GenomeNet

Database: RefSeq
Entry: NC_014025
LinkDB: NC_014025
Original site: NC_014025 
LOCUS       NC_014025              66985 bp    DNA     circular CON 08-JUN-2013
DEFINITION  Bacillus megaterium QM B1551 plasmid pBM500, complete sequence.
ACCESSION   NC_014025
VERSION     NC_014025.1  GI:294509091
DBLINK      Project: 15862
            BioProject: PRJNA15862
KEYWORDS    RefSeq.
SOURCE      Bacillus megaterium QM B1551
  ORGANISM  Bacillus megaterium QM B1551
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
REFERENCE   1  (bases 1 to 66985)
  AUTHORS   Eppinger,M., Bunk,B., Johns,M.A., Edirisinghe,J.N., Kutumbaka,K.K.,
            Koenig,S.S., Creasy,H.H., Rosovitz,M.J., Riley,D.R., Daugherty,S.,
            Martin,M., Elbourne,L.D., Paulsen,I., Biedendieck,R., Braun,C.,
            Grayburn,S., Dhingra,S., Lukyanchuk,V., Ball,B., Ul-Qamar,R.,
            Seibel,J., Bremer,E., Jahn,D., Ravel,J. and Vary,P.S.
  TITLE     Genome sequences of the biotechnologically important Bacillus
            megaterium strains QM B1551 and DSM319
  JOURNAL   J. Bacteriol. 193 (16), 4199-4213 (2011)
   PUBMED   21705586
REFERENCE   2  (bases 1 to 66985)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (08-APR-2010) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 66985)
  AUTHORS   Eppinger,M., Bunk,B., Johns,M.A., Edirisinghe,J.N., Kutumbaka,K.K.,
            Riley,D.R., Huot-Creasy,H., Koenig,S.S.K., Galens,K., Orvis,J.,
            Creasy,T., Biedendieck,R., Braun,C., Grayburn,S., Jahn,D.,
            Vary,P.S. and Ravel,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2010) Institute for Genome Sciences, University
            of Maryland School of Medicine, 801 West Baltimore St, Baltimore,
            MD 21201, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP001988.
            Bacteria available from the Bacillus Genetic Stock Center,
            (http://www.bgsc.org/), The Ohio State University, 776 Biological
            Sciences Building, 484 West 12th Avenue, Columbus. Ohio 43210 under
            inventory No. 7A116 or from Patricia S. Vary (pvary@niu.edu), Dept.
            of Biological Sciences, Northern Illinois University, DeKalb, IL
            60115.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..66985
                     /organism="Bacillus megaterium QM B1551"
                     /mol_type="genomic DNA"
                     /strain="QM B1551"
                     /db_xref="taxon:545693"
                     /plasmid="pBM500"
     gene            177..1298
                     /locus_tag="BMQ_pBM50001"
                     /db_xref="GeneID:8997187"
     CDS             177..1298
                     /locus_tag="BMQ_pBM50001"
                     /codon_start=1
                     /transl_table=11
                     /product="putative replication protein"
                     /protein_id="YP_003566020.1"
                     /db_xref="GI:294509092"
                     /db_xref="GeneID:8997187"
                     /translation="MEMLDYVIYNLVATGIQAIHSKTLMQKFDVSQSTVSRFVKSLKE
                     TPFMIVARYIKEDTTGAHPDSYVFILKSHTNFNQICEEIFFAHDTTGVQTLQQEEMTT
                     PVTTPVTTPVTSPERAENVDTPSFEGEKTSSPFINLDLPKNHLTNHLISASQSFAYIK
                     GVPKKVNNVYAGKYGHQLKDFYARIQNAAKAVKRDTEIEIVKEQVHEVAYTAIVGLDK
                     YVHEANHKGTPLSLDEMCRLVYQIAYNQFTNLLTGNTEEQPSESDIHTEAETAALFTP
                     KHIIRKEIVPAWLKVEKEQKECTQEPALSLDEQLEMIQLKQDLGQELTPEEETLLQEH
                     SSTYSSLEMAQLKQDLGQALTPEEQALLHQQDQLKGSVS"
     misc_feature    <1095..>1232
                     /locus_tag="BMQ_pBM50001"
                     /note="Beta-catenin-interacting protein ICAT; Region:
                     ICAT; pfam06384"
                     /db_xref="CDD:148158"
     gene            1406..2173
                     /locus_tag="BMQ_pBM50002"
                     /db_xref="GeneID:8997094"
     CDS             1406..2173
                     /locus_tag="BMQ_pBM50002"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stability protein"
                     /protein_id="YP_003566021.1"
                     /db_xref="GI:294509093"
                     /db_xref="GeneID:8997094"
                     /translation="MPHKMTLTGSATGPLREYDRYVAFDMREKGSPSAPKGLKKSTFI
                     SYTVFVAKKAFNKTGLTKKSIMHEKILIQGEPTLDIPIDECPGEIGIICFQITVLPNK
                     NDKEANESKDKKEAKLEVSKAQQEVAATRQEEKQNPVSQPVATEAKTIQPEAKEMPVQ
                     EKKAAPQKKQLPTQPKGTQDVVNFDEIIVPEAFLKTRPNPVKTEEVIEFVKRTGHLDK
                     PLTIDKGSKILKDGYRRYIVAKTVKMDKVPVVYEYQK"
     misc_feature    1736..>1942
                     /locus_tag="BMQ_pBM50002"
                     /note="Protein of unknown function (DUF1421); Region:
                     DUF1421; pfam07223"
                     /db_xref="CDD:254110"
     gene            2253..3065
                     /locus_tag="BMQ_pBM50003"
                     /db_xref="GeneID:8997095"
     CDS             2253..3065
                     /locus_tag="BMQ_pBM50003"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566022.1"
                     /db_xref="GI:294509094"
                     /db_xref="GeneID:8997095"
                     /translation="MSYPYDLDYLLPDDQRYNIYVATLIPKLSIDEDSVQFFENYIRF
                     DVMVGTGEHTSREILDISIFSDDKPEFDHRKFEFDYEKPRKAMVFTGWKKGPIELSLL
                     HVYREDSKYYLDTEIVYIGQAFGENGERLPAEELMSDPMLQKVEEALLREYPEKDLAL
                     LLLEFNSQLLEEIDSEDEDLIQLQEITKNPSLELNNQILNATEAALINYFKPEYNKKL
                     NNDFSNVEDHGLHYHSVTVQVHPDIMGLKLFSKEKTYLSNDPIVSSPLHSNS"
     gene            3386..3955
                     /locus_tag="BMQ_pBM50004"
                     /db_xref="GeneID:8997096"
     CDS             3386..3955
                     /locus_tag="BMQ_pBM50004"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566023.1"
                     /db_xref="GI:294509095"
                     /db_xref="GeneID:8997096"
                     /translation="MSEQLGYFAKQVCGKLKLNPNTLRKWAIELEENGYKFERNNKGP
                     NGQRIYYERDINIIAEFKVLLERTHSVENTAKLLMKRVEEDSNAEITHGVREEKERSN
                     PITVTFTREELEQYTRGIIEETSAKVAAEVSAQTAEAVYKKMENLIEQRDHKLINQMN
                     ESMEQRRLEIAAAREEPASSFWSRLFNRK"
     misc_feature    3416..3619
                     /locus_tag="BMQ_pBM50004"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:261364"
     misc_feature    order(3455..3457,3521..3529)
                     /locus_tag="BMQ_pBM50004"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     gene            4029..4202
                     /locus_tag="BMQ_pBM50005"
                     /db_xref="GeneID:8997097"
     CDS             4029..4202
                     /locus_tag="BMQ_pBM50005"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566024.1"
                     /db_xref="GI:294509096"
                     /db_xref="GeneID:8997097"
                     /translation="MTRGEKGSNTGITHSVREEKERSNPVTVMFTREELEQYTFGLSK
                     KFQCKRQKQRIKK"
     gene            4486..4605
                     /locus_tag="BMQ_pBM50006"
                     /db_xref="GeneID:8997098"
     CDS             4486..4605
                     /locus_tag="BMQ_pBM50006"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566025.1"
                     /db_xref="GI:294509097"
                     /db_xref="GeneID:8997098"
                     /translation="MLQSCSENENKKEDTIHNISSHEVKKDLLSILEIRLFSI"
     gene            4861..5088
                     /locus_tag="BMQ_pBM50007"
                     /db_xref="GeneID:8997099"
     CDS             4861..5088
                     /locus_tag="BMQ_pBM50007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566026.1"
                     /db_xref="GI:294509098"
                     /db_xref="GeneID:8997099"
                     /translation="MFWWKNPKRSKFGKWLDKNGIQQTDFAMKSNVSRRTIWTICNDK
                     NYIPSATIVKKVMDAVKMVDSSKQPKDFFDI"
     misc_feature    4888..>5046
                     /locus_tag="BMQ_pBM50007"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    4900..5037
                     /locus_tag="BMQ_pBM50007"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(4906..4908,4981..4983)
                     /locus_tag="BMQ_pBM50007"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(4909..4911,4984..4986)
                     /locus_tag="BMQ_pBM50007"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(4927..4932,4963..4965,4972..4974,4984..4989)
                     /locus_tag="BMQ_pBM50007"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(5572..6804)
                     /locus_tag="BMQ_pBM50008"
                     /db_xref="GeneID:8997100"
     CDS             complement(5572..6804)
                     /locus_tag="BMQ_pBM50008"
                     /EC_number="1.14.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="YP_003566027.1"
                     /db_xref="GI:294509099"
                     /db_xref="GeneID:8997100"
                     /translation="MKKVTVDDFSSPENMHDVIGFYKKLTEHQEPLIRLDDYYGLGPA
                     WVALRHDDVVTILKNPRFLKDVRKFTPLQDKKDSIDDSTSASKLFEWMMNMPNMLTVD
                     PPDHTRLRRLASKAFTPRMIENLRPRIQQITNELLDSVEGKRNMDLVADFSFPLPIIV
                     ISEMLGIPPLDQKRFRDWTDKLIKAAMDPSQGAVVMETLKEFIDYIKKMLVEKRNHPD
                     DDVMSALLQAHEQEDKLSENELLSTIWLLITAGHETTAHLISNGVLALLKHPEQMRLL
                     RDNPSLLPSAVEELLRYAGPVMIGGRFAGEDIIMHGKMIPKGEMVLFSLVAANIDSQK
                     FSYPEGLDITREENEHLTFGKGIHHCLGAPLARMEAHIAFGTLLQRFPDLRLAIESEQ
                     LVYNNSTLRSLKSLPVIF"
     misc_feature    complement(5575..6714)
                     /locus_tag="BMQ_pBM50008"
                     /note="Cytochrome P450 [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: CypX;
                     COG2124"
                     /db_xref="CDD:225035"
     gene            complement(6957..7652)
                     /locus_tag="BMQ_pBM50009"
                     /db_xref="GeneID:8997101"
     CDS             complement(6957..7652)
                     /locus_tag="BMQ_pBM50009"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566028.1"
                     /db_xref="GI:294509100"
                     /db_xref="GeneID:8997101"
                     /translation="MSFRLSQRDKDIIAFINQFRAVDRDSLVDLFFKQLKSPVNACNS
                     VMVRLYRLGVIERTQQYSPTVYLPVDAKIKKNSQKILHFLSVLDVYKQMCAYSVPKHV
                     IVEDKPTGRKGGIEPDLFCIFKGSPFWIEIQRNQYSEQKMQAKINLYEEFFFSDEWKA
                     LQWQSEDRAALFPSVMVITPVRYAVASNHIRIIQVASIHELMEKYKSSSKQQKEARSK
                     TDPSSGGIKINLT"
     misc_feature    complement(7173..7613)
                     /locus_tag="BMQ_pBM50009"
                     /note="Replication-relaxation; Region: Replic_Relax;
                     pfam13814"
                     /db_xref="CDD:258094"
     gene            complement(7649..8446)
                     /locus_tag="BMQ_pBM50010"
                     /db_xref="GeneID:8997102"
     CDS             complement(7649..8446)
                     /locus_tag="BMQ_pBM50010"
                     /codon_start=1
                     /transl_table=11
                     /product="FtsK/SpoIIIE family"
                     /protein_id="YP_003566029.1"
                     /db_xref="GI:294509101"
                     /db_xref="GeneID:8997102"
                     /translation="MELPVCIGQDIYGNLVSWDFADLETLLISGEIGAGKSSLMRVIL
                     TTWVKYTSPDDLRLVLVDLKRADLGLFHGIEHVDALCFEAKDMRKPFSLLRAEMYRRG
                     DLLLEHGVTHISRLPFKLPRIVVVVDEMSIIKRETELVEIIQQFASQGRALGVHTIIA
                     MQRPDSDLLNSALKANLRVRISGRQADATNAKVAGVIGAEEIDAAARGRMKIKIDEVK
                     EFQAFFLDEGDCKEILSPYKALVHDPEPDIEVASQSIFGLLEKEEQR"
     misc_feature    complement(7949..8446)
                     /locus_tag="BMQ_pBM50010"
                     /note="FtsK/SpoIIIE family; Region: FtsK_SpoIIIE;
                     pfam01580"
                     /db_xref="CDD:250719"
     gene            complement(9786..10028)
                     /locus_tag="BMQ_pBM50011"
                     /db_xref="GeneID:8997103"
     CDS             complement(9786..10028)
                     /locus_tag="BMQ_pBM50011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566030.1"
                     /db_xref="GI:294509102"
                     /db_xref="GeneID:8997103"
                     /translation="MNKKKSNYIIFSLWFLVLFFLWIIISLSAGTNGQWWSMYRFNPE
                     KYGPWALEFSYIKIIMAAVISLLIAYVVAFVLTRKK"
     misc_feature    complement(<9801..>9998)
                     /locus_tag="BMQ_pBM50011"
                     /note="Protein of unknown function (DUF1003); Region:
                     DUF1003; cl01831"
                     /db_xref="CDD:261088"
     gene            complement(10191..10883)
                     /locus_tag="BMQ_pBM50012"
                     /db_xref="GeneID:8997104"
     CDS             complement(10191..10883)
                     /locus_tag="BMQ_pBM50012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566031.1"
                     /db_xref="GI:294509103"
                     /db_xref="GeneID:8997104"
                     /translation="MATNYKYSKELWLNGRPQLHVIKTKISNICTETICKPLTDTSYY
                     GINGGFFDSRDYHKTPNASRAICVDTGESGKKITVGGKTFYKNYNYNNTSSNPISRKT
                     AVIYTVSGTKKMTSMYAKTRDNVAAKYPKYNQIIGGMDYSSKAWGTKAYSAPTQRTVL
                     AWSGSYAYLIVTEVAMSIPGLKKAVEQLGLNSANSIVLDGSGSTSMKCKEFVKKGDKR
                     HIFNMVRLFKTS"
     gene            complement(11014..11205)
                     /locus_tag="BMQ_pBM50013"
                     /db_xref="GeneID:8997105"
     CDS             complement(11014..11205)
                     /locus_tag="BMQ_pBM50013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566032.1"
                     /db_xref="GI:294509104"
                     /db_xref="GeneID:8997105"
                     /translation="MLYTNEEIEEVLICLEYKLRKSLRETHPKYREDLAQNLRESIVR
                     KMKSDTLHKSPSFFTLINQ"
     misc_feature    complement(11023..11196)
                     /locus_tag="BMQ_pBM50013"
                     /note="hypothetical protein; Provisional; Region:
                     PRK14082"
                     /db_xref="CDD:184493"
     gene            complement(11224..11394)
                     /locus_tag="BMQ_pBM50014"
                     /db_xref="GeneID:8997106"
     CDS             complement(11224..11394)
                     /locus_tag="BMQ_pBM50014"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566033.1"
                     /db_xref="GI:294509105"
                     /db_xref="GeneID:8997106"
                     /translation="MIDSTNIIQLIGNFGFPMALAIYLLLRFENRLESLKSAIDKLAE
                     TMREFPNINKDN"
     misc_feature    complement(11269..11370)
                     /locus_tag="BMQ_pBM50014"
                     /note="YvrJ protein family; Region: YvrJ; pfam12841"
                     /db_xref="CDD:257341"
     gene            complement(11387..11923)
                     /locus_tag="BMQ_pBM50015"
                     /db_xref="GeneID:8997107"
     CDS             complement(11387..11923)
                     /locus_tag="BMQ_pBM50015"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RNA polymerase sigma-70, region 4"
                     /protein_id="YP_003566034.1"
                     /db_xref="GI:294509106"
                     /db_xref="GeneID:8997107"
                     /translation="MLKIKNPLIQGFLKEEENYSLFKKYQLEPTQKNEQKLDNKFKKY
                     YLKIRAISYFSKVIHFESKKFDNKHRTYNKRFLSILDKPVPESDNGTLIDLLIDSSTN
                     YCTEEVPSKKLEDYIENPSLYLSIKKLSSKQKKILYLAYIKDLKDVEIARYLNVSQQY
                     ITRTRNKTLLKLRGDLSD"
     misc_feature    complement(11405..11548)
                     /locus_tag="BMQ_pBM50015"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cl17257"
                     /db_xref="CDD:266592"
     misc_feature    complement(order(11417..11419,11423..11428,11432..11440,
                     11444..11449,11453..11455,11483..11488,11504..11506,
                     11534..11536))
                     /locus_tag="BMQ_pBM50015"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            12363..12479
                     /locus_tag="BMQ_pBM50016"
                     /db_xref="GeneID:8997108"
     CDS             12363..12479
                     /locus_tag="BMQ_pBM50016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566035.1"
                     /db_xref="GI:294509107"
                     /db_xref="GeneID:8997108"
                     /translation="MRLSLPAQLQFLFVFIDYRLPKTFVKVFELQETFVIYF"
     gene            complement(12773..13345)
                     /locus_tag="BMQ_pBM50017"
                     /db_xref="GeneID:8997109"
     CDS             complement(12773..13345)
                     /locus_tag="BMQ_pBM50017"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR family"
                     /protein_id="YP_003566036.1"
                     /db_xref="GI:294509108"
                     /db_xref="GeneID:8997109"
                     /translation="MSKQIDPRVLRTRKLIMDALIELSMKKEFKDITIKDITTVATVN
                     RATFYYHFMDKYDLLEKVLSESIMREVLQEVSTHEVINEETIEAIFLSIIKFQTSLSN
                     QCQQNYEAFMPQIETIFKKELQAFFSEWGKKQWNNPNKMEVEAGAVMLSWTLYGAAVH
                     WMQNQTTEPEDYLMSLMSFIKNWNEHINLI"
     misc_feature    complement(12815..13312)
                     /locus_tag="BMQ_pBM50017"
                     /note="probable dihydroxyacetone kinase regulator; Region:
                     DHAK_reg; TIGR02366"
                     /db_xref="CDD:233838"
     misc_feature    complement(13166..13300)
                     /locus_tag="BMQ_pBM50017"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            13380..14138
                     /locus_tag="BMQ_pBM50018"
                     /db_xref="GeneID:8997110"
     CDS             13380..14138
                     /locus_tag="BMQ_pBM50018"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD dependent epimerase/dehydratase family"
                     /protein_id="YP_003566037.1"
                     /db_xref="GI:294509109"
                     /db_xref="GeneID:8997110"
                     /translation="MCWIYYICVILLVEQRFLPWYINFTTSVGYTKGVETKNMKITIF
                     GATGQIGQLLVTQALQAGYDVTAYSRRPNALNIKHEKLQIIVGDLTDQGKLREAILER
                     DVVVSALGPTMSMKRQVLDLPITQGHKAIISVMEEYGPKRFITLATPTISAKEDVKQL
                     VTQLPSIMAKLLYPTGYAEMKEIEKLIENSRLDWTVVRMLNPNMKTNGNGYSVSFGDT
                     KGKMNVSRYNVAKCMLEATQKDEWVHKMPIVFNN"
     misc_feature    13494..>13973
                     /locus_tag="BMQ_pBM50018"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    13497..14126
                     /locus_tag="BMQ_pBM50018"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(13512..13514,13518..13523,13527..13529,13584..13592,
                     13701..13709,13815..13820,13827..13829,13905..13907,
                     13917..13919,13974..13976)
                     /locus_tag="BMQ_pBM50018"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(13749..13751,13827..13829,13905..13907,13917..13919)
                     /locus_tag="BMQ_pBM50018"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            14358..14981
                     /locus_tag="BMQ_pBM50019"
                     /db_xref="GeneID:8997111"
     CDS             14358..14981
                     /locus_tag="BMQ_pBM50019"
                     /EC_number="1.13.11.39"
                     /codon_start=1
                     /transl_table=11
                     /product="biphenyl-2,3-diol 1,2-dioxygenase III"
                     /protein_id="YP_003566038.1"
                     /db_xref="GI:294509110"
                     /db_xref="GeneID:8997111"
                     /translation="MSNQENKKITPILHHIGLTTGRFEEMISWYNNVLGMEPVHYSEN
                     PAGDIGMKVKALWVTNDEANHRIAMIGIPGLTSDMNRSKHSRIQHIAFEYDTLDDLLD
                     TYIRLKNLGITPHVTADQGVSIAFYYNDPDGNTVELTMDTFGDWSKSKEFMKKSPTFA
                     KKPMGKYIDVEKILLAREQGLSANEIHERAYAGEYEPNTPMDPQKML"
     misc_feature    14394..14819
                     /locus_tag="BMQ_pBM50019"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:265436"
     misc_feature    order(14400..14402,14412..14414,14502..14504,14559..14561,
                     14565..14567,14622..14624,14736..14738,14760..14762,
                     14766..14768)
                     /locus_tag="BMQ_pBM50019"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(14400..14402,14622..14624,14766..14768)
                     /locus_tag="BMQ_pBM50019"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            complement(15064..15183)
                     /locus_tag="BMQ_pBM50020"
                     /db_xref="GeneID:8997112"
     CDS             complement(15064..15183)
                     /locus_tag="BMQ_pBM50020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566039.1"
                     /db_xref="GI:294509111"
                     /db_xref="GeneID:8997112"
                     /translation="MHYFKCIAYLLEVCAFLLSGTCNMNTALKEINYKIASLF"
     gene            complement(15288..16280)
                     /locus_tag="BMQ_pBM50021"
                     /db_xref="GeneID:8997113"
     CDS             complement(15288..16280)
                     /locus_tag="BMQ_pBM50021"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase GFO/IDH/MOCA family"
                     /protein_id="YP_003566040.1"
                     /db_xref="GI:294509112"
                     /db_xref="GeneID:8997113"
                     /translation="MKKANLCFIGAGFHASTNIYPSAIEAGAAIQAVSTRNIERSKAT
                     LQRFGSKGTPYDDYKKMLQYEECDGVVVVAQPEDQPSLVMDCIRAGKNVFVDKPLGMS
                     ADEAAEIADAADEAGVTVMVGFMKRYAPCYTKLKEIIENGSLGNARSFQAKFAVDSTP
                     FCKDDEQFIKFAAIHIVDLIRYLFGEVLYVSGFKNSDNGFISHSITLKFKNGVVGSLY
                     FTGMTAWSRESENILVTFDNGFAFADEVNSLTIHKSQTFSDLPWKSLEEADTVFTPSA
                     SPMSGTYRDLYLRGFVGEMTHFIDCCKNKRKPTSNGRDNVHTMSLCDRILSELI"
     misc_feature    complement(15303..16280)
                     /locus_tag="BMQ_pBM50021"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    complement(15909..16259)
                     /locus_tag="BMQ_pBM50021"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; cl19130"
                     /db_xref="CDD:267483"
     misc_feature    complement(15603..15875)
                     /locus_tag="BMQ_pBM50021"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            complement(16520..16651)
                     /locus_tag="BMQ_pBM50022"
                     /db_xref="GeneID:8997114"
     CDS             complement(16520..16651)
                     /locus_tag="BMQ_pBM50022"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566041.1"
                     /db_xref="GI:294509113"
                     /db_xref="GeneID:8997114"
                     /translation="MTEIFIFYYLRKKHSPFNQMNANENHFPIALEKFTHDYKEQFL"
     gene            16714..17244
                     /locus_tag="BMQ_pBM50023"
                     /db_xref="GeneID:8997115"
     CDS             16714..17244
                     /locus_tag="BMQ_pBM50023"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor, sigma-70 family"
                     /protein_id="YP_003566042.1"
                     /db_xref="GI:294509114"
                     /db_xref="GeneID:8997115"
                     /translation="MSTIKKEERPVSDVTFEDLFKQYYVYVVKQIVWIVKNQMIAEEL
                     AQEVFLQLYRNDWKSIENVPGWLLKSSTYVAYNYLRSEKRHQARINKTIQYHEAQHIS
                     SLDDDWIRKEEITKVQNVLSNMNERERTILLLKFSSFQYKEIAEVLQINISSIGTLLV
                     RAKQKFRKIYKQLEEA"
     misc_feature    16747..17241
                     /locus_tag="BMQ_pBM50023"
                     /note="RNA polymerase sigma factor SigX; Provisional;
                     Region: PRK09639"
                     /db_xref="CDD:236602"
     misc_feature    16768..16965
                     /locus_tag="BMQ_pBM50023"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    17053..17214
                     /locus_tag="BMQ_pBM50023"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(17086..17088,17116..17118,17131..17136,17164..17166,
                     17170..17175,17179..17187,17191..17196,17200..17202)
                     /locus_tag="BMQ_pBM50023"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            17248..18225
                     /locus_tag="BMQ_pBM50024"
                     /db_xref="GeneID:8997116"
     CDS             17248..18225
                     /locus_tag="BMQ_pBM50024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566043.1"
                     /db_xref="GI:294509115"
                     /db_xref="GeneID:8997116"
                     /translation="MNCYDKGFIQAYIDGELSHDTRKEFTKHLDTCEICQDVLIEISK
                     LNRWEDVVLEEETRHLSQEINIDVDQAWKTFESRTKLENVSYINQKTEQKRGLFTNMN
                     KKSKRFMYTAVAAAGLFTTAMIPQVQVAATNVASYFSNEISNDKVVNEGIHDENGVTQ
                     DMMKDGQFIPIDKKITDQGVTVHFKELYVADSRISIHYKIEKADGSLVPFEFDTTGLD
                     LKNDGKTNEQQEENPEYQEKDGSFSQLPFIQGASGLPFKLMAAGEELEYVGIRDKDRP
                     EGIITFVEGPEGKDSFKQPLTLNVDINKIGKVAGSWKGQIQIDPAKLKK"
     misc_feature    17272..17355
                     /locus_tag="BMQ_pBM50024"
                     /note="Putative zinc-finger; Region: zf-HC2; pfam13490"
                     /db_xref="CDD:257814"
     misc_feature    17548..17859
                     /locus_tag="BMQ_pBM50024"
                     /note="Domain of unknown function (DUF4179); Region:
                     DUF4179; pfam13786"
                     /db_xref="CDD:258070"
     gene            complement(18233..18394)
                     /locus_tag="BMQ_pBM50025"
                     /db_xref="GeneID:8997117"
     CDS             complement(18233..18394)
                     /locus_tag="BMQ_pBM50025"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566044.1"
                     /db_xref="GI:294509116"
                     /db_xref="GeneID:8997117"
                     /translation="MSGPKNKESLPCPYWDVFMVIRLKKIKYDINVTNIRKNISMVLD
                     THRSILFFI"
     gene            18531..18659
                     /locus_tag="BMQ_pBM50026"
                     /db_xref="GeneID:8997118"
     CDS             18531..18659
                     /locus_tag="BMQ_pBM50026"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566045.1"
                     /db_xref="GI:294509117"
                     /db_xref="GeneID:8997118"
                     /translation="MNAFFSYIIKKVFCHKTWISGFSIIRESNKSEVLTGMLTKKD"
     gene            18794..19243
                     /locus_tag="BMQ_pBM50027"
                     /db_xref="GeneID:8997119"
     CDS             18794..19243
                     /locus_tag="BMQ_pBM50027"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_003566046.1"
                     /db_xref="GI:294509118"
                     /db_xref="GeneID:8997119"
                     /translation="MNRGEKIAKARREMNLTQDQLAEMLEVTRQTISKWESNLAYPES
                     VKLGKLAEVLNVTCDYLLRENQATSTSTSIEVTMNNSGNYTLDWSKLYPILNEYQNMI
                     DCPHYFEKIYGMVKEIMVKYKYSSEDTFLILKDLLYQIYLQMEKKVQ"
     misc_feature    18803..19147
                     /locus_tag="BMQ_pBM50027"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    18803..18976
                     /locus_tag="BMQ_pBM50027"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(18815..18817,18827..18829,18902..18904)
                     /locus_tag="BMQ_pBM50027"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(18824..18826,18899..18901)
                     /locus_tag="BMQ_pBM50027"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(18845..18850,18881..18883,18890..18892,18902..18907)
                     /locus_tag="BMQ_pBM50027"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            19366..19503
                     /locus_tag="BMQ_pBM50028"
                     /db_xref="GeneID:8997120"
     CDS             19366..19503
                     /locus_tag="BMQ_pBM50028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566047.1"
                     /db_xref="GI:294509119"
                     /db_xref="GeneID:8997120"
                     /translation="MVKNKNRALVYQCSVFILVPRLLIMLTTFVYRIQLKNRKNYLRI
                     R"
     gene            19549..19689
                     /locus_tag="BMQ_pBM50029"
                     /db_xref="GeneID:8997121"
     CDS             19549..19689
                     /locus_tag="BMQ_pBM50029"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566048.1"
                     /db_xref="GI:294509120"
                     /db_xref="GeneID:8997121"
                     /translation="MGSLLKEVKNMYIHKNEVYFKFYLNVCFETYKKGKSILILFQIN
                     LK"
     gene            19743..19889
                     /locus_tag="BMQ_pBM50030"
                     /db_xref="GeneID:8997122"
     CDS             19743..19889
                     /locus_tag="BMQ_pBM50030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566049.1"
                     /db_xref="GI:294509121"
                     /db_xref="GeneID:8997122"
                     /translation="MSINKEVFYRGKRFKIIHIYSSGYCELRKVNDPFKVELALLNDI
                     LLTG"
     gene            complement(20095..20304)
                     /gene="gsiB"
                     /locus_tag="BMQ_pBM50031"
                     /db_xref="GeneID:8997123"
     CDS             complement(20095..20304)
                     /gene="gsiB"
                     /locus_tag="BMQ_pBM50031"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose starvation-inducible protein B"
                     /protein_id="YP_003566050.1"
                     /db_xref="GI:294509122"
                     /db_xref="GeneID:8997123"
                     /translation="MTTNKNNDKMSREEAGRMGGKATSKNHDKEFYQEIGEKGGEATS
                     KNHDKEFYQEIGEKGGKANNKRNND"
     misc_feature    complement(20104..20301)
                     /gene="gsiB"
                     /locus_tag="BMQ_pBM50031"
                     /note="General stress protein [General function prediction
                     only]; Region: GsiB; COG3729"
                     /db_xref="CDD:226252"
     gene            complement(20385..20498)
                     /locus_tag="BMQ_pBM50032"
                     /db_xref="GeneID:8997124"
     CDS             complement(20385..20498)
                     /locus_tag="BMQ_pBM50032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566051.1"
                     /db_xref="GI:294509123"
                     /db_xref="GeneID:8997124"
                     /translation="MYFIDTLILKKSISTNISKIFQKEELQNKKRKMILNY"
     gene            20728..20886
                     /locus_tag="BMQ_pBM50033"
                     /db_xref="GeneID:8997125"
     CDS             20728..20886
                     /locus_tag="BMQ_pBM50033"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566052.1"
                     /db_xref="GI:294509124"
                     /db_xref="GeneID:8997125"
                     /translation="MDNKHNLLLCPGEVNCLREGYKNCEKELIKSEIHKDIILLSDEI
                     KVDYKVNR"
     gene            21038..21211
                     /locus_tag="BMQ_pBM50034"
                     /db_xref="GeneID:8997126"
     CDS             21038..21211
                     /locus_tag="BMQ_pBM50034"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566053.1"
                     /db_xref="GI:294509125"
                     /db_xref="GeneID:8997126"
                     /translation="MGEQTYSDIQRKKTSIIDSLIHLGIYKKGNKQLYELTLHELETE
                     YHIVNPEIQDISF"
     misc_feature    21068..21172
                     /locus_tag="BMQ_pBM50034"
                     /note="Protein of unknown function (DUF3940); Region:
                     DUF3940; pfam13076"
                     /db_xref="CDD:257485"
     gene            21256..21438
                     /locus_tag="BMQ_pBM50035"
                     /db_xref="GeneID:8997127"
     CDS             21256..21438
                     /locus_tag="BMQ_pBM50035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566054.1"
                     /db_xref="GI:294509126"
                     /db_xref="GeneID:8997127"
                     /translation="MFLKKLIKNGLITVKYYENGSLQTYKGRVYNLNLHEQTLSLKDE
                     KQNIFFIRLSGIEDIY"
     misc_feature    <21268..21432
                     /locus_tag="BMQ_pBM50035"
                     /note="YolD-like protein; Region: YolD; pfam08863"
                     /db_xref="CDD:255077"
     gene            21574..21711
                     /locus_tag="BMQ_pBM50036"
                     /db_xref="GeneID:8997128"
     CDS             21574..21711
                     /locus_tag="BMQ_pBM50036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566055.1"
                     /db_xref="GI:294509127"
                     /db_xref="GeneID:8997128"
                     /translation="MRENKQIWSDFIEEDRFELHSYLTYLFKQCHDENLRQLEDENIE
                     E"
     gene            21927..22190
                     /locus_tag="BMQ_pBM50037"
                     /db_xref="GeneID:8997129"
     CDS             21927..22190
                     /locus_tag="BMQ_pBM50037"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566056.1"
                     /db_xref="GI:294509128"
                     /db_xref="GeneID:8997129"
                     /translation="MNTTVNELYDFGTVLRRKLLNNNLYAHYLSDAMRRENHFDFLYY
                     FLTATVDSQTPIPEHVSAVFLKVLSDKEKLSDLTPFIMGLIGK"
     gene            22680..22886
                     /locus_tag="BMQ_pBM50038"
                     /db_xref="GeneID:8997130"
     CDS             22680..22886
                     /locus_tag="BMQ_pBM50038"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566057.1"
                     /db_xref="GI:294509129"
                     /db_xref="GeneID:8997130"
                     /translation="MLTKVSELSQRIYLSECIINKRRELVDLGMDYGLLNKKTIQCSQ
                     DLDQLINLYMQGSKKTEYKFYYIL"
     misc_feature    22719..22844
                     /locus_tag="BMQ_pBM50038"
                     /note="Spo0E like sporulation regulatory protein; Region:
                     SpoOE-like; pfam09388"
                     /db_xref="CDD:255336"
     gene            23082..23273
                     /locus_tag="BMQ_pBM50039"
                     /db_xref="GeneID:8997131"
     CDS             23082..23273
                     /locus_tag="BMQ_pBM50039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566058.1"
                     /db_xref="GI:294509130"
                     /db_xref="GeneID:8997131"
                     /translation="MSKQAEAIKEVKLLNAEIDLCNRIKNLLNQGKLRDLQLKKEYTE
                     YEILQIALNRLMNELTFRY"
     gene            complement(23463..23816)
                     /locus_tag="BMQ_pBM50040"
                     /db_xref="GeneID:8997132"
     CDS             complement(23463..23816)
                     /locus_tag="BMQ_pBM50040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566059.1"
                     /db_xref="GI:294509131"
                     /db_xref="GeneID:8997132"
                     /translation="MVTEGLTPTTLVKNLSALPTPCNDVVYYPTHLTVLGIQGEYSVF
                     QAFSRKSGLAYIAITHPDTTKFIFAGSRNSMYELYQVIPWPEYKISNGELTFYYKTAP
                     SLQTLEDYFNNIKKQ"
     gene            complement(24194..24313)
                     /locus_tag="BMQ_pBM50041"
                     /db_xref="GeneID:8997133"
     CDS             complement(24194..24313)
                     /locus_tag="BMQ_pBM50041"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566060.1"
                     /db_xref="GI:294509132"
                     /db_xref="GeneID:8997133"
                     /translation="MSRKSIIFIVRLSLKFNYERSLKNTPFYERFGKKIRFLP"
     gene            24294..24422
                     /locus_tag="BMQ_pBM50042"
                     /db_xref="GeneID:8997134"
     CDS             24294..24422
                     /locus_tag="BMQ_pBM50042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566061.1"
                     /db_xref="GI:294509133"
                     /db_xref="GeneID:8997134"
                     /translation="MIDFLLKRKVRKCILLRKLNLILFQIVKGIKLRIFLELLKLF"
     gene            complement(24658..24846)
                     /locus_tag="BMQ_pBM50043"
                     /db_xref="GeneID:8997135"
     CDS             complement(24658..24846)
                     /locus_tag="BMQ_pBM50043"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566062.1"
                     /db_xref="GI:294509134"
                     /db_xref="GeneID:8997135"
                     /translation="MINKIKVKFLRERFSANSINIFDVFLPENRELSFNEQIMLLRVL
                     LNQACYFFYYIQVISRRN"
     misc_feature    complement(<24682..24819)
                     /locus_tag="BMQ_pBM50043"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl09925"
                     /db_xref="CDD:263920"
     gene            complement(24966..25439)
                     /locus_tag="BMQ_pBM50044"
                     /db_xref="GeneID:8997136"
     CDS             complement(24966..25439)
                     /locus_tag="BMQ_pBM50044"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566063.1"
                     /db_xref="GI:294509135"
                     /db_xref="GeneID:8997136"
                     /translation="MFRIILFIHILVGVICLVTGFAAMIAPKKKGFHTNLGEIYHFSF
                     IIVFLTTIVMAVMHWSSSSYLLYIGIFSYSLALLGYLAGKFKWKNWVAIHIGSILGSY
                     IAILTAVLVVNVNRIPILNNYNPLIFWLLPTVIGSPIIYLIRKKYEIDLNQEKSV"
     gene            complement(25870..27621)
                     /locus_tag="BMQ_pBM50045"
                     /db_xref="GeneID:8997137"
     CDS             complement(25870..27621)
                     /locus_tag="BMQ_pBM50045"
                     /codon_start=1
                     /transl_table=11
                     /product="drug resistance transporter, EmrB/QacA
                     subfamily"
                     /protein_id="YP_003566064.1"
                     /db_xref="GI:294509136"
                     /db_xref="GeneID:8997137"
                     /translation="MDHKLQSNLNSFPILLLMCLGIFICLLDTTIMNIALPAIQNDLN
                     TTLETSSWMLNTYTMTIAVLSIPMGRLAEIYGKMKFFILGLIIFACGSAFCGLSDNGE
                     MLIFARFCQSLGASILVPVATIIGVESLPLKKRHISLSLLGATQGLSTALGPSIGGLI
                     AQNLGWNWVFFVNIPICIVALVIAFIILPFKLEKRVKAKIDWAGLILAAIGIFNLNLV
                     LIKGNTWGWTSFTSLCCFFIFIVSLIMFIIVERKIKDPMVDLNLFKDRLYVGATLAVS
                     SAYLFLVGVMVLLPQFLTSFQDKTEIQAALLITPISATIFIVVNFVGFLVKKIGYVIP
                     IMIGYIIVAASYFQLEHLNTASTVSEIIIIGVTLGIGFSFIISPATMASVSSFEGEML
                     TSSQSVFTMLRQIGVVLAVAIFVSSITHEVDSKKQNVISYAKEQTSNIDVSPEKRLEI
                     LKSTEKKIDTDSTFSNVIEAPTVSASERQDLIDKNVKDTLSQYPAAEQEKIKEQITNQ
                     VTNQVNQDILKVNKEIKIYTENVTSYTRKEFSSVFSIVFGHALPFIFIGLLISILYRK
                     SKKSKVIKNKEVTALGE"
     misc_feature    complement(26380..27579)
                     /locus_tag="BMQ_pBM50045"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(26392..27570)
                     /locus_tag="BMQ_pBM50045"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(26401..26403,26410..26415,26422..26427,
                     26434..26439,26470..26472,26479..26484,26494..26496,
                     26503..26508,26515..26517,26665..26667,26677..26679,
                     26686..26688,26698..26700,26710..26712,26752..26754,
                     26761..26766,26884..26889,26896..26898,27172..27174,
                     27190..27195,27202..27207,27241..27243,27250..27255,
                     27262..27267,27274..27279,27415..27420,27424..27429,
                     27439..27441,27448..27453,27460..27462,27511..27516,
                     27520..27528,27535..27537))
                     /locus_tag="BMQ_pBM50045"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    complement(<26008..26355)
                     /locus_tag="BMQ_pBM50045"
                     /note="Repeat of unknown function (DUF1103); Region:
                     DUF1103; pfam06513"
                     /db_xref="CDD:115185"
     gene            27600..27731
                     /locus_tag="BMQ_pBM50046"
                     /db_xref="GeneID:8997138"
     CDS             27600..27731
                     /locus_tag="BMQ_pBM50046"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566065.1"
                     /db_xref="GI:294509137"
                     /db_xref="GeneID:8997138"
                     /translation="MIVIYDPFLHLLSSFLQNTEYKFTKSTIVNSNCFSIKLQYQKS"
     gene            complement(27703..28110)
                     /locus_tag="BMQ_pBM50047"
                     /db_xref="GeneID:8997139"
     CDS             complement(27703..28110)
                     /locus_tag="BMQ_pBM50047"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566066.1"
                     /db_xref="GI:294509138"
                     /db_xref="GeneID:8997139"
                     /translation="MKAEIQDLWDNLVFHYEHQEEFQLIILDNKKVKYMWDNYNASLL
                     KILHKKDLHYATSNGRFIERIGARLAVKLAYGKRYPKENLKNIFIASDTWGAPSLWYQ
                     THEIKRVVVSLTHIPNYSGACLHNINSFDIVTL"
     misc_feature    complement(27766..>27978)
                     /locus_tag="BMQ_pBM50047"
                     /note="4'-phosphopantetheinyl transferase superfamily;
                     Region: ACPS; cl00500"
                     /db_xref="CDD:260463"
     gene            complement(28100..30529)
                     /locus_tag="BMQ_pBM50048"
                     /db_xref="GeneID:8997140"
     CDS             complement(28100..30529)
                     /locus_tag="BMQ_pBM50048"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-ketoacyl synthase domain protein"
                     /protein_id="YP_003566067.1"
                     /db_xref="GI:294509139"
                     /db_xref="GeneID:8997140"
                     /translation="MKIAVTGIGILSALGNNQYEFWDNIQSGKTGIREMVQLDSSELL
                     TNYAGEVRNLSPEKMMTQEEIEETERCTQLSFLAASEALKQADIPAGFYNTFKQGVIL
                     GTSLGGIPNGEKFHKQWIREGYEHTDPNLLLSYPLHTAADFLSVRFNLKGPKVAISTA
                     CSAGSNAIGYGIELIKSGKADMLIVGGADPLSMLSLAGFNSLKALSDEPCSPYSQSKG
                     ITLAEGAGVLILERLDRVKERGGKILSLVTGFGLTSDAYHPTAPNPGGAGAFKSMQMA
                     LERSNITSQDIDYVNGHGTGTRANDSAETTALKNLFSNTDKNVPVSSTKSMIGHTLGA
                     AGAVEGITCVLSLMKQTAPPTISFTNNPYNMDFIPNVSRPMAINTVLSNSFAFGGNNA
                     SLIFKKYEEEKQQTEVLSGIKQKVLITGIGCVQPLGIGKDELWESIEKGNSAINPIDF
                     EKEKYIGKLGASVSEKKYLKYINPSLIRRLDLLGKLSLASSKMALNDSGIKINRDNSD
                     KIAVIYGTSSGPLQTVEDIHRTIVVDGVKKVNPSQFPNTVMNAAAGHICSTFQIKGPS
                     TTICTGNVAGSQSITYAYHMINEGLIDAALVVVADEYTETIHAGYDRLGVLGNAPYPF
                     ERDSDGMALSCGSTALFLESEKHAKERKASVYGQIKGYGITSDAYKLAGNNPNGKAYS
                     YAMSDALKESELSVDDIDAIFSDARGLRSMDLTEVNAIRHLGGAKIPVTTLSNKNGYN
                     LSGMTPLHIVAALQTFNNHKIPGLKVKNPIYNLNFAKENQKLHSANNFLFNSANFGGT
                     YTSVVVGRYES"
     misc_feature    complement(29342..30529)
                     /locus_tag="BMQ_pBM50048"
                     /note="Beta-ketoacyl-acyl carrier protein (ACP) synthase
                     (KAS), type I and II. KASs are responsible for the
                     elongation steps in fatty acid biosynthesis. KASIII
                     catalyses the initial condensation and KAS I and II
                     catalyze further elongation steps by Claisen...; Region:
                     KAS_I_II; cd00834"
                     /db_xref="CDD:238430"
     misc_feature    complement(29339..30517)
                     /locus_tag="BMQ_pBM50048"
                     /note="beta-ketoacyl-acyl-carrier-protein synthase II;
                     Region: fabF; TIGR03150"
                     /db_xref="CDD:200247"
     misc_feature    complement(order(29360..29362,29366..29368,29717..29719,
                     29759..29773,29924..29929,29936..29941,29999..30001,
                     30008..30013,30020..30022,30056..30064,30068..30070,
                     30074..30076,30092..30094,30104..30106,30116..30118,
                     30134..30136,30170..30175,30179..30181,30191..30196,
                     30215..30217))
                     /locus_tag="BMQ_pBM50048"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238430"
     misc_feature    complement(order(29540..29542,29651..29653,30047..30049))
                     /locus_tag="BMQ_pBM50048"
                     /note="active site"
                     /db_xref="CDD:238430"
     misc_feature    complement(28118..29290)
                     /locus_tag="BMQ_pBM50048"
                     /note="Condensing enzymes; Family of enzymes that catalyze
                     a (decarboxylating or non-decarboxylating) Claisen-like
                     condensation reaction. Members are share strong structural
                     similarity, and are involved in the synthesis and
                     degradation of fatty acids, and the...; Region:
                     cond_enzymes; cl09938"
                     /db_xref="CDD:263929"
     misc_feature    complement(28106..29287)
                     /locus_tag="BMQ_pBM50048"
                     /note="3-oxoacyl-(acyl-carrier-protein) synthase [Lipid
                     metabolism / Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: FabB; COG0304"
                     /db_xref="CDD:223381"
     misc_feature    complement(order(28286..28288,28811..28813))
                     /locus_tag="BMQ_pBM50048"
                     /note="active site"
                     /db_xref="CDD:238201"
     gene            complement(30541..31623)
                     /locus_tag="BMQ_pBM50049"
                     /db_xref="GeneID:8997141"
     CDS             complement(30541..31623)
                     /locus_tag="BMQ_pBM50049"
                     /codon_start=1
                     /transl_table=11
                     /product="aminomethyl transferase"
                     /protein_id="YP_003566068.1"
                     /db_xref="GI:294509140"
                     /db_xref="GeneID:8997141"
                     /translation="MTYRKSPANESINVITKVVGNQNVPSVFSSLEEEYKAIREEVAV
                     LDFSFNTFLKVSGDSASSFLQELITKDLDYLTEEQTVTCLMLDEDGHLVTELIVYVME
                     NEYLLEIEPSLSEKAEDYLQSHIKDGVLIENLAGKLQMIQLEGPKSWEVVQTLLPFPI
                     EILPYKNFAPFHFEGHNLYIARLGYTAEYGYKVFGDEAGIDLFWKALFAYDLSEINVQ
                     QIGLDAHDVCRLEVRFPDLSKEATSNKLIVESGVNWMLDFNKDFIGKDKNLEGLTSGL
                     CQELVCFTSESAVAKNQDILVDGNKVGYIQHTLYSPGINGSIGVAYLDEKYVASGLTF
                     TLDNDMTINTVSSPMIYPKSLSIRIG"
     misc_feature    complement(30574..31554)
                     /locus_tag="BMQ_pBM50049"
                     /note="putative dimethyl sulfoniopropionate demethylase;
                     Reviewed; Region: dmdA; PRK12486"
                     /db_xref="CDD:237113"
     misc_feature    complement(30859..31467)
                     /locus_tag="BMQ_pBM50049"
                     /note="Aminomethyltransferase folate-binding domain;
                     Region: GCV_T; pfam01571"
                     /db_xref="CDD:250713"
     misc_feature    complement(30607..30846)
                     /locus_tag="BMQ_pBM50049"
                     /note="Glycine cleavage T-protein C-terminal barrel
                     domain; Region: GCV_T_C; pfam08669"
                     /db_xref="CDD:254962"
     gene            complement(31651..32151)
                     /locus_tag="BMQ_pBM50050"
                     /db_xref="GeneID:8997142"
     CDS             complement(31651..32151)
                     /locus_tag="BMQ_pBM50050"
                     /codon_start=1
                     /transl_table=11
                     /product="FabA-like domain protein"
                     /protein_id="YP_003566069.1"
                     /db_xref="GI:294509141"
                     /db_xref="GeneID:8997142"
                     /translation="MTNLLEKKSLKLPLELDQIKNMIPHRYPFLLIDRVNELNPGVSG
                     VAIKNVTANEPFFQGHFPGEAIMPGVLIIEAMAQLIAVIYVSKALVEVESQETSNDIN
                     YADRVGYLAAVKNIKFKNKVVPGDQLVLRAKVVGKMGVLSQVQVWAEVNGKTVVEGSI
                     SVSEKM"
     misc_feature    complement(31669..32085)
                     /locus_tag="BMQ_pBM50050"
                     /note="FabZ is a 17kD beta-hydroxyacyl-acyl carrier
                     protein (ACP) dehydratase that primarily catalyzes the
                     dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP,
                     the third step in the elongation phase of the bacterial/
                     plastid, type II, fatty-acid...; Region: FabZ; cd01288"
                     /db_xref="CDD:238615"
     gene            complement(32148..32447)
                     /locus_tag="BMQ_pBM50051"
                     /db_xref="GeneID:8997143"
     CDS             complement(32148..32447)
                     /locus_tag="BMQ_pBM50051"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier domain protein"
                     /protein_id="YP_003566070.1"
                     /db_xref="GI:294509142"
                     /db_xref="GeneID:8997143"
                     /translation="MSTITQNDLLEQVNERKQLCQQIKTEIVERLSLNIEPAWIADNQ
                     PLFGRGLELDSIDTLEISIALQEVFDVMLTDDNMDVLGSVNKIADFITSQRNENL"
     misc_feature    complement(32163..32393)
                     /locus_tag="BMQ_pBM50051"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; cl09936"
                     /db_xref="CDD:263928"
     gene            complement(32471..33211)
                     /locus_tag="BMQ_pBM50052"
                     /db_xref="GeneID:8997144"
     CDS             complement(32471..33211)
                     /locus_tag="BMQ_pBM50052"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-acyl carrier protein reductase"
                     /protein_id="YP_003566071.1"
                     /db_xref="GI:294509143"
                     /db_xref="GeneID:8997144"
                     /translation="MFKDKVVLVTGASKGIGRATALYFLNEGAKVIINYSKEGNHIKE
                     LKEMVSNKEDQTLFFCADVSNVSSVREMFKAIKNKWGQLDILVSNAGITRDSWLMMMG
                     DKNWDDVLNINLKGTFFCIREASKMMAAKKQGVIINVSSTSGLKGQPGQANYSASKGG
                     IIAMTKTLSRELASYNIRVNCIAPGFIHTGMTNNMPQNTLDSYIQHIPLGRIGEANEV
                     AETIGFLASPKASYITGQCIVVDGGLTT"
     misc_feature    complement(32477..33211)
                     /locus_tag="BMQ_pBM50052"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05557"
                     /db_xref="CDD:235500"
     misc_feature    complement(32477..33199)
                     /locus_tag="BMQ_pBM50052"
                     /note="beta-Keto acyl carrier protein reductase (BKR),
                     involved in Type II FAS, classical (c) SDRs; Region:
                     BKR_SDR_c; cd05333"
                     /db_xref="CDD:187594"
     misc_feature    complement(order(32639..32647,32651..32653,32657..32662,
                     32738..32740,32750..32752,32789..32797,32876..32878,
                     32936..32947,33023..33031,33104..33109,33164..33175,
                     33179..33181))
                     /locus_tag="BMQ_pBM50052"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187594"
     misc_feature    complement(order(32477..32479,32483..32521,32528..32530,
                     32540..32545,32549..32554,32561..32563,32570..32581,
                     32585..32593,32654..32656,32690..32695,32699..32716,
                     32720..32725,32732..32737,32744..32749,32756..32779,
                     32825..32827,32834..32839,32846..32851,32855..32860,
                     32867..32872,32882..32884,32891..32896,32903..32911,
                     32915..32926,33002..33004,33131..33133,33143..33145))
                     /locus_tag="BMQ_pBM50052"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187594"
     misc_feature    complement(order(32699..32704,32708..32716,32720..32725,
                     32732..32737,32744..32749,32756..32782,32825..32827,
                     32834..32839,32846..32848,32855..32860,32867..32872,
                     32882..32884,32891..32896,32903..32905,32909..32911,
                     32915..32923))
                     /locus_tag="BMQ_pBM50052"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187594"
     misc_feature    complement(order(32738..32740,32750..32752,32789..32791,
                     32873..32875))
                     /locus_tag="BMQ_pBM50052"
                     /note="active site"
                     /db_xref="CDD:187594"
     gene            complement(33204..34163)
                     /locus_tag="BMQ_pBM50053"
                     /db_xref="GeneID:8997145"
     CDS             complement(33204..34163)
                     /locus_tag="BMQ_pBM50053"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl transferase domain protein"
                     /protein_id="YP_003566072.1"
                     /db_xref="GI:294509144"
                     /db_xref="GeneID:8997145"
                     /translation="MNKKVAVIFPGQGSQVMGMGKDLISLPLFAQRLEKVAELANLTL
                     DEFFQPKNMKIIEKTEIVQPYIFVISVTLHELISKEYSLKPILFGGHSLGEFSALVAS
                     GMLSFEAGFELVKVRGSLMGEACNKTKGGMLAVLSPEKELFSLLHDEVKEQHNTIKIA
                     NYNSANQLVISGADESIKEFKNVIENKLKARAIPLKVSGAFHSVLMNEANKDFSHYLD
                     FTKFQAPLAPIVMNVSGEAELNKSNIFSLIKEQMISSVLWKKSMETIESFQPDLVLEI
                     GPGRVLSSLIKSSHRNLNVSNIGNRSDLLRFKKQLEREVEIVV"
     misc_feature    complement(33234..34157)
                     /locus_tag="BMQ_pBM50053"
                     /note="(acyl-carrier-protein) S-malonyltransferase [Lipid
                     metabolism]; Region: FabD; COG0331"
                     /db_xref="CDD:223408"
     gene            complement(34185..34532)
                     /locus_tag="BMQ_pBM50054"
                     /db_xref="GeneID:8997146"
     CDS             complement(34185..34532)
                     /locus_tag="BMQ_pBM50054"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheinyl transferase superfamily"
                     /protein_id="YP_003566073.1"
                     /db_xref="GI:294509145"
                     /db_xref="GeneID:8997146"
                     /translation="MISVGIDLVDIERFKLALSRSGELFVSRILNNYEIAKYDSYQWA
                     ILFSAKECAIKMIKQIPKDFRLRDIQVDILSKDELLVTFDESLYKQVDLPTNSIKGTY
                     KVFKDCIVTHLIA"
     misc_feature    complement(<34320..34532)
                     /locus_tag="BMQ_pBM50054"
                     /note="4'-phosphopantetheinyl transferase superfamily;
                     Region: ACPS; cl00500"
                     /db_xref="CDD:260463"
     gene            complement(34529..34966)
                     /locus_tag="BMQ_pBM50055"
                     /db_xref="GeneID:8997147"
     CDS             complement(34529..34966)
                     /locus_tag="BMQ_pBM50055"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase family protein"
                     /protein_id="YP_003566074.1"
                     /db_xref="GI:294509146"
                     /db_xref="GeneID:8997147"
                     /translation="MKWLETKARVRWSEVDSQSIVYYGNYFLYFDLGREYVAEKVELE
                     YLTEEFDVITLDTTAKYRQPARYGDELIIRTRMIHPSPAEMASPMGFTFQFEYQILKS
                     QGKLLLAEGTSRHALKDKITHKLYVKVPKEKKEKFLSVFEIYK"
     misc_feature    complement(34610..34954)
                     /locus_tag="BMQ_pBM50055"
                     /note="4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes
                     the final step in the 4-chlorobenzoate degradation pathway
                     in which 4-chlorobenzoate is converted to
                     4-hydroxybenzoate in certain soil-dwelling bacteria. 4HBT
                     forms a homotetramer with four active sites; Region: 4HBT;
                     cd00586"
                     /db_xref="CDD:238329"
     misc_feature    complement(order(34691..34699,34724..34726,34805..34807,
                     34811..34813,34874..34876))
                     /locus_tag="BMQ_pBM50055"
                     /note="active site"
                     /db_xref="CDD:238329"
     gene            complement(34993..35730)
                     /locus_tag="BMQ_pBM50056"
                     /db_xref="GeneID:8997148"
     CDS             complement(34993..35730)
                     /locus_tag="BMQ_pBM50056"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, short chain
                     dehydrogenase/reductase family"
                     /protein_id="YP_003566075.1"
                     /db_xref="GI:294509147"
                     /db_xref="GeneID:8997148"
                     /translation="MEVAIVTGAGSGIGRATAIQLSSQDYRVYALDKDEKSIKDFEKT
                     KNITPIVCDVLKENDINSFFSRFSSKEKHLDLLFNGVGAMKLGGLLDTSEDDWDFGFH
                     INLKSALVFSKRAYNYLLESKNPSIINISSVLGETYEEKAAIYTVMKSALVTLTKCLA
                     KELAPKKIRVNAISPGPIQTSFVRSFSQETKKIQGASKLVMKLSHTPIGRTGKPEEVA
                     KLVSYLASPQASFITGSCISIDGGWSI"
     misc_feature    complement(34996..35730)
                     /locus_tag="BMQ_pBM50056"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK05565"
                     /db_xref="CDD:235506"
     misc_feature    complement(35011..35721)
                     /locus_tag="BMQ_pBM50056"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(35188..35193,35197..35208,35284..35286,
                     35296..35298,35335..35343,35422..35424,35485..35493,
                     35569..35577,35629..35637,35692..35703,35707..35709))
                     /locus_tag="BMQ_pBM50056"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(35284..35286,35296..35298,35335..35337,
                     35419..35421))
                     /locus_tag="BMQ_pBM50056"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            36663..36797
                     /locus_tag="BMQ_pBM50057"
                     /db_xref="GeneID:8997149"
     CDS             36663..36797
                     /locus_tag="BMQ_pBM50057"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566076.1"
                     /db_xref="GI:294509148"
                     /db_xref="GeneID:8997149"
                     /translation="MSCVPERDIMLTTNVYLIQHKKRKNPCRWSGVFSVTYQGIKNDT
                     "
     gene            complement(36837..37235)
                     /locus_tag="BMQ_pBM50058"
                     /db_xref="GeneID:8997150"
     CDS             complement(36837..37235)
                     /locus_tag="BMQ_pBM50058"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase, GNAT family"
                     /protein_id="YP_003566077.1"
                     /db_xref="GI:294509149"
                     /db_xref="GeneID:8997150"
                     /translation="MVIEYKVNASISAKEVADIFKSSGIKRPVNELERIERMIKNSDI
                     NLTAWNNQQLIGIARAITDYSYCCYLSDLAIHKDYQNKGIGKELVQRLQDIIGEEVAL
                     ILLASSVAMDYYPHIGFEKSENAFRIPRKK"
     misc_feature    complement(36951..37100)
                     /locus_tag="BMQ_pBM50058"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(<36873..>37019)
                     /locus_tag="BMQ_pBM50058"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     misc_feature    complement(order(36978..36983,37011..37019))
                     /locus_tag="BMQ_pBM50058"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(37417..38643)
                     /locus_tag="BMQ_pBM50059"
                     /db_xref="GeneID:8997151"
     CDS             complement(37417..38643)
                     /locus_tag="BMQ_pBM50059"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter, major facilitator family"
                     /protein_id="YP_003566078.1"
                     /db_xref="GI:294509150"
                     /db_xref="GeneID:8997151"
                     /translation="MIPITKEAKVRTGIWKGKFIYLWVASIFSSLSISMYLTIEQWYV
                     VNYLNLKSSLGIILMATTIPRVLLMVIGGVVSDKYRRSKVIFFSLLTRCFMLLLMALF
                     YTNNLLSLSVLFIFALLFGASDAFFWSARDSIVPGIVHKEQLVRANSVIQTTNQLSVM
                     FGPVLGATLLSLFSYSTIFLIIAFTLLISIILLQFIKEKKTLRPKKTSILRDLAEGIN
                     YVKDSSFLLTVMVTFIIVNLFFIGPLMLSIPILAEDRFKGNAFYLSIFQSSFASGMLL
                     GAIVMGWLNIKRNRGKLAISFIFLEGLLLMIFSQGINLWLAAAILLAIGCCVSSINIL
                     IVSLIQEKTPSTIVGRVMSVNTMVSMGLIPVSYGLVSTLLSINVDIKFILLCAGIVIV
                     LFSVLLLLKASDLKNT"
     misc_feature    complement(37441..38589)
                     /locus_tag="BMQ_pBM50059"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(37525..38589)
                     /locus_tag="BMQ_pBM50059"
                     /note="H+ Antiporter protein; Region: 2A0121; TIGR00900"
                     /db_xref="CDD:162098"
     misc_feature    complement(order(37555..37557,37564..37569,37576..37581,
                     37588..37593,37624..37626,37633..37638,37648..37650,
                     37657..37662,37669..37671,37810..37812,37822..37824,
                     37831..37833,37843..37845,37855..37857,37897..37899,
                     37906..37911,37918..37923,37930..37932,38167..38169,
                     38185..38190,38197..38202,38236..38238,38245..38250,
                     38257..38262,38269..38274,38425..38430,38434..38439,
                     38449..38451,38458..38463,38470..38472,38521..38526,
                     38530..38538,38545..38547))
                     /locus_tag="BMQ_pBM50059"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(38736..39317)
                     /locus_tag="BMQ_pBM50060"
                     /db_xref="GeneID:8997152"
     CDS             complement(38736..39317)
                     /locus_tag="BMQ_pBM50060"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, ArsR family"
                     /protein_id="YP_003566079.1"
                     /db_xref="GI:294509151"
                     /db_xref="GeneID:8997152"
                     /translation="MQLDKLVNYYKAVGDPTRIRIISLLKKGHLHGQAIAYKLGLQPS
                     TITHHISKLRDVGLVYQRRQGNIIYFYLDTERLEYNSKAILNIGEESMENQDSKINDK
                     DKLSIIKSFINSDGTLKQIPSQRKKKNVILAYLIRDLHQGKMYKEKDLNEYIKNYHED
                     YATIRRELIMQHFMYRQNGEYELNPKEMWPVTF"
     misc_feature    complement(39099..39287)
                     /locus_tag="BMQ_pBM50060"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(39108..39116,39129..39137,39153..39158,
                     39162..39167,39174..39179,39183..39194,39219..39227,
                     39264..39272,39282..39287))
                     /locus_tag="BMQ_pBM50060"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(39147..39149,39237..39239,39246..39251,
                     39258..39263,39270..39272,39279..39281,39285..39287))
                     /locus_tag="BMQ_pBM50060"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(39216..39218,39225..39227))
                     /locus_tag="BMQ_pBM50060"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(38754..39023)
                     /locus_tag="BMQ_pBM50060"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2087); Region: DUF2087; cl01589"
                     /db_xref="CDD:261007"
     gene            39500..40165
                     /locus_tag="BMQ_pBM50061"
                     /db_xref="GeneID:8997153"
     CDS             39500..40165
                     /locus_tag="BMQ_pBM50061"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566080.1"
                     /db_xref="GI:294509152"
                     /db_xref="GeneID:8997153"
                     /translation="MLDYIWIDGDLPILSQLPNDFNSAAILFHPFIQMPSGWEKSKRE
                     NPYQHIYPSDEEMLKLGEPISWKEVMVKSNLKSYKELFRVLQYLTGAPSDEYKKLASY
                     VKSNPDFYYPEEDRTSLFILNSLVKILCSKGANTLYFSEPIHDTNGSFKVNDMSSLEI
                     ANLSPNESIITDENMDFAFMGIYDSFITLLLAKDTNIEDTIKSLNLEAFICDKETYFN
                     SFI"
     misc_feature    39533..40153
                     /locus_tag="BMQ_pBM50061"
                     /note="Protein of unknown function (DUF2711); Region:
                     DUF2711; pfam10924"
                     /db_xref="CDD:151371"
     gene            40299..40595
                     /locus_tag="BMQ_pBM50062"
                     /db_xref="GeneID:8997154"
     CDS             40299..40595
                     /locus_tag="BMQ_pBM50062"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566081.1"
                     /db_xref="GI:294509153"
                     /db_xref="GeneID:8997154"
                     /translation="MLGETFTLFRPIYYLITIFLVCNFVYVVFLSNKIKANSYILFNS
                     LFFVIIGAMLLFQQGIIVDETNQSGDPVIFDLTILFGVLFIASFIFRNIKKRKV"
     gene            40799..41128
                     /gene="csaA"
                     /locus_tag="BMQ_pBM50063"
                     /db_xref="GeneID:8997155"
     CDS             40799..41128
                     /gene="csaA"
                     /locus_tag="BMQ_pBM50063"
                     /codon_start=1
                     /transl_table=11
                     /product="export-related chaperone CsaA"
                     /protein_id="YP_003566082.1"
                     /db_xref="GI:294509154"
                     /db_xref="GeneID:8997155"
                     /translation="MATIDDFFKLDIRIGTVVKAEPFPEARKPAIKLEIDFGELGVKC
                     SSAQITRRYKPEQLIGSQVVAVVNFPPMRIAGFKSEVLVMGGIPEEGDVVLLKPSEFV
                     KNGTPIA"
     misc_feature    40802..41122
                     /gene="csaA"
                     /locus_tag="BMQ_pBM50063"
                     /note="tRNA-binding-domain-containing CsaA-like proteins.
                     CsaA is a molecular chaperone with export related
                     activities. CsaA has a putative tRNA binding activity. The
                     functional unit of CsaA is a homodimer and this domain
                     acts as a dimerization domain; Region: tRNA_bind_CsaA;
                     cd02798"
                     /db_xref="CDD:239197"
     misc_feature    order(40805..40816,40820..40828,40838..40840,40952..40957,
                     40979..40981,41000..41005,41048..41059,41075..41077,
                     41081..41089,41093..41098,41102..41104,41117..41122)
                     /gene="csaA"
                     /locus_tag="BMQ_pBM50063"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239197"
     misc_feature    order(40883..40885,40922..40924,41000..41002,41012..41014,
                     41033..41035,41042..41044)
                     /gene="csaA"
                     /locus_tag="BMQ_pBM50063"
                     /note="putative tRNA-binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239197"
     gene            41429..42307
                     /locus_tag="BMQ_pBM50064"
                     /db_xref="GeneID:8997156"
     CDS             41429..42307
                     /locus_tag="BMQ_pBM50064"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein (DUF6)"
                     /protein_id="YP_003566083.1"
                     /db_xref="GI:294509155"
                     /db_xref="GeneID:8997156"
                     /translation="MKNTLLGSIYLALAASIWGGMYVVVKVVVAVIPPLELVWIRYVI
                     AILALFIIGLIKRQSWRINKRHIPLIVAIGVIGNAISIVTQEYGTMLSSAQMGAIITS
                     STPAFMVIFARLILKERLNMKKGISVGLATIGVLLIVGNGHINMSSQLGGLSLLMAAL
                     TWALMSILIKRVPSSYSPVVITTYSILVAILVLTPFVYKGLGEIHISKLIDPTIGGGL
                     LYLGIVSTALAFILWNRGLQLLNASSGGLFFFFQPLVGTLLGWLLLGESIGGTFWIGS
                     FLILSGVLLVIKEKTN"
     misc_feature    41429..42298
                     /locus_tag="BMQ_pBM50064"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    41477..41845
                     /locus_tag="BMQ_pBM50064"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    41906..42289
                     /locus_tag="BMQ_pBM50064"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            42441..42584
                     /locus_tag="BMQ_pBM50065"
                     /db_xref="GeneID:8997157"
     CDS             42441..42584
                     /locus_tag="BMQ_pBM50065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566084.1"
                     /db_xref="GI:294509156"
                     /db_xref="GeneID:8997157"
                     /translation="MTTNRQFYFLWYTNISSPCLLRNCYIKGNQTEKFQTFNIIIFLT
                     TYI"
     gene            42602..42724
                     /locus_tag="BMQ_pBM50066"
                     /db_xref="GeneID:8997158"
     CDS             42602..42724
                     /locus_tag="BMQ_pBM50066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566085.1"
                     /db_xref="GI:294509157"
                     /db_xref="GeneID:8997158"
                     /translation="MSFIQKSKYINKLIKIKVLLFTLPDDKYGLFLHTIQILMY"
     gene            43331..43639
                     /locus_tag="BMQ_pBM50067"
                     /db_xref="GeneID:8997159"
     CDS             43331..43639
                     /locus_tag="BMQ_pBM50067"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566086.1"
                     /db_xref="GI:294509158"
                     /db_xref="GeneID:8997159"
                     /translation="MPNIQVVEKSSHAKIAIDEFLRAGFNTDEIHLLTCNSANTINSY
                     ENELCSTNFVNPDTNILQVDEDVFFSKMQSFGISKRDAERYKESMDKGSIMVIVSKAV
                     "
     misc_feature    43334..43624
                     /locus_tag="BMQ_pBM50067"
                     /note="Heat induced stress protein YflT; Region: YflT;
                     pfam11181"
                     /db_xref="CDD:256338"
     gene            43649..43795
                     /locus_tag="BMQ_pBM50068"
                     /db_xref="GeneID:8997160"
     CDS             43649..43795
                     /locus_tag="BMQ_pBM50068"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566087.1"
                     /db_xref="GI:294509159"
                     /db_xref="GeneID:8997160"
                     /translation="MQNIKTILRIFETKIGIKKVQKRFFLIPSELLTLFNKTLLFICL
                     YKEF"
     gene            complement(43957..45414)
                     /locus_tag="BMQ_pBM50069"
                     /db_xref="GeneID:8997161"
     CDS             complement(43957..45414)
                     /locus_tag="BMQ_pBM50069"
                     /EC_number="3.4.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="intracellular serine protease"
                     /protein_id="YP_003566088.1"
                     /db_xref="GI:294509160"
                     /db_xref="GeneID:8997161"
                     /translation="MKKKILHTVLSITVGVGILSVGGVPTQAKSKNQEMNNTYAIAFK
                     SRLPENYQEVIQKAGGKVTKVLPEVGGIEAQSDQPSFLKNLKGNSSIEAANREIPLSL
                     DKTAVSPYNYESSIISQQNSESYWDSQWDIQRVTNNGKSYDLETGGYKNKDGSITHKA
                     VVGVIDTGIDESHPDLKNNIIGGRNLVPAGMDESETGDPTDIKDRNGHGTHVAGIIGA
                     NGKVKGVGPELGIRSYRVFYSEQALGLPAWIIDGIIAATNDKVDVINMSLRFYNNTKM
                     TIEGESYKSVAETLLWKRAIQYAVKNGVTVVAGSGNESLNLDDKKEVNEFLNKMYEPY
                     GMSVKGPATVVPAQMPGVINVSASTKWSTQQLAFYSNYGNSAIDVAAPGGDYGQKYAE
                     TNDPAAADPSNLILSTWPTYLGTSYELNAGTSMATPQVAGIAGVIKAAHPEYKPAQIT
                     ARIKQTAFDYGKKGQDALFGSGEANAYRALENIKK"
     misc_feature    complement(44077..44940)
                     /locus_tag="BMQ_pBM50069"
                     /note="Peptidase domain in the S8 and S53 families;
                     Region: Peptidases_S8_S53; cl10459"
                     /db_xref="CDD:263972"
     misc_feature    complement(43999..44934)
                     /locus_tag="BMQ_pBM50069"
                     /note="Subtilase family; Region: Peptidase_S8; pfam00082"
                     /db_xref="CDD:249571"
     misc_feature    complement(order(44143..44145,44611..44613,44791..44793))
                     /locus_tag="BMQ_pBM50069"
                     /note="active site"
                     /db_xref="CDD:173787"
     misc_feature    complement(order(44143..44145,44791..44793))
                     /locus_tag="BMQ_pBM50069"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173787"
     gene            45625..45867
                     /locus_tag="BMQ_pBM50070"
                     /db_xref="GeneID:8997162"
     CDS             45625..45867
                     /locus_tag="BMQ_pBM50070"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_003566089.1"
                     /db_xref="GI:294509161"
                     /db_xref="GeneID:8997162"
                     /translation="MLQLNYGRNWCILKNNVKTFRVQADLTQHQLAEKVGVTRQTISL
                     IEKGKYNPTLKLCLEICYVVNRTLDEIFWIDQEENK"
     misc_feature    45658..>45840
                     /locus_tag="BMQ_pBM50070"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    45667..45837
                     /locus_tag="BMQ_pBM50070"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(45676..45678,45688..45690,45763..45765)
                     /locus_tag="BMQ_pBM50070"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(45685..45687,45760..45762)
                     /locus_tag="BMQ_pBM50070"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(45706..45711,45742..45744,45751..45753,45763..45768)
                     /locus_tag="BMQ_pBM50070"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            45864..46295
                     /locus_tag="BMQ_pBM50071"
                     /db_xref="GeneID:8997163"
     CDS             45864..46295
                     /locus_tag="BMQ_pBM50071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566090.1"
                     /db_xref="GI:294509162"
                     /db_xref="GeneID:8997163"
                     /translation="MKVIRDERLVIKNLKNIRIAFAFQTLAMAGILIYDGITRGFNNV
                     TDNPLWLVLILTSVILGYLNLGISVDSYESEKQLRKTPYYLIVIGCLTIGIIFGLLTK
                     ITSNSSVQDSTIIGLVIFLCFLGTFSFWHFLIKKRSKDEDE"
     gene            46481..46804
                     /locus_tag="BMQ_pBM50072"
                     /db_xref="GeneID:8997164"
     CDS             46481..46804
                     /locus_tag="BMQ_pBM50072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566091.1"
                     /db_xref="GI:294509163"
                     /db_xref="GeneID:8997164"
                     /translation="MYIWSNSEGAISLLYSRPVFIFFIVVLAALFIIILMQNKKQLVT
                     GLHVITIIIISLFISGLILFLEGIIVDDLNLSEDTISSYMFLIIVALCVINSVTYSFK
                     NKKLQ"
     gene            47060..47221
                     /locus_tag="BMQ_pBM50073"
                     /db_xref="GeneID:8997165"
     CDS             47060..47221
                     /locus_tag="BMQ_pBM50073"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566092.1"
                     /db_xref="GI:294509164"
                     /db_xref="GeneID:8997165"
                     /translation="MIPAILTVIAAIVLFYIGYVEVRGFEGAAYLFLSVFLILFAIIS
                     FVMAKKPLR"
     gene            47357..47626
                     /locus_tag="BMQ_pBM50074"
                     /db_xref="GeneID:8997166"
     CDS             47357..47626
                     /locus_tag="BMQ_pBM50074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566093.1"
                     /db_xref="GI:294509165"
                     /db_xref="GeneID:8997166"
                     /translation="MQNRFSKYSLWLSIAGIIIAIGQYFTPLYNLNILYIGIVIYLIG
                     FVCGVIAVGKHEKGLMKYFSLYSFVLIPVFIFFGFLFLAFQIGEK"
     gene            complement(47841..49391)
                     /locus_tag="BMQ_pBM50075"
                     /db_xref="GeneID:8997167"
     CDS             complement(47841..49391)
                     /locus_tag="BMQ_pBM50075"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 2 family protein"
                     /protein_id="YP_003566094.1"
                     /db_xref="GI:294509166"
                     /db_xref="GeneID:8997167"
                     /translation="MKHKKRILVASPIHQKPEILTLFLESLKHLKKEEMIVDFYFIDD
                     NENVDSSRLLIQFQECIQSVIVEKSDYQDVYSRDGQTHHWNEHLVWKVAGFKNSIIQY
                     AKEKNYDYLFLVDSDLLLFPETIVHLVQQEKDIISEVFWTRWQPDSMEQPQVWLYDEY
                     TQYHKQPGEDLSTEQIKVRYQEFIAKVRTPGVYEVGGLGACTLISQNALQKGVNFNKI
                     PNLTFWGEDRHFCIRAAAMGLSLYVDTRYPAYHIYRDTNIKEGQEFIKKITARQKTIQ
                     SNIYVPTTKKTKLTLSMVIKNEENRFLKEVLRSYVPYIDDVVIIDDGSTDNSVEVCKE
                     VLKTVPYKIIRNEVSKFSNEVELRKQQWEETVNTEPNWILNMDADEIFEDKFDRDIQQ
                     LLTQRDYDLYSFRLYDFWNDTHYREDDYWQSHFYYRPFLVRYRNDFSYTWQETPQHCG
                     RFPNNIFQLPNSISDLRVKHYGWSKLEYRLEKYKRYLTLDPHAQYGTKEQYESILDEN
                     PNLIKWEE"
     misc_feature    complement(<48633..49379)
                     /locus_tag="BMQ_pBM50075"
                     /note="Predicted glycosyltransferases [General function
                     prediction only]; Region: COG1216"
                     /db_xref="CDD:224137"
     misc_feature    complement(<47907..48530)
                     /locus_tag="BMQ_pBM50075"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    complement(<47925..48530)
                     /locus_tag="BMQ_pBM50075"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    complement(order(48255..48257,48261..48263,48432..48434,
                     48504..48506,48510..48512))
                     /locus_tag="BMQ_pBM50075"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(49381..50481)
                     /locus_tag="BMQ_pBM50076"
                     /db_xref="GeneID:8997168"
     CDS             complement(49381..50481)
                     /locus_tag="BMQ_pBM50076"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 2 family protein"
                     /protein_id="YP_003566095.1"
                     /db_xref="GI:294509167"
                     /db_xref="GeneID:8997168"
                     /translation="MVSISLCMIVKNEEDSIGRCLESIYQLVDEINIIDTGSNDQTKK
                     IASKYTNRIYDFEWVHDFSKARNYAFEKATKDYILWLDADDVFLEEDQQKLLALKLNL
                     ESSVDSVTMKYILATDEYGNVTSSLRRNRLVKRRNGFRWIGAVHEYLEVWGNIMNSEV
                     AVTHKSIHHDSDRNLKIYEKKLLTGEDFSPRDLYYFANELKDHRQFKRAIEFYEKFLS
                     TEKGWIEDNIAACRNLADCYLEIFDKERMIKSLLRSFTYTAPRPEICCRLAHYFIEKN
                     DYQSAVFWYGSATKTGVTSDNLGIQNQAYSTWIPHIQLCVCYDALGDYEKANHHNELA
                     GTYRPNDPKYLHNKGYLETKIPIEKVGVGNET"
     misc_feature    complement(49849..50472)
                     /locus_tag="BMQ_pBM50076"
                     /note="UDP-glucose LOS-beta-1,4 glucosyltransferase is
                     required for biosynthesis of lipooligosaccharide; Region:
                     Beta4Glucosyltransferase; cd02511"
                     /db_xref="CDD:133005"
     misc_feature    complement(order(50230..50232,50236..50238))
                     /locus_tag="BMQ_pBM50076"
                     /note="putative metal binding site; other site"
                     /db_xref="CDD:133005"
     misc_feature    complement(49612..49908)
                     /locus_tag="BMQ_pBM50076"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(49657..49662,49669..49674,49681..49686,
                     49762..49767,49774..49779,49783..49788,49885..49890,
                     49897..49902,49906..49908))
                     /locus_tag="BMQ_pBM50076"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(49618..49620,49627..49629,49639..49641,
                     49675..49677,49720..49722,49729..49731,49741..49743,
                     49777..49779,49834..49836,49843..49845,49855..49857,
                     49891..49893))
                     /locus_tag="BMQ_pBM50076"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            50892..53756
                     /locus_tag="BMQ_pBM50077"
                     /db_xref="GeneID:8997169"
     CDS             50892..53756
                     /locus_tag="BMQ_pBM50077"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566096.1"
                     /db_xref="GI:294509168"
                     /db_xref="GeneID:8997169"
                     /translation="MSIQNLIVNGGFETGTLSSWLIANTVITSEYSHSGFYSARLQGG
                     ATFSYISQFVPIEPGERLEILASLATVGQAPAIFITIQVFYYDNQSNLLENGLLVTVP
                     GNQIPNVENHTWLENYHTTTAAPPGSTQAFIVINTLPQVETSDVLVDDVAVLVVNNNG
                     AIGATGATGATGATGATGITGATGVTGATGITGITGVTGATGATGATGVTGATGATGI
                     TGITGITGITGITGVTGATGITGITGITGVTGATGATGATGVTGATGITGATGVTGVT
                     GVTGITGVTGVTGVTGVTGATGITGVTGETGVTGETGATGVTGITGATGITGVTGITG
                     ATGVTGVTGVTGVTGATGITGVTGETGVTGETGATGVTGITGATGITGVTGITGATGV
                     TGATGVTGITGVTGITGVTGVTGVTGITGVTGATGATGITGATGATGITGVTGITGVT
                     GVTGVTGITGVTGATGATGITGATGATGITGVTGATGITGATGITGATGVTGVTGVTG
                     VTGATGATGITGATGITGATGVTGATGVTGVTGATGATGVTGITGVTGVTGATGVTGV
                     TGVTGVTGATGVTGVTGITGITGVTGVTGITGVTGATGATGVTGATGVTGVTGATGAT
                     GVTGITGVTGATGVTGATGITGATGITGATGATGITGVTGATGVTGATGITGATGVTG
                     ATGATGITGVTGATGATGVTGVTGITGVTGVTGITGVTGVTGVTGITGVTGATGATGV
                     TGVTGITGVTGVTGITGVTGVTGVTGITGVTGATGATGITGATGATGATGITGVTGAT
                     GITGVTGVTGATGATGATGPTASSPTLAFSEAPGTIAIFPPLNTEVTVASVTQNVLIN
                     QQLKIDYALAVEIITTANWSIVFEMRLYRDTTLIDTRIFNRSATQAGTQRFPLASTQV
                     NIAPTTTTSTYSVRIIVTAATSITSATAINRDLNIITFTP"
     misc_feature    52692..52865
                     /locus_tag="BMQ_pBM50077"
                     /note="Collagen triple helix repeat (20 copies); Region:
                     Collagen; pfam01391"
                     /db_xref="CDD:189968"
     misc_feature    52791..52964
                     /locus_tag="BMQ_pBM50077"
                     /note="Collagen triple helix repeat (20 copies); Region:
                     Collagen; pfam01391"
                     /db_xref="CDD:189968"
     gene            53811..53978
                     /locus_tag="BMQ_pBM50078"
                     /db_xref="GeneID:8997170"
     CDS             53811..53978
                     /locus_tag="BMQ_pBM50078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566097.1"
                     /db_xref="GI:294509169"
                     /db_xref="GeneID:8997170"
                     /translation="MYIRDSYHVDVLEKNSEKLVYDQELYSKYYSVIEKLYKIKFQNW
                     IQDQKRTCYCR"
     gene            54305..54919
                     /locus_tag="BMQ_pBM50079"
                     /db_xref="GeneID:8997171"
     CDS             54305..54919
                     /locus_tag="BMQ_pBM50079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566098.1"
                     /db_xref="GI:294509170"
                     /db_xref="GeneID:8997171"
                     /translation="MGDISEGKFSYVDYWEENYSNGGTSGKGSYGVLAQFKGDVINQF
                     IKGKRIHKVIEFGCGDGNQLKYMNYPSYLGMDISPTSIDICSKMFGKDKTKSFLLYNP
                     KYFINNGYFKSDLVVCLDVLYHITNEDDFWKTLDDIFSCKPFYIILYTRVTKPEEFVY
                     GIPTIQDRDILSCLSRYQDYKLIQIIEQKYKELSGASFIILEKV"
     misc_feature    54464..54769
                     /locus_tag="BMQ_pBM50079"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            54955..55602
                     /locus_tag="BMQ_pBM50080"
                     /db_xref="GeneID:8997172"
     CDS             54955..55602
                     /locus_tag="BMQ_pBM50080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566099.1"
                     /db_xref="GI:294509171"
                     /db_xref="GeneID:8997172"
                     /translation="MSIFTSRFILKTDPYSKHFVFNLPKTWETRPHEYEWAKNFAETE
                     DIVLDAACGLSHPLKFYLAGKCKEVYACDIDARILSKSSILKDIRDTYGTIIENSFLN
                     HYFHHIHFCHSSLSKLPYQDKSFDKIFCISVLEHLSKVDIEQTFKEFRRTLKDEGLLI
                     VTFDYPTINLEALKILLDKVKFKFYGDYSLDKPDNLLVSTIWGELNCFRAVLIKN"
     misc_feature    55093..55443
                     /locus_tag="BMQ_pBM50080"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(55102..55122,55171..55176,55291..55299,55345..55347)
                     /locus_tag="BMQ_pBM50080"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            55742..57058
                     /locus_tag="BMQ_pBM50081"
                     /db_xref="GeneID:8997173"
     CDS             55742..57058
                     /locus_tag="BMQ_pBM50081"
                     /codon_start=1
                     /transl_table=11
                     /product="collagen triple helix repeat domain protein"
                     /protein_id="YP_003566100.1"
                     /db_xref="GI:294509172"
                     /db_xref="GeneID:8997173"
                     /translation="MAYKRATKVRYFSSNHDNNYLKKGNCKEKDCIDITGSQIRRLLT
                     ILDSLKDIIPLMLRNPNTGNINTLSNLMNRLITLLNELKPNSSAVTYLITTAQSLLSS
                     LTTTLLPPMRLVSLLQKLINRLILLITLLCLNSETYILLLKNLNQLEAILAQYTSIGI
                     TGATGPTGATGIRGTPGPPGGPGVTGITGVTGPTGATGVTGDPGITGATGSTGATGIT
                     GAAGVTGVTGITGTTGVTGDPGIAGATGITGVTGVTGDPGIAGATGSTGATGITGATG
                     VTGATGITGATGVTGATGITGATGTSLTTNSMFAGNTVGSTILVVLGGTSVPLPSNQN
                     LDSFTVNGTNTTFTVPATGRYYITYQINTTAALLAGSRLILNGTTPIPGSTISPAVAA
                     SSYNNDVIVSLTVGDTITLQLFGLLATVVLTGGGSTGAALTIIRLS"
     misc_feature    56306..56533
                     /locus_tag="BMQ_pBM50081"
                     /note="Collagen triple helix repeat (20 copies); Region:
                     Collagen; pfam01391"
                     /db_xref="CDD:189968"
     misc_feature    56468..56641
                     /locus_tag="BMQ_pBM50081"
                     /note="Collagen triple helix repeat (20 copies); Region:
                     Collagen; pfam01391"
                     /db_xref="CDD:189968"
     gene            57329..57976
                     /locus_tag="BMQ_pBM50082"
                     /db_xref="GeneID:8997174"
     CDS             57329..57976
                     /locus_tag="BMQ_pBM50082"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566101.1"
                     /db_xref="GI:294509173"
                     /db_xref="GeneID:8997174"
                     /translation="MKNIEVSQKYLLLVLNDKGGVAPIGSLRIRAFMVASGILELVLD
                     DIVSLSDNQVTVKQELPSDKEYLRSIYNKISTEKSIHLKKLGRELISKRELFKELFNS
                     VGDSLVELDVVTKTNGGILGQSSHYIGSENSKKQIVEQMRAELLEEGPVTTDTVVLSS
                     LLIGSRTLKNYFSKFEDKDLNDKLTMLRKDTRNKEIFALIDSISHTITTIIASVG"
     misc_feature    57344..57958
                     /locus_tag="BMQ_pBM50082"
                     /note="Golgi phosphoprotein 3 (GPP34); Region: GPP34;
                     pfam05719"
                     /db_xref="CDD:253348"
     gene            57991..58254
                     /locus_tag="BMQ_pBM50083"
                     /db_xref="GeneID:8997175"
     CDS             57991..58254
                     /locus_tag="BMQ_pBM50083"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MerR family"
                     /protein_id="YP_003566102.1"
                     /db_xref="GI:294509174"
                     /db_xref="GeneID:8997175"
                     /translation="MSRRRSLEDILQSEYVSIGELSRLTDSRYSTLKYYTEAGLIPFE
                     QSDENLTRRYPREASVQRIETIKQLKKSGLSISEISDWVVNND"
     misc_feature    58039..58227
                     /locus_tag="BMQ_pBM50083"
                     /note="MerR HTH family regulatory protein; Region: MerR_1;
                     pfam13411"
                     /db_xref="CDD:257736"
     misc_feature    58039..>58227
                     /locus_tag="BMQ_pBM50083"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: SoxR; COG0789"
                     /db_xref="CDD:223860"
     misc_feature    order(58039..58047,58087..58089,58138..58146)
                     /locus_tag="BMQ_pBM50083"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     gene            complement(58498..58680)
                     /locus_tag="BMQ_pBM50084"
                     /db_xref="GeneID:8997176"
     CDS             complement(58498..58680)
                     /locus_tag="BMQ_pBM50084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566103.1"
                     /db_xref="GI:294509175"
                     /db_xref="GeneID:8997176"
                     /translation="MNQRDQKRLAITRELMENAKKRLDLSYELEQDLENLGLQRRMKQ
                     LDLENKLLKEQNNELA"
     gene            complement(59316..59693)
                     /locus_tag="BMQ_pBM50085"
                     /db_xref="GeneID:8997177"
     CDS             complement(59316..59693)
                     /locus_tag="BMQ_pBM50085"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566104.1"
                     /db_xref="GI:294509176"
                     /db_xref="GeneID:8997177"
                     /translation="MSERQNAFTIKTNRLSDEVYNRLATYAKSRKLGEYISSLILRDL
                     DDSSTGRKAIEDKKTYEMLEHIKNELADLKTLAKTTGFVGNDSFKEEEPSKVPQLKEG
                     KIADLENISGSLDDDDLEEYNDF"
     gene            complement(59711..60895)
                     /locus_tag="BMQ_pBM50086"
                     /db_xref="GeneID:8997178"
     CDS             complement(59711..60895)
                     /locus_tag="BMQ_pBM50086"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566105.1"
                     /db_xref="GI:294509177"
                     /db_xref="GeneID:8997178"
                     /translation="MKISRFNKDCGNSVDMNIMDGYLFDFPTNVVELQKEAADSFFTD
                     AVTAPEEFKKRILLSTTIKGEEKERYFLVGDIAASQLLANNHINKLHNKITSHIPYIT
                     FLAAIAYYHALHAKNKKDNTIEIDYFSTMLPIWLLKKESTFGAAQKAMANRFLGDHTF
                     TVHTPGFENTLKVLVEESACLKEGESARFALKKDLTLQDREDANEYVECETVMVDIGG
                     GSIDVVILPEGLKAANSRESFQSIEGIPYLAHIDKLRKEKFLELFTDLRAFDQFILDN
                     YSKQKFVLKNENTGESIDLTSTIKSSLREYVEILLAKLNDVAPPPANKLRKYVYCGGV
                     APTLEVAIMNSMREKIGEERTEKYHKVPQDSRHLNLFGLEIRSIGYVQKKQAAEKKAV
                     KS"
     misc_feature    complement(59846..60871)
                     /locus_tag="BMQ_pBM50086"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:266502"
     misc_feature    complement(order(59900..59902,60242..60253,60347..60349,
                     60851..60853,60860..60871))
                     /locus_tag="BMQ_pBM50086"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            61345..61470
                     /locus_tag="BMQ_pBM50087"
                     /db_xref="GeneID:8997179"
     CDS             61345..61470
                     /locus_tag="BMQ_pBM50087"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566106.1"
                     /db_xref="GI:294509178"
                     /db_xref="GeneID:8997179"
                     /translation="MILILYYMCTTSFTIKTYRILFYFLWLYFYNENALFFIIGI"
     gene            complement(61493..62743)
                     /locus_tag="BMQ_pBM50088"
                     /db_xref="GeneID:8997180"
     CDS             complement(61493..62743)
                     /locus_tag="BMQ_pBM50088"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter, major facilitator family"
                     /protein_id="YP_003566107.1"
                     /db_xref="GI:294509179"
                     /db_xref="GeneID:8997180"
                     /translation="MEEKLPVNHSTNLFGNRVFQAIIISGLFLQIGIWVRNFAVLLFI
                     MEKTNGDPFAVSLISVAEFAPIFIFSFIGGTFADRWRPKRTMVWCDILSAISVFAVLV
                     TLILGSWHIVFFATLISAILSQFSQPSGMKLFKMHLPEEQMQVGMSVYQTVFAIFMVL
                     GPILGTFAFQAFGISLSIAITGTAFLLSAAALTFLPSDRKMEEENGTTSLLSEMKSGI
                     KYVLGKKELSLLGLCFLAAGLGIGFIQPLSIFLVTEQLGLAKENLQWLLTANGIGMIL
                     GGAVVMIFAKTVAPQRLLAFGMVGNAIGFAIMGLSVNLWLTLGAQFLNGLMLPCIQIG
                     INTMILQRTEAAFIGRVNGILSPLFTGAMVLTMSVAGILKEQFSLVAIFEAAAVLFII
                     GLLFILPLYNLKEETKQEGIELGE"
     misc_feature    complement(61610..62689)
                     /locus_tag="BMQ_pBM50088"
                     /note="H+ Antiporter protein; Region: 2A0121; TIGR00900"
                     /db_xref="CDD:162098"
     misc_feature    complement(61541..62629)
                     /locus_tag="BMQ_pBM50088"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(61655..61657,61664..61669,61676..61681,
                     61688..61693,61724..61726,61733..61738,61748..61750,
                     61757..61762,61769..61771,61910..61912,61922..61924,
                     61931..61933,61943..61945,61955..61957,61997..61999,
                     62006..62011,62018..62023,62030..62032,62270..62272,
                     62288..62293,62300..62305,62339..62341,62348..62353,
                     62360..62365,62372..62377,62522..62527,62531..62536,
                     62546..62548,62555..62560,62567..62569,62618..62623,
                     62627..62629))
                     /locus_tag="BMQ_pBM50088"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(63134..63403)
                     /locus_tag="BMQ_pBM50089"
                     /db_xref="GeneID:8997181"
     CDS             complement(63134..63403)
                     /locus_tag="BMQ_pBM50089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566108.1"
                     /db_xref="GI:294509180"
                     /db_xref="GeneID:8997181"
                     /translation="MKGQQWSTRFNDVKETIQSIIYTWNPLSLHASEEYEYEATWILP
                     MVYKVENVESLAIEITDILNQSFNSTLIKEECIGIAQQIWEQIRE"
     misc_feature    complement(63155..63346)
                     /locus_tag="BMQ_pBM50089"
                     /note="Domain of unknown function (DUF1871); Region:
                     DUF1871; pfam08958"
                     /db_xref="CDD:149887"
     gene            complement(63542..64204)
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /db_xref="GeneID:8997182"
     CDS             complement(63542..64204)
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-H factor"
                     /protein_id="YP_003566109.1"
                     /db_xref="GI:294509181"
                     /db_xref="GeneID:8997182"
                     /translation="MNMIAGVEIREKKMTLNDEEIVQAFQKGDEDVFNVLVKKYEYLV
                     WSKVKRYFLLGGDREDLLQEARLGLYKAVRDFKTEGMSSFRGFADLCITRQLITAIKA
                     SARQKHSPLNNALSLNIPKNSKRLEDDLILMEMLPHPRAVSPEQATVEKENKREREQM
                     LQEILSPIEQDVFTLYLKGQTYMQISQNLNLPQKSVDNALYRIKKKMKHQMQYLYLQQ
                     SS"
     misc_feature    complement(63584..64162)
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /note="RNA polymerase factor sigma-70; Validated; Region:
                     PRK08295"
                     /db_xref="CDD:181361"
     misc_feature    complement(63887..64099)
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(63584..63733)
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /note="Sigma-70, region 4; Region: Sigma70_r4_2;
                     pfam08281"
                     /db_xref="CDD:203898"
     misc_feature    complement(order(63593..63595,63599..63604,63608..63616,
                     63620..63625,63629..63631,63659..63664,63707..63709))
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            64272..64526
                     /locus_tag="BMQ_pBM50091"
                     /db_xref="GeneID:8997183"
     CDS             64272..64526
                     /locus_tag="BMQ_pBM50091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566110.1"
                     /db_xref="GI:294509182"
                     /db_xref="GeneID:8997183"
                     /translation="MSKKQRVERIFREEEVSHYIKPYIMYMTCIIWTIFNLVYDFKKA
                     NRRFLACFTRCYWINDSDTAIVKISKFVLVLIDIGQILIR"
     gene            64532..64720
                     /locus_tag="BMQ_pBM50092"
                     /db_xref="GeneID:8997184"
     CDS             64532..64720
                     /locus_tag="BMQ_pBM50092"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566111.1"
                     /db_xref="GI:294509183"
                     /db_xref="GeneID:8997184"
                     /translation="MLLLSSFYLPSMKKEDSFAFKLLLFFTFHFLCCIPFSVECAPMF
                     RAKNFVSSFYNFSFLLLS"
     gene            complement(65363..65548)
                     /locus_tag="BMQ_pBM50093"
                     /db_xref="GeneID:8997185"
     CDS             complement(65363..65548)
                     /locus_tag="BMQ_pBM50093"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566112.1"
                     /db_xref="GI:294509184"
                     /db_xref="GeneID:8997185"
                     /translation="MINVPSRVTSFKVFFEKNKTEVSDLFLFSSHVHNQKSHLFLLTI
                     QVIYACFFIIYESIFIL"
     gene            66551..66673
                     /locus_tag="BMQ_pBM50094"
                     /db_xref="GeneID:8997186"
     CDS             66551..66673
                     /locus_tag="BMQ_pBM50094"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566113.1"
                     /db_xref="GI:294509185"
                     /db_xref="GeneID:8997186"
                     /translation="MRRGKKIPLPYSKKLIYDKGDSYSNIGSLVAKYTCFDIFC"
CONTIG      join(CP001988.1:1..66985)
//
DBGET integrated database retrieval system