: RNB; smart00955"
                     /db_xref="CDD:214935"
     misc_feature    355701..355946
                     /locus_tag="Hneap_0351"
                     /note="S1_RNase_R: RNase R C-terminal S1 domain. RNase R
                     is a processive 3' to 5' exoribonuclease, which is a
                     homolog of RNase II. RNase R degrades RNA with secondary
                     structure having a 3' overhang of at least 7 nucleotides.
                     RNase R and PNPase...; Region: S1_RNase_R; cd04471"
                     /db_xref="CDD:239917"
     misc_feature    order(355728..355730,355752..355754,355785..355787,
                     355791..355793)
                     /locus_tag="Hneap_0351"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239917"
     gene            356195..357001
                     /locus_tag="Hneap_0352"
                     /db_xref="GeneID:8533472"
     CDS             356195..357001
                     /locus_tag="Hneap_0352"
                     /inference="protein motif:TFAM:TIGR00186"
                     /note="TIGRFAM: RNA methyltransferase, TrmH family, group
                     3;
                     PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
                     methyltransferase substrate binding;
                     KEGG: cja:CJA_2994 RNA methyltransferase, TrmH family,
                     group 3"
                     /codon_start=1
                     /transl_table=11
                     /product="TrmH family RNA methyltransferase"
                     /protein_id="YP_003262262.1"
                     /db_xref="GI:261854979"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR004441"
                     /db_xref="InterPro:IPR013123"
                     /db_xref="GeneID:8533472"
                     /translation="MAERKSASSTQWLSGFHAVEAALQHDPERVLSVIFEQGRQDKRV
                     QQLRVLAESRGVSIEEAPEKVFADRVRADRELARHQGVLARYQPKPAGNEHDLFALLD
                     NLDEPAFLLILDGVTDPHNLGACLRSAEAAGVHAVISPKDRAVGLTPTARKAASGAAE
                     RLPFIQVTNLARTLADLKSRQIWIVGAAGGGMVSLYESDFAAESVALVMGSEGEGLRR
                     LTQEGCDQLIFIPMRPPVESLNVSVAAAVCLFEFRRVRDQVINQARALSQ"
     misc_feature    356219..356962
                     /locus_tag="Hneap_0352"
                     /note="23S rRNA (guanosine-2'-O-)-methyltransferase;
                     Provisional; Region: PRK11181"
                     /db_xref="CDD:183021"
     misc_feature    356228..356449
                     /locus_tag="Hneap_0352"
                     /note="RNA 2'-O ribose methyltransferase substrate
                     binding; Region: SpoU_sub_bind; pfam08032"
                     /db_xref="CDD:254595"
     misc_feature    356519..356944
                     /locus_tag="Hneap_0352"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     gene            357115..358290
                     /locus_tag="Hneap_0353"
                     /db_xref="GeneID:8533473"
     CDS             357115..358290
                     /locus_tag="Hneap_0353"
                     /inference="protein motif:PFAM:PF00155"
                     /note="PFAM: aminotransferase class I and II;
                     KEGG: mca:MCA2202 aspartate aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="class I and II aminotransferase"
                     /protein_id="YP_003262263.1"
                     /db_xref="GI:261854980"
                     /db_xref="InterPro:IPR001176"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="GeneID:8533473"
                     /translation="MIFSDRVRRVRPSPTLAVTAKAAELKAQGRDIISLGAGEPDFDT
                     PEPIRAAAIDAINAGFTRYTAVEGILSLRQAIAKRLRDDQGLDYAPNEIIVSTGGKQS
                     IYNLFQALLNPGDEVIIVAPYWVSYPDMVLLAGGEPVIVLAGQNQGFKVSPAQLEAAI
                     TDKTRIVMLNSPSNPTGVAYTRDDWAAMAKVLRAHPKLLIATDDMYEKILWADESFSN
                     IAMVAPDLKARTVVLNGVSKAYAMTGWRIGYAAGPADIIKAMNVIQSQSTSGACSIAQ
                     VAAQAAIEGDQSEIRAMVHSFRTRHDFVVGRLNEMPDVVCLPSQGAFYSFPDVSAVIA
                     RLGLKDDVALSEMLLEKAGVAVVPGTAFGAPGHIRLSYATSMGALDEALRRMADVMG"
     misc_feature    357115..358287
                     /locus_tag="Hneap_0353"
                     /note="aspartate aminotransferase; Provisional; Region:
                     PRK05764"
                     /db_xref="CDD:235596"
     misc_feature    357211..358278
                     /locus_tag="Hneap_0353"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(357406..357414,357484..357486,357634..357636,
                     357730..357732,357817..357819,357823..357828,
                     357850..357852)
                     /locus_tag="Hneap_0353"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(357415..357417,357514..357516,357709..357711,
                     357844..357852,357937..357939,357946..357948)
                     /locus_tag="Hneap_0353"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    357826..357828
                     /locus_tag="Hneap_0353"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            358362..359411
                     /locus_tag="Hneap_0354"
                     /db_xref="GeneID:8533474"
     CDS             358362..359411
                     /locus_tag="Hneap_0354"
                     /inference="protein motif:TFAM:TIGR02012"
                     /note="KEGG: tgr:Tgr7_1287 RecA protein;
                     TIGRFAM: recA protein;
                     PFAM: RecA domain protein;
                     SMART: ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase A"
                     /protein_id="YP_003262264.1"
                     /db_xref="GI:261854981"
                     /db_xref="InterPro:IPR001553"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013765"
                     /db_xref="InterPro:IPR020584"
                     /db_xref="InterPro:IPR020587"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="GeneID:8533474"
                     /translation="MDENRKKALTAALSQIERQFGKGAVMRMNDTAGVDVPVVSTGSI
                     ALDAALGIGGLPRGRVVEIYGPESSGKTTLTLQVIAQAQKTGGVCAFVDAEHALDPTY
                     AQKLGVNVDDLLVSQPDTGEQALEITDMLVRSGAVDVVVVDSVAALVPKAEIEGEMGD
                     AHVGLQARLMSQALRKLTGNIKRTNCMVIFINQIRMKIGVSYGSPETTTGGNALKFYA
                     SVRLDIRRVGAVKKGEEIIGNQTRIKVVKNKMAPPFKVVDVDILYGEGISRLMELIDM
                     ATTHGLIQKAGAWYSCGDIRLGQGKDNARQYFVEHPELADDIEAKLRASMLASTGKVA
                     VRASEDDESSAVLED"
     misc_feature    358362..359396
                     /locus_tag="Hneap_0354"
                     /note="recombinase A; Provisional; Region: recA; PRK09354"
                     /db_xref="CDD:236476"
     misc_feature    358371..359330
                     /locus_tag="Hneap_0354"
                     /note="RecA is a  bacterial enzyme which has roles in
                     homologous recombination, DNA repair, and the induction of
                     the SOS response.  RecA couples ATP hydrolysis to DNA
                     strand exchange; Region: recA; cd00983"
                     /db_xref="CDD:238483"
     misc_feature    order(358395..358400,358404..358409,358416..358418,
                     358428..358442,358647..358652,358656..358676,
                     358689..358694,358995..358997,359007..359009,
                     359151..359153,359289..359291)
                     /locus_tag="Hneap_0354"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238483"
     misc_feature    358554..358577
                     /locus_tag="Hneap_0354"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238483"
     misc_feature    order(358560..358580,358644..358646,358656..358658,
                     358665..358667,358788..358790,358938..358940,
                     359037..359039,359076..359078,359142..359153)
                     /locus_tag="Hneap_0354"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238483"
     misc_feature    358776..358790
                     /locus_tag="Hneap_0354"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238483"
     gene            359427..359933
                     /locus_tag="Hneap_0355"
                     /db_xref="GeneID:8533475"
     CDS             359427..359933
                     /locus_tag="Hneap_0355"
                     /inference="protein motif:PFAM:PF02631"
                     /note="PFAM: regulatory protein RecX;
                     KEGG: aeh:Mlg_1482 recombination regulator RecX"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein RecX"
                     /protein_id="YP_003262265.1"
                     /db_xref="GI:261854982"
                     /db_xref="InterPro:IPR003783"
                     /db_xref="GeneID:8533475"
                     /translation="MAWHWQAKAQEDKTDAAKIEKVAVGLLARREHSAFELQRKLSQR
                     GFDSLVIDDVISRLAEQGWQSDARYAEAYVRMRVERGYGRESIRAELGQRGVARAVIQ
                     TALDEADIDWLACAKRQIHRHYHAAPDGHDDQLRRYRHLLSRGFTPEQSRIASGQWRD
                     AEGMDDAF"
     misc_feature    359493..359882
                     /locus_tag="Hneap_0355"
                     /note="recombination regulator RecX; Reviewed; Region:
                     recX; PRK00117"
                     /db_xref="CDD:234646"
     gene            359920..360090
                     /locus_tag="Hneap_0356"
                     /db_xref="GeneID:8533476"
     CDS             359920..360090
                     /locus_tag="Hneap_0356"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262266.1"
                     /db_xref="GI:261854983"
                     /db_xref="GeneID:8533476"
                     /translation="MMPFNYCFCGWKADRQIPVAAWRISSLEAVFAVTATMGHRLITA
                     FRYTRAQHRFTF"
     gene            360104..362722
                     /locus_tag="Hneap_0357"
                     /db_xref="GeneID:8533477"
     CDS             360104..362722
                     /locus_tag="Hneap_0357"
                     /EC_number="6.1.1.7"
                     /inference="protein motif:TFAM:TIGR00344"
                     /note="KEGG: tgr:Tgr7_1289 alanyl-tRNA synthetase;
                     TIGRFAM: alanyl-tRNA synthetase;
                     PFAM: Alanyl-tRNA synthetase, class IIc-like;
                     phosphoesterase DHHA1; threonyl/alanyl tRNA synthetase
                     SAD"
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl-tRNA synthetase"
                     /protein_id="YP_003262267.1"
                     /db_xref="GI:261854984"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="GeneID:8533477"
                     /translation="MMKTTAELRTAFLEFFNQRGHEIVPSSSLIPAHDPTLLFTNAGM
                     VQFKDAFLGLEHRANPRAVSCQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDY
                     FKPEAIRYGWDFLTQVLKLPADRLLVTVYQTDDEAYAIWRDEIGLPEEKVLRIGDKPS
                     GGSDNFWQMGDTGPCGPCTEIFYDHGAHIPGGPPGSADEDGDRFIEIWNIVFMQYDRT
                     VDGQLHPLPKPSVDTGMGIERLAAILQGGHSNYDIDIFRHLITAAQAVTGAADQKSSS
                     LKVLADHIRSCAFLIVDGVRPGNEGRDYVLRRIIRRAARHGHKLGVDEPFFYRLVAPL
                     VEVMGPAYSELANAQAEVARVLRQEEERFLQTLASGMQVLETELADMTPGGTIPGEVV
                     FKLYDTHGFPFDLTADIARERGLVLDESGFEHAMAERRAQSRAASQFAQQTHVLEIET
                     PTCFEGYAQDKAQGALIAIVHDGEQIDVLEAGQSGALVLDHTPFYAESGGQVGDTGVI
                     TTAGGRFVVTDTQKQGANFLHLGEVIEGRVALGDVADAQIDVERRHSIRLNHSATHLL
                     HAALRQVLGTHVHQKGSRVGAESLRFDFSQSEPITDAQLREIERIVNAQIRENHSVET
                     REMPVDEARAAGAMALFGEKYGDVVRVVTMGPFSMELCGGTHARRGGDIGLIKIVSES
                     GVASGVRRIEAVTGASALAVLEQTDDALAEIASMVRGSRQDAVSRVSQVIERARQLER
                     ELAEIKAKQAAEAGGDLLTTAVAMGDVNYLVAELPDADVNTLRDTVDQLKNKLGTSAV
                     MLASVEDGKVRLIAGVSKDLTGRIKAGDWVNVAAQIVGGKGGGRPDMAQAGGPDSAQL
                     PAAMEAARAWMKKQLS"
     misc_feature    360107..362716
                     /locus_tag="Hneap_0357"
                     /note="alanyl-tRNA synthetase; Reviewed; Region: alaS;
                     PRK00252"
                     /db_xref="CDD:234701"
     misc_feature    360116..360841
                     /locus_tag="Hneap_0357"
                     /note="Alanyl-tRNA synthetase (AlaRS) class II core
                     catalytic domain. AlaRS is a homodimer. It is responsible
                     for the attachment of alanine to the 3' OH group of ribose
                     of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: AlaRS_core;
                     cd00673"
                     /db_xref="CDD:238360"
     misc_feature    360170..360184
                     /locus_tag="Hneap_0357"
                     /note="motif 1; other site"
                     /db_xref="CDD:238360"
     misc_feature    order(360251..360253,360257..360259,360311..360313,
                     360374..360376,360380..360382,360386..360394,
                     360719..360724,360734..360736,360791..360796,
                     360806..360811,360818..360820)
                     /locus_tag="Hneap_0357"
                     /note="active site"
                     /db_xref="CDD:238360"
     misc_feature    360308..360316
                     /locus_tag="Hneap_0357"
                     /note="motif 2; other site"
                     /db_xref="CDD:238360"
     misc_feature    360803..360820
                     /locus_tag="Hneap_0357"
                     /note="motif 3; other site"
                     /db_xref="CDD:238360"
     misc_feature    362048..362176
                     /locus_tag="Hneap_0357"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; smart00863"
                     /db_xref="CDD:197931"
     misc_feature    362495..362698
                     /locus_tag="Hneap_0357"
                     /note="DHHA1 domain; Region: DHHA1; pfam02272"
                     /db_xref="CDD:251196"
     gene            362922..364154
                     /locus_tag="Hneap_0358"
                     /db_xref="GeneID:8533478"
     CDS             362922..364154
                     /locus_tag="Hneap_0358"
                     /EC_number="2.7.2.4"
                     /inference="protein motif:TFAM:TIGR00657"
                     /note="KEGG: tgr:Tgr7_1290 aspartate kinase;
                     TIGRFAM: aspartate kinase; aspartate kinase,
                     monofunctional class;
                     PFAM: aspartate/glutamate/uridylate kinase; amino
                     acid-binding ACT domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase"
                     /protein_id="YP_003262268.1"
                     /db_xref="GI:261854985"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR001341"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR005260"
                     /db_xref="InterPro:IPR018042"
                     /db_xref="GeneID:8533478"
                     /translation="MALIVQKYGGTSVGSVERIGAVADRVIRTCRAGHDVVVVVSAMS
                     GETNRLLDLAKQLQARPNERELDALVSTGEQVTTALLSMALLQRGQDARSYTGAQVKI
                     TTNSAFNKARIQSIDTQAVMGDLAAGRVVVVAGFQGVNEKGDITTLGRGGSDTSAVAI
                     AAALNADECQIYTDVDGVYTTDPRVEPRARRLDRITFEEMLEMASSGSKVLQIRSVEF
                     AGKYNVPLRVLSSFSDGAGTLITMEDDVVEQAVISGIAFNRDEAQLTVKGVPDSPGIA
                     YAILGPVAEANIEVDMILQNMGADNTTDFTFTVQHVDYEKTLDIVRVQAEALGAREVS
                     GNPKIVKVSVVGVGMRSHAGIAAKMFKVLADEKINIRMISTSEIKISVVVDDKYLELA
                     VRTLHDAFELDAPSALIG"
     misc_feature    362922..364130
                     /locus_tag="Hneap_0358"
                     /note="aspartate kinase; Reviewed; Region: PRK06635"
                     /db_xref="CDD:235843"
     misc_feature    362928..363644
                     /locus_tag="Hneap_0358"
                     /note="AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily
                     (AAK), AKii; this CD includes the N-terminal catalytic
                     aspartokinase (AK) domain of the lysine-sensitive
                     aspartokinase isoenzyme AKII of Bacillus subtilis 168, and
                     the lysine plus threonine-sensitive...; Region:
                     AAK_AKii-LysC-BS; cd04261"
                     /db_xref="CDD:239794"
     misc_feature    order(362940..362942,362946..362954,363441..363446,
                     363453..363458)
                     /locus_tag="Hneap_0358"
                     /note="putative nucleotide binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239794"
     misc_feature    order(362940..362942,363060..363062,363141..363143)
                     /locus_tag="Hneap_0358"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239794"
     misc_feature    order(363042..363044,363060..363062,363381..363383,
                     363465..363467)
                     /locus_tag="Hneap_0358"
                     /note="putative Mg ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239794"
     misc_feature    order(363042..363047,363060..363062,363141..363143)
                     /locus_tag="Hneap_0358"
                     /note="putative aspartate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239794"
     misc_feature    363702..363920
                     /locus_tag="Hneap_0358"
                     /note="ACT domains of the lysine-sensitive aspartokinase
                     isoenzyme AKII of Bacillus subtilis (BS) strain 168 and
                     related proteins; Region: ACT_AKii-LysC-BS-like_1;
                     cd04913"
                     /db_xref="CDD:153185"
     misc_feature    363813..363818
                     /locus_tag="Hneap_0358"
                     /note="putative allosteric regulatory site; other site"
                     /db_xref="CDD:153185"
     misc_feature    363942..364127
                     /locus_tag="Hneap_0358"
                     /note="ACT domains of the lysine-sensitive, aspartokinase
                     (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168
                     and related domains; Region: ACT_AKii-LysC-BS-like_2;
                     cd04936"
                     /db_xref="CDD:153208"
     gene            364233..364448
                     /locus_tag="Hneap_0359"
                     /db_xref="GeneID:8533479"
     CDS             364233..364448
                     /locus_tag="Hneap_0359"
                     /inference="protein motif:TFAM:TIGR00202"
                     /note="TIGRFAM: carbon storage regulator;
                     PFAM: carbon storage regulator;
                     KEGG: tgr:Tgr7_1291 carbon storage regulator, CsrA"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon storage regulator CsrA"
                     /protein_id="YP_003262269.1"
                     /db_xref="GI:261854986"
                     /db_xref="InterPro:IPR003751"
                     /db_xref="GeneID:8533479"
                     /translation="MLILTRRIGEVLRVGDEVSITVLGIKGNQVRIGIDAPKDVSVHR
                     EEIYQRIKNEGHSQEDGVSGQQSSVEE"
     misc_feature    364233..364421
                     /locus_tag="Hneap_0359"
                     /note="carbon storage regulator; Provisional; Region:
                     PRK01712"
                     /db_xref="CDD:234973"
     gene            364525..365724
                     /locus_tag="Hneap_0360"
                     /db_xref="GeneID:8533480"
     CDS             364525..365724
                     /locus_tag="Hneap_0360"
                     /inference="protein motif:PFAM:PF00909"
                     /note="PFAM: ammonium transporter;
                     KEGG: mei:Msip34_1153 Rh family protein/ammonium
                     transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="YP_003262270.1"
                     /db_xref="GI:261854987"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="GeneID:8533480"
                     /translation="METASLVSAVDVLFVLSGAIMVLAMHAGFAFLEVGTVRRKNQVN
                     ALAKIMADFAVSAIAYFFIGYFVAYHIDFWSSASQLTADHGHELVKFFFLLTFAAAIP
                     AIISGGIAERARFYPQLAATFLLVSLVYPFYEGLIWNGNFGFQAWLTHQFGAAFHDYA
                     GSMVVHGMGGWIAIAAVLLLGPRHGRYGKNGEIFAHPPSNIPFLALGSWILAVGWFGF
                     NVMSAQNIAGISGLVAVNSLMAMVGGILSALVVGRNDPGFLHNGPLAGLVAVCAGSDV
                     MHPVGALVTGLIAGGLFVWLFTFVQNRLKIDDVLGVWSLHGVCGLWGALAAGIFGLKA
                     LGGVGGVSFISQFIGSAVAIAVALGAGFVIYGMLKLFIGIRLTEEQEYEGADLTVHRI
                     SATPKYD"
     misc_feature    364555..365706
                     /locus_tag="Hneap_0360"
                     /note="Ammonia permease [Inorganic ion transport and
                     metabolism]; Region: AmtB; COG0004"
                     /db_xref="CDD:223083"
     gene            365792..365881
                     /locus_tag="Hneap_R0008"
                     /note="tRNA-Ser1"
                     /db_xref="GeneID:8533481"
     tRNA            365792..365881
                     /locus_tag="Hneap_R0008"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:8533481"
     gene            complement(367010..369424)
                     /locus_tag="Hneap_0361"
                     /db_xref="GeneID:8533482"
     CDS             complement(367010..369424)
                     /locus_tag="Hneap_0361"
                     /inference="protein motif:PFAM:PF03432"
                     /note="PFAM: Relaxase/mobilization nuclease family
                     protein;
                     KEGG: lhk:LHK_00918 relaxase/mobilization nuclease
                     topoisomerase/primase fusion protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Relaxase/mobilization nuclease family protein"
                     /protein_id="YP_003262271.1"
                     /db_xref="GI:261854988"
                     /db_xref="InterPro:IPR005094"
                     /db_xref="GeneID:8533482"
                     /translation="MKAKITRGMGFRGVLDYALDTGNQKGKNPEIVGGTLTVGNARAM
                     SAQFAVTRRLRPDIKAPVWHASLALPIGERLSSDKWSSIADEFMQAMGFPSDSLYTVI
                     RHNDTQYDHVHIIASRISLSGALWHGQWEVYRAIKATQTLERIHDLILTPGLGEPKDE
                     KSLTKNEIEMALCTGEEPPRQRLQRLVKEAAQGRPTAVMFAERLALAGVGVRFQIQKT
                     GITGVSYEIDGIAFKGQSLGDAYKWSKFSKKQAVSYEQARDSEGIRQFTTAIADRARG
                     DKLGDSSTHLENDTGIATTNHRGADDPSTGTPDLVEGGSNTSPDRLRHSDSSAAPGTG
                     RADAGDDRQSSAGIRAEGGEAESDHLDFVAASAGTEIKHRQDDENRPPDRIDTPETRR
                     ITSANDYSGRGTDADGTTDAATKVENSTGADSGRDGQRSGSSDWSRRFREASAAKRRT
                     AERGMGGSRLGERNARRASVADEDRQSAREIDPSSYLKTMGFAVKKQGRHVSVSLNGD
                     ETYRGTLKPDGHFVWCDRYENGIGHNIDLVNEIEPGSGYATAVYRLLGAPSVNPNLQR
                     AAPKRQPPRLPEQAVANRLSGRAYLGNERGISKDTLDHAEACGMLRYADGGVLFVGYD
                     AKGTPQSITRRATELADPIQKRDFARSDKSYAPILSGDPSTVWIVEGGVDALALHDLA
                     KRQEQPSPTVIVSGGANVRSFLDNPFIQMIIRAAKRIFIAMEREKDAATQAKTDAAHE
                     QQAQRVEEITGIRPLIWQPKKDKDLADMNHRQQKPQPVRLMRDAIKQSTVKLPSTVMK
                     DDFTQG"
     misc_feature    complement(368675..369394)
                     /locus_tag="Hneap_0361"
                     /note="Relaxase/Mobilisation nuclease domain; Region:
                     Relaxase; cl19391"
                     /db_xref="CDD:267744"
     misc_feature    complement(<367514..367660)
                     /locus_tag="Hneap_0361"
                     /note="Protein of unknown function (DUF3991); Region:
                     DUF3991; pfam13154"
                     /db_xref="CDD:257525"
     misc_feature    complement(367121..367432)
                     /locus_tag="Hneap_0361"
                     /note="Topoisomerase-primase domain. This is a nucleotidyl
                     transferase/hydrolase domain found in type IA, type IIA
                     and type IIB topoisomerases, bacterial DnaG-type primases,
                     small primase-like proteins from bacteria and archaea, OLD
                     family nucleases from...; Region: TOPRIM; cl00718"
                     /db_xref="CDD:260587"
     gene            complement(369414..369818)
                     /locus_tag="Hneap_0362"
                     /db_xref="GeneID:8533483"
     CDS             complement(369414..369818)
                     /locus_tag="Hneap_0362"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: lhk:LHK_00917 auxiliary mobilization protein
                     C"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262272.1"
                     /db_xref="GI:261854989"
                     /db_xref="GeneID:8533483"
                     /translation="MKPIDQSRTSRRPRRGHALPETERRRHAVMLRVNDAELAEIDAR
                     RGIYDRGEFLRMALFGMTQARPRPAMVIPTLNQSAWLELSRSASNLNQFARHLNEAGI
                     QLGDLPQIIILLNQFRDALIGVRLTEDMDDES"
     misc_feature    complement(369441..369575)
                     /locus_tag="Hneap_0362"
                     /note="Bacterial mobilisation protein (MobC); Region:
                     MobC; pfam05713"
                     /db_xref="CDD:253345"
     gene            complement(370195..371868)
                     /locus_tag="Hneap_0363"
                     /db_xref="GeneID:8533484"
     CDS             complement(370195..371868)
                     /locus_tag="Hneap_0363"
                     /inference="protein motif:PFAM:PF04830"
                     /note="PFAM: protein of unknown function DUF637
                     hemagglutinin
                     KEGG: aci:ACIAD2784  hemagglutinin protein (FhaB)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262273.1"
                     /db_xref="GI:261854990"
                     /db_xref="InterPro:IPR006915"
                     /db_xref="GeneID:8533484"
                     /translation="MLIEPRIDLLPGLPSEAKPGKPSNRTMGALLTIGLVFAWFSSQG
                     HMTAGHIQANQGDLTLAAVQAKATGTSEPSDGSDGPVHSPGQISLKAAGNINLASVST
                     ESYQRTDEKHKDKAWQETHGEGNYDQQTHYNQLTAGQLDLQAGGSITADMSVRDSAAM
                     LAQSPDMAWLRQLQQNPKLVGKVDWQQIEEAHQHWDYKHQGLTPAASAVVALVVAYFT
                     MGAGSAIVNTAAGSTTAAASGAGAVAAGMTQAAVSTMASQAAVSFINNGGDLSKTLND
                     LGSSQSMRQLATAVVTAGVLSSIGQVTFGEGKNAFRLNDVKVSDGLVPNIGKNLIDGV
                     ARATVNSAITGTDLQTNIRTNVVAGILGAAEQQGANWIGNQTLLGGDFNTNGNVNEFA
                     HEFAHAIVGCAAGVAGASASGSGASTGQGCSAGALGAVVGELSAQFYGGTDPNQTIAF
                     AQMMGGIAAAAAGLGSEGVAIAANTGANAAQNNYMAHYDTYEADLKDCQQNPGGVNCG
                     AILSLTEPTSVQTHQTLSPLAQCAQAHRLSGRHERSDLPSRDFASSFDI"
     misc_feature    complement(370576..371124)
                     /locus_tag="Hneap_0363"
                     /note="Possible hemagglutinin (DUF637); Region: DUF637;
                     pfam04830"
                     /db_xref="CDD:252824"
     gene            complement(372103..372546)
                     /locus_tag="Hneap_0364"
                     /db_xref="GeneID:8533485"
     CDS             complement(372103..372546)
                     /locus_tag="Hneap_0364"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262274.1"
                     /db_xref="GI:261854991"
                     /db_xref="GeneID:8533485"
                     /translation="MSNFSKLQAIVNGFNFKKGDYVGAEDQLSRFAESYAQLSLEDAE
                     LLRSKFDSKDRLGWLRIASTLFVKGFADADSMEKEKLCRIFFALYSFENLEFGFDGAM
                     DVISVSDQRKAMLAWLKGIGSNLANSLVMMPQKTIWKIRYSLPNE"
     gene            complement(372550..372795)
                     /locus_tag="Hneap_0365"
                     /db_xref="GeneID:8533486"
     CDS             complement(372550..372795)
                     /locus_tag="Hneap_0365"
                     /inference="similar to AA sequence:KEGG:BcerKBAB4_0928"
                     /note="KEGG: bwe:BcerKBAB4_0928 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262275.1"
                     /db_xref="GI:261854992"
                     /db_xref="GeneID:8533486"
                     /translation="MKLLELEKYLSKLKLHPDAYSIGIGLPEADETYCIVNEDGLWRI
                     YYAERGQRGDMREYDSEDEACNAFIELLKSDKSVWLR"
     misc_feature    complement(<372604..372783)
                     /locus_tag="Hneap_0365"
                     /note="Immunity protein 38; Region: Imm38; pfam15599"
                     /db_xref="CDD:259730"
     gene            complement(372792..377507)
                     /locus_tag="Hneap_0366"
                     /db_xref="GeneID:8533487"
     CDS             complement(372792..377507)
                     /locus_tag="Hneap_0366"
                     /inference="protein motif:PFAM:PF04830"
                     /note="PFAM: protein of unknown function DUF637
                     hemagglutinin
                     KEGG: rso:RS02477 hemagglutinin-related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262276.1"
                     /db_xref="GI:261854993"
                     /db_xref="InterPro:IPR006915"
                     /db_xref="GeneID:8533487"
                     /translation="MWVKAVEFGCADQGLNGRRSFACPLATGKQPVLFAHRNRPNGVF
                     HWVVVNRQVTGFGVADQCRPAFDGVVHGPGCATARRHALAGGGEPVIEFVQCAPGLLA
                     QGLSFTQGSRRGFRLQGIQTGNVSQCGFCNGALVGLVQFIELAPGMRPAGQLGNPPLG
                     KQMLVATVVIHHQMTVPVPEETIGMFTCPAGLVVEYHNGRTSIPIIAAPGPQVGSSGF
                     AGTGIQLGNRGFIGTGRRFLTGYSSDEAQFQALMNAGVAYAKQWHLIPGVALTAAQVA
                     QLSSDMVWLVAKDVQLPNGKTERVLVPQVYAASNPNDPGSNGSLISANRIQTLGQGTW
                     TNSGTIAGRQLVAVGADDINNLGGRILGQSVSLSARNDINNIGGSIVAGDALSLNAGR
                     DINIVSTHQHVSNTVGASQFSRDSILQTAQLKVRNTDGMLLASAGRDLVLTAANVDNA
                     GTGTTGSEGPATQLQAGHDIRLTTLTTGQENRVVWDADNHDTHGNQQDVGTRIHSAGD
                     LAMIAGNDIQAKAAGIHSDNGTLNLQAGHDIQLTDGQSSTLWDEAHKLSSSGLFSSST
                     SISRDNVSDSRSVATKLSGQSVQLSANHDIALQGSQIDANGNIALLAGDNISLLAGRN
                     QHSESHYREERKSGFTTKGYGKSHTIDTVDMASLLNDGSSLHSTQGNITLAANLAEQN
                     QADQGAVLIEGSQVHADHGRVDVSGKHVILSTSEDQQQYSHSHQSTHSNWAFITGLPD
                     GMRDGLDTQQQTITVNGSTLQGQKGVGAQATGLVDMTAAHLKASQGDIDISGAQVAIR
                     SGTNQQASSSRETHKKSGISWRDLTGLFTPGKGVGYDATLDKKSSKTTVAHATLEGQN
                     IHIQANQGDLTLAAVQAKATGTSEPSDGSDGPVHSPGQISLKAAGNINLASVSTESYQ
                     RTDEKHKDKAWQETHGEGNYDQQTHYNQLTAGQLDLQAGGSITADMSVRDSAAMLAQS
                     PDMAWLRQLQQNPKLVGKVDWQQIEEAHQHWDYKHQGLTPAASAVVALVVAYFTMGAG
                     SAIVNTAAGSTTAAASGAGAVAAGMTQAAVSTMASQAAVSFINNGGDLSKTLNDLGSS
                     QSMRQLATAVVTAGVLSSIGQVTFGEGKNAFRLNDVKVSDGLVPNIGKNLIDGVARAT
                     VNSAITGTDLQTNIRTNVVAGILGAAEQQGANWIGNQTLLGGDFNTNGNVNEFAHEFA
                     HAIVGCAAGVAGASASGSGASTGQGCSAGALGAVVGELSAQFYGGTDPNQTIAFAQMM
                     GGIAAAAAGLGSEGVAIAANTGANAAQNNYMAHYDTYEADLKDCQQNPGGVNCGAILS
                     LTEGTNARYLGMTQGGYRVAANMGKDGAASYTVVSPNGEMMVMQPTEWAYFSQMTSGQ
                     QATIFAGSQWQLDLTSATEYGLAGDTTAAMANYAHMLTQPDYWIGMGAAFLPAGVLGR
                     AATATDEAALLGRGAAGDATRGIPRNKSLVPFNPPNDGFLGAPLDFTLILGTRIDRIG
                     FDGGRFLSPAGTPIPMRALRPGTETRPLRTFEVIRPLDVRAGEIAPAFGQPGLGTQFV
                     TDRPVRDLLREGFLRSVDP"
     misc_feature    complement(375579..>376814)
                     /locus_tag="Hneap_0366"
                     /note="Large exoproteins involved in heme utilization or
                     adhesion [Intracellular trafficking and secretion];
                     Region: FhaB; COG3210"
                     /db_xref="CDD:225751"
     misc_feature    complement(375327..375803)
                     /locus_tag="Hneap_0366"
                     /note="Haemagluttinin repeat; Region: Fil_haemagg_2;
                     pfam13332"
                     /db_xref="CDD:257662"
     misc_feature    complement(373791..374339)
                     /locus_tag="Hneap_0366"
                     /note="Possible hemagglutinin (DUF637); Region: DUF637;
                     pfam04830"
                     /db_xref="CDD:252824"
     misc_feature    complement(372798..373061)
                     /locus_tag="Hneap_0366"
                     /note="Protein of unknown function (DUF4237); Region:
                     DUF4237; pfam14021"
                     /db_xref="CDD:258256"
     gene            377511..377576
                     /locus_tag="Hneap_0367"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:8533488"
     gene            377617..378168
                     /locus_tag="Hneap_0368"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:8533489"
     gene            complement(378521..378835)
                     /locus_tag="Hneap_0369"
                     /db_xref="GeneID:8533490"
     CDS             complement(378521..378835)
                     /locus_tag="Hneap_0369"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262277.1"
                     /db_xref="GI:261854994"
                     /db_xref="GeneID:8533490"
                     /translation="MVKIDDWNDPKLMEAILIWTGYGDSMSPRRDSSMVVQRFGSEAT
                     KWISLIELLEDEFYESKANFESANMQEMSAMVIADFRKKYPEVPDEITKALAWCYTFD
                     NR"
     gene            complement(378823..386088)
                     /locus_tag="Hneap_0370"
                     /db_xref="GeneID:8533491"
     CDS             complement(378823..386088)
                     /locus_tag="Hneap_0370"
                     /inference="protein motif:TFAM:TIGR01901"
                     /note="TIGRFAM: filamentous haemagglutinin family outer
                     membrane protein; adhesin HecA family;
                     PFAM: filamentous haemagglutinin domain protein;
                     Haemagluttinin repeat-containing protein; protein of
                     unknown function DUF637 hemagglutinin
                     KEGG: pct:PC1_2330 filamentous hemagglutinin family outer
                     membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="filamentous hemagglutinin family outer membrane
                     protein"
                     /protein_id="YP_003262278.1"
                     /db_xref="GI:261854995"
                     /db_xref="InterPro:IPR006915"
                     /db_xref="InterPro:IPR008619"
                     /db_xref="InterPro:IPR008638"
                     /db_xref="InterPro:IPR010069"
                     /db_xref="GeneID:8533491"
                     /translation="MKIEQKCNSIARTAQQRQSVPAVAPIGYRVLVFLLSAIIPPSAN
                     ASGIAADHQAPAYQQPTIQVTANGTPEANIQTPGVDGVSHNVYKQFDVGSKGVILNNA
                     RTNAQTQLGGWIQGNPNLANGSARVILNEVNSSQPSQLNGYVEIGGQRAELVIANPSG
                     INVDGGGFINASRATLTTGKPVFQNGTLAGYQVSNGSININGAGLDASSTDYTDILAR
                     AINVNAGIWANQLKLVTGSNDISPDGTQITPTSGDANKPGFGIDVAQLGGMYAGKITL
                     IGTEAGVGVRNAGQIGASDNLVLNANGELTNSGQITSQGTTTAQTNVIDNSGTIYAQD
                     NAQLNANGDITNSGRILAQGNLGLDAATDVVNLDGAILGAGVQPDGSLGGARNLTIAS
                     GQNARLQGKNLASGNLTAKGNTVDLSHSQTQADSITLTATHGDIDASSATITAQHQLQ
                     ANASGSFINDQAQTAAGTLQLKAANLSNLDGLILLGDSSGASDITLSNLFDNRGGLLH
                     TTGEMQITANQVDNRNTTQSAQGIQGNDVTITADRINNGSGHILANQNIQLNSAGQID
                     NSQGLVSAGGNLSAQDGQATRSLAITNTQGTFVAGQNLAVTSATLSGDGQLYAQQDIH
                     LLLDGGFDNSGTLIANHDTDLNIGGILTNSGTLQAGNTLTAHAGTIDNQASGQISAAE
                     DRINATGKLTNRGLIDGGTTRLQANTIDNLGTGRIYGDHIAIGANDLTNENENGTAGT
                     IAARNRLDIGVQTLENKEHALIYSAGDMSIGGALDANDQATGQAVHLTNSSATIDADG
                     QIQLSAQTIDNLNAHLVTSQVDDATVTHEYVQPRGQSQLFDISACSGIGGGQDKNSCN
                     GYPGTFEDYTLFIVHSTPSHTIVVSSDPGKIQAGGDIVINGALNNRDSAVIAGGDLVA
                     SQPVSNTATKGQDITRSTGTAELTTVESCGLFGSDHCREWHGQSAYNPAPVYGTPYDL
                     PTLTYQTHTLIGGTAPTIGNRSATGTSQPVSQPINTSGGYAWTQPNITLRSSSLFQVH
                     DDNGNHPLIETDPRFADYRQWLSSDYMISALSLQPDSLLKRLGDGYYEQKLVQDQVAE
                     LTGRRFLTGYSSDEAQFQALMNAGVTYAKQWHLIPGVALTAAQVAQLSSDMVWLVAKD
                     VQLPNGKTERVLVPQVYAASNPNDPGSNGSLISANRIQTLGQGTWTNSGTIAGRQLVA
                     VGADDINNLGGRILGQSVSLSARNDINNIGGSIVAGDALSLNAGRDINIVSTHQHVSN
                     TVGASQFSRDSILQTAQLKVRNTDGMLLASAGRDLVLTAANVDNAGTGTTGSEGPATQ
                     LQAGHDIRLTTLTTGQENRVVWDADNHDTHGNQQDVGTRIHSAGDLAMIAGNDIQAKA
                     AGIHSDNGTLNLQAGHDIQLTDGQSSTLWDEAHKLSSSGLFSSSTSISRDNVSDSRSV
                     ATKLSGQSVQLSANHDIALQGSQIDANGNIALLAGDNISLLAGRNQHSESHYREERKS
                     GFTTKGYGKSHTIDTVDMASLLNDGSSLHSTQGNITLAANLAEQNQADQGAVLIEGSQ
                     VHADHGRVDVSGKHVILSTSEDQQQYSHSHQSTHSNWAFITGLPDGMRDGLDTQQQTI
                     TVNGSTLQGQNGVGVQATGLVDMTAAHLKASQGDIDISGAQVAIRSGTNQQASSSRET
                     HKKSGISWRDLTGLFTPGKGVGYDATLDKKSSKTTVAHATLEGQNIHIQANQGDLTLA
                     AVQAKATGTSEPSDGSDGPVHSPGQISLKAAGNINLASVSTESYQRTDEKHKDKAWQE
                     THGEGNYDQQTHYNQLTAGQLDLQAGGSITADMSVRDSAAMLAQSPDMAWLRQLQQNP
                     KLVGKVDWQQIEEAHQHWDYKHQGLTPAASAVVALVVAYFTMGAGSAIVNTAAGSTTA
                     AASGAGAVAAGMTQAAVSTMASQAAVSFINNGGDLSKTLNDLGSSQSMRQLATAVVTA
                     GVLSSIGQVTFGEGKNAFRLNDVKVSDGLVPNIGKNLIDGVARATVNSAITGTDLQTN
                     IRTNVVAGILGAAEQQGANWIGNQTLLGGDFNTNGNVNEFAHEFAHAIVGCAAGVAGA
                     SASGSGTSTGQGCSAGALGAVVGELSAQFYGGTDPNQTIAFAQMMGGIAAAAAGLGSE
                     GVAIAANTGANAAQNNYMAHYDTYEADLKDCQQNPGGVNCGAILSLTEGTNARYLGMT
                     QGGYRVAANMGKDGAASYTVVSPNGEMMVMQPTEWAYFSQMTSGQQATIFAGSQWQLD
                     LTSATEYGLAGDTTAAMANYAHMLTQPDYWIGMGAALIPTSVLGRTAGMTNQLATGTN
                     KAMFWSGLGRGGDKIAARAAAQQGKMTLESTLAARGIKLPKWDPDNPEVVSAWRQASH
                     DFAAGARGNVRVLQGDVLRGNSVWAEVEFPALKANPTVKSITSIDAATGKEVLLWSR"
     misc_feature    complement(385531..385932)
                     /locus_tag="Hneap_0370"
                     /note="haemagglutination activity domain; Region:
                     Haemagg_act; pfam05860"
                     /db_xref="CDD:253427"
     misc_feature    complement(<382150..384549)
                     /locus_tag="Hneap_0370"
                     /note="Large exoproteins involved in heme utilization or
                     adhesion [Intracellular trafficking and secretion];
                     Region: FhaB; COG3210"
                     /db_xref="CDD:225751"
     misc_feature    complement(381337..381813)
                     /locus_tag="Hneap_0370"
                     /note="Haemagluttinin repeat; Region: Fil_haemagg_2;
                     pfam13332"
                     /db_xref="CDD:257662"
     misc_feature    complement(379801..380349)
                     /locus_tag="Hneap_0370"
                     /note="Possible hemagglutinin (DUF637); Region: DUF637;
                     pfam04830"
                     /db_xref="CDD:252824"
     misc_feature    complement(<378871..>379173)
                     /locus_tag="Hneap_0370"
                     /note="ADP-ribosyl cyclase, also known as cyclic
                     ADP-ribose hydrolase or CD38; Region: Rib_hydrolase;
                     cl08346"
                     /db_xref="CDD:212612"
     misc_feature    complement(order(378913..378915,378928..378930,
                     379012..379014,379084..379089,379132..379134,
                     379153..379161))
                     /locus_tag="Hneap_0370"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:212498"
     gene            complement(386116..387873)
                     /locus_tag="Hneap_0371"
                     /db_xref="GeneID:8533492"
     CDS             complement(386116..387873)
                     /locus_tag="Hneap_0371"
                     /inference="protein motif:PFAM:PF08479"
                     /note="PFAM: polypeptide-transport-associated domain
                     protein ShlB-type; Hemolysin activator HlyB domain
                     protein;
                     KEGG: rso:RS02577 activation/secretion protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polypeptide-transport-associated
                     domain-containing protein"
                     /protein_id="YP_003262279.1"
                     /db_xref="GI:261854996"
                     /db_xref="InterPro:IPR005565"
                     /db_xref="InterPro:IPR013686"
                     /db_xref="GeneID:8533492"
                     /translation="MFQPTDGLSLHQQSRQPFDVFMRRVFLCALFSLLWGASGAWAQP
                     PVASSSVQQELLQQQRQRALEQGQQATPDVRLQKGLAKLPSTLPKHETPCVFINQVTL
                     GGEGAGQFSWAIKTASRALGGIKGRCIGTNGIQILVKQVQNAILARGFITTRVLVTQQ
                     NLNDHKLTLTIIPGRIGAIRLAKGSNPRGTLWNAFPAKPGDLLNLRDLEQGLENLQRL
                     PTASTHINIKPGEQPGTSDIVTDWQQRFPFRLSMWVDDAGSEATGHYEGTVVLSYDDW
                     FTLNDLFYASFTRDLGLDNGRNKRGTQSYTFHYSVPYGYWLLGFTTNRFRYYQTVAGI
                     NQDYRYSGTGTRQDLKLSRIIHRNAHGKTRVSLDAYLQTYGNAIDDTTIEVQQRRMAG
                     YIFDIHQRQFIGRATLDMDVGYRWGTGALGAEPAPEEAYGGGTSRPHIASASIQFNTP
                     FSALGQSWRYQGELRGQYNYTPLIPQDRFAIGGRYTVRGFSGEQVLSSERGLIFRNDL
                     GIVIAGNNELYLGLDYGQVGGSSAQQLLGTRLAGGVIGIRGAYKLLNYDVFAGHAIAK
                     PDGFPAKGITAGFNIGWTI"
     misc_feature    complement(386122..387687)
                     /locus_tag="Hneap_0371"
                     /note="Hemolysin activation/secretion protein
                     [Intracellular trafficking and secretion]; Region: FhaC;
                     COG2831"
                     /db_xref="CDD:225387"
     misc_feature    complement(387352..387585)
                     /locus_tag="Hneap_0371"
                     /note="POTRA domain, ShlB-type; Region: POTRA_2;
                     pfam08479"
                     /db_xref="CDD:117056"
     gene            complement(388197..388487)
                     /locus_tag="Hneap_0372"
                     /db_xref="GeneID:8533493"
     CDS             complement(388197..388487)
                     /locus_tag="Hneap_0372"
                     /inference="protein motif:TFAM:TIGR02607"
                     /note="KEGG: noc:Noc_0437 plasmid maintenance system
                     antidote protein;
                     TIGRFAM: addiction module antidote protein, HigA family;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family plasmid maintenance system antidote
                     protein"
                     /protein_id="YP_003262280.1"
                     /db_xref="GI:261854997"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR013430"
                     /db_xref="GeneID:8533493"
                     /translation="MTVHNQPHPGAFIRQIYLEPHQLSVRALAESLGVAPSTVTRIIN
                     GHSAISPEMALRLAKALGRSAESWLAMQHNYDLWQAKQITDLIRVKSIEFAA"
     misc_feature    complement(<388278..388460)
                     /locus_tag="Hneap_0372"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(388290..388460)
                     /locus_tag="Hneap_0372"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(388356..388358,388434..388436,
                     388446..388448))
                     /locus_tag="Hneap_0372"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(388359..388361,388437..388439))
                     /locus_tag="Hneap_0372"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(388353..388358,388368..388370,
                     388377..388379,388410..388415))
                     /locus_tag="Hneap_0372"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(388487..388765)
                     /locus_tag="Hneap_0373"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:8533494"
     gene            complement(388837..389127)
                     /locus_tag="Hneap_0374"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:8533495"
     gene            complement(389298..389554)
                     /locus_tag="Hneap_0375"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:8533496"
     gene            complement(389710..390156)
                     /locus_tag="Hneap_0376"
                     /db_xref="GeneID:8533497"
     CDS             complement(389710..390156)
                     /locus_tag="Hneap_0376"
                     /inference="protein motif:PFAM:PF03625"
                     /note="PFAM: protein of unknown function DUF302;
                     KEGG: tcx:Tcr_0949 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262281.1"
                     /db_xref="GI:261854998"
                     /db_xref="InterPro:IPR005180"
                     /db_xref="GeneID:8533497"
                     /translation="MRAILFIFLFLSFSSSAMADEGMIEQASPYSVTQTMQRLEMAIR
                     KGGLTIFAVIDHAKGAAKVGQKLRPTQLIIFGSPKGGTPLMQCNQTAGIDLPLKILVW
                     ENAQGKVMLGYNDPVWIAKRHNVPDCAVAPKLHKNMAKLVQKALEQ"
     misc_feature    complement(389713..390093)
                     /locus_tag="Hneap_0376"
                     /note="Domain of unknown function DUF302; Region: DUF302;
                     cl01364"
                     /db_xref="CDD:260900"
     gene            complement(390584..390784)
                     /locus_tag="Hneap_0377"
                     /db_xref="GeneID:8533498"
     CDS             complement(390584..390784)
                     /locus_tag="Hneap_0377"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262282.1"
                     /db_xref="GI:261854999"
                     /db_xref="GeneID:8533498"
                     /translation="MNTANAHNTHLHQFALLATGGLLLALAGCSAGAVSGPRSSCKPK
                     MSTSGRGPAAKHAHERRMRPES"
     gene            391181..391453
                     /locus_tag="Hneap_0378"
                     /db_xref="GeneID:8533499"
     CDS             391181..391453
                     /locus_tag="Hneap_0378"
                     /inference="protein motif:PFAM:PF03692"
                     /note="PFAM: protein of unknown function UPF0153;
                     KEGG: bmu:Bmul_2476 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262283.1"
                     /db_xref="GI:261855000"
                     /db_xref="InterPro:IPR005358"
                     /db_xref="GeneID:8533499"
                     /translation="MTSPHTFECRAGCGACCIAPSISSPIPDMKRGKPAGVACVQLTD
                     DFRCAIFGKPERPRCCSGLSPNIEMCGVSQAQALEWLTSLEEDTKP"
     misc_feature    391202..>391360
                     /locus_tag="Hneap_0378"
                     /note="Putative zinc- or iron-chelating domain; Region:
                     CxxCxxCC; pfam03692"
                     /db_xref="CDD:252103"
     gene            complement(391719..393110)
                     /locus_tag="Hneap_0379"
                     /db_xref="GeneID:8533500"
     CDS             complement(391719..393110)
                     /locus_tag="Hneap_0379"
                     /inference="protein motif:PFAM:PF03349"
                     /note="PFAM: membrane protein involved in aromatic
                     hydrocarbon degradation;
                     KEGG: tgr:Tgr7_2202 SalD"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic hydrocarbon degradation membrane
                     protein"
                     /protein_id="YP_003262284.1"
                     /db_xref="GI:261855001"
                     /db_xref="InterPro:IPR005017"
                     /db_xref="GeneID:8533500"
                     /translation="MVFKRSLLAASVAATLIASGAAHATNGYFSHGFGVKSIGMGGSG
                     VALPNDSAMIIATNPAGITETGTQINFDISWFHPVRGYDQTGVPASGDSNSNNFYIPE
                     LSASYQLNDNSALGIAIYGNGGLNTDYEPNATSIATGQPAGAFATAPGTGGEGGVNLK
                     QMFIAPTYAHKFMNGKLSVGATLLFARQTMQVKGLDGFGGFSTDPTHLTSNKVSSSTG
                     WGGKIGVLYHATDAISLGGSYQTKMHMSKFDDYSGLFSDGGKFDIPSTWTVGGAFKVA
                     PTWTLTADFQRINYADVAAIGNPSTGYLLGNGMPGNGCAGGDTSKCLGGSNGAGFGWS
                     NVNVIKIGAQWQATPALQLRAGFNHGTNPVGSEDVVFNALAPGVMKNHFTAGFTYAID
                     KHQEISGAFMYAPKVTVTGSNPIPSALTYQGALMSGATQAQAQAAAGNVPATTTSIHM
                     KQYEATIGYAYKF"
     misc_feature    complement(391842..393014)
                     /locus_tag="Hneap_0379"
                     /note="Outer membrane protein transport protein
                     (OMPP1/FadL/TodX); Region: Toluene_X; cl17479"
                     /db_xref="CDD:266717"
     gene            complement(393520..394365)
                     /locus_tag="Hneap_0380"
                     /db_xref="GeneID:8533501"
     CDS             complement(393520..394365)
                     /locus_tag="Hneap_0380"
                     /EC_number="5.1.1.7"
                     /inference="protein motif:TFAM:TIGR00652"
                     /note="KEGG: avn:Avin_47710 diaminopimelate epimerase;
                     TIGRFAM: diaminopimelate epimerase;
                     PFAM: diaminopimelate epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="YP_003262285.1"
                     /db_xref="GI:261855002"
                     /db_xref="InterPro:IPR001653"
                     /db_xref="InterPro:IPR018510"
                     /db_xref="GeneID:8533501"
                     /translation="MTIHFTKMHGLGNDFMVIDAINQAIELNPEQIRQWANRHFGIGF
                     DQLLIVEPPKTADTLFTYRIFNADGGEVEQCGNGARCFARYVYDKGLTTEKEIPVGTA
                     SGRIVLHINDSGDVTVDMGRPMFTPTNIPFITECEATSYPLTLDDGSEWVIDAVSMGN
                     PHAVLEVENVDTAPVSHLGPMIEHHRQFPNRVNVGFMQIVDRQHIRLRVFERGSGETL
                     ACGTGACAAVVSGIRRNRLDSPCLVDVRGGRLSVAWTGKTQDSVLMTGPAQSVFEGQI
                     TQTIA"
     misc_feature    complement(393538..394365)
                     /locus_tag="Hneap_0380"
                     /note="diaminopimelate epimerase; Provisional; Region:
                     dapF; PRK00450"
                     /db_xref="CDD:234768"
     misc_feature    complement(393991..394353)
                     /locus_tag="Hneap_0380"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     pfam01678"
                     /db_xref="CDD:250792"
     misc_feature    complement(393553..393903)
                     /locus_tag="Hneap_0380"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     pfam01678"
                     /db_xref="CDD:250792"
     gene            complement(394425..394526)
                     /locus_tag="Hneap_0381"
                     /product="hypothetical protein"
                     /pseudo
                     /db_xref="GeneID:8533502"
     gene            394554..394997
                     /locus_tag="Hneap_0382"
                     /db_xref="GeneID:8533503"
     CDS             394554..394997
                     /locus_tag="Hneap_0382"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262286.1"
                     /db_xref="GI:261855003"
                     /db_xref="GeneID:8533503"
                     /translation="MIVQAVWVDLAALFDFQPDDKLVLFPDALDAFEQWRALELKVVG
                     ITADVRRYGSRLSSVFDETFVVIDRPLPQWRQMETWLDLAQEMAVSPEQIVFITSTPM
                     LMSFARRTGLRTVGVLRDPHTMAVLDGYWVDSLADIDWQDPRFFE"
     misc_feature    <394623..394910
                     /locus_tag="Hneap_0382"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            395075..396916
                     /locus_tag="Hneap_0383"
                     /db_xref="GeneID:8533504"
     CDS             395075..396916
                     /locus_tag="Hneap_0383"
                     /inference="protein motif:TFAM:TIGR01394"
                     /note="TIGRFAM: GTP-binding protein TypA; small
                     GTP-binding protein;
                     PFAM: protein synthesis factor GTP-binding; elongation
                     factor G domain protein; elongation factor Tu domain 2
                     protein;
                     KEGG: tgr:Tgr7_3148 GTP-binding protein TypA"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein TypA"
                     /protein_id="YP_003262287.1"
                     /db_xref="GI:261855004"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006298"
                     /db_xref="GeneID:8533504"
                     /translation="MDAPVISHLRNIAIIAHVDHGKTTLVDKLLQQSGTLDARTDTGE
                     RMMDSNAIEKERGITILAKNTAIRWTSPSGEEYRINIVDTPGHADFGGEVERVLSMVD
                     SVLLLVDAVDGPMPQTRFVTQKAFEHGLKPIVVINKIDRPGSRPQWVVDQVFDLFDRL
                     GASDEQLDFPIVYASALNGYAGLEDSVREGDMTPLYQTIVDSVAPPDVDAEGPLQMQV
                     SSLDYNPYMGVMGIAKIQRGRIKTNTQVKVVDREGAIRSGRILQIMGFHGLERIEVPS
                     AQAGDIIVFSGLDPLFISDTICDPEHVEMLPPLTVDEPTVSMSFNVNTSPFAGKEGKF
                     ITSRQIRDRLHKELLHNVALRVEDTEEGDKFRVSGRGELHLSVLIENMRREGFEMGVG
                     RPEVIIREVDGVKQEPYEQLVVDIEEQNQGAVMEKLGTRRAELRNMEPDGKGRVRLEY
                     IIPSRGLIGFRTEFMTATQGTGLLFSVFDHYGEYKPGNVGQRINGVLIANETGKALSY
                     ALYNLQDRGKMMIGHGDEVYEGQVVGIHSRDNDLTVNVLKGKKLTNMRASGTDEALTL
                     VPPIRFTLEQALEFIDDDELVEVTPASIRIRKKWLTELDRKRYGRGD"
     misc_feature    395099..396907
                     /locus_tag="Hneap_0383"
                     /note="Predicted membrane GTPase involved in stress
                     response [Signal transduction mechanisms]; Region: TypA;
                     COG1217"
                     /db_xref="CDD:224138"
     misc_feature    395099..395692
                     /locus_tag="Hneap_0383"
                     /note="Tyrosine phosphorylated protein A (TypA)/BipA
                     family belongs to ribosome-binding GTPases; Region:
                     TypA_BipA; cd01891"
                     /db_xref="CDD:206678"
     misc_feature    395120..395143
                     /locus_tag="Hneap_0383"
                     /note="G1 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    order(395123..395125,395129..395131,395141..395146,
                     395153..395155,395162..395167,395261..395266,
                     395333..395338,395405..395410,395516..395518,
                     395528..395530)
                     /locus_tag="Hneap_0383"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206678"
     misc_feature    order(395129..395146,395483..395488,395492..395494,
                     395597..395605)
                     /locus_tag="Hneap_0383"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206678"
     misc_feature    395228..395263
                     /locus_tag="Hneap_0383"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206678"
     misc_feature    395249..395251
                     /locus_tag="Hneap_0383"
                     /note="G2 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    395321..395332
                     /locus_tag="Hneap_0383"
                     /note="G3 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    395327..395383
                     /locus_tag="Hneap_0383"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206678"
     misc_feature    395483..395494
                     /locus_tag="Hneap_0383"
                     /note="G4 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    395597..395605
                     /locus_tag="Hneap_0383"
                     /note="G5 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    395714..395971
                     /locus_tag="Hneap_0383"
                     /note="BipA_TypA_II: domain II of BipA (also called TypA)
                     having homology to domain II of the elongation factors
                     (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein
                     with global regulatory properties in Escherichia coli.
                     BipA is phosphorylated on a...; Region: BipA_TypA_II;
                     cd03691"
                     /db_xref="CDD:239662"
     misc_feature    <396134..396229
                     /locus_tag="Hneap_0383"
                     /note="Elongation Factor G, domain II; Region: EFG_II;
                     pfam14492"
                     /db_xref="CDD:258632"
     misc_feature    396293..396529
                     /locus_tag="Hneap_0383"
                     /note="BipA_TypA_C: a C-terminal portion of BipA or TypA
                     having homology to the C terminal domains of the
                     elongation factors EF-G and EF-2. A member of the ribosome
                     binding GTPase superfamily, BipA is widely distributed in
                     bacteria and plants.  BipA is a highly...; Region:
                     BipA_TypA_C; cd03710"
                     /db_xref="CDD:239681"
     gene            396964..398319
                     /locus_tag="Hneap_0384"
                     /db_xref="GeneID:8533505"
     CDS             396964..398319
                     /locus_tag="Hneap_0384"
                     /inference="protein motif:TFAM:TIGR00959"
                     /note="KEGG: sbc:SbBS512_E2999 signal recognition particle
                     protein;
                     TIGRFAM: signal recognition particle protein;
                     PFAM: GTP-binding signal recognition particle SRP54 G-
                     domain; Signal peptide binding (SRP54) M- domain protein;
                     GTP-binding signal recognition particle SRP54 helical
                     bundle;
                     SMART: ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle protein"
                     /protein_id="YP_003262288.1"
                     /db_xref="GI:261855005"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004125"
                     /db_xref="InterPro:IPR004780"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="GeneID:8533505"
                     /translation="MFENLSQRLGGLFDGLRGQGRLTEDNIKDALREVRMALLEADVA
                     LPVVRDFVNQVKERAVGAEVIKSLKPGQVFIKVVSDELTALMGAENSALNLAAQPPAV
                     VLMAGLQGAGKTTTVGKLGRLLRTREQKKVLVVSADVYRPAAIKQLETVAKQVGVDFF
                     PSDAGQKPLDIVQSALKQARVGFYDVLIVDTAGRLHVDAEMMDEVRQLHAALNPVETL
                     FVVDAMTGQDAANTAKAFNEVLPLTGVVLTKADGDARGGAALSVRAITGKPIKFIGMG
                     EKLDALEPFHPDRIASRILGMGDVVSLVEEAQRTLDTSKAQALAEKVRTGKGFTLVDM
                     RDQFEQMLNMGGIHGLMDKLPGMGKLTADAKANIEDRDVHRMIAIINSMTIQERLHPE
                     LIKGSRKRRIALGSGMQVHDVNRLLKQHRDMSDMMKKFSGGGMKKMMRALKGRIPGMP
                     M"
     misc_feature    396964..398274
                     /locus_tag="Hneap_0384"
                     /note="signal recognition particle protein; Provisional;
                     Region: PRK10867"
                     /db_xref="CDD:236780"
     misc_feature    396988..397221
                     /locus_tag="Hneap_0384"
                     /note="SRP54-type protein, helical bundle domain; Region:
                     SRP54_N; smart00963"
                     /db_xref="CDD:214941"
     misc_feature    397264..397785
                     /locus_tag="Hneap_0384"
                     /note="The signal recognition particle (SRP) mediates the
                     transport to or across the plasma membrane in bacteria and
                     the endoplasmic reticulum in eukaryotes. SRP recognizes
                     N-terminal sighnal sequences of newly synthesized
                     polypeptides at the ribosome. The...; Region: SRP;
                     cd03115"
                     /db_xref="CDD:239389"
     misc_feature    397282..397305
                     /locus_tag="Hneap_0384"
                     /note="P loop; other site"
                     /db_xref="CDD:239389"
     misc_feature    order(397375..397377,397540..397542,397705..397707,
                     397714..397719)
                     /locus_tag="Hneap_0384"
                     /note="GTP binding site [chemical binding]; other site"
                     /db_xref="CDD:239389"
     misc_feature    397948..398244
                     /locus_tag="Hneap_0384"
                     /note="Signal peptide binding domain; Region: SRP_SPB;
                     pfam02978"
                     /db_xref="CDD:251653"
     gene            398461..398544
                     /locus_tag="Hneap_R0009"
                     /note="tRNA-Leu1"
                     /db_xref="GeneID:8533506"
     tRNA            398461..398544
                     /locus_tag="Hneap_R0009"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:8533506"
     gene            398612..399910
                     /locus_tag="Hneap_0385"
                     /db_xref="GeneID:8533507"
     CDS             398612..399910
                     /locus_tag="Hneap_0385"
                     /inference="protein motif:TFAM:TIGR00115"
                     /note="TIGRFAM: trigger factor;
                     PFAM: trigger factor domain; trigger factor domain
                     protein; peptidylprolyl isomerase FKBP-type;
                     KEGG: psa:PST_2060 trigger factor"
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="YP_003262289.1"
                     /db_xref="GI:261855006"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR005215"
                     /db_xref="InterPro:IPR008880"
                     /db_xref="InterPro:IPR008881"
                     /db_xref="GeneID:8533507"
                     /translation="MQVELQSSEGLIRRLAIEVPASEIDVEVDRRIKDMSRRVRLDGF
                     RPGKAPLPVVRQRYEGQVREEVVGDVMGRNYQAAIAEQQLRPAGNPVIESVDAQPGTN
                     LKFVAAIEVYPEFEIGDLSVIEIETTTAEVTDADVADMLSTLREQHADWQNVDRAAKD
                     GDRVTVNFAGKVDGEAFQGGSGEGMQVVLGEKRMLADFEKGLAGIAVGEPERVFDVAF
                     PEDYPVENLQGKTAQFTVTATAVEEKVLPELNDEFAARFGSATVAELESDVRKNMERE
                     LKQALKRHTKDVVLTAVTDSLTFDVPKALVDEEAVVMRDGFVRQQMPHADASALDAGL
                     FSEQAAKRVKMGLVIMEIVKSADLQVDDALVDEFINDIAAAYDEPDQVVATYKGDREM
                     MSNARTVVLEQQAVDHVLSKAKVTQKSQDFKSVMNPAPQA"
     misc_feature    398612..399892
                     /locus_tag="Hneap_0385"
                     /note="trigger factor; Provisional; Region: tig; PRK01490"
                     /db_xref="CDD:234956"
     misc_feature    398612..399046
                     /locus_tag="Hneap_0385"
                     /note="Bacterial trigger factor protein (TF); Region:
                     Trigger_N; pfam05697"
                     /db_xref="CDD:253331"
     misc_feature    399074..399322
                     /locus_tag="Hneap_0385"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
                     Region: FKBP_C; pfam00254"
                     /db_xref="CDD:249719"
     misc_feature    399392..399844
                     /locus_tag="Hneap_0385"
                     /note="Bacterial trigger factor protein (TF) C-terminus;
                     Region: Trigger_C; pfam05698"
                     /db_xref="CDD:253332"
     gene            400076..400708
                     /locus_tag="Hneap_0386"
                     /db_xref="GeneID:8533508"
     CDS             400076..400708
                     /locus_tag="Hneap_0386"
                     /EC_number="3.4.21.92"
                     /inference="protein motif:TFAM:TIGR00493"
                     /note="KEGG: vha:VIBHAR_01417 ATP-dependent Clp protease
                     proteolytic subunit;
                     TIGRFAM: ATP-dependent Clp protease proteolytic subunit
                     ClpP;
                     PFAM: peptidase S14 ClpP"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease proteolytic subunit
                     ClpP"
                     /protein_id="YP_003262290.1"
                     /db_xref="GI:261855007"
                     /db_xref="InterPro:IPR001907"
                     /db_xref="InterPro:IPR018215"
                     /db_xref="GeneID:8533508"
                     /translation="MIFGSQTTAGLSSPELAALVPMVVEQTSRGERAYDIYSRLLKER
                     VVFVVGPIEDHMANLIVAQLLFLESENPDKDIHLYINSPGGVVTAGMSIYDTMQFIKP
                     HVSTLCIGQAASMGSILLSGGEPGKRFALPNSRVMIHQPLGGFQGQASDIKIHAEEII
                     KLRHSLNGVLAKHCNQPMEVIERDTDRDKFLSASEAVEYGLIDAVLDKRA"
     misc_feature    400178..400690
                     /locus_tag="Hneap_0386"
                     /note="Caseinolytic protease (ClpP) is an ATP-dependent,
                     highly conserved serine protease; Region: S14_ClpP_2;
                     cd07017"
                     /db_xref="CDD:132928"
     misc_feature    order(400214..400216,400220..400222,400247..400252,
                     400259..400264,400271..400273,400316..400318,
                     400337..400339,400349..400351,400358..400360,
                     400367..400372,400382..400384,400406..400408,
                     400472..400474,400478..400480,400496..400507,
                     400547..400549,400556..400558,400562..400564,
                     400568..400570,400637..400639,400643..400645)
                     /locus_tag="Hneap_0386"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132928"
     misc_feature    order(400415..400417,400490..400492,400637..400639)
                     /locus_tag="Hneap_0386"
                     /note="active site residues [active]"
                     /db_xref="CDD:132928"
     gene            400769..402073
                     /locus_tag="Hneap_0387"
                     /db_xref="GeneID:8533509"
     CDS             400769..402073
                     /locus_tag="Hneap_0387"
                     /inference="protein motif:TFAM:TIGR00382"
                     /note="KEGG: cja:CJA_2005 ATP-dependent Clp protease
                     ATP-binding subunit ClpX;
                     TIGRFAM: ATP-dependent Clp protease ATP-binding subunit
                     ClpX;
                     PFAM: ATPase AAA; zinc finger C4 domain protein; Clp
                     ATPase-like;
                     SMART: ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpX"
                     /protein_id="YP_003262291.1"
                     /db_xref="GI:261855008"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004487"
                     /db_xref="InterPro:IPR010603"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="GeneID:8533509"
                     /translation="MAKSTQSEQDLSCSFCGKPQAEVRKLIAGPSVYICDECVELCND
                     ILREEISAAKDESPARLPTPKELVEALDEYVIGQQRAKRALAVAVYNHYKRLNLFGST
                     RKVAEKDKDSDSEPVELSKSNILLIGPTGSGKTLLAQTLARVLDVPFAIADATTLTEA
                     GYVGEDVENILQKLLQRCDYDVEKAQHGIVYIDEIDKITRKSENPSITRDVSGEGVQQ
                     ALLKLIEGTQASVPPQGGRKHPQQEFVQLDTTNILFICGGAFSGLDSIIRQRIEKGGI
                     GFSAEVKSKDDKRAADELLTQIESEDLTRYGLIPEFIGRLPVIATLNELDEAALVKIL
                     VEPKNALTKQYMRLFEMEGVELDLREDALREVARQAIKRKTGARGLRTIVEHVLLDTM
                     FDVPSTENVQKVVVDASVVRGENAPYLLFDQAESLPKAASDK"
     misc_feature    400772..402043
                     /locus_tag="Hneap_0387"
                     /note="ATP-dependent protease ATP-binding subunit ClpX;
                     Provisional; Region: clpX; PRK05342"
                     /db_xref="CDD:235422"
     misc_feature    400799..400915
                     /locus_tag="Hneap_0387"
                     /note="ClpX C4-type zinc finger; Region: zf-C4_ClpX;
                     pfam06689"
                     /db_xref="CDD:253863"
     misc_feature    400991..>401203
                     /locus_tag="Hneap_0387"
                     /note="Magnesium chelatase, subunit ChlI; Region:
                     Mg_chelatase; pfam01078"
                     /db_xref="CDD:144608"
     misc_feature    401126..>401380
                     /locus_tag="Hneap_0387"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    401150..401173
                     /locus_tag="Hneap_0387"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(401153..401176,401345..401347)
                     /locus_tag="Hneap_0387"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    401333..401350
                     /locus_tag="Hneap_0387"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    401741..401992
                     /locus_tag="Hneap_0387"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; smart01086"
                     /db_xref="CDD:198154"
     gene            402135..402251
                     /locus_tag="Hneap_0388"
                     /db_xref="GeneID:8533510"
     CDS             402135..402251
                     /locus_tag="Hneap_0388"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262292.1"
                     /db_xref="GI:261855009"
                     /db_xref="GeneID:8533510"
                     /translation="MSGSGRLDSVALYFVLSFMVPTAFVSVPLEKLPFGINY"
     gene            402313..404745
                     /locus_tag="Hneap_0389"
                     /db_xref="GeneID:8533511"
     CDS             402313..404745
                     /locus_tag="Hneap_0389"
                     /EC_number="3.4.21.53"
                     /inference="protein motif:TFAM:TIGR00763"
                     /note="KEGG: aeh:Mlg_2286 Lon-A peptidase;
                     TIGRFAM: ATP-dependent protease La;
                     PFAM: peptidase S16; ATPase AAA central domain protein;
                     ATPase AAA;
                     SMART: peptidase S16; ATPase AAA"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease La"
                     /protein_id="YP_003262293.1"
                     /db_xref="GI:261855010"
                     /db_xref="InterPro:IPR001984"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:8533511"
                     /translation="MPHNDTTSEVIAGTPRTVPVLPLRDVVVYPHMVIPLFVGREKSV
                     SALEEAIKGSKQLLLVAQKDADLDDPGRKDLHAVGTLASILQLHKLPDGTIKVLVEGV
                     ERVRCVQVHEVDQYLVAEVHAIEEPKEQPDRELEVEARTLLNQFDGYVKLNKKTPPEV
                     LTSLAGIDDVSRLADTIAAHMALGLDEKQKILETIDLHARIEQLMVLIESEIDTLQVE
                     KRIRGRVKQQMEKSQREYYLNEQMKAIQKELGDLEEGGSDLDELERKILTAGMPKEAL
                     EKAKSELNKLKMMSPMSAEASVVRNYLDWIVAVPWKKRTKIKHDLGVAEQVLEADHFG
                     LEKVKERILEYLAVQQRVRKMNGPILCLVGPPGVGKTSLGQSIAKATNRKFGRIALGG
                     VRDDAEIRGHRRTYVGALPGRIVQTLSKIGSRNPLILLDEIDKMASDFRGDPASALLE
                     VLDPEQNKAFADHYMDMDIDLSEVMFVCTANSLNIPGPLLDRMEVIRIAGYTEDEKTE
                     IAERYLLPKQLEKNGLKDKELSIDTSAVRDVIRYYTREAGVRNLERELAKVSRKVVRK
                     LVTNEEKAPITVDSSSLDQYLGVHRFDFGKVEHPDQVGQVTGLAWTEVGGDLLTIEAA
                     TMPGKGNLKYTGQLGEVMQESIQAAMTVVRSRAVSLGIDPDFSQKTDIHVHVPEGATP
                     KDGPSAGGAMCTTIVSALTGIPVKSTVAMTGEITLRGEVLPIGGLKEKLLAAQRGGIK
                     LVLIPEGNRKDLAEIPEKIKASLDIRPVRWIDEVLDVALVTPPTPKPVALQDAVPSAE
                     VKRADDQSAHAH"
     misc_feature    402361..404673
                     /locus_tag="Hneap_0389"
                     /note="ATP-dependent Lon protease, bacterial type
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: Lon; COG0466"
                     /db_xref="CDD:223542"
     misc_feature    402361..402942
                     /locus_tag="Hneap_0389"
                     /note="ATP-dependent protease La (LON) domain; Region:
                     LON; pfam02190"
                     /db_xref="CDD:251146"
     misc_feature    403327..403800
                     /locus_tag="Hneap_0389"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    403402..403425
                     /locus_tag="Hneap_0389"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(403405..403428,403603..403605,403753..403755)
                     /locus_tag="Hneap_0389"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    403591..403608
                     /locus_tag="Hneap_0389"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    403786..403788
                     /locus_tag="Hneap_0389"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    404041..404652
                     /locus_tag="Hneap_0389"
                     /note="Lon protease (S16) C-terminal proteolytic domain;
                     Region: Lon_C; pfam05362"
                     /db_xref="CDD:191262"
     gene            405027..405299
                     /locus_tag="Hneap_0390"
                     /db_xref="GeneID:8533512"
     CDS             405027..405299
                     /locus_tag="Hneap_0390"
                     /inference="protein motif:PFAM:PF00216"
                     /note="PFAM: histone family protein DNA-binding protein;
                     SMART: histone family protein DNA-binding protein;
                     KEGG: tgr:Tgr7_0942 histone family protein DNA-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="histone family protein DNA-binding protein"
                     /protein_id="YP_003262294.1"
                     /db_xref="GI:261855011"
                     /db_xref="InterPro:IPR000119"
                     /db_xref="GeneID:8533512"
                     /translation="MNKSELIDAMAAKSGMKKTESAAALDAFIEAVGDALKKGDQVTL
                     VGFGTFLVREREARTGRNPRSGETIEIAASRLPSFKAGKGLKDAVN"
     misc_feature    405030..405287
                     /locus_tag="Hneap_0390"
                     /note="histone-like DNA-binding protein HU; Region: HU;
                     cd13831"
                     /db_xref="CDD:259853"
     misc_feature    order(405042..405044,405051..405056,405063..405065,
                     405090..405101,405105..405113,405117..405125,
                     405129..405134,405144..405158,405165..405167,
                     405249..405257,405261..405263,405267..405269,
                     405279..405284)
                     /locus_tag="Hneap_0390"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259853"
     misc_feature    order(405183..405185,405189..405194,405198..405200,
                     405204..405215,405228..405233,405237..405239)
                     /locus_tag="Hneap_0390"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259853"
     gene            405502..407439
                     /locus_tag="Hneap_0391"
                     /db_xref="GeneID:8533513"
     CDS             405502..407439
                     /locus_tag="Hneap_0391"
                     /inference="protein motif:PFAM:PF00639"
                     /note="PFAM: PpiC-type peptidyl-prolyl cis-trans
                     isomerase;
                     KEGG: mca:MCA0533 peptidyl-prolyl cis-trans isomerse D"
                     /codon_start=1
                     /transl_table=11
                     /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_003262295.1"
                     /db_xref="GI:261855012"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="GeneID:8533513"
                     /translation="MLMDLRERIQGWIAYAIIGLISIPFVLWGVGEYFSGGKNQPVAE
                     VDGLPISQQAFEQAVSQQRQAIIQKLGGSVSAEMLQSLNLDQQVLDQMINERVLRVFV
                     QKAGFRAPDAVVADLIRSEPAFKTDGAFDVKKYEAFVAARGTTVANFEAGLKQDIVMQ
                     TLENAISESTIVTAPELDQIVKLRDQTREIGMVRLDRARVIDTVAAPTDGAIEAYYAA
                     HKGEFIRPERVKLRYIELSPKTLAPSVKVTDAQVEQAYANYVKKQEAQVVRTVRHILI
                     SVPKNADGAAIEAAKNKALAARAAIVSGKTSFADEARAVSDDPGSKNKGGDLGEVAPG
                     QMVKPFEEAMDALKVGEVSEPVRTQFGWHLIEVTKESHPDIKPLADMRDKMVAEVQEQ
                     QVEKIYYNEGEKLSDQSYEHPDSLIPSAEALGLKVQASDWLDRNSGTGIAANEKVRQA
                     AFSKEVLKQKLNSNLIELGVNHAVVIRVDQHEPATQLTLAEVKDQIATTLKDQAIDKA
                     LADAAKNIGKKLTADADPQAVATAAGATWVAPVWLKRTARDAPIPAEAIQAAFALAPA
                     PDGQLASKALALSDGNEALVVVEAIKDGDPATISEQDKEALSAQIQQAQAQQTLGVLL
                     KALRDEAKITINQKAEKTATP"
     misc_feature    405535..405987
                     /locus_tag="Hneap_0391"
                     /note="SurA N-terminal domain; Region: SurA_N_3; cl07813"
                     /db_xref="CDD:263474"
     misc_feature    405550..407418
                     /locus_tag="Hneap_0391"
                     /note="periplasmic folding chaperone; Provisional; Region:
                     PRK10788"
                     /db_xref="CDD:182731"
     misc_feature    406318..406608
                     /locus_tag="Hneap_0391"
                     /note="PPIC-type PPIASE domain; Region: Rotamase;
                     pfam00639"
                     /db_xref="CDD:250020"
     gene            complement(407619..408407)
                     /locus_tag="Hneap_0392"
                     /db_xref="GeneID:8533514"
     CDS             complement(407619..408407)
                     /locus_tag="Hneap_0392"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: tgr:Tgr7_0946 short-chain dehydrogenase/reductase
                     SDR"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_003262296.1"
                     /db_xref="GI:261855013"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="GeneID:8533514"
                     /translation="MGFLSGKRVLIVGIANNRSIASGIAEAMQREGAELAFTYLNDRF
                     KEKVEKATAELGSNIYLPLDATSDEQIDALFPALAEHWPEGFDILVHSIAFAPREALD
                     GDYLDGMSREAFRVAHDVSAYSLAALAKAGRSTMRDNGAIVTLSYLGAERVMPNYNVM
                     GVAKAALEANVRYLAGSLGGRGIRVNSISAGPIKTLAASGIGEFKSFLDYVALNSPLK
                     RNVTIEQVGNTAAFLCSDLASGITGENVYVDSGYFITGMGQCPK"
     misc_feature    complement(407634..408407)
                     /locus_tag="Hneap_0392"
                     /note="Enoyl-[acyl-carrier-protein]; Region: FabI;
                     COG0623"
                     /db_xref="CDD:223696"
     misc_feature    complement(407640..408392)
                     /locus_tag="Hneap_0392"
                     /note="Enoyl acyl carrier protein (ACP) reductase (ENR),
                     divergent SDR; Region: ENR_SDR; cd05372"
                     /db_xref="CDD:187630"
     misc_feature    complement(order(407814..407825,407829..407840,
                     407916..407918,407937..407939,407967..407975,
                     408048..408050,408123..408134,408213..408221,
                     408288..408290,408348..408353,408363..408371))
                     /locus_tag="Hneap_0392"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187630"
     misc_feature    complement(order(407640..407651,407655..407693,
                     407697..407699,407712..407714,407721..407726,
                     407733..407735,407751..407762,407778..407780,
                     407787..407789,407868..407873,407877..407894,
                     407898..407903,407910..407915,407922..407927,
                     407934..407939,407943..407954,407958..407963,
                     408009..408011,408018..408020,408030..408032,
                     408039..408044,408051..408056,408063..408068,
                     408075..408083,408087..408098,408195..408197,
                     408204..408215,408318..408320))
                     /locus_tag="Hneap_0392"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    complement(order(407874..407882,407886..407894,
                     407898..407903,407910..407915,407922..407927,
                     407934..407939,407946..407954,407958..407963,
                     408009..408011,408018..408023,408030..408032,
                     408039..408044,408051..408056,408063..408068,
                     408075..408083,408087..408098,408204..408215))
                     /locus_tag="Hneap_0392"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    complement(order(407796..407798,407805..407807,
                     407814..407819,407916..407918,407928..407930,
                     407937..407939,407967..407969,408120..408122,
                     408126..408128))
                     /locus_tag="Hneap_0392"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    complement(order(407916..407918,407928..407930,
                     407967..407969,408045..408047))
                     /locus_tag="Hneap_0392"
                     /note="active site"
                     /db_xref="CDD:187630"
     gene            408537..410513
                     /locus_tag="Hneap_0393"
                     /db_xref="GeneID:8533515"
     CDS             408537..410513
                     /locus_tag="Hneap_0393"
                     /inference="protein motif:PFAM:PF00496"
                     /note="PFAM: extracellular solute-binding protein family
                     5;
                     KEGG: lhk:LHK_02060 extracellular solute-binding protein,
                     family 5"
                     /codon_start=1
                     /transl_table=11
                     /product="family 5 extracellular solute-binding protein"
                     /protein_id="YP_003262297.1"
                     /db_xref="GI:261855014"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="GeneID:8533515"
                     /translation="MKNEHPSRHDQFTDDQRSRRDFLRYLLATGALAAGAGAFSRVGH
                     AAGFADALGYSPKYPANFNAFNYVNPDAPKGGRLSLSVFGNFDSLNPFVLKGLAASGL
                     NELCFESLTARAWDEPFSAYGLLADRADLAADGLSITFRINAKARFYDGSPVTARDVL
                     FSFNTLMSKQAHPRYRIYWADIAGTELTDARHVRFSFKRVNPELHLIIGELPVFSERW
                     LAGRDFASLSREAFLTSGPYRVGRVDYGNTITYERNPDYWAKDLDVRRGQFNFDQIVF
                     KYYKDETVSLEAFKAGEFDVFYETNSKRWARDYTGANFDDGRIIRREIPHKNNAGMQG
                     FGMNTRQALFSDRRVRRALDLALDFGWSNTHLFYGQYTRCDSYFSNSELACRGLPQGD
                     ELALLEPFKAQLPPELFREPYQVPVANNPAEQRANLLKARDLLAEAGWRVEEGVLKNA
                     EGQPFSFEITLAMRGFERIVAPYAYNLKRLGIEVSYRTIDVSLYQRKMDRFEFDMAVV
                     AYGESQSPGNELRDRFGSAAAHTDGSSNYMGIDSPVVDALIDRVIYAKSRAELVTACR
                     ALDRVLLWGEYLVPNWYIGAHRLAWWNRFGFHQPLPLYFDAMTWVMQTWWQVYEHPQK
                     QSKGHLEKPTALSDCVVACSFTRSWLKPAPRLST"
     misc_feature    408693..410318
                     /locus_tag="Hneap_0393"
                     /note="ABC-type oligopeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     OppA; COG4166"
                     /db_xref="CDD:226636"
     misc_feature    408717..410327
                     /locus_tag="Hneap_0393"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_14; cd08497"
                     /db_xref="CDD:173862"
     gene            410515..411264
                     /locus_tag="Hneap_0394"
                     /db_xref="GeneID:8533516"
     CDS             410515..411264
                     /locus_tag="Hneap_0394"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: tbd:Tbd_0681 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262298.1"
                     /db_xref="GI:261855015"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="GeneID:8533516"
                     /translation="MSRCSLNAKLAQARGSLHSNMLTRSWRQPVTVFRGAPLLLWLKR
                     SLLLAAVAALAGCATPQYATQTSYTPPQTAKGLICVAQCQDSLKQCQNSCSAARQSCI
                     AHIEPAARAAFDSALKTYEVQRRQYETDRQFYELNRSLRMGFFNPVFVPGYGWVMRPG
                     YYDDYYDDAPTPPVAPSLAKERQRMIHEQCDSAPCPCQENFEQCYVGCGGGVKKSVVC
                     IANCKDSDPKPSSGAESSPVVQQQTGSPSAN"
     gene            411276..411950
                     /locus_tag="Hneap_0395"
                     /db_xref="GeneID:8533517"
     CDS             411276..411950
                     /locus_tag="Hneap_0395"
                     /inference="protein motif:PFAM:PF04299"
                     /note="PFAM: negative transcriptional regulator;
                     KEGG: bbr:BB0424  regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding negative transcriptional regulator"
                     /protein_id="YP_003262299.1"
                     /db_xref="GI:261855016"
                     /db_xref="InterPro:IPR007396"
                     /db_xref="GeneID:8533517"
                     /translation="MYRPPAFVENDRDTIARMIRAHPFGQLITCDQGRSEVTHLPFML
                     HWDKTIQGQGQGYGNSKGKLISHIARANPQWQHFAHGEEVLVVFQGPHTYISPSWYTN
                     FGVPTWNYAAVHVRGTVRLIEDEARLIAMLTELTETHEAAQPTPWVFDIDRERRAHLM
                     TMLVGFEIDISDIQATFKFNQNRSAEDRAGVIAALSQSPDANDQAVARLMREQMKSQK
                     KAGTNE"
     misc_feature    411276..411914
                     /locus_tag="Hneap_0395"
                     /note="Transcriptional regulator [Transcription]; Region:
                     PaiB; COG2808"
                     /db_xref="CDD:225366"
     gene            411947..413011
                     /locus_tag="Hneap_0396"
                     /db_xref="GeneID:8533518"
     CDS             411947..413011
                     /locus_tag="Hneap_0396"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transporters inner
                     membrane component;
                     KEGG: pnu:Pnuc_1236 binding-protein-dependent transport
                     systems inner membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_003262300.1"
                     /db_xref="GI:261855017"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8533518"
                     /translation="MTGYIFKRLLLMIPTLFGILAISFAVIQFVPGGPVEQLVAQLKS
                     GGAGAAGAESGGGLSGGLYRGDQGLDTRQLDQIKSFYGFDKPAWQRFGDMLGNYLTFN
                     LGTSYFYQRSVTDLILEKLPVSISIGLWTFFLTYLVSIPLGIAKAVRDGSRFDTVTST
                     VILVGYAIPGFVLGLVLIVLFGGGSFWQWFPLRGLTSDNFDQLSIFGKITDYLWHIVL
                     PVTAMMVGNFAVMTMLTKNSFLEEIRKQYVLTARAKGLSERRILYGHVFRNALIPIVT
                     GFPAAFLGAFFTGSLLIETIFSLDGLGLLSYNAVIQRDYPVVLGTLYVFTLIGLIGKL
                     LSDLAYVWVDPRINFQAVNS"
     misc_feature    411947..412999
                     /locus_tag="Hneap_0396"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG4174"
                     /db_xref="CDD:226642"
     misc_feature    412307..412960
                     /locus_tag="Hneap_0396"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(412355..412360,412367..412372,412388..412390,
                     412418..412429,412433..412462,412469..412474,
                     412478..412480,412622..412627,412631..412633,
                     412637..412639,412646..412651,412655..412657,
                     412667..412672,412679..412681,412730..412732,
                     412772..412777,412784..412786,412808..412819,
                     412826..412831,412868..412873,412910..412915,
                     412922..412927,412931..412936,412943..412948,
                     412955..412960)
                     /locus_tag="Hneap_0396"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(412436..412480,412808..412825)
                     /locus_tag="Hneap_0396"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(412478..412480,412607..412609,412826..412828,
                     412862..412864,412871..412873,412910..412912)
                     /locus_tag="Hneap_0396"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(412682..412720,412736..412741,412751..412753)
                     /locus_tag="Hneap_0396"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            413008..414048
                     /locus_tag="Hneap_0397"
                     /db_xref="GeneID:8533519"
     CDS             413008..414048
                     /locus_tag="Hneap_0397"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transporters inner
                     membrane component;
                     KEGG: lhk:LHK_01099 DppC2"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_003262301.1"
                     /db_xref="GI:261855018"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:8533519"
                     /translation="MSEQAAQVSHQGPWRRVWQRFVRHRRGYLSLWLFSILFVLSLGA
                     ELLANNRPLLVYYQHQLYLPLIHNYPETTFGGDFATNADYTDPYVIGKIREHGWLLRA
                     PIPFSYDTIDYYNPAPNPAPPNARHWLGTDDRGRDVAARLIYGFRLSVLFGFALTAIG
                     MVIGMLAGAVQGYLGGKVDLFFQRFIEVWGSLPELYLLIIFASIFQPSIGLLLILLSL
                     FGWIGLSDYVRAEFLKGRNLEYVRAARALGVSGPRIMFRHLLPNALTPVITFLPFRVS
                     GAILALTSLDFLGLGVPPSTPSLGELLAQGKNNIDAWWLSLTTFGVLVGTLLLLIFIG
                     EALRAAFDTRQK"
     misc_feature    413044..>413151
                     /locus_tag="Hneap_0397"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    413050..414039
                     /locus_tag="Hneap_0397"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG4239"
                     /db_xref="CDD:226690"
     misc_feature    413443..413922
                     /locus_tag="Hneap_0397"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(413491..413496,413503..413508,413521..413523,
                     413551..413562,413566..413595,413602..413607,
                     413611..413613,413662..413667,413671..413673,
                     413677..413679,413686..413691,413695..413697,
                     413707..413712,413719..413721,413770..413772,
                     413812..413817,413824..413826,413845..413856,
                     413863..413868,413908..413913)
                     /locus_tag="Hneap_0397"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(413569..413613,413845..413862)
                     /locus_tag="Hneap_0397"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(413611..413613,413863..413865,413902..413904,
                     413911..413913)
                     /locus_tag="Hneap_0397"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(413722..413760,413776..413781,413791..413793)
                     /locus_tag="Hneap_0397"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(414118..414513)
                     /locus_tag="Hneap_0398"
                     /db_xref="GeneID:8533520"
     CDS             complement(414118..414513)
                     /locus_tag="Hneap_0398"
                     /inference="protein motif:PFAM:PF03692"
                     /note="PFAM: protein of unknown function UPF0153;
                     KEGG: dze:Dd1591_2181 protein of unknown function UPF0153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262302.1"
                     /db_xref="GI:261855019"
                     /db_xref="InterPro:IPR005358"
                     /db_xref="GeneID:8533520"
                     /translation="MGNPCQRCGACCAYFRVSFYWAESVPFLDGQVPPELTEQINPHL
                     VSMKGTLTSPARCVALEGGIGDCVSCSIYPNRPTPCRELEPWDEHGQPDEKCSRARAA
                     HGLPPLEPLYEPTAPHTPEIVDPLRTGTD"
     misc_feature    complement(414190..414513)
                     /locus_tag="Hneap_0398"
                     /note="Predicted Fe-S-cluster oxidoreductase [General
                     function prediction only]; Region: COG0727"
                     /db_xref="CDD:223799"
     gene            414775..415542
                     /locus_tag="Hneap_0399"
                     /db_xref="GeneID:8533521"
     CDS             414775..415542
                     /locus_tag="Hneap_0399"
                     /inference="protein motif:PFAM:PF01547"
                     /note="PFAM: extracellular solute-binding protein family
                     1;
                     KEGG: tbd:Tbd_2270 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 1 extracellular solute-binding protein"
                     /protein_id="YP_003262303.1"
                     /db_xref="GI:261855020"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="GeneID:8533521"
                     /translation="MVKRFLGFVGLMALALSNISSAQAQETIYVYGPGGPAPAMKEAA
                     AVFEKETGTKVEVTAGPTPKWIEQAKTKGDIIYSGSENMMTDFTFQLDGQIKSDQVIP
                     LYLRPMAILVRPGNPKKIKGFEDIIKPGVKVLVVQGAGQTGAWEDIAGRLGNIQTVQS
                     LRSNIVDYAKNSALAKKAWIDQPDIDAWLIYNIWQVANPKLADVVEIEPQYAIYRDVG
                     VVLTQRAQANAQSKAFIKFLQSEQGEKIFVKWGWKAN"
     misc_feature    414781..415533
                     /locus_tag="Hneap_0399"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; cl17199"
                     /db_xref="CDD:266549"
     gene            416111..416392
                     /locus_tag="Hneap_0400"
                     /db_xref="GeneID:8533522"
     CDS             416111..416392
                     /locus_tag="Hneap_0400"
                     /inference="similar to AA sequence:KEGG:PFL_4201"
                     /note="KEGG: pfl:PFL_4201 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262304.1"
                     /db_xref="GI:261855021"
                     /db_xref="GeneID:8533522"
                     /translation="MAITHNSYFDGAVQSLAFDFGNAGATVGVLAPGDHVFNLKARET
                     MTVVAGKMFVTINDMAEFPAAAGTTFDAPEGCTLRMRCDVDTAYLCEFH"
     misc_feature    416126..416386
                     /locus_tag="Hneap_0400"
                     /note="Protein of unknown function (DUF1255); Region:
                     DUF1255; cl01202"
                     /db_xref="CDD:260831"
     gene            416802..418271
                     /locus_tag="Hneap_0401"
                     /db_xref="GeneID:8533523"
     CDS             416802..418271
                     /locus_tag="Hneap_0401"
                     /EC_number="3.4.16.4"
                     /inference="protein motif:TFAM:TIGR00666"
                     /note="KEGG: dar:Daro_0423 D-alanyl-D-alanine
                     carboxypeptidase PBP3;
                     TIGRFAM: D-alanyl-D-alanine
                     carboxypeptidase/D-alanyl-D-alanine-endopeptidase;
                     PFAM: peptidase S13 D-Ala-D-Ala carboxypeptidase C"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine
                     carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
                     /protein_id="YP_003262305.1"
                     /db_xref="GI:261855022"
                     /db_xref="InterPro:IPR000667"
                     /db_xref="GeneID:8533523"
                     /translation="MFLILPRRLRFFLLAAFFLGIGSANIQSATAAGAVGMPPSVLET
                     LKKQKLSLGDLGIWVQAVDSNKPLLTHLPDDLFNPASVMKLVTSVVALDVLGTNFQWT
                     TRVYADALPVNGVVHGNLYIKGEGDPWFRSEDLWDLVRQLSDLGIHEVTGKLVLDNSY
                     FDPGPADPSDFDDHPERVYNALPQALLLDNRATRVLIVPPDRSGAGAVVRAWPPNSNI
                     AINNDVKLVKGACTGQTNQPSIAVLGPDTNTPTLNVSGKISTECQPDQFYLVAGNAND
                     AFYSAFKHLFEGQGGKIDGTWAEGVVPKTAVYLVQHNSENLTQYLYLQNKWSNNLMAR
                     QIFLTMGAEIKGAPGTLLKSKAVIADWLKRQGFNWPGFDIENGSGLSRKARISPKEMG
                     QLLMYAWRSPTMPELMASLPIAGIDGTMRKRMRGEPARGMIHLKTGTLRDVRAGAGYI
                     ITQSGRRYVVVILQNEQNVQNGGGSKVQDAILDWLYDNG"
     misc_feature    416910..418262
                     /locus_tag="Hneap_0401"
                     /note="D-alanyl-D-alanine carboxypeptidase
                     (penicillin-binding protein 4) [Cell envelope biogenesis,
                     outer membrane]; Region: DacB; COG2027"
                     /db_xref="CDD:224938"
     misc_feature    416919..418256
                     /locus_tag="Hneap_0401"
                     /note="D-Ala-D-Ala carboxypeptidase 3 (S13) family;
                     Region: Peptidase_S13; cl17429"
                     /db_xref="CDD:266677"
     gene            complement(418294..419646)
                     /locus_tag="Hneap_0402"
                     /db_xref="GeneID:8533524"
     CDS             complement(418294..419646)
                     /locus_tag="Hneap_0402"
                     /inference="protein motif:PFAM:PF01966"
                     /note="PFAM: metal-dependent phosphohydrolase HD sub
                     domain;
                     SMART: metal-dependent phosphohydrolase HD region;
                     KEGG: aha:AHA_3080 metal-dependent phosphohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="YP_003262306.1"
                     /db_xref="GI:261855023"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="GeneID:8533524"
                     /translation="MSIPSLLPETTLRLRQSEIIGALSHALDLTEGLPAGHAQRCCWI
                     GMHIGQELNLNDHDRADLYYALLLKDAGCSSNAARIFNVYGCDDRILKRDFKLIDTHK
                     IDDMAKFAWSHVAPGESWLKRLPMLASLITKGSEIGEDLFLTRCEQGAEIAEQLGFSA
                     QVCDAVRGLDEHWDGRGNPRQLKGEQIPLFARIALLAQVIEIFFAEGGSALAMQTVRA
                     RAGTWFDPTLVHHLEKLAQNDEFWAGLQDPDIAARLVTIEPADYVRTVDDEELDRLAG
                     AFAAVIDAKSPYTFGHSSRVCQYAQRIGGEVGLSEKQLFWLRRAALLHDIGKLGVSNS
                     ILDKPGKLTDEEFAQIKLHPVHSMDILSKVGIFDSLAPVASGHHERLDGCGYPWGLKG
                     DQIDFATRIISVADVFDAVSAERPYRGAMPVAQALSILDDLSGPALDGDLVAALKRTL
                     "
     misc_feature    complement(418924..>419595)
                     /locus_tag="Hneap_0402"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HD-GYP domain [Transcription / Signal
                     transduction mechanisms]; Region: COG3437"
                     /db_xref="CDD:225971"
     misc_feature    complement(419068..419232)
                     /locus_tag="Hneap_0402"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cl17215"
                     /db_xref="CDD:266561"
     misc_feature    complement(418297..>418902)
                     /locus_tag="Hneap_0402"
                     /note="c-di-GMP phosphodiesterase class II (HD-GYP domain)
                     [Signal transduction mechanisms]; Region: COG2206"
                     /db_xref="CDD:225116"
     misc_feature    complement(418417..418788)
                     /locus_tag="Hneap_0402"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(418429..418431,418672..418677,
                     418771..418773))
                     /locus_tag="Hneap_0402"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(418672..418674)
                     /locus_tag="Hneap_0402"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            complement(419701..421494)
                     /locus_tag="Hneap_0403"
                     /db_xref="GeneID:8533525"
     CDS             complement(419701..421494)
                     /locus_tag="Hneap_0403"
                     /inference="protein motif:TFAM:TIGR00644"
                     /note="TIGRFAM: single-stranded-DNA-specific exonuclease
                     RecJ;
                     PFAM: phosphoesterase RecJ domain protein; phosphoesterase
                     DHHA1;
                     KEGG: aeh:Mlg_1819 single-stranded-DNA-specific
                     exonuclease RecJ"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded-DNA-specific exonuclease RecJ"
                     /protein_id="YP_003262307.1"
                     /db_xref="GI:261855024"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR004610"
                     /db_xref="GeneID:8533525"
                     /translation="MTPPPNEQRLIQRRQQPQIPEAMSSIDSRLAAILVNRGIVHPRQ
                     INPDLEFLLPPADMPGIDVAADILADAVRENARILIIGDFDADGATATALCVRALRAM
                     GAKQVEYTLPDRQRHGYGLSPALLKDWIAEADAPPDIILTVDNGIAAFAGVAAALTLN
                     ATVIITDHHLPGDTLPPAHAIVNPNLNGSDFASKAIAGVGVAFYVMAALRERLSAQDW
                     FAGGIARPNLARWLDLVAVGTVADVVSLDDNNRRLVAQGLARIQAQQCVPGISALFAV
                     AGKDPRYASSTDLGFVVGPRLNAAGRLEDMRIGVDCLLADDPISARQYAMTLNEINHE
                     RRALEQEMLFSLKKQGKSSGLNELDLDRPIDPADWVIFDDSFHQGVIGIVAGRLKERW
                     QRPVFVFAPENNDAPRAKLKASGRSIPGVHLRDVLVSMATTAPDLMHAFGGHAMAAGL
                     SLSFDQLDTFRRLFAREMAKHRLHFPDQAIVHTDGPLSANELTLDFAQQLQTCTPWGT
                     DCPEPIFDNRFEVLERTPLKEGRHWRLRLRLLKTEPATPTIGADLTAVWFGIGDHIPA
                     GKYWHLAYRIDINRFRGQQTLQLMIVSGVAA"
     misc_feature    complement(419722..421464)
                     /locus_tag="Hneap_0403"
                     /note="ssDNA exonuclease RecJ; Provisional; Region:
                     PRK11070"
                     /db_xref="CDD:182944"
     misc_feature    complement(420775..421284)
                     /locus_tag="Hneap_0403"
                     /note="DHH family; Region: DHH; pfam01368"
                     /db_xref="CDD:250564"
     misc_feature    complement(420103..420315)
                     /locus_tag="Hneap_0403"
                     /note="DHHA1 domain; Region: DHHA1; pfam02272"
                     /db_xref="CDD:251196"
     gene            complement(421502..423019)
                     /locus_tag="Hneap_0404"
                     /db_xref="GeneID:8533526"
     CDS             complement(421502..423019)
                     /locus_tag="Hneap_0404"
                     /EC_number="3.6.1.40"
                     /inference="protein motif:PRIAM:3.6.1.40"
                     /note="PFAM: Ppx/GppA phosphatase;
                     KEGG: tgr:Tgr7_2467
                     guanosine-5'-triphosphate,3'-diphosphate diphosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="ppx/GppA phosphatase"
                     /protein_id="YP_003262308.1"
                     /db_xref="GI:261855025"
                     /db_xref="InterPro:IPR003695"
                     /db_xref="GeneID:8533526"
                     /translation="MMQNDSLVAAVDLGSNSFHMLIARVSDGQVQVVDRMKEMVRLAG
                     GLQSDGSLAEDAMDRGVACLTRFGQRVSGMPPGSVRIVGTNTLRAAKNGAEFIKRGEK
                     AIGHPIEIIAGREEARLVYLGVSRSEIPIDGDRLVVDIGGGSTELILGKGITPFKMES
                     VPIGCVALMRDFFADGVFDAARMDHAKTRAELELSPYKMAYLKAGWTQAIGSSGTARS
                     LATVIKANDWGEGAITAEGLAKVQSAVLKAGSLSALKLPGLSDDRKPVFVGGLIAMQA
                     VFAALNIRQMFVSDGALREGLVFDWLDRDDHDDIRIATIRRLQRLFTVDVRHADRVAK
                     TAADLLAQVAPNWGLDCHPESIDAPRYAVWLDIAARLHEIGLAVSHSGFHHHGAYILS
                     YADMPGLTRPAQMIIASLVHTHRRKFKLQRFGEVDERLREQIVRLSAVLRLAVLLHRD
                     RSPRPNLSRVRLEAGADNLHVSFPDGWLKTRPLTRVDLELEQSYLAMANIRLSFA"
     misc_feature    complement(421538..423001)
                     /locus_tag="Hneap_0404"
                     /note="Exopolyphosphatase [Nucleotide transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: GppA; COG0248"
                     /db_xref="CDD:223326"
     misc_feature    complement(422123..423001)
                     /locus_tag="Hneap_0404"
                     /note="exopolyphosphatase; Region: exo_poly_only;
                     TIGR03706"
                     /db_xref="CDD:234320"
     gene            complement(423167..424231)
                     /locus_tag="Hneap_0405"
                     /db_xref="GeneID:8533527"
     CDS             complement(423167..424231)
                     /locus_tag="Hneap_0405"
                     /EC_number="4.1.2.13"
                     /inference="protein motif:TFAM:TIGR01521"
                     /note="class II aldolase; catalyzes the reversible aldol
                     condensation of dihydroxyacetonephosphate and
                     glyceraldehyde 3-phosphate in the Calvin cycle, glycolysis
                     and gluconeogenesis"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1,6-bisphosphate aldolase"
                     /protein_id="YP_003262309.1"
                     /db_xref="GI:261855026"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="InterPro:IPR006412"
                     /db_xref="GeneID:8533527"
                     /translation="MALISLRQLLDHAAEHSYGMPAFNVNNMEQIHAIMQAADAVDSP
                     VILQGSAGARKYAGEPFLRHLVSAAVEMYPHIPVVMHQDHGADPGVCFRAIQSGFSSV
                     MMDGSLMPDMKTPSSFEYNVEVTRKVAEMSHFVGVSVEGELGCLGSLETGKMGEEDGH
                     GAEGELDHSMLLTDPEEAAQFVKMTDVDALAIAIGTSHGAYKFTQKPTGKVLRIDRVK
                     EIHARIPNTHLVMHGSSSVPEDWLEIINNYGGDMGQTYGVPVEEIVEGIKHGVRKVNI
                     DTDLRMASTGAIRKHLHDNPANFDPRKFFAEATKAMKSICQARFEAFGAAGKASLIKP
                     LNLDEMHKRYASGSLKQQIK"
     misc_feature    complement(423251..424216)
                     /locus_tag="Hneap_0405"
                     /note="Tagatose-1,6-bisphosphate (TBP) aldolase and
                     related Type B Class II aldolases. TBP aldolase is a
                     tetrameric class II aldolase that catalyzes the reversible
                     condensation of dihydroxyacetone phosphate with
                     glyceraldehyde 3-phsophate to produce tagatose 1; Region:
                     TBP_aldolase_IIB; cd00947"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(423356..423358,423365..423367,
                     423377..423379,423386..423391,423395..423400,
                     423761..423763,424025..424030,424037..424039,
                     424049..424051,424061..424069,424076..424078,
                     424136..424138,424145..424153))
                     /locus_tag="Hneap_0405"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(423398..423403,423407..423409,
                     423527..423529,423533..423538,423629..423631,
                     423635..423643,423980..423985))
                     /locus_tag="Hneap_0405"
                     /note="active site"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(423536..423538,423638..423640,
                     423980..423982))
                     /locus_tag="Hneap_0405"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238477"
     misc_feature    complement(order(423527..423529,423533..423535,
                     423629..423631,423635..423637,423641..423643))
                     /locus_tag="Hneap_0405"
                     /note="Na+ binding site [ion binding]; other site"
                     /db_xref="CDD:238477"
     gene            complement(424313..425788)
                     /locus_tag="Hneap_0406"
                     /db_xref="GeneID:8533528"
     CDS             complement(424313..425788)
                     /locus_tag="Hneap_0406"
                     /EC_number="2.7.1.40"
                     /inference="protein motif:TFAM:TIGR01064"
                     /note="KEGG: tgr:Tgr7_2890 pyruvate kinase;
                     TIGRFAM: pyruvate kinase;
                     PFAM: pyruvate kinase barrel; pyruvate kinase alpha/beta"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate kinase"
                     /protein_id="YP_003262310.1"
                     /db_xref="GI:261855027"
                     /db_xref="InterPro:IPR001697"
                     /db_xref="InterPro:IPR015793"
                     /db_xref="InterPro:IPR015794"
                     /db_xref="InterPro:IPR018209"
                     /db_xref="GeneID:8533528"
                     /translation="MHAQNPPGYLSTKRRTKIVATLGPASDNPKVIADLISAGVDVVR
                     LNFSHGKAADHQHRADMVRAAASAQGKFVAILGDLQGPKIRIDRFKNGKVELADGAHF
                     TLDADLDRDSGDETTVGITYKALVTDSKAGDILLLDDGRIVLQVESVSGNKIQTKVVV
                     GGELSNNKGINRQGGGLSAPAITEKDREDIKTAAAIGVDYIAVSFPRSGEDIHEARRL
                     LQEAGCTAHIVAKIERAEAIECIRDIIQASDAIMIARGDLGVEIGDAELPAVQKAFIR
                     MARDMNRPVITATQMMETMITNPIPTRAEVFDVANAVLDGTDAVMLSAETAAGKHPVR
                     VVETMARICHRAEYQIEAKRGQPPLDIPFERIDQAIAYSAIYTANHLSVAAIVALTES
                     GATALWMSRVSTDIPIYAFTRNEVAARRMALYRGVQAVHFPYSSTDHAEVNRLTIEAL
                     TQMECLDDGDVVIITKGDLMGQMGGTNAMKIVRVGQIINAD"
     misc_feature    complement(424337..425749)
                     /locus_tag="Hneap_0406"
                     /note="Pyruvate kinase (PK):  Large allosteric enzyme that
                     regulates glycolysis through binding of the substrate,
                     phosphoenolpyruvate, and one or more allosteric effectors.
                     Like other allosteric enzymes, PK has a high substrate
                     affinity R state and a low...; Region: Pyruvate_Kinase;
                     cd00288"
                     /db_xref="CDD:238178"
     misc_feature    complement(424364..425749)
                     /locus_tag="Hneap_0406"
                     /note="pyruvate kinase; Provisional; Region: PRK05826"
                     /db_xref="CDD:235619"
     misc_feature    complement(order(424511..424519,424523..424525,
                     424529..424534,424541..424543,424574..424576,
                     424580..424582,424586..424588,424739..424744,
                     424748..424750,424835..424837,424841..424843,
                     424937..424939,424949..424954,425006..425008,
                     425114..425116,425147..425149,425168..425170,
                     425192..425194,425237..425251,425258..425260,
                     425276..425281,425534..425545,425567..425569,
                     425573..425575,425741..425746))
                     /locus_tag="Hneap_0406"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238178"
     misc_feature    complement(order(424922..424924,425018..425020,
                     425090..425092,425096..425098,425174..425176,
                     425555..425557,425651..425653,425657..425659))
                     /locus_tag="Hneap_0406"
                     /note="active site"
                     /db_xref="CDD:238178"
     gene            complement(425798..426997)
                     /gene="pgk"
                     /locus_tag="Hneap_0407"
                     /db_xref="GeneID:8533529"
     CDS             complement(425798..426997)
                     /gene="pgk"
                     /locus_tag="Hneap_0407"
                     /EC_number="2.7.2.3"
                     /inference="protein motif:PRIAM:2.7.2.3"
                     /note="Converts 3-phospho-D-glycerate to
                     3-phospho-D-glyceroyl phosphate during the glycolysis
                     pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="YP_003262311.1"
                     /db_xref="GI:261855028"
                     /db_xref="InterPro:IPR001576"
                     /db_xref="InterPro:IPR015911"
                     /db_xref="GeneID:8533529"
                     /translation="MANFLRMTDLDLAGKRVFIRADLNVPVKNGKVTSDARISASMAT
                     ITHCIKAGAKVMVTSHLGRPEEGIYSEENSLAPVAADMGAKLGKSVRLIKDWVDGGFN
                     VAPGEVVLLENVRFNAGEKKSLDETAKKYAALCDVFVMDAFGTAHRAEASTHGIAKFA
                     PVACAGILLAQELEALDKALANPARPMVAIVGGSKVSTKLTVLEALSEKVDQMVVGGG
                     IANTFIKAVGHNVGKSLCEDDLVPTAQMLMKKMEARGASIPVAVDVVVGTELPFLPGN
                     ENTPATLKPVDSVSDDDMIFDIGPKSAQELADIIMKAGTVVWNGPVGVFEYDQFGEGT
                     KTIAMAIAKTKAFTLAGGGDTIAAIQKYDIYDQVSYISTAGGAFLEYLEGKTLPAVAI
                     LEQRASA"
     misc_feature    complement(425813..426988)
                     /gene="pgk"
                     /locus_tag="Hneap_0407"
                     /note="phosphoglycerate kinase; Provisional; Region: pgk;
                     PRK00073"
                     /db_xref="CDD:234613"
     misc_feature    complement(order(426653..426655,426818..426820,
                     426887..426889,426926..426928,426932..426934))
                     /gene="pgk"
                     /locus_tag="Hneap_0407"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238195"
     misc_feature    complement(order(425879..425887,426449..426460))
                     /gene="pgk"
                     /locus_tag="Hneap_0407"
                     /note="hinge regions; other site"
                     /db_xref="CDD:238195"
     misc_feature    complement(order(425933..425941,426020..426031,
                     426035..426037,426041..426043,426113..426115,
                     426344..426346))
                     /gene="pgk"
                     /locus_tag="Hneap_0407"
                     /note="ADP binding site [chemical binding]; other site"
                     /db_xref="CDD:238195"
     misc_feature    complement(425936..425938)
                     /gene="pgk"
                     /locus_tag="Hneap_0407"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238195"
     gene            complement(427153..428151)
                     /locus_tag="Hneap_0408"
                     /db_xref="GeneID:8533530"
     CDS             complement(427153..428151)
                     /locus_tag="Hneap_0408"
                     /EC_number="1.2.1.12"
                     /inference="protein motif:TFAM:TIGR01534"
                     /note="KEGG: tgr:Tgr7_2892 glyceraldehyde-3-phosphate
                     dehydrogenase (phosphorylating);
                     TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase, type I;
                     PFAM: glyceraldehyde 3-phosphate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="YP_003262312.1"
                     /db_xref="GI:261855029"
                     /db_xref="InterPro:IPR000173"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="GeneID:8533530"
                     /translation="MTIKVGINGFGRIGRMVFRAAAKDFPEIEVVAINDLLDADYLAY
                     MLKYDSVHGRFDGDVSVDGNHLVVNGKRIRLTAERDPANLKWNEAGADIVIESTGFFL
                     TKETCQAHINAGAKKVIQSAPSKDDTPMFVYGVNHDKYAGENIVSAASCTTNCLAPVA
                     KVLNDAFGIKRGLMTTVHAATATQKTVDGPSAKDWRGGRGILENIIPSSTGAAKAVGV
                     VLPELNGKLTGMAFRVPTSDVSVVDLTVELNKETTYADICKAMKSASESGSLKGVLGY
                     TDDSVVSTDFRGVAQPSVFDAKAGIQLDPTFVKVVAWYDNEYGYTSNLMRMVKVIG"
     misc_feature    complement(427156..428148)
                     /locus_tag="Hneap_0408"
                     /note="Glyceraldehyde-3-phosphate
                     dehydrogenase/erythrose-4-phosphate dehydrogenase
                     [Carbohydrate transport and metabolism]; Region: GapA;
                     COG0057"
                     /db_xref="CDD:223135"
     misc_feature    complement(427699..428145)
                     /locus_tag="Hneap_0408"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase, NAD
                     binding domain; Region: Gp_dh_N; smart00846"
                     /db_xref="CDD:214851"
     misc_feature    complement(427210..427686)
                     /locus_tag="Hneap_0408"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase,
                     C-terminal domain; Region: Gp_dh_C; pfam02800"
                     /db_xref="CDD:251539"
     gene            complement(428269..430257)
                     /locus_tag="Hneap_0409"
                     /db_xref="GeneID:8533531"
     CDS             complement(428269..430257)
                     /locus_tag="Hneap_0409"
                     /inference="protein motif:TFAM:TIGR00232"
                     /note="TIGRFAM: transketolase;
                     PFAM: transketolase central region; transketolase;
                     KEGG: vcj:VCD_001133 transketolase"
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="YP_003262313.1"
                     /db_xref="GI:261855030"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR005478"
                     /db_xref="GeneID:8533531"
                     /translation="MSTRRELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNGY
                     LKHNPKNPQWPNRDRFVLSNGHGSMLIYSLLHLSGYELPMEELKNFRQLHSKTPGHPE
                     YGYTPGVETTTGPLGQGITNAVGFAIAEKMLAGQFNKPGHNVVDHYTYCFLGDGCMME
                     GISHEACSLAGTLGLGKLIAFYDDNGISIDGHVEGWFTDDTPARFEAYGWHVVRDVDG
                     HDAEAIDAAIREARSVNDKPTMICTKTVIGFGAPNLCGTHDCHGAALGEAEVKATRDN
                     LGWHHEPFVIPAEIYAGWDATEAGIRNESAWEDAMNAYAKAYPAEAAELKRRLAGDLP
                     ADFTSKMDAFIAEVAAKGETIATRKASQNSITAIAAILPEIVGGSADLAPSNLTTWKG
                     CRALTATESDANYIHYGVREFGMSAIMNGMVLHGGFVPFAATFLMFSEYARNALRMSA
                     LMKIGSIFVYTHDSIGLGEDGPTHQPVEQIATLRMIPRMNTWRPCDAVESAVAWKAAI
                     MRRDSPSTLIFSRQNLAHQNRTPEQIANIARGGYILRDCAGTPDLILIATGSEVALAT
                     AAAEKLAGKKVRVVSMPCTEVFDAQDPAYRESVLPAAVRARVAVEAGVTGFWGKYVGL
                     DGKVVGIDTFGESAPAGDLFKLFGFTVDNVVATAQSVL"
     misc_feature    complement(428272..430257)
                     /locus_tag="Hneap_0409"
                     /note="transketolase; Reviewed; Region: PRK12753"
                     /db_xref="CDD:183723"
     misc_feature    complement(429436..430233)
                     /locus_tag="Hneap_0409"
                     /note="Thiamine pyrophosphate (TPP) family, Transketolase
                     (TK) subfamily, TPP-binding module; TK catalyzes the
                     transfer of a two-carbon unit from ketose phosphates to
                     aldose phosphates. In heterotrophic organisms, TK provides
                     a link between glycolysis and the...; Region: TPP_TK;
                     cd02012"
                     /db_xref="CDD:238970"
     misc_feature    complement(order(429475..429477,429691..429693,
                     429697..429699,429703..429705,429778..429780,
                     429790..429795,429910..429912,429916..429918,
                     430060..430062))
                     /locus_tag="Hneap_0409"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238970"
     misc_feature    complement(order(429646..429648,429691..429696,
                     429742..429744,429754..429756,429763..429768,
                     429775..429786,429904..429906,429910..429915,
                     429952..429954,429958..429963,429985..429987))
                     /locus_tag="Hneap_0409"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238970"
     misc_feature    complement(428695..429183)
                     /locus_tag="Hneap_0409"
                     /note="Pyrimidine (PYR) binding domain of
                     1-deoxy-D-xylulose-5-phosphate synthase (DXS),
                     transketolase (TK), and related proteins; Region:
                     TPP_PYR_DXS_TK_like; cd07033"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(428722..428724,428788..428793,
                     428839..428841,428848..428850,428923..428928,
                     428935..428937,428992..429000,429004..429009,
                     429016..429033,429037..429039,429046..429048,
                     429115..429117,429133..429135,429139..429141))
                     /locus_tag="Hneap_0409"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(428797..428799,428803..428808,
                     428812..428817,428842..428844,428848..428850,
                     428929..428931,428935..428940,429022..429030,
                     429037..429039,429115..429117))
                     /locus_tag="Hneap_0409"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(428935..428937,428944..428946,
                     429022..429024,429028..429030))
                     /locus_tag="Hneap_0409"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(428296..428637)
                     /locus_tag="Hneap_0409"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            complement(430447..430998)
                     /locus_tag="Hneap_0410"
                     /db_xref="GeneID:8533532"
     CDS             complement(430447..430998)
                     /locus_tag="Hneap_0410"
                     /inference="protein motif:PFAM:PF00578"
                     /note="PFAM: alkyl hydroperoxide reductase/ thiol specific
                     antioxidant/ Mal allergen; redoxin;
                     KEGG: dar:Daro_3587 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase/ thiol specific
                     antioxidant/ Mal allergen"
                     /protein_id="YP_003262314.1"
                     /db_xref="GI:261855031"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="GeneID:8533532"
                     /translation="MVSTTTPICEFNRPAIDFSLPDTEGRLWTLQDCRGPKGLLVMFI
                     CNHCPYVQAILPKIVRDTAELKRSGINSVAIMSNDIADYPEDSPEHMHRLAREYDFSF
                     PYLYDETQEIAKAYNAVCTPDFFGYNADLKLQFRGRLDASGRQNQPDAPRELFHAMQL
                     IAETGTGPSDQTPSIGCSIKWRP"
     misc_feature    complement(430456..430962)
                     /locus_tag="Hneap_0410"
                     /note="Peroxiredoxin (PRX)-like 1 family; hypothetical
                     proteins that show sequence similarity to PRXs. Members of
                     this group contain a conserved cysteine that aligns to the
                     first cysteine in the CXXC motif of TRX. This does not
                     correspond to the peroxidatic...; Region: PRX_like1;
                     cd02969"
                     /db_xref="CDD:239267"
     misc_feature    complement(430855..430857)
                     /locus_tag="Hneap_0410"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:239267"
     gene            431225..432082
                     /locus_tag="Hneap_0411"
                     /db_xref="GeneID:8533533"
     CDS             431225..432082
                     /locus_tag="Hneap_0411"
                     /inference="similar to AA sequence:KEGG:Tgr7_1818"
                     /note="KEGG: tgr:Tgr7_1818 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262315.1"
                     /db_xref="GI:261855032"
                     /db_xref="GeneID:8533533"
                     /translation="MSVQGLTVPLRFRNGGFARKIGRYISGFVALWLCFVMSVSAEAA
                     ALKFAIPPFLPKAELEKSFGPLVQRLSEMTGTPIDLEVFPNYLAFWQETRTGSPFDIA
                     LDAAPTTDFRVARQHWHVIAKLSGTVTQSLVTGPNDAVLDPSELINKKIAVQPSPSVS
                     ALTLYQLFPNPVQQPQLVFVDSNRAAAEAVKAGEVAAAVIPTPIAAGYPSLNMVTTTA
                     PLPFLAVSVSPNVSPELAKSLQSALIRLSETPEGEAMLQQSQLRAFTKATDSDYAGQE
                     KLLEGTFGY"
     misc_feature    431309..432064
                     /locus_tag="Hneap_0411"
                     /note="ABC-type phosphate/phosphonate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: PhnD; COG3221"
                     /db_xref="CDD:225762"
     misc_feature    <431519..431977
                     /locus_tag="Hneap_0411"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(431558..431560,431711..431713,431825..431827)
                     /locus_tag="Hneap_0411"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(431774..431776,431786..431788,431804..431806)
                     /locus_tag="Hneap_0411"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    431885..431902
                     /locus_tag="Hneap_0411"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            432113..433252
                     /locus_tag="Hneap_0412"
                     /db_xref="GeneID:8533534"
     CDS             432113..433252
                     /locus_tag="Hneap_0412"
                     /inference="similar to AA sequence:KEGG:BMULJ_05850"
                     /note="KEGG: bmj:BMULJ_05850 ISBmu8 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="ISBmu8 transposase"
                     /protein_id="YP_003262316.1"
                     /db_xref="GI:261855033"
                     /db_xref="GeneID:8533534"
                     /translation="MNHYAYWRSELENPLRRLPMKSPILLEDEQRDVLERWSRSRTVS
                     LRWRERAQIILAATEKVSDAVIAARLGTTRHRVARWRRRFASGGVEALKKDRPRAGRP
                     PRVDAAKVKQIVRLTTQTQPTHATQWSTRSMAKRVGVSDTTVLRVWHAHGLKPHRVRT
                     FKLSNDPQFTEKLEDIVGLYLAPPEHALVLCCDEKSQIQALDRTQPGLPIKKGRAQTM
                     THDYKRNGTTTLFAALNILDGQVIGHCQSRHTHVEWLKFLKKVDRNTPKGKELHLIVD
                     NYATHKHPEVKAWLALHPRFHIHFTPTSASWLNMVERFFRSITVDRLRCGVFHSVADL
                     EKAISGYINHYNKNPKPFVWTAKANDILEKVVRAQTTLDKMGQTA"
     misc_feature    432260..432568
                     /locus_tag="Hneap_0412"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    432362..432556
                     /locus_tag="Hneap_0412"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    432743..433117
                     /locus_tag="Hneap_0412"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     cl19249"
                     /db_xref="CDD:267602"
     gene            433325..434497
                     /locus_tag="Hneap_0413"
                     /db_xref="GeneID:8533535"
     CDS             433325..434497
                     /locus_tag="Hneap_0413"
                     /EC_number="2.5.1.6"
                     /inference="protein motif:TFAM:TIGR01034"
                     /note="catalyzes the formation of S-adenosylmethionine
                     from methionine and ATP; methionine adenosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="YP_003262317.1"
                     /db_xref="GI:261855034"
                     /db_xref="InterPro:IPR002133"
                     /db_xref="GeneID:8533535"
                     /translation="MTVHREPVHFFTSESVAEGHPDKIADQISDAVLDAILRKDPHAR
                     VACETLVKTGFVVLAGEVTTSAWVDLDELVRKVIVDIGYDSSELGFDGNTCGVLNAIG
                     KQSSDIAQGVDRMVAEEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKS
                     HTLSWLRPDAKSQVTFRYKKGKPVGIDAVVLSTQHGPEVSQKDLREAVMELIIKPTLP
                     ADWLDEKTKYHINPTGNFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKV
                     DRSAAYAGRYVAKNIVAAGLADRCEIQVSYAIGVAEPTSISIDTFGTGKISDQRITDL
                     VRAHFDLRPYGIVRMLDLIRPIYQKTAAYGHFGREDADFTWEKTDKADALRADAGL"
     misc_feature    433349..434494
                     /locus_tag="Hneap_0413"
                     /note="S-adenosylmethionine synthetase; Validated; Region:
                     PRK05250"
                     /db_xref="CDD:235374"
     misc_feature    433349..433639
                     /locus_tag="Hneap_0413"
                     /note="S-adenosylmethionine synthetase, N-terminal domain;
                     Region: S-AdoMet_synt_N; pfam00438"
                     /db_xref="CDD:249858"
     misc_feature    433676..434032
                     /locus_tag="Hneap_0413"
                     /note="S-adenosylmethionine synthetase, central domain;
                     Region: S-AdoMet_synt_M; pfam02772"
                     /db_xref="CDD:251520"
     misc_feature    434036..434455
                     /locus_tag="Hneap_0413"
                     /note="S-adenosylmethionine synthetase, C-terminal domain;
                     Region: S-AdoMet_synt_C; pfam02773"
                     /db_xref="CDD:111646"
     gene            434628..436040
                     /locus_tag="Hneap_0414"
                     /db_xref="GeneID:8533536"
     CDS             434628..436040
                     /locus_tag="Hneap_0414"
                     /EC_number="3.3.1.1"
                     /inference="protein motif:TFAM:TIGR00936"
                     /note="catalyzes the formation of L-homocysteine from
                     S-adenosyl-L-homocysteine"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-L-homocysteine hydrolase"
                     /protein_id="YP_003262318.1"
                     /db_xref="GI:261855035"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="GeneID:8533536"
                     /translation="MQNPNAFKLAIDCKVADITLADYGRKELRIAEREMPALMAIRAK
                     YREAQPLAGARIVGSLHMTVQTAVLIETLVDLGASVRWSSCNIFSTQDHAAAAIAAAG
                     IPVFAWKGETEEEYWWCIEQTITGPNGWTPNLILDDGGDLTGLIHDKHPELLAGIHGV
                     SEETTTGVHRLLDMLKAGTLKVPAINVNDSVTKSKNDNKYGCRHSLNDAIKRATDHLL
                     SGKQALVIGYGDVGKGSAASLRQEGMIVKVTEIDPICAMQACMDGYEVVSPYLNGHND
                     GSDTCVDKQLLGKIDLIVTTTGNVNVCDAPMLKALKNGAVVSNIGHFDNEIDTAYMRK
                     NWVWEEIKPQVHKIYRETAPGSEPNLDSDNYLILLSEGRLVNLGNATGHPSRIMDGSF
                     ANQVLAQLHLFANKFADQPAARKAELLRVEVLPKALDEEVARYMVAGFGGVLTKMTDK
                     QASYLGVEVNGPYKPDSYRY"
     misc_feature    434655..436019
                     /locus_tag="Hneap_0414"
                     /note="S-adenosyl-L-homocysteine hydrolase; Provisional;
                     Region: PRK05476"
                     /db_xref="CDD:235488"
     misc_feature    434691..435998
                     /locus_tag="Hneap_0414"
                     /note="S-Adenosylhomocysteine Hydrolase, NAD-binding and
                     catalytic domains; Region: SAHH; cd00401"
                     /db_xref="CDD:240619"
     misc_feature    order(434694..434696,434703..434705,434715..434717,
                     434724..434729,435132..435134,435141..435146,
                     435192..435194,435198..435200,435210..435215,
                     435225..435227,435234..435239,435249..435251,
                     435258..435263,435270..435290,435312..435317,
                     435324..435326,435351..435356,435360..435362,
                     435375..435401,435405..435416,435420..435431,
                     435465..435467,435519..435533,435561..435569,
                     435600..435602,435648..435653,435666..435668,
                     435768..435770,435777..435779,435783..435788,
                     435795..435797,435894..435896,435912..435917,
                     435924..435929,435936..435938,435945..435950,
                     435954..435962,435966..435968,435975..435980,
                     435987..435992)
                     /locus_tag="Hneap_0414"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240619"
     misc_feature    order(434808..434810,434814..434816,434820..434825,
                     435039..435041,435114..435119,435204..435206,
                     435216..435218,435756..435758,435771..435776,
                     435789..435791,435801..435803)
                     /locus_tag="Hneap_0414"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240619"
     misc_feature    order(434808..434810,435039..435041,435114..435116,
                     435216..435218)
                     /locus_tag="Hneap_0414"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240619"
     misc_feature    order(435117..435125,435219..435221,435231..435233,
                     435306..435308,435312..435320,435372..435383,
                     435390..435392,435513..435524,435531..435533,
                     435585..435593,435747..435749,435753..435755,
                     435774..435776)
                     /locus_tag="Hneap_0414"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240619"
     gene            436058..436909
                     /locus_tag="Hneap_0415"
                     /db_xref="GeneID:8533537"
     CDS             436058..436909
                     /locus_tag="Hneap_0415"
                     /EC_number="1.5.1.20"
                     /inference="protein motif:TFAM:TIGR00676"
                     /note="KEGG: tgr:Tgr7_2896 5,10-methylenetetrahydrofolate
                     reductase;
                     TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
                     PFAM: methylenetetrahydrofolate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="YP_003262319.1"
                     /db_xref="GI:261855036"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004620"
                     /db_xref="GeneID:8533537"
                     /translation="MHTPLSCEFFPPKSDEGALKLRAVTEQLTSALKPEYFSVTYGAG
                     GSTQDRSFATVQAIQTESGVPAAPHLSCIGSTRASIAAILDQYRALGIKRIVALRGDL
                     PSGMRDPGDFRFASELVAFIREHSGDWFHIEVAAYPEFHPQSANARADLLHFKQKVEA
                     GVDGAITQYFYSIEAYARFLDDCEKLQIMIPIVPGIMPISNYTQLARFSDASGADLPR
                     WLRKRLEAFGDDMDGLRAFGHDVVTGLTSDLVQAGAPGLHFYTMNQAVPVINICRDAG
                     LMPSQPN"
     misc_feature    436070..436876
                     /locus_tag="Hneap_0415"
                     /note="Methylenetetrahydrofolate reductase (MTHFR).
                     5,10-Methylenetetrahydrofolate is reduced to
                     5-methyltetrahydrofolate by methylenetetrahydrofolate
                     reductase, a cytoplasmic, NAD(P)-dependent enzyme.
                     5-methyltetrahydrofolate is utilized by methionine
                     synthase...; Region: MTHFR; cd00537"
                     /db_xref="CDD:238299"
     misc_feature    order(436178..436180,436262..436264,436349..436357,
                     436397..436402,436460..436462,436466..436468,
                     436478..436480,436484..436486,436505..436507,
                     436514..436516,436523..436528,436553..436555,
                     436559..436561,436835..436837)
                     /locus_tag="Hneap_0415"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:238299"
     gene            437084..437998
                     /locus_tag="Hneap_0416"
                     /db_xref="GeneID:8533538"
     CDS             437084..437998
                     /locus_tag="Hneap_0416"
                     /inference="protein motif:PFAM:PF01145"
                     /note="PFAM: band 7 protein;
                     SMART: band 7 protein;
                     KEGG: ddr:Deide_07280 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262320.1"
                     /db_xref="GI:261855037"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="InterPro:IPR001972"
                     /db_xref="InterPro:IPR018080"
                     /db_xref="GeneID:8533538"
                     /translation="MGTFAIVLLVLAAATIFAGIKQVPQGSMWTVERFGRYTRTLEPG
                     LNLIVPYIDRIGRKINVMEQVLDVSSQEIITRDNAMIKVDGVVFFQVLDPARAAYEVH
                     QLDYAILNLVITNIRNVMGSMDLDEILSRRDDINARLLSVVDEATSPWGTKITRIEIK
                     DITPPQDLVAAMGRQMKAEREKRANILEAEGFRQAAILKAEGEKQSNILQAEGDREAA
                     FRDAEARERLSQAEAFATKTVSEAIAAGNVQAINYFVATKYIEAFQAVATAPNQKVIM
                     LPIEASNMLGSLEGIAELAKEAFKVNPK"
     misc_feature    437084..437962
                     /locus_tag="Hneap_0416"
                     /note="Membrane protease subunits, stomatin/prohibitin
                     homologs [Posttranslational modification, protein
                     turnover, chaperones]; Region: HflC; COG0330"
                     /db_xref="CDD:223407"
     misc_feature    437255..437581
                     /locus_tag="Hneap_0416"
                     /note="Paraslipin or slipin-2 (SLP-2, a subgroup of the
                     stomatin-like proteins (slipins) family; belonging to the
                     SPFH (stomatin, prohibitin, flotillin, and HflK/C)
                     superfamily; Region: SPFH_paraslipin; cd08829"
                     /db_xref="CDD:259811"
     gene            438038..438391
                     /locus_tag="Hneap_0417"
                     /db_xref="GeneID:8533539"
     CDS             438038..438391
                     /locus_tag="Hneap_0417"
                     /inference="similar to AA sequence:KEGG:Dbac_1947"
                     /note="KEGG: dba:Dbac_1947 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262321.1"
                     /db_xref="GI:261855038"
                     /db_xref="GeneID:8533539"
                     /translation="MNMTRNFFAALSVLVVLALAGCSSGAPSSSDVEQALKSGMAKAM
                     SQASSVEGGQAVSAMMAKVEIKSVKVLECNKDASGTGFDCKVETEVSTPFAGDQKNTR
                     MLHLVKGSDGWVIAR"
     gene            438432..438884
                     /locus_tag="Hneap_0418"
                     /db_xref="GeneID:8533540"
     CDS             438432..438884
                     /locus_tag="Hneap_0418"
                     /inference="protein motif:PFAM:PF01957"
                     /note="PFAM: protein of unknown function DUF107;
                     KEGG: xau:Xaut_1881 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262322.1"
                     /db_xref="GI:261855039"
                     /db_xref="InterPro:IPR002810"
                     /db_xref="GeneID:8533540"
                     /translation="MPLDTLIWDYWAWFILGVLLVVVEIFAPSSFFLWLGVAAGVVGG
                     ISFFMPDIGWPVQIGLFAVLSIVAVLIGRRVFVPNKQATDHPMLNRRGQQYIGRHFTL
                     EAPIVNGVGWVRIGDSRWRVLGPDMPSGSVVEVTSVDSSNLVVAPVTR"
     misc_feature    438453..438875
                     /locus_tag="Hneap_0418"
                     /note="Membrane protein implicated in regulation of
                     membrane protease activity [Posttranslational
                     modification, protein turnover, chaperones / Intracellular
                     trafficking and secretion]; Region: COG1585"
                     /db_xref="CDD:224501"
     gene            438898..440259
                     /locus_tag="Hneap_0419"
                     /db_xref="GeneID:8533541"
     CDS             438898..440259
                     /locus_tag="Hneap_0419"
                     /inference="protein motif:TFAM:TIGR00508"
                     /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase;
                     PFAM: aminotransferase class-III;
                     KEGG: mca:MCA0017
                     adenosylmethionine--8-amino-7-oxononanoate transaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="YP_003262323.1"
                     /db_xref="GI:261855040"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR005815"
                     /db_xref="GeneID:8533541"
                     /translation="MMSSNQSWIDRDLAVLWHPCTQMKEHETLPPIPVARGEGSWLYD
                     FDGRRYLDVISSWWVNLFGHANPVINARLKAQLDQLEHVILAGFSHQPVVELSERLVQ
                     LTPPGLERVFFADNGASGVEVALKMSFHYWRNQGRAEKTRFIALENSYHGETMGALGV
                     GNIPIFTETYAPLIQPAFIAPSPDCQQAEPGESCADVTERALAAMRALLERVASQTCA
                     IIIEPLVQCAAGMRMHEPAYLTGLRALCDEFEVHLIADEIAVGFGRTGTLFACEQGGI
                     TPDILCLSKGITGGYLPLSAVLTTEDIYQAFYCEAPASRAFLHSHSYTGNPLACTAAL
                     ATLDIFEQNNVIERNRQRGAMIDRLTAPLAELPNIAHMRRCGMIVAMDLVDDRAGNRG
                     KPFPRAERRNQKAYRYALDHEVLLRPLGNTIYWMPPYIMDDDQWQMLADVTFDAVRFA
                     VQD"
     misc_feature    438910..440256
                     /locus_tag="Hneap_0419"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    438919..440250
                     /locus_tag="Hneap_0419"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(439243..439251,439345..439350,439354..439356,
                     439561..439563,439663..439665,439669..439674,
                     439750..439752)
                     /locus_tag="Hneap_0419"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(439246..439251,439345..439350,439561..439563,
                     439663..439665,439672..439674,439750..439752)
                     /locus_tag="Hneap_0419"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    439750..439752
                     /locus_tag="Hneap_0419"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            440276..441010
                     /locus_tag="Hneap_0420"
                     /db_xref="GeneID:8533542"
     CDS             440276..441010
                     /locus_tag="Hneap_0420"
                     /inference="protein motif:PFAM:PF04452"
                     /note="PFAM: protein of unknown function DUF558;
                     KEGG: pfo:Pfl01_5288 16S ribosomal RNA methyltransferase
                     RsmE"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003262324.1"
                     /db_xref="GI:261855041"
                     /db_xref="InterPro:IPR006700"
                     /db_xref="GeneID:8533542"
                     /translation="MRIPRIYLDAALAEGATLPLPAERLNYLKNVLRLRDGQALRVFD
                     GQNHEADATLSLGKREGSLAIGRVAAHSVESPLQTHLIQAMGKGEKMDWVIQKAVELG
                     VTRFTPVSTERSVVELKGERADKRHARFIDIAIGACEQSGRNFLPRVDPILSLEEALT
                     QTDAALKWVLHPNPGSGAALPAVAPDSVALLIGPEGGLSDHEVEAAIASGFMPLTLGS
                     RVLRTETAPIVALSVLQMQWGDFFVG"
     misc_feature    440282..440998
                     /locus_tag="Hneap_0420"
                     /note="16S ribosomal RNA methyltransferase RsmE;
                     Provisional; Region: PRK11713"
                     /db_xref="CDD:236959"
     gene            441129..442227
                     /locus_tag="Hneap_0421"
                     /db_xref="GeneID: