GenomeNet

Database: RefSeq
Entry: NC_014025
LinkDB: NC_014025
Original site: NC_014025 
LOCUS       NC_014025              66985 bp    DNA     circular CON 30-JUL-2015
DEFINITION  Bacillus megaterium QM B1551 plasmid pBM500, complete sequence.
ACCESSION   NC_014025
VERSION     NC_014025.1  GI:294509091
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603354
            Assembly: GCF_000025825.1
KEYWORDS    RefSeq.
SOURCE      Bacillus megaterium QM B1551
  ORGANISM  Bacillus megaterium QM B1551
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
REFERENCE   1  (bases 1 to 66985)
  AUTHORS   Eppinger,M., Bunk,B., Johns,M.A., Edirisinghe,J.N., Kutumbaka,K.K.,
            Koenig,S.S., Huot Creasy,H., Rosovitz,M.J., Riley,D.R.,
            Daugherty,S., Martin,M., Elbourne,L.D., Paulsen,I., Biedendieck,R.,
            Braun,C., Grayburn,S., Dhingra,S., Lukyanchuk,V., Ball,B.,
            Ul-Qamar,R., Seibel,J., Bremer,E., Jahn,D., Ravel,J. and Vary,P.S.
  TITLE     Genome sequences of the biotechnologically important Bacillus
            megaterium strains QM B1551 and DSM319
  JOURNAL   J. Bacteriol. 193 (16), 4199-4213 (2011)
   PUBMED   21705586
REFERENCE   2  (bases 1 to 66985)
  AUTHORS   Eppinger,M., Bunk,B., Johns,M.A., Edirisinghe,J.N., Kutumbaka,K.K.,
            Riley,D.R., Huot-Creasy,H., Koenig,S.S.K., Galens,K., Orvis,J.,
            Creasy,T., Biedendieck,R., Braun,C., Grayburn,S., Jahn,D.,
            Vary,P.S. and Ravel,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2010) Institute for Genome Sciences, University
            of Maryland School of Medicine, 801 West Baltimore St, Baltimore,
            MD 21201, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP001988.
            Bacteria available from the Bacillus Genetic Stock Center,
            (http://www.bgsc.org/), The Ohio State University, 776 Biological
            Sciences Building, 484 West 12th Avenue, Columbus. Ohio 43210 under
            inventory No. 7A116 or from Patricia S. Vary (pvary@niu.edu), Dept.
            of Biological Sciences, Northern Illinois University, DeKalb, IL
            60115.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 07/30/2015 19:45:07
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 5,528
            CDS                                       5,264
            Pseudo Genes                           :: 90
            rRNAs                                  :: 13, 12, 12 (5S, 16S, 23S)
            complete rRNAs                         :: 13, 12, 12 (5S, 16S, 23S)
            tRNAs                                  :: 137
            ncRNA                                  :: 0
            Frameshifted Genes                     :: 44
            Frameshifted Genes On Monomer Runs     :: 4
            Frameshifted Genes Not On Monomer Runs :: 0
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..66985
                     /organism="Bacillus megaterium QM B1551"
                     /mol_type="genomic DNA"
                     /strain="QM B1551"
                     /db_xref="taxon:545693"
                     /plasmid="pBM500"
     gene            join(66985..66985,1..1298)
                     /locus_tag="BMQ_RS26140"
                     /old_locus_tag="BMQ_pBM50001"
     CDS             join(66985..66985,1..1298)
                     /locus_tag="BMQ_RS26140"
                     /old_locus_tag="BMQ_pBM50001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016097945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049787065.1"
                     /db_xref="GI:908643048"
                     /translation="MNKILTCYLPDVNTFNGRFTWLWKEKPTLRKKKEAFLETLRTHF
                     KQQQVALHKVFPKKRMEMLDYVIYNLVATGIQAIHSKTLMQKFDVSQSTVSRFVKSLK
                     ETPFMIVARYIKEDTTGAHPDSYVFILKSHTNFNQICEEIFFAHDTTGVQTLQQEEMT
                     TPVTTPVTTPVTSPERAENVDTPSFEGEKTSSPFINLDLPKNHLTNHLISASQSFAYI
                     KGVPKKVNNVYAGKYGHQLKDFYARIQNAAKAVKRDTEIEIVKEQVHEVAYTAIVGLD
                     KYVHEANHKGTPLSLDEMCRLVYQIAYNQFTNLLTGNTEEQPSESDIHTEAETAALFT
                     PKHIIRKEIVPAWLKVEKEQKECTQEPALSLDEQLEMIQLKQDLGQELTPEEETLLQE
                     HSSTYSSLEMAQLKQDLGQALTPEEQALLHQQDQLKGSVS"
     gene            1406..2173
                     /locus_tag="BMQ_RS26145"
                     /old_locus_tag="BMQ_pBM50002"
     CDS             1406..2173
                     /locus_tag="BMQ_RS26145"
                     /old_locus_tag="BMQ_pBM50002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_013060105.1"
                     /db_xref="GI:502825129"
                     /translation="MPHKMTLTGSATGPLREYDRYVAFDMREKGSPSAPKGLKKSTFI
                     SYTVFVAKKAFNKTGLTKKSIMHEKILIQGEPTLDIPIDECPGEIGIICFQITVLPNK
                     NDKEANESKDKKEAKLEVSKAQQEVAATRQEEKQNPVSQPVATEAKTIQPEAKEMPVQ
                     EKKAAPQKKQLPTQPKGTQDVVNFDEIIVPEAFLKTRPNPVKTEEVIEFVKRTGHLDK
                     PLTIDKGSKILKDGYRRYIVAKTVKMDKVPVVYEYQK"
     gene            2313..3065
                     /locus_tag="BMQ_RS26150"
                     /old_locus_tag="BMQ_pBM50003"
     CDS             2313..3065
                     /locus_tag="BMQ_RS26150"
                     /old_locus_tag="BMQ_pBM50003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003275286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041816902.1"
                     /db_xref="GI:754204102"
                     /translation="MATLIPKLSIDEDSVQFFENYIRFDVMVGTGEHTSREILDISIF
                     SDDKPEFDHRKFEFDYEKPRKAMVFTGWKKGPIELSLLHVYREDSKYYLDTEIVYIGQ
                     AFGENGERLPAEELMSDPMLQKVEEALLREYPEKDLALLLLEFNSQLLEEIDSEDEDL
                     IQLQEITKNPSLELNNQILNATEAALINYFKPEYNKKLNNDFSNVEDHGLHYHSVTVQ
                     VHPDIMGLKLFSKEKTYLSNDPIVSSPLHSNS"
     gene            3386..3955
                     /locus_tag="BMQ_RS26155"
                     /old_locus_tag="BMQ_pBM50004"
     CDS             3386..3955
                     /locus_tag="BMQ_RS26155"
                     /old_locus_tag="BMQ_pBM50004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012745165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060107.1"
                     /db_xref="GI:502825131"
                     /translation="MSEQLGYFAKQVCGKLKLNPNTLRKWAIELEENGYKFERNNKGP
                     NGQRIYYERDINIIAEFKVLLERTHSVENTAKLLMKRVEEDSNAEITHGVREEKERSN
                     PITVTFTREELEQYTRGIIEETSAKVAAEVSAQTAEAVYKKMENLIEQRDHKLINQMN
                     ESMEQRRLEIAAAREEPASSFWSRLFNRK"
     gene            4861..5088
                     /locus_tag="BMQ_RS26160"
                     /old_locus_tag="BMQ_pBM50007"
     CDS             4861..5088
                     /locus_tag="BMQ_RS26160"
                     /old_locus_tag="BMQ_pBM50007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013060110.1"
                     /db_xref="GI:502825134"
                     /translation="MFWWKNPKRSKFGKWLDKNGIQQTDFAMKSNVSRRTIWTICNDK
                     NYIPSATIVKKVMDAVKMVDSSKQPKDFFDI"
     gene            complement(5572..6804)
                     /locus_tag="BMQ_RS26165"
                     /old_locus_tag="BMQ_pBM50008"
     CDS             complement(5572..6804)
                     /locus_tag="BMQ_RS26165"
                     /old_locus_tag="BMQ_pBM50008"
                     /EC_number="1.14.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_013060111.1"
                     /db_xref="GI:502825135"
                     /translation="MKKVTVDDFSSPENMHDVIGFYKKLTEHQEPLIRLDDYYGLGPA
                     WVALRHDDVVTILKNPRFLKDVRKFTPLQDKKDSIDDSTSASKLFEWMMNMPNMLTVD
                     PPDHTRLRRLASKAFTPRMIENLRPRIQQITNELLDSVEGKRNMDLVADFSFPLPIIV
                     ISEMLGIPPLDQKRFRDWTDKLIKAAMDPSQGAVVMETLKEFIDYIKKMLVEKRNHPD
                     DDVMSALLQAHEQEDKLSENELLSTIWLLITAGHETTAHLISNGVLALLKHPEQMRLL
                     RDNPSLLPSAVEELLRYAGPVMIGGRFAGEDIIMHGKMIPKGEMVLFSLVAANIDSQK
                     FSYPEGLDITREENEHLTFGKGIHHCLGAPLARMEAHIAFGTLLQRFPDLRLAIESEQ
                     LVYNNSTLRSLKSLPVIF"
     gene            complement(6957..7652)
                     /locus_tag="BMQ_RS26170"
                     /old_locus_tag="BMQ_pBM50009"
     CDS             complement(6957..7652)
                     /locus_tag="BMQ_RS26170"
                     /old_locus_tag="BMQ_pBM50009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011106174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060112.1"
                     /db_xref="GI:502825136"
                     /translation="MSFRLSQRDKDIIAFINQFRAVDRDSLVDLFFKQLKSPVNACNS
                     VMVRLYRLGVIERTQQYSPTVYLPVDAKIKKNSQKILHFLSVLDVYKQMCAYSVPKHV
                     IVEDKPTGRKGGIEPDLFCIFKGSPFWIEIQRNQYSEQKMQAKINLYEEFFFSDEWKA
                     LQWQSEDRAALFPSVMVITPVRYAVASNHIRIIQVASIHELMEKYKSSSKQQKEARSK
                     TDPSSGGIKINLT"
     gene            complement(7649..8782)
                     /locus_tag="BMQ_RS26175"
     CDS             complement(7649..8782)
                     /locus_tag="BMQ_RS26175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013059939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_041816903.1"
                     /db_xref="GI:754204104"
                     /translation="MFEKLKLRGKLIKAFRTAEIYRVIKRGDRTSYQFPKIHRIDHQH
                     TYTRYAFSLLNGIDPELLNKKRWALRQVLGSNIEVNGSLKNFSITVHHKSLPKMLTYS
                     YEAIHAHIEKMELPVCIGQDIYGNLVSWDFADLETLLISGEIGAGKSSLMRVILTTWV
                     KYTSPDDLRLVLVDLKRADLGLFHGIEHVDALCFEAKDMRKPFSLLRAEMYRRGDLLL
                     EHGVTHISRLPFKLPRIVVVVDEMSIIKRETELVEIIQQFASQGRALGVHTIIAMQRP
                     DSDLLNSALKANLRVRISGRQADATNAKVAGVIGAEEIDAAARGRMKIKIDEVKEFQA
                     FFLDEGDCKEILSPYKALVHDPEPDIEVASQSIFGLLEKEEQR"
     gene            complement(8794..9093)
                     /locus_tag="BMQ_RS26180"
     CDS             complement(8794..9093)
                     /locus_tag="BMQ_RS26180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016766542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041816904.1"
                     /db_xref="GI:754204105"
                     /translation="MRKTQRFPFRKIFSPSPKSSLKRPRPFKAYSFVPFSPLALLDPT
                     ILTKGGIVLGIAFIEQILNRWGVMDLADQFEKVMRFILPVTFYGALFYFFATFMF"
     gene            complement(9786..10028)
                     /locus_tag="BMQ_RS26185"
                     /old_locus_tag="BMQ_pBM50011"
     CDS             complement(9786..10028)
                     /locus_tag="BMQ_RS26185"
                     /old_locus_tag="BMQ_pBM50011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060114.1"
                     /db_xref="GI:502825138"
                     /translation="MNKKKSNYIIFSLWFLVLFFLWIIISLSAGTNGQWWSMYRFNPE
                     KYGPWALEFSYIKIIMAAVISLLIAYVVAFVLTRKK"
     gene            complement(10191..10883)
                     /locus_tag="BMQ_RS26190"
                     /old_locus_tag="BMQ_pBM50012"
     CDS             complement(10191..10883)
                     /locus_tag="BMQ_RS26190"
                     /old_locus_tag="BMQ_pBM50012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013373793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060115.1"
                     /db_xref="GI:502825139"
                     /translation="MATNYKYSKELWLNGRPQLHVIKTKISNICTETICKPLTDTSYY
                     GINGGFFDSRDYHKTPNASRAICVDTGESGKKITVGGKTFYKNYNYNNTSSNPISRKT
                     AVIYTVSGTKKMTSMYAKTRDNVAAKYPKYNQIIGGMDYSSKAWGTKAYSAPTQRTVL
                     AWSGSYAYLIVTEVAMSIPGLKKAVEQLGLNSANSIVLDGSGSTSMKCKEFVKKGDKR
                     HIFNMVRLFKTS"
     gene            complement(11014..11205)
                     /locus_tag="BMQ_RS26195"
                     /old_locus_tag="BMQ_pBM50013"
     CDS             complement(11014..11205)
                     /locus_tag="BMQ_RS26195"
                     /old_locus_tag="BMQ_pBM50013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009792170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060116.1"
                     /db_xref="GI:502825140"
                     /translation="MLYTNEEIEEVLICLEYKLRKSLRETHPKYREDLAQNLRESIVR
                     KMKSDTLHKSPSFFTLINQ"
     gene            complement(11387..11923)
                     /locus_tag="BMQ_RS26200"
                     /old_locus_tag="BMQ_pBM50015"
     CDS             complement(11387..11923)
                     /locus_tag="BMQ_RS26200"
                     /old_locus_tag="BMQ_pBM50015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017379718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase sigma-70 factor"
                     /protein_id="WP_013060118.1"
                     /db_xref="GI:502825142"
                     /translation="MLKIKNPLIQGFLKEEENYSLFKKYQLEPTQKNEQKLDNKFKKY
                     YLKIRAISYFSKVIHFESKKFDNKHRTYNKRFLSILDKPVPESDNGTLIDLLIDSSTN
                     YCTEEVPSKKLEDYIENPSLYLSIKKLSSKQKKILYLAYIKDLKDVEIARYLNVSQQY
                     ITRTRNKTLLKLRGDLSD"
     gene            complement(12773..13345)
                     /locus_tag="BMQ_RS26205"
                     /old_locus_tag="BMQ_pBM50017"
     CDS             complement(12773..13345)
                     /locus_tag="BMQ_RS26205"
                     /old_locus_tag="BMQ_pBM50017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013060120.1"
                     /db_xref="GI:502825144"
                     /translation="MSKQIDPRVLRTRKLIMDALIELSMKKEFKDITIKDITTVATVN
                     RATFYYHFMDKYDLLEKVLSESIMREVLQEVSTHEVINEETIEAIFLSIIKFQTSLSN
                     QCQQNYEAFMPQIETIFKKELQAFFSEWGKKQWNNPNKMEVEAGAVMLSWTLYGAAVH
                     WMQNQTTEPEDYLMSLMSFIKNWNEHINLI"
     gene            13494..14138
                     /locus_tag="BMQ_RS26210"
                     /old_locus_tag="BMQ_pBM50018"
     CDS             13494..14138
                     /locus_tag="BMQ_RS26210"
                     /old_locus_tag="BMQ_pBM50018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_041816905.1"
                     /db_xref="GI:754204107"
                     /translation="MKITIFGATGQIGQLLVTQALQAGYDVTAYSRRPNALNIKHEKL
                     QIIVGDLTDQGKLREAILERDVVVSALGPTMSMKRQVLDLPITQGHKAIISVMEEYGP
                     KRFITLATPTISAKEDVKQLVTQLPSIMAKLLYPTGYAEMKEIEKLIENSRLDWTVVR
                     MLNPNMKTNGNGYSVSFGDTKGKMNVSRYNVAKCMLEATQKDEWVHKMPIVFNN"
     gene            14358..14981
                     /locus_tag="BMQ_RS26215"
                     /old_locus_tag="BMQ_pBM50019"
     CDS             14358..14981
                     /locus_tag="BMQ_RS26215"
                     /old_locus_tag="BMQ_pBM50019"
                     /EC_number="1.13.11.39"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005199843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biphenyl-2,3-diol 1,2-dioxygenase III"
                     /protein_id="WP_013060122.1"
                     /db_xref="GI:502825146"
                     /translation="MSNQENKKITPILHHIGLTTGRFEEMISWYNNVLGMEPVHYSEN
                     PAGDIGMKVKALWVTNDEANHRIAMIGIPGLTSDMNRSKHSRIQHIAFEYDTLDDLLD
                     TYIRLKNLGITPHVTADQGVSIAFYYNDPDGNTVELTMDTFGDWSKSKEFMKKSPTFA
                     KKPMGKYIDVEKILLAREQGLSANEIHERAYAGEYEPNTPMDPQKML"
     gene            complement(15288..16280)
                     /locus_tag="BMQ_RS26220"
                     /old_locus_tag="BMQ_pBM50021"
     CDS             complement(15288..16280)
                     /locus_tag="BMQ_RS26220"
                     /old_locus_tag="BMQ_pBM50021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_013060124.1"
                     /db_xref="GI:502825148"
                     /translation="MKKANLCFIGAGFHASTNIYPSAIEAGAAIQAVSTRNIERSKAT
                     LQRFGSKGTPYDDYKKMLQYEECDGVVVVAQPEDQPSLVMDCIRAGKNVFVDKPLGMS
                     ADEAAEIADAADEAGVTVMVGFMKRYAPCYTKLKEIIENGSLGNARSFQAKFAVDSTP
                     FCKDDEQFIKFAAIHIVDLIRYLFGEVLYVSGFKNSDNGFISHSITLKFKNGVVGSLY
                     FTGMTAWSRESENILVTFDNGFAFADEVNSLTIHKSQTFSDLPWKSLEEADTVFTPSA
                     SPMSGTYRDLYLRGFVGEMTHFIDCCKNKRKPTSNGRDNVHTMSLCDRILSELI"
     gene            16714..17244
                     /locus_tag="BMQ_RS26225"
                     /old_locus_tag="BMQ_pBM50023"
     CDS             16714..17244
                     /locus_tag="BMQ_RS26225"
                     /old_locus_tag="BMQ_pBM50023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor SigX"
                     /protein_id="WP_013060126.1"
                     /db_xref="GI:502825150"
                     /translation="MSTIKKEERPVSDVTFEDLFKQYYVYVVKQIVWIVKNQMIAEEL
                     AQEVFLQLYRNDWKSIENVPGWLLKSSTYVAYNYLRSEKRHQARINKTIQYHEAQHIS
                     SLDDDWIRKEEITKVQNVLSNMNERERTILLLKFSSFQYKEIAEVLQINISSIGTLLV
                     RAKQKFRKIYKQLEEA"
     gene            17248..18225
                     /locus_tag="BMQ_RS26230"
                     /old_locus_tag="BMQ_pBM50024"
     CDS             17248..18225
                     /locus_tag="BMQ_RS26230"
                     /old_locus_tag="BMQ_pBM50024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013060127.1"
                     /db_xref="GI:502825151"
                     /translation="MNCYDKGFIQAYIDGELSHDTRKEFTKHLDTCEICQDVLIEISK
                     LNRWEDVVLEEETRHLSQEINIDVDQAWKTFESRTKLENVSYINQKTEQKRGLFTNMN
                     KKSKRFMYTAVAAAGLFTTAMIPQVQVAATNVASYFSNEISNDKVVNEGIHDENGVTQ
                     DMMKDGQFIPIDKKITDQGVTVHFKELYVADSRISIHYKIEKADGSLVPFEFDTTGLD
                     LKNDGKTNEQQEENPEYQEKDGSFSQLPFIQGASGLPFKLMAAGEELEYVGIRDKDRP
                     EGIITFVEGPEGKDSFKQPLTLNVDINKIGKVAGSWKGQIQIDPAKLKK"
     gene            18794..19243
                     /locus_tag="BMQ_RS26235"
                     /old_locus_tag="BMQ_pBM50027"
     CDS             18794..19243
                     /locus_tag="BMQ_RS26235"
                     /old_locus_tag="BMQ_pBM50027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013060130.1"
                     /db_xref="GI:502825154"
                     /translation="MNRGEKIAKARREMNLTQDQLAEMLEVTRQTISKWESNLAYPES
                     VKLGKLAEVLNVTCDYLLRENQATSTSTSIEVTMNNSGNYTLDWSKLYPILNEYQNMI
                     DCPHYFEKIYGMVKEIMVKYKYSSEDTFLILKDLLYQIYLQMEKKVQ"
     gene            complement(20095..20304)
                     /locus_tag="BMQ_RS26240"
                     /old_locus_tag="BMQ_pBM50031"
     CDS             complement(20095..20304)
                     /locus_tag="BMQ_RS26240"
                     /old_locus_tag="BMQ_pBM50031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose starvation-inducible protein B"
                     /protein_id="WP_013060134.1"
                     /db_xref="GI:502825158"
                     /translation="MTTNKNNDKMSREEAGRMGGKATSKNHDKEFYQEIGEKGGEATS
                     KNHDKEFYQEIGEKGGKANNKRNND"
     gene            21256..21438
                     /locus_tag="BMQ_RS26245"
                     /old_locus_tag="BMQ_pBM50035"
     CDS             21256..21438
                     /locus_tag="BMQ_RS26245"
                     /old_locus_tag="BMQ_pBM50035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016766014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060138.1"
                     /db_xref="GI:502825162"
                     /translation="MFLKKLIKNGLITVKYYENGSLQTYKGRVYNLNLHEQTLSLKDE
                     KQNIFFIRLSGIEDIY"
     gene            21927..22190
                     /locus_tag="BMQ_RS26250"
                     /old_locus_tag="BMQ_pBM50037"
     CDS             21927..22190
                     /locus_tag="BMQ_RS26250"
                     /old_locus_tag="BMQ_pBM50037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060140.1"
                     /db_xref="GI:502825164"
                     /translation="MNTTVNELYDFGTVLRRKLLNNNLYAHYLSDAMRRENHFDFLYY
                     FLTATVDSQTPIPEHVSAVFLKVLSDKEKLSDLTPFIMGLIGK"
     gene            22680..22886
                     /locus_tag="BMQ_RS26255"
                     /old_locus_tag="BMQ_pBM50038"
     CDS             22680..22886
                     /locus_tag="BMQ_RS26255"
                     /old_locus_tag="BMQ_pBM50038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060141.1"
                     /db_xref="GI:502825165"
                     /translation="MLTKVSELSQRIYLSECIINKRRELVDLGMDYGLLNKKTIQCSQ
                     DLDQLINLYMQGSKKTEYKFYYIL"
     gene            23082..23273
                     /locus_tag="BMQ_RS26260"
                     /old_locus_tag="BMQ_pBM50039"
     CDS             23082..23273
                     /locus_tag="BMQ_RS26260"
                     /old_locus_tag="BMQ_pBM50039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016766062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060142.1"
                     /db_xref="GI:502825166"
                     /translation="MSKQAEAIKEVKLLNAEIDLCNRIKNLLNQGKLRDLQLKKEYTE
                     YEILQIALNRLMNELTFRY"
     gene            complement(23463..23816)
                     /locus_tag="BMQ_RS26265"
                     /old_locus_tag="BMQ_pBM50040"
     CDS             complement(23463..23816)
                     /locus_tag="BMQ_RS26265"
                     /old_locus_tag="BMQ_pBM50040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060143.1"
                     /db_xref="GI:502825167"
                     /translation="MVTEGLTPTTLVKNLSALPTPCNDVVYYPTHLTVLGIQGEYSVF
                     QAFSRKSGLAYIAITHPDTTKFIFAGSRNSMYELYQVIPWPEYKISNGELTFYYKTAP
                     SLQTLEDYFNNIKKQ"
     gene            complement(24966..25439)
                     /locus_tag="BMQ_RS26270"
                     /old_locus_tag="BMQ_pBM50044"
     CDS             complement(24966..25439)
                     /locus_tag="BMQ_RS26270"
                     /old_locus_tag="BMQ_pBM50044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_013060147.1"
                     /db_xref="GI:502825171"
                     /translation="MFRIILFIHILVGVICLVTGFAAMIAPKKKGFHTNLGEIYHFSF
                     IIVFLTTIVMAVMHWSSSSYLLYIGIFSYSLALLGYLAGKFKWKNWVAIHIGSILGSY
                     IAILTAVLVVNVNRIPILNNYNPLIFWLLPTVIGSPIIYLIRKKYEIDLNQEKSV"
     gene            complement(25605..25835)
                     /locus_tag="BMQ_RS26275"
     CDS             complement(25605..25835)
                     /locus_tag="BMQ_RS26275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002106394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049787066.1"
                     /db_xref="GI:908643049"
                     /translation="MKRLKGFYIHLCVYILVNVFLLIVNLIQSPNDLWATKSIFGWGI
                     GVLVHMLILVFFNFFNIQNWEEKKIKHYMNKD"
     gene            complement(25870..27621)
                     /locus_tag="BMQ_RS26280"
                     /old_locus_tag="BMQ_pBM50045"
     CDS             complement(25870..27621)
                     /locus_tag="BMQ_RS26280"
                     /old_locus_tag="BMQ_pBM50045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013060148.1"
                     /db_xref="GI:502825172"
                     /translation="MDHKLQSNLNSFPILLLMCLGIFICLLDTTIMNIALPAIQNDLN
                     TTLETSSWMLNTYTMTIAVLSIPMGRLAEIYGKMKFFILGLIIFACGSAFCGLSDNGE
                     MLIFARFCQSLGASILVPVATIIGVESLPLKKRHISLSLLGATQGLSTALGPSIGGLI
                     AQNLGWNWVFFVNIPICIVALVIAFIILPFKLEKRVKAKIDWAGLILAAIGIFNLNLV
                     LIKGNTWGWTSFTSLCCFFIFIVSLIMFIIVERKIKDPMVDLNLFKDRLYVGATLAVS
                     SAYLFLVGVMVLLPQFLTSFQDKTEIQAALLITPISATIFIVVNFVGFLVKKIGYVIP
                     IMIGYIIVAASYFQLEHLNTASTVSEIIIIGVTLGIGFSFIISPATMASVSSFEGEML
                     TSSQSVFTMLRQIGVVLAVAIFVSSITHEVDSKKQNVISYAKEQTSNIDVSPEKRLEI
                     LKSTEKKIDTDSTFSNVIEAPTVSASERQDLIDKNVKDTLSQYPAAEQEKIKEQITNQ
                     VTNQVNQDILKVNKEIKIYTENVTSYTRKEFSSVFSIVFGHALPFIFIGLLISILYRK
                     SKKSKVIKNKEVTALGE"
     gene            complement(27703..28110)
                     /locus_tag="BMQ_RS26285"
                     /old_locus_tag="BMQ_pBM50047"
     CDS             complement(27703..28110)
                     /locus_tag="BMQ_RS26285"
                     /old_locus_tag="BMQ_pBM50047"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060150.1"
                     /db_xref="GI:502825174"
                     /translation="MKAEIQDLWDNLVFHYEHQEEFQLIILDNKKVKYMWDNYNASLL
                     KILHKKDLHYATSNGRFIERIGARLAVKLAYGKRYPKENLKNIFIASDTWGAPSLWYQ
                     THEIKRVVVSLTHIPNYSGACLHNINSFDIVTL"
     gene            complement(28100..30529)
                     /locus_tag="BMQ_RS26290"
                     /old_locus_tag="BMQ_pBM50048"
     CDS             complement(28100..30529)
                     /locus_tag="BMQ_RS26290"
                     /old_locus_tag="BMQ_pBM50048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003288167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoacyl synthase"
                     /protein_id="WP_013060151.1"
                     /db_xref="GI:502825175"
                     /translation="MKIAVTGIGILSALGNNQYEFWDNIQSGKTGIREMVQLDSSELL
                     TNYAGEVRNLSPEKMMTQEEIEETERCTQLSFLAASEALKQADIPAGFYNTFKQGVIL
                     GTSLGGIPNGEKFHKQWIREGYEHTDPNLLLSYPLHTAADFLSVRFNLKGPKVAISTA
                     CSAGSNAIGYGIELIKSGKADMLIVGGADPLSMLSLAGFNSLKALSDEPCSPYSQSKG
                     ITLAEGAGVLILERLDRVKERGGKILSLVTGFGLTSDAYHPTAPNPGGAGAFKSMQMA
                     LERSNITSQDIDYVNGHGTGTRANDSAETTALKNLFSNTDKNVPVSSTKSMIGHTLGA
                     AGAVEGITCVLSLMKQTAPPTISFTNNPYNMDFIPNVSRPMAINTVLSNSFAFGGNNA
                     SLIFKKYEEEKQQTEVLSGIKQKVLITGIGCVQPLGIGKDELWESIEKGNSAINPIDF
                     EKEKYIGKLGASVSEKKYLKYINPSLIRRLDLLGKLSLASSKMALNDSGIKINRDNSD
                     KIAVIYGTSSGPLQTVEDIHRTIVVDGVKKVNPSQFPNTVMNAAAGHICSTFQIKGPS
                     TTICTGNVAGSQSITYAYHMINEGLIDAALVVVADEYTETIHAGYDRLGVLGNAPYPF
                     ERDSDGMALSCGSTALFLESEKHAKERKASVYGQIKGYGITSDAYKLAGNNPNGKAYS
                     YAMSDALKESELSVDDIDAIFSDARGLRSMDLTEVNAIRHLGGAKIPVTTLSNKNGYN
                     LSGMTPLHIVAALQTFNNHKIPGLKVKNPIYNLNFAKENQKLHSANNFLFNSANFGGT
                     YTSVVVGRYES"
     gene            complement(30541..31623)
                     /locus_tag="BMQ_RS26295"
                     /old_locus_tag="BMQ_pBM50049"
     CDS             complement(30541..31623)
                     /locus_tag="BMQ_RS26295"
                     /old_locus_tag="BMQ_pBM50049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020547700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminomethyl transferase"
                     /protein_id="WP_013060152.1"
                     /db_xref="GI:502825176"
                     /translation="MTYRKSPANESINVITKVVGNQNVPSVFSSLEEEYKAIREEVAV
                     LDFSFNTFLKVSGDSASSFLQELITKDLDYLTEEQTVTCLMLDEDGHLVTELIVYVME
                     NEYLLEIEPSLSEKAEDYLQSHIKDGVLIENLAGKLQMIQLEGPKSWEVVQTLLPFPI
                     EILPYKNFAPFHFEGHNLYIARLGYTAEYGYKVFGDEAGIDLFWKALFAYDLSEINVQ
                     QIGLDAHDVCRLEVRFPDLSKEATSNKLIVESGVNWMLDFNKDFIGKDKNLEGLTSGL
                     CQELVCFTSESAVAKNQDILVDGNKVGYIQHTLYSPGINGSIGVAYLDEKYVASGLTF
                     TLDNDMTINTVSSPMIYPKSLSIRIG"
     gene            complement(31651..32151)
                     /locus_tag="BMQ_RS26300"
                     /old_locus_tag="BMQ_pBM50050"
     CDS             complement(31651..32151)
                     /locus_tag="BMQ_RS26300"
                     /old_locus_tag="BMQ_pBM50050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymyristoyl-ACP dehydratase"
                     /protein_id="WP_013060153.1"
                     /db_xref="GI:502825177"
                     /translation="MTNLLEKKSLKLPLELDQIKNMIPHRYPFLLIDRVNELNPGVSG
                     VAIKNVTANEPFFQGHFPGEAIMPGVLIIEAMAQLIAVIYVSKALVEVESQETSNDIN
                     YADRVGYLAAVKNIKFKNKVVPGDQLVLRAKVVGKMGVLSQVQVWAEVNGKTVVEGSI
                     SVSEKM"
     gene            complement(32148..32447)
                     /locus_tag="BMQ_RS26305"
                     /old_locus_tag="BMQ_pBM50051"
     CDS             complement(32148..32447)
                     /locus_tag="BMQ_RS26305"
                     /old_locus_tag="BMQ_pBM50051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_013060154.1"
                     /db_xref="GI:502825178"
                     /translation="MSTITQNDLLEQVNERKQLCQQIKTEIVERLSLNIEPAWIADNQ
                     PLFGRGLELDSIDTLEISIALQEVFDVMLTDDNMDVLGSVNKIADFITSQRNENL"
     gene            complement(32471..33211)
                     /locus_tag="BMQ_RS26310"
                     /old_locus_tag="BMQ_pBM50052"
     CDS             complement(32471..33211)
                     /locus_tag="BMQ_RS26310"
                     /old_locus_tag="BMQ_pBM50052"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_013060155.1"
                     /db_xref="GI:502825179"
                     /translation="MFKDKVVLVTGASKGIGRATALYFLNEGAKVIINYSKEGNHIKE
                     LKEMVSNKEDQTLFFCADVSNVSSVREMFKAIKNKWGQLDILVSNAGITRDSWLMMMG
                     DKNWDDVLNINLKGTFFCIREASKMMAAKKQGVIINVSSTSGLKGQPGQANYSASKGG
                     IIAMTKTLSRELASYNIRVNCIAPGFIHTGMTNNMPQNTLDSYIQHIPLGRIGEANEV
                     AETIGFLASPKASYITGQCIVVDGGLTT"
     gene            complement(33204..34163)
                     /locus_tag="BMQ_RS26315"
                     /old_locus_tag="BMQ_pBM50053"
     CDS             complement(33204..34163)
                     /locus_tag="BMQ_RS26315"
                     /old_locus_tag="BMQ_pBM50053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006323106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl transferase"
                     /protein_id="WP_013060156.1"
                     /db_xref="GI:502825180"
                     /translation="MNKKVAVIFPGQGSQVMGMGKDLISLPLFAQRLEKVAELANLTL
                     DEFFQPKNMKIIEKTEIVQPYIFVISVTLHELISKEYSLKPILFGGHSLGEFSALVAS
                     GMLSFEAGFELVKVRGSLMGEACNKTKGGMLAVLSPEKELFSLLHDEVKEQHNTIKIA
                     NYNSANQLVISGADESIKEFKNVIENKLKARAIPLKVSGAFHSVLMNEANKDFSHYLD
                     FTKFQAPLAPIVMNVSGEAELNKSNIFSLIKEQMISSVLWKKSMETIESFQPDLVLEI
                     GPGRVLSSLIKSSHRNLNVSNIGNRSDLLRFKKQLEREVEIVV"
     gene            complement(34185..34508)
                     /locus_tag="BMQ_RS26320"
                     /old_locus_tag="BMQ_pBM50054"
     CDS             complement(34185..34508)
                     /locus_tag="BMQ_RS26320"
                     /old_locus_tag="BMQ_pBM50054"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041816907.1"
                     /db_xref="GI:754204110"
                     /translation="MDIERFKLALSRSGELFVSRILNNYEIAKYDSYQWAILFSAKEC
                     AIKMIKQIPKDFRLRDIQVDILSKDELLVTFDESLYKQVDLPTNSIKGTYKVFKDCIV
                     THLIA"
     gene            complement(34529..34966)
                     /locus_tag="BMQ_RS26325"
                     /old_locus_tag="BMQ_pBM50055"
     CDS             complement(34529..34966)
                     /locus_tag="BMQ_RS26325"
                     /old_locus_tag="BMQ_pBM50055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013581010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_013060158.1"
                     /db_xref="GI:502825182"
                     /translation="MKWLETKARVRWSEVDSQSIVYYGNYFLYFDLGREYVAEKVELE
                     YLTEEFDVITLDTTAKYRQPARYGDELIIRTRMIHPSPAEMASPMGFTFQFEYQILKS
                     QGKLLLAEGTSRHALKDKITHKLYVKVPKEKKEKFLSVFEIYK"
     gene            complement(34993..35730)
                     /locus_tag="BMQ_RS26330"
                     /old_locus_tag="BMQ_pBM50056"
     CDS             complement(34993..35730)
                     /locus_tag="BMQ_RS26330"
                     /old_locus_tag="BMQ_pBM50056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014786415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase/reductase"
                     /protein_id="WP_013060159.1"
                     /db_xref="GI:502825183"
                     /translation="MEVAIVTGAGSGIGRATAIQLSSQDYRVYALDKDEKSIKDFEKT
                     KNITPIVCDVLKENDINSFFSRFSSKEKHLDLLFNGVGAMKLGGLLDTSEDDWDFGFH
                     INLKSALVFSKRAYNYLLESKNPSIINISSVLGETYEEKAAIYTVMKSALVTLTKCLA
                     KELAPKKIRVNAISPGPIQTSFVRSFSQETKKIQGASKLVMKLSHTPIGRTGKPEEVA
                     KLVSYLASPQASFITGSCISIDGGWSI"
     gene            complement(36837..37235)
                     /locus_tag="BMQ_RS26335"
                     /old_locus_tag="BMQ_pBM50058"
     CDS             complement(36837..37235)
                     /locus_tag="BMQ_RS26335"
                     /old_locus_tag="BMQ_pBM50058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family N-acetyltransferase"
                     /protein_id="WP_013060161.1"
                     /db_xref="GI:502825185"
                     /translation="MVIEYKVNASISAKEVADIFKSSGIKRPVNELERIERMIKNSDI
                     NLTAWNNQQLIGIARAITDYSYCCYLSDLAIHKDYQNKGIGKELVQRLQDIIGEEVAL
                     ILLASSVAMDYYPHIGFEKSENAFRIPRKK"
     gene            complement(37417..38643)
                     /locus_tag="BMQ_RS26340"
                     /old_locus_tag="BMQ_pBM50059"
     CDS             complement(37417..38643)
                     /locus_tag="BMQ_RS26340"
                     /old_locus_tag="BMQ_pBM50059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter, major facilitator family"
                     /protein_id="WP_013060162.1"
                     /db_xref="GI:502825186"
                     /translation="MIPITKEAKVRTGIWKGKFIYLWVASIFSSLSISMYLTIEQWYV
                     VNYLNLKSSLGIILMATTIPRVLLMVIGGVVSDKYRRSKVIFFSLLTRCFMLLLMALF
                     YTNNLLSLSVLFIFALLFGASDAFFWSARDSIVPGIVHKEQLVRANSVIQTTNQLSVM
                     FGPVLGATLLSLFSYSTIFLIIAFTLLISIILLQFIKEKKTLRPKKTSILRDLAEGIN
                     YVKDSSFLLTVMVTFIIVNLFFIGPLMLSIPILAEDRFKGNAFYLSIFQSSFASGMLL
                     GAIVMGWLNIKRNRGKLAISFIFLEGLLLMIFSQGINLWLAAAILLAIGCCVSSINIL
                     IVSLIQEKTPSTIVGRVMSVNTMVSMGLIPVSYGLVSTLLSINVDIKFILLCAGIVIV
                     LFSVLLLLKASDLKNT"
     gene            complement(38736..39317)
                     /locus_tag="BMQ_RS26345"
                     /old_locus_tag="BMQ_pBM50060"
     CDS             complement(38736..39317)
                     /locus_tag="BMQ_RS26345"
                     /old_locus_tag="BMQ_pBM50060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_013060163.1"
                     /db_xref="GI:502825187"
                     /translation="MQLDKLVNYYKAVGDPTRIRIISLLKKGHLHGQAIAYKLGLQPS
                     TITHHISKLRDVGLVYQRRQGNIIYFYLDTERLEYNSKAILNIGEESMENQDSKINDK
                     DKLSIIKSFINSDGTLKQIPSQRKKKNVILAYLIRDLHQGKMYKEKDLNEYIKNYHED
                     YATIRRELIMQHFMYRQNGEYELNPKEMWPVTF"
     gene            39461..40165
                     /locus_tag="BMQ_RS26350"
                     /old_locus_tag="BMQ_pBM50061"
     CDS             39461..40165
                     /locus_tag="BMQ_RS26350"
                     /old_locus_tag="BMQ_pBM50061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049787063.1"
                     /db_xref="GI:908643046"
                     /translation="MYVTKYIQRRCLVLLDYIWIDGDLPILSQLPNDFNSAAILFHPF
                     IQMPSGWEKSKRENPYQHIYPSDEEMLKLGEPISWKEVMVKSNLKSYKELFRVLQYLT
                     GAPSDEYKKLASYVKSNPDFYYPEEDRTSLFILNSLVKILCSKGANTLYFSEPIHDTN
                     GSFKVNDMSSLEIANLSPNESIITDENMDFAFMGIYDSFITLLLAKDTNIEDTIKSLN
                     LEAFICDKETYFNSFI"
     gene            40299..40595
                     /locus_tag="BMQ_RS26355"
                     /old_locus_tag="BMQ_pBM50062"
     CDS             40299..40595
                     /locus_tag="BMQ_RS26355"
                     /old_locus_tag="BMQ_pBM50062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060165.1"
                     /db_xref="GI:502825189"
                     /translation="MLGETFTLFRPIYYLITIFLVCNFVYVVFLSNKIKANSYILFNS
                     LFFVIIGAMLLFQQGIIVDETNQSGDPVIFDLTILFGVLFIASFIFRNIKKRKV"
     gene            40799..41128
                     /locus_tag="BMQ_RS26360"
                     /old_locus_tag="BMQ_pBM50063"
     CDS             40799..41128
                     /locus_tag="BMQ_RS26360"
                     /old_locus_tag="BMQ_pBM50063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016763720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-binding protein"
                     /protein_id="WP_013060166.1"
                     /db_xref="GI:502825190"
                     /translation="MATIDDFFKLDIRIGTVVKAEPFPEARKPAIKLEIDFGELGVKC
                     SSAQITRRYKPEQLIGSQVVAVVNFPPMRIAGFKSEVLVMGGIPEEGDVVLLKPSEFV
                     KNGTPIA"
     gene            41429..42307
                     /locus_tag="BMQ_RS26365"
                     /old_locus_tag="BMQ_pBM50064"
     CDS             41429..42307
                     /locus_tag="BMQ_RS26365"
                     /old_locus_tag="BMQ_pBM50064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016763719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013060167.1"
                     /db_xref="GI:502825191"
                     /translation="MKNTLLGSIYLALAASIWGGMYVVVKVVVAVIPPLELVWIRYVI
                     AILALFIIGLIKRQSWRINKRHIPLIVAIGVIGNAISIVTQEYGTMLSSAQMGAIITS
                     STPAFMVIFARLILKERLNMKKGISVGLATIGVLLIVGNGHINMSSQLGGLSLLMAAL
                     TWALMSILIKRVPSSYSPVVITTYSILVAILVLTPFVYKGLGEIHISKLIDPTIGGGL
                     LYLGIVSTALAFILWNRGLQLLNASSGGLFFFFQPLVGTLLGWLLLGESIGGTFWIGS
                     FLILSGVLLVIKEKTN"
     gene            43331..43639
                     /locus_tag="BMQ_RS26370"
                     /old_locus_tag="BMQ_pBM50067"
     CDS             43331..43639
                     /locus_tag="BMQ_RS26370"
                     /old_locus_tag="BMQ_pBM50067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013056955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060170.1"
                     /db_xref="GI:502825194"
                     /translation="MPNIQVVEKSSHAKIAIDEFLRAGFNTDEIHLLTCNSANTINSY
                     ENELCSTNFVNPDTNILQVDEDVFFSKMQSFGISKRDAERYKESMDKGSIMVIVSKAV
                     "
     gene            complement(43957..45414)
                     /locus_tag="BMQ_RS26375"
                     /old_locus_tag="BMQ_pBM50069"
     CDS             complement(43957..45414)
                     /locus_tag="BMQ_RS26375"
                     /old_locus_tag="BMQ_pBM50069"
                     /EC_number="3.4.21.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_013060172.1"
                     /db_xref="GI:502825196"
                     /translation="MKKKILHTVLSITVGVGILSVGGVPTQAKSKNQEMNNTYAIAFK
                     SRLPENYQEVIQKAGGKVTKVLPEVGGIEAQSDQPSFLKNLKGNSSIEAANREIPLSL
                     DKTAVSPYNYESSIISQQNSESYWDSQWDIQRVTNNGKSYDLETGGYKNKDGSITHKA
                     VVGVIDTGIDESHPDLKNNIIGGRNLVPAGMDESETGDPTDIKDRNGHGTHVAGIIGA
                     NGKVKGVGPELGIRSYRVFYSEQALGLPAWIIDGIIAATNDKVDVINMSLRFYNNTKM
                     TIEGESYKSVAETLLWKRAIQYAVKNGVTVVAGSGNESLNLDDKKEVNEFLNKMYEPY
                     GMSVKGPATVVPAQMPGVINVSASTKWSTQQLAFYSNYGNSAIDVAAPGGDYGQKYAE
                     TNDPAAADPSNLILSTWPTYLGTSYELNAGTSMATPQVAGIAGVIKAAHPEYKPAQIT
                     ARIKQTAFDYGKKGQDALFGSGEANAYRALENIKK"
     gene            45661..45867
                     /locus_tag="BMQ_RS26380"
                     /old_locus_tag="BMQ_pBM50070"
     CDS             45661..45867
                     /locus_tag="BMQ_RS26380"
                     /old_locus_tag="BMQ_pBM50070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="WP_041816908.1"
                     /db_xref="GI:754204112"
                     /translation="MKNNVKTFRVQADLTQHQLAEKVGVTRQTISLIEKGKYNPTLKL
                     CLEICYVVNRTLDEIFWIDQEENK"
     gene            45864..46295
                     /locus_tag="BMQ_RS26385"
                     /old_locus_tag="BMQ_pBM50071"
     CDS             45864..46295
                     /locus_tag="BMQ_RS26385"
                     /old_locus_tag="BMQ_pBM50071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_013060174.1"
                     /db_xref="GI:502825198"
                     /translation="MKVIRDERLVIKNLKNIRIAFAFQTLAMAGILIYDGITRGFNNV
                     TDNPLWLVLILTSVILGYLNLGISVDSYESEKQLRKTPYYLIVIGCLTIGIIFGLLTK
                     ITSNSSVQDSTIIGLVIFLCFLGTFSFWHFLIKKRSKDEDE"
     gene            46481..46804
                     /locus_tag="BMQ_RS26390"
                     /old_locus_tag="BMQ_pBM50072"
     CDS             46481..46804
                     /locus_tag="BMQ_RS26390"
                     /old_locus_tag="BMQ_pBM50072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016742197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060175.1"
                     /db_xref="GI:502825199"
                     /translation="MYIWSNSEGAISLLYSRPVFIFFIVVLAALFIIILMQNKKQLVT
                     GLHVITIIIISLFISGLILFLEGIIVDDLNLSEDTISSYMFLIIVALCVINSVTYSFK
                     NKKLQ"
     gene            46958..47221
                     /locus_tag="BMQ_RS26395"
     CDS             46958..47221
                     /locus_tag="BMQ_RS26395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013084153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecDF"
                     /protein_id="WP_041816909.1"
                     /db_xref="GI:754204113"
                     /translation="MMIGVPLLIAIIPGVIVLLLTWLFRRMKWGITVRMIPAILTVIA
                     AIVLFYIGYVEVRGFEGAAYLFLSVFLILFAIISFVMAKKPLR"
     gene            47357..47626
                     /locus_tag="BMQ_RS26400"
                     /old_locus_tag="BMQ_pBM50074"
     CDS             47357..47626
                     /locus_tag="BMQ_RS26400"
                     /old_locus_tag="BMQ_pBM50074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060177.1"
                     /db_xref="GI:502825201"
                     /translation="MQNRFSKYSLWLSIAGIIIAIGQYFTPLYNLNILYIGIVIYLIG
                     FVCGVIAVGKHEKGLMKYFSLYSFVLIPVFIFFGFLFLAFQIGEK"
     gene            complement(47841..49391)
                     /locus_tag="BMQ_RS26405"
                     /old_locus_tag="BMQ_pBM50075"
     CDS             complement(47841..49391)
                     /locus_tag="BMQ_RS26405"
                     /old_locus_tag="BMQ_pBM50075"
                     /EC_number="2.4.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_013060178.1"
                     /db_xref="GI:502825202"
                     /translation="MKHKKRILVASPIHQKPEILTLFLESLKHLKKEEMIVDFYFIDD
                     NENVDSSRLLIQFQECIQSVIVEKSDYQDVYSRDGQTHHWNEHLVWKVAGFKNSIIQY
                     AKEKNYDYLFLVDSDLLLFPETIVHLVQQEKDIISEVFWTRWQPDSMEQPQVWLYDEY
                     TQYHKQPGEDLSTEQIKVRYQEFIAKVRTPGVYEVGGLGACTLISQNALQKGVNFNKI
                     PNLTFWGEDRHFCIRAAAMGLSLYVDTRYPAYHIYRDTNIKEGQEFIKKITARQKTIQ
                     SNIYVPTTKKTKLTLSMVIKNEENRFLKEVLRSYVPYIDDVVIIDDGSTDNSVEVCKE
                     VLKTVPYKIIRNEVSKFSNEVELRKQQWEETVNTEPNWILNMDADEIFEDKFDRDIQQ
                     LLTQRDYDLYSFRLYDFWNDTHYREDDYWQSHFYYRPFLVRYRNDFSYTWQETPQHCG
                     RFPNNIFQLPNSISDLRVKHYGWSKLEYRLEKYKRYLTLDPHAQYGTKEQYESILDEN
                     PNLIKWEE"
     gene            complement(49381..50481)
                     /locus_tag="BMQ_RS26410"
                     /old_locus_tag="BMQ_pBM50076"
     CDS             complement(49381..50481)
                     /locus_tag="BMQ_RS26410"
                     /old_locus_tag="BMQ_pBM50076"
                     /EC_number="2.4.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta 1,4 glucosyltransferase"
                     /protein_id="WP_013060179.1"
                     /db_xref="GI:502825203"
                     /translation="MVSISLCMIVKNEEDSIGRCLESIYQLVDEINIIDTGSNDQTKK
                     IASKYTNRIYDFEWVHDFSKARNYAFEKATKDYILWLDADDVFLEEDQQKLLALKLNL
                     ESSVDSVTMKYILATDEYGNVTSSLRRNRLVKRRNGFRWIGAVHEYLEVWGNIMNSEV
                     AVTHKSIHHDSDRNLKIYEKKLLTGEDFSPRDLYYFANELKDHRQFKRAIEFYEKFLS
                     TEKGWIEDNIAACRNLADCYLEIFDKERMIKSLLRSFTYTAPRPEICCRLAHYFIEKN
                     DYQSAVFWYGSATKTGVTSDNLGIQNQAYSTWIPHIQLCVCYDALGDYEKANHHNELA
                     GTYRPNDPKYLHNKGYLETKIPIEKVGVGNET"
     gene            50892..53756
                     /locus_tag="BMQ_RS26415"
                     /old_locus_tag="BMQ_pBM50077"
     CDS             50892..53756
                     /locus_tag="BMQ_RS26415"
                     /old_locus_tag="BMQ_pBM50077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060180.1"
                     /db_xref="GI:502825204"
                     /translation="MSIQNLIVNGGFETGTLSSWLIANTVITSEYSHSGFYSARLQGG
                     ATFSYISQFVPIEPGERLEILASLATVGQAPAIFITIQVFYYDNQSNLLENGLLVTVP
                     GNQIPNVENHTWLENYHTTTAAPPGSTQAFIVINTLPQVETSDVLVDDVAVLVVNNNG
                     AIGATGATGATGATGATGITGATGVTGATGITGITGVTGATGATGATGVTGATGATGI
                     TGITGITGITGITGVTGATGITGITGITGVTGATGATGATGVTGATGITGATGVTGVT
                     GVTGITGVTGVTGVTGVTGATGITGVTGETGVTGETGATGVTGITGATGITGVTGITG
                     ATGVTGVTGVTGVTGATGITGVTGETGVTGETGATGVTGITGATGITGVTGITGATGV
                     TGATGVTGITGVTGITGVTGVTGVTGITGVTGATGATGITGATGATGITGVTGITGVT
                     GVTGVTGITGVTGATGATGITGATGATGITGVTGATGITGATGITGATGVTGVTGVTG
                     VTGATGATGITGATGITGATGVTGATGVTGVTGATGATGVTGITGVTGVTGATGVTGV
                     TGVTGVTGATGVTGVTGITGITGVTGVTGITGVTGATGATGVTGATGVTGVTGATGAT
                     GVTGITGVTGATGVTGATGITGATGITGATGATGITGVTGATGVTGATGITGATGVTG
                     ATGATGITGVTGATGATGVTGVTGITGVTGVTGITGVTGVTGVTGITGVTGATGATGV
                     TGVTGITGVTGVTGITGVTGVTGVTGITGVTGATGATGITGATGATGATGITGVTGAT
                     GITGVTGVTGATGATGATGPTASSPTLAFSEAPGTIAIFPPLNTEVTVASVTQNVLIN
                     QQLKIDYALAVEIITTANWSIVFEMRLYRDTTLIDTRIFNRSATQAGTQRFPLASTQV
                     NIAPTTTTSTYSVRIIVTAATSITSATAINRDLNIITFTP"
     repeat_region   51738..52069
     repeat_region   52283..52532
     repeat_region   52626..52731
     repeat_region   52755..53244
     gene            54305..54919
                     /locus_tag="BMQ_RS26420"
                     /old_locus_tag="BMQ_pBM50079"
     CDS             54305..54919
                     /locus_tag="BMQ_RS26420"
                     /old_locus_tag="BMQ_pBM50079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060182.1"
                     /db_xref="GI:502825206"
                     /translation="MGDISEGKFSYVDYWEENYSNGGTSGKGSYGVLAQFKGDVINQF
                     IKGKRIHKVIEFGCGDGNQLKYMNYPSYLGMDISPTSIDICSKMFGKDKTKSFLLYNP
                     KYFINNGYFKSDLVVCLDVLYHITNEDDFWKTLDDIFSCKPFYIILYTRVTKPEEFVY
                     GIPTIQDRDILSCLSRYQDYKLIQIIEQKYKELSGASFIILEKV"
     gene            54955..55602
                     /locus_tag="BMQ_RS26425"
                     /old_locus_tag="BMQ_pBM50080"
     CDS             54955..55602
                     /locus_tag="BMQ_RS26425"
                     /old_locus_tag="BMQ_pBM50080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060183.1"
                     /db_xref="GI:502825207"
                     /translation="MSIFTSRFILKTDPYSKHFVFNLPKTWETRPHEYEWAKNFAETE
                     DIVLDAACGLSHPLKFYLAGKCKEVYACDIDARILSKSSILKDIRDTYGTIIENSFLN
                     HYFHHIHFCHSSLSKLPYQDKSFDKIFCISVLEHLSKVDIEQTFKEFRRTLKDEGLLI
                     VTFDYPTINLEALKILLDKVKFKFYGDYSLDKPDNLLVSTIWGELNCFRAVLIKN"
     gene            56213..57058
                     /locus_tag="BMQ_RS26430"
     CDS             56213..57058
                     /locus_tag="BMQ_RS26430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019421526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041816916.1"
                     /db_xref="GI:754204126"
                     /translation="MGITGATGPTGATGIRGTPGPPGGPGVTGITGVTGPTGATGVTG
                     DPGITGATGSTGATGITGAAGVTGVTGITGTTGVTGDPGIAGATGITGVTGVTGDPGI
                     AGATGSTGATGITGATGVTGATGITGATGVTGATGITGATGTSLTTNSMFAGNTVGST
                     ILVVLGGTSVPLPSNQNLDSFTVNGTNTTFTVPATGRYYITYQINTTAALLAGSRLIL
                     NGTTPIPGSTISPAVAASSYNNDVIVSLTVGDTITLQLFGLLATVVLTGGGSTGAALT
                     IIRLS"
     gene            57329..57976
                     /locus_tag="BMQ_RS26435"
                     /old_locus_tag="BMQ_pBM50082"
     CDS             57329..57976
                     /locus_tag="BMQ_RS26435"
                     /old_locus_tag="BMQ_pBM50082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005812920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060185.1"
                     /db_xref="GI:502825209"
                     /translation="MKNIEVSQKYLLLVLNDKGGVAPIGSLRIRAFMVASGILELVLD
                     DIVSLSDNQVTVKQELPSDKEYLRSIYNKISTEKSIHLKKLGRELISKRELFKELFNS
                     VGDSLVELDVVTKTNGGILGQSSHYIGSENSKKQIVEQMRAELLEEGPVTTDTVVLSS
                     LLIGSRTLKNYFSKFEDKDLNDKLTMLRKDTRNKEIFALIDSISHTITTIIASVG"
     gene            57991..58254
                     /locus_tag="BMQ_RS26440"
                     /old_locus_tag="BMQ_pBM50083"
     CDS             57991..58254
                     /locus_tag="BMQ_RS26440"
                     /old_locus_tag="BMQ_pBM50083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_013060186.1"
                     /db_xref="GI:502825210"
                     /translation="MSRRRSLEDILQSEYVSIGELSRLTDSRYSTLKYYTEAGLIPFE
                     QSDENLTRRYPREASVQRIETIKQLKKSGLSISEISDWVVNND"
     gene            complement(58498..58680)
                     /locus_tag="BMQ_RS26445"
                     /old_locus_tag="BMQ_pBM50084"
     CDS             complement(58498..58680)
                     /locus_tag="BMQ_RS26445"
                     /old_locus_tag="BMQ_pBM50084"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060187.1"
                     /db_xref="GI:502825211"
                     /translation="MNQRDQKRLAITRELMENAKKRLDLSYELEQDLENLGLQRRMKQ
                     LDLENKLLKEQNNELA"
     gene            59044..59244
                     /locus_tag="BMQ_RS26450"
     CDS             59044..59244
                     /locus_tag="BMQ_RS26450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013084238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049787064.1"
                     /db_xref="GI:908643047"
                     /translation="MGLFFRKIDPETDSKYRKWLNFSLVIAILINLINSLFLNLRWLY
                     ITMTAVIGILAILIFKEYKDEK"
     gene            complement(59316..59693)
                     /locus_tag="BMQ_RS26455"
                     /old_locus_tag="BMQ_pBM50085"
     CDS             complement(59316..59693)
                     /locus_tag="BMQ_RS26455"
                     /old_locus_tag="BMQ_pBM50085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060188.1"
                     /db_xref="GI:502825212"
                     /translation="MSERQNAFTIKTNRLSDEVYNRLATYAKSRKLGEYISSLILRDL
                     DDSSTGRKAIEDKKTYEMLEHIKNELADLKTLAKTTGFVGNDSFKEEEPSKVPQLKEG
                     KIADLENISGSLDDDDLEEYNDF"
     gene            complement(59711..60895)
                     /locus_tag="BMQ_RS26460"
                     /old_locus_tag="BMQ_pBM50086"
     CDS             complement(59711..60895)
                     /locus_tag="BMQ_RS26460"
                     /old_locus_tag="BMQ_pBM50086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016766092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013060189.1"
                     /db_xref="GI:502825213"
                     /translation="MKISRFNKDCGNSVDMNIMDGYLFDFPTNVVELQKEAADSFFTD
                     AVTAPEEFKKRILLSTTIKGEEKERYFLVGDIAASQLLANNHINKLHNKITSHIPYIT
                     FLAAIAYYHALHAKNKKDNTIEIDYFSTMLPIWLLKKESTFGAAQKAMANRFLGDHTF
                     TVHTPGFENTLKVLVEESACLKEGESARFALKKDLTLQDREDANEYVECETVMVDIGG
                     GSIDVVILPEGLKAANSRESFQSIEGIPYLAHIDKLRKEKFLELFTDLRAFDQFILDN
                     YSKQKFVLKNENTGESIDLTSTIKSSLREYVEILLAKLNDVAPPPANKLRKYVYCGGV
                     APTLEVAIMNSMREKIGEERTEKYHKVPQDSRHLNLFGLEIRSIGYVQKKQAAEKKAV
                     KS"
     gene            complement(61493..62743)
                     /locus_tag="BMQ_RS26465"
                     /old_locus_tag="BMQ_pBM50088"
     CDS             complement(61493..62743)
                     /locus_tag="BMQ_RS26465"
                     /old_locus_tag="BMQ_pBM50088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013060191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013060191.1"
                     /db_xref="GI:502825215"
                     /translation="MEEKLPVNHSTNLFGNRVFQAIIISGLFLQIGIWVRNFAVLLFI
                     MEKTNGDPFAVSLISVAEFAPIFIFSFIGGTFADRWRPKRTMVWCDILSAISVFAVLV
                     TLILGSWHIVFFATLISAILSQFSQPSGMKLFKMHLPEEQMQVGMSVYQTVFAIFMVL
                     GPILGTFAFQAFGISLSIAITGTAFLLSAAALTFLPSDRKMEEENGTTSLLSEMKSGI
                     KYVLGKKELSLLGLCFLAAGLGIGFIQPLSIFLVTEQLGLAKENLQWLLTANGIGMIL
                     GGAVVMIFAKTVAPQRLLAFGMVGNAIGFAIMGLSVNLWLTLGAQFLNGLMLPCIQIG
                     INTMILQRTEAAFIGRVNGILSPLFTGAMVLTMSVAGILKEQFSLVAIFEAAAVLFII
                     GLLFILPLYNLKEETKQEGIELGE"
     gene            complement(63134..63403)
                     /locus_tag="BMQ_RS26470"
                     /old_locus_tag="BMQ_pBM50089"
     CDS             complement(63134..63403)
                     /locus_tag="BMQ_RS26470"
                     /old_locus_tag="BMQ_pBM50089"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013060192.1"
                     /db_xref="GI:502825216"
                     /translation="MKGQQWSTRFNDVKETIQSIIYTWNPLSLHASEEYEYEATWILP
                     MVYKVENVESLAIEITDILNQSFNSTLIKEECIGIAQQIWEQIRE"
     gene            complement(63542..64204)
                     /locus_tag="BMQ_RS26475"
                     /old_locus_tag="BMQ_pBM50090"
     CDS             complement(63542..64204)
                     /locus_tag="BMQ_RS26475"
                     /old_locus_tag="BMQ_pBM50090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016766094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-H factor"
                     /protein_id="WP_013060193.1"
                     /db_xref="GI:502825217"
                     /translation="MNMIAGVEIREKKMTLNDEEIVQAFQKGDEDVFNVLVKKYEYLV
                     WSKVKRYFLLGGDREDLLQEARLGLYKAVRDFKTEGMSSFRGFADLCITRQLITAIKA
                     SARQKHSPLNNALSLNIPKNSKRLEDDLILMEMLPHPRAVSPEQATVEKENKREREQM
                     LQEILSPIEQDVFTLYLKGQTYMQISQNLNLPQKSVDNALYRIKKKMKHQMQYLYLQQ
                     SS"
CONTIG      join(CP001988.1:1..66985)
//
DBGET integrated database retrieval system