GenomeNet

Database: RefSeq
Entry: NC_014025
LinkDB: NC_014025
Original site: NC_014025 
LOCUS       NC_014025              66985 bp    DNA     circular CON 08-JUN-2013
DEFINITION  Bacillus megaterium QM B1551 plasmid pBM500, complete sequence.
ACCESSION   NC_014025
VERSION     NC_014025.1  GI:294509091
DBLINK      Project: 15862
            BioProject: PRJNA15862
KEYWORDS    RefSeq.
SOURCE      Bacillus megaterium QM B1551
  ORGANISM  Bacillus megaterium QM B1551
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
REFERENCE   1  (bases 1 to 66985)
  AUTHORS   Eppinger,M., Bunk,B., Johns,M.A., Edirisinghe,J.N., Kutumbaka,K.K.,
            Koenig,S.S., Creasy,H.H., Rosovitz,M.J., Riley,D.R., Daugherty,S.,
            Martin,M., Elbourne,L.D., Paulsen,I., Biedendieck,R., Braun,C.,
            Grayburn,S., Dhingra,S., Lukyanchuk,V., Ball,B., Ul-Qamar,R.,
            Seibel,J., Bremer,E., Jahn,D., Ravel,J. and Vary,P.S.
  TITLE     Genome sequences of the biotechnologically important Bacillus
            megaterium strains QM B1551 and DSM319
  JOURNAL   J. Bacteriol. 193 (16), 4199-4213 (2011)
   PUBMED   21705586
REFERENCE   2  (bases 1 to 66985)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (08-APR-2010) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 66985)
  AUTHORS   Eppinger,M., Bunk,B., Johns,M.A., Edirisinghe,J.N., Kutumbaka,K.K.,
            Riley,D.R., Huot-Creasy,H., Koenig,S.S.K., Galens,K., Orvis,J.,
            Creasy,T., Biedendieck,R., Braun,C., Grayburn,S., Jahn,D.,
            Vary,P.S. and Ravel,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2010) Institute for Genome Sciences, University
            of Maryland School of Medicine, 801 West Baltimore St, Baltimore,
            MD 21201, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP001988.
            Bacteria available from the Bacillus Genetic Stock Center,
            (http://www.bgsc.org/), The Ohio State University, 776 Biological
            Sciences Building, 484 West 12th Avenue, Columbus. Ohio 43210 under
            inventory No. 7A116 or from Patricia S. Vary (pvary@niu.edu), Dept.
            of Biological Sciences, Northern Illinois University, DeKalb, IL
            60115.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..66985
                     /organism="Bacillus megaterium QM B1551"
                     /mol_type="genomic DNA"
                     /strain="QM B1551"
                     /db_xref="taxon:545693"
                     /plasmid="pBM500"
     gene            177..1298
                     /locus_tag="BMQ_pBM50001"
                     /db_xref="GeneID:8997187"
     CDS             177..1298
                     /locus_tag="BMQ_pBM50001"
                     /codon_start=1
                     /transl_table=11
                     /product="putative replication protein"
                     /protein_id="YP_003566020.1"
                     /db_xref="GI:294509092"
                     /db_xref="GeneID:8997187"
                     /translation="MEMLDYVIYNLVATGIQAIHSKTLMQKFDVSQSTVSRFVKSLKE
                     TPFMIVARYIKEDTTGAHPDSYVFILKSHTNFNQICEEIFFAHDTTGVQTLQQEEMTT
                     PVTTPVTTPVTSPERAENVDTPSFEGEKTSSPFINLDLPKNHLTNHLISASQSFAYIK
                     GVPKKVNNVYAGKYGHQLKDFYARIQNAAKAVKRDTEIEIVKEQVHEVAYTAIVGLDK
                     YVHEANHKGTPLSLDEMCRLVYQIAYNQFTNLLTGNTEEQPSESDIHTEAETAALFTP
                     KHIIRKEIVPAWLKVEKEQKECTQEPALSLDEQLEMIQLKQDLGQELTPEEETLLQEH
                     SSTYSSLEMAQLKQDLGQALTPEEQALLHQQDQLKGSVS"
     gene            1406..2173
                     /locus_tag="BMQ_pBM50002"
                     /db_xref="GeneID:8997094"
     CDS             1406..2173
                     /locus_tag="BMQ_pBM50002"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stability protein"
                     /protein_id="YP_003566021.1"
                     /db_xref="GI:294509093"
                     /db_xref="GeneID:8997094"
                     /translation="MPHKMTLTGSATGPLREYDRYVAFDMREKGSPSAPKGLKKSTFI
                     SYTVFVAKKAFNKTGLTKKSIMHEKILIQGEPTLDIPIDECPGEIGIICFQITVLPNK
                     NDKEANESKDKKEAKLEVSKAQQEVAATRQEEKQNPVSQPVATEAKTIQPEAKEMPVQ
                     EKKAAPQKKQLPTQPKGTQDVVNFDEIIVPEAFLKTRPNPVKTEEVIEFVKRTGHLDK
                     PLTIDKGSKILKDGYRRYIVAKTVKMDKVPVVYEYQK"
     gene            2253..3065
                     /locus_tag="BMQ_pBM50003"
                     /db_xref="GeneID:8997095"
     CDS             2253..3065
                     /locus_tag="BMQ_pBM50003"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566022.1"
                     /db_xref="GI:294509094"
                     /db_xref="GeneID:8997095"
                     /translation="MSYPYDLDYLLPDDQRYNIYVATLIPKLSIDEDSVQFFENYIRF
                     DVMVGTGEHTSREILDISIFSDDKPEFDHRKFEFDYEKPRKAMVFTGWKKGPIELSLL
                     HVYREDSKYYLDTEIVYIGQAFGENGERLPAEELMSDPMLQKVEEALLREYPEKDLAL
                     LLLEFNSQLLEEIDSEDEDLIQLQEITKNPSLELNNQILNATEAALINYFKPEYNKKL
                     NNDFSNVEDHGLHYHSVTVQVHPDIMGLKLFSKEKTYLSNDPIVSSPLHSNS"
     gene            3386..3955
                     /locus_tag="BMQ_pBM50004"
                     /db_xref="GeneID:8997096"
     CDS             3386..3955
                     /locus_tag="BMQ_pBM50004"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566023.1"
                     /db_xref="GI:294509095"
                     /db_xref="GeneID:8997096"
                     /translation="MSEQLGYFAKQVCGKLKLNPNTLRKWAIELEENGYKFERNNKGP
                     NGQRIYYERDINIIAEFKVLLERTHSVENTAKLLMKRVEEDSNAEITHGVREEKERSN
                     PITVTFTREELEQYTRGIIEETSAKVAAEVSAQTAEAVYKKMENLIEQRDHKLINQMN
                     ESMEQRRLEIAAAREEPASSFWSRLFNRK"
     gene            4029..4202
                     /locus_tag="BMQ_pBM50005"
                     /db_xref="GeneID:8997097"
     CDS             4029..4202
                     /locus_tag="BMQ_pBM50005"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566024.1"
                     /db_xref="GI:294509096"
                     /db_xref="GeneID:8997097"
                     /translation="MTRGEKGSNTGITHSVREEKERSNPVTVMFTREELEQYTFGLSK
                     KFQCKRQKQRIKK"
     gene            4486..4605
                     /locus_tag="BMQ_pBM50006"
                     /db_xref="GeneID:8997098"
     CDS             4486..4605
                     /locus_tag="BMQ_pBM50006"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566025.1"
                     /db_xref="GI:294509097"
                     /db_xref="GeneID:8997098"
                     /translation="MLQSCSENENKKEDTIHNISSHEVKKDLLSILEIRLFSI"
     gene            4861..5088
                     /locus_tag="BMQ_pBM50007"
                     /db_xref="GeneID:8997099"
     CDS             4861..5088
                     /locus_tag="BMQ_pBM50007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566026.1"
                     /db_xref="GI:294509098"
                     /db_xref="GeneID:8997099"
                     /translation="MFWWKNPKRSKFGKWLDKNGIQQTDFAMKSNVSRRTIWTICNDK
                     NYIPSATIVKKVMDAVKMVDSSKQPKDFFDI"
     gene            complement(5572..6804)
                     /locus_tag="BMQ_pBM50008"
                     /db_xref="GeneID:8997100"
     CDS             complement(5572..6804)
                     /locus_tag="BMQ_pBM50008"
                     /EC_number="1.14.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="YP_003566027.1"
                     /db_xref="GI:294509099"
                     /db_xref="GeneID:8997100"
                     /translation="MKKVTVDDFSSPENMHDVIGFYKKLTEHQEPLIRLDDYYGLGPA
                     WVALRHDDVVTILKNPRFLKDVRKFTPLQDKKDSIDDSTSASKLFEWMMNMPNMLTVD
                     PPDHTRLRRLASKAFTPRMIENLRPRIQQITNELLDSVEGKRNMDLVADFSFPLPIIV
                     ISEMLGIPPLDQKRFRDWTDKLIKAAMDPSQGAVVMETLKEFIDYIKKMLVEKRNHPD
                     DDVMSALLQAHEQEDKLSENELLSTIWLLITAGHETTAHLISNGVLALLKHPEQMRLL
                     RDNPSLLPSAVEELLRYAGPVMIGGRFAGEDIIMHGKMIPKGEMVLFSLVAANIDSQK
                     FSYPEGLDITREENEHLTFGKGIHHCLGAPLARMEAHIAFGTLLQRFPDLRLAIESEQ
                     LVYNNSTLRSLKSLPVIF"
     gene            complement(6957..7652)
                     /locus_tag="BMQ_pBM50009"
                     /db_xref="GeneID:8997101"
     CDS             complement(6957..7652)
                     /locus_tag="BMQ_pBM50009"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566028.1"
                     /db_xref="GI:294509100"
                     /db_xref="GeneID:8997101"
                     /translation="MSFRLSQRDKDIIAFINQFRAVDRDSLVDLFFKQLKSPVNACNS
                     VMVRLYRLGVIERTQQYSPTVYLPVDAKIKKNSQKILHFLSVLDVYKQMCAYSVPKHV
                     IVEDKPTGRKGGIEPDLFCIFKGSPFWIEIQRNQYSEQKMQAKINLYEEFFFSDEWKA
                     LQWQSEDRAALFPSVMVITPVRYAVASNHIRIIQVASIHELMEKYKSSSKQQKEARSK
                     TDPSSGGIKINLT"
     gene            complement(7649..8446)
                     /locus_tag="BMQ_pBM50010"
                     /db_xref="GeneID:8997102"
     CDS             complement(7649..8446)
                     /locus_tag="BMQ_pBM50010"
                     /codon_start=1
                     /transl_table=11
                     /product="FtsK/SpoIIIE family"
                     /protein_id="YP_003566029.1"
                     /db_xref="GI:294509101"
                     /db_xref="GeneID:8997102"
                     /translation="MELPVCIGQDIYGNLVSWDFADLETLLISGEIGAGKSSLMRVIL
                     TTWVKYTSPDDLRLVLVDLKRADLGLFHGIEHVDALCFEAKDMRKPFSLLRAEMYRRG
                     DLLLEHGVTHISRLPFKLPRIVVVVDEMSIIKRETELVEIIQQFASQGRALGVHTIIA
                     MQRPDSDLLNSALKANLRVRISGRQADATNAKVAGVIGAEEIDAAARGRMKIKIDEVK
                     EFQAFFLDEGDCKEILSPYKALVHDPEPDIEVASQSIFGLLEKEEQR"
     gene            complement(9786..10028)
                     /locus_tag="BMQ_pBM50011"
                     /db_xref="GeneID:8997103"
     CDS             complement(9786..10028)
                     /locus_tag="BMQ_pBM50011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566030.1"
                     /db_xref="GI:294509102"
                     /db_xref="GeneID:8997103"
                     /translation="MNKKKSNYIIFSLWFLVLFFLWIIISLSAGTNGQWWSMYRFNPE
                     KYGPWALEFSYIKIIMAAVISLLIAYVVAFVLTRKK"
     gene            complement(10191..10883)
                     /locus_tag="BMQ_pBM50012"
                     /db_xref="GeneID:8997104"
     CDS             complement(10191..10883)
                     /locus_tag="BMQ_pBM50012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566031.1"
                     /db_xref="GI:294509103"
                     /db_xref="GeneID:8997104"
                     /translation="MATNYKYSKELWLNGRPQLHVIKTKISNICTETICKPLTDTSYY
                     GINGGFFDSRDYHKTPNASRAICVDTGESGKKITVGGKTFYKNYNYNNTSSNPISRKT
                     AVIYTVSGTKKMTSMYAKTRDNVAAKYPKYNQIIGGMDYSSKAWGTKAYSAPTQRTVL
                     AWSGSYAYLIVTEVAMSIPGLKKAVEQLGLNSANSIVLDGSGSTSMKCKEFVKKGDKR
                     HIFNMVRLFKTS"
     gene            complement(11014..11205)
                     /locus_tag="BMQ_pBM50013"
                     /db_xref="GeneID:8997105"
     CDS             complement(11014..11205)
                     /locus_tag="BMQ_pBM50013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566032.1"
                     /db_xref="GI:294509104"
                     /db_xref="GeneID:8997105"
                     /translation="MLYTNEEIEEVLICLEYKLRKSLRETHPKYREDLAQNLRESIVR
                     KMKSDTLHKSPSFFTLINQ"
     gene            complement(11224..11394)
                     /locus_tag="BMQ_pBM50014"
                     /db_xref="GeneID:8997106"
     CDS             complement(11224..11394)
                     /locus_tag="BMQ_pBM50014"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566033.1"
                     /db_xref="GI:294509105"
                     /db_xref="GeneID:8997106"
                     /translation="MIDSTNIIQLIGNFGFPMALAIYLLLRFENRLESLKSAIDKLAE
                     TMREFPNINKDN"
     gene            complement(11387..11923)
                     /locus_tag="BMQ_pBM50015"
                     /db_xref="GeneID:8997107"
     CDS             complement(11387..11923)
                     /locus_tag="BMQ_pBM50015"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RNA polymerase sigma-70, region 4"
                     /protein_id="YP_003566034.1"
                     /db_xref="GI:294509106"
                     /db_xref="GeneID:8997107"
                     /translation="MLKIKNPLIQGFLKEEENYSLFKKYQLEPTQKNEQKLDNKFKKY
                     YLKIRAISYFSKVIHFESKKFDNKHRTYNKRFLSILDKPVPESDNGTLIDLLIDSSTN
                     YCTEEVPSKKLEDYIENPSLYLSIKKLSSKQKKILYLAYIKDLKDVEIARYLNVSQQY
                     ITRTRNKTLLKLRGDLSD"
     gene            12363..12479
                     /locus_tag="BMQ_pBM50016"
                     /db_xref="GeneID:8997108"
     CDS             12363..12479
                     /locus_tag="BMQ_pBM50016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566035.1"
                     /db_xref="GI:294509107"
                     /db_xref="GeneID:8997108"
                     /translation="MRLSLPAQLQFLFVFIDYRLPKTFVKVFELQETFVIYF"
     gene            complement(12773..13345)
                     /locus_tag="BMQ_pBM50017"
                     /db_xref="GeneID:8997109"
     CDS             complement(12773..13345)
                     /locus_tag="BMQ_pBM50017"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR family"
                     /protein_id="YP_003566036.1"
                     /db_xref="GI:294509108"
                     /db_xref="GeneID:8997109"
                     /translation="MSKQIDPRVLRTRKLIMDALIELSMKKEFKDITIKDITTVATVN
                     RATFYYHFMDKYDLLEKVLSESIMREVLQEVSTHEVINEETIEAIFLSIIKFQTSLSN
                     QCQQNYEAFMPQIETIFKKELQAFFSEWGKKQWNNPNKMEVEAGAVMLSWTLYGAAVH
                     WMQNQTTEPEDYLMSLMSFIKNWNEHINLI"
     gene            13380..14138
                     /locus_tag="BMQ_pBM50018"
                     /db_xref="GeneID:8997110"
     CDS             13380..14138
                     /locus_tag="BMQ_pBM50018"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD dependent epimerase/dehydratase family"
                     /protein_id="YP_003566037.1"
                     /db_xref="GI:294509109"
                     /db_xref="GeneID:8997110"
                     /translation="MCWIYYICVILLVEQRFLPWYINFTTSVGYTKGVETKNMKITIF
                     GATGQIGQLLVTQALQAGYDVTAYSRRPNALNIKHEKLQIIVGDLTDQGKLREAILER
                     DVVVSALGPTMSMKRQVLDLPITQGHKAIISVMEEYGPKRFITLATPTISAKEDVKQL
                     VTQLPSIMAKLLYPTGYAEMKEIEKLIENSRLDWTVVRMLNPNMKTNGNGYSVSFGDT
                     KGKMNVSRYNVAKCMLEATQKDEWVHKMPIVFNN"
     gene            14358..14981
                     /locus_tag="BMQ_pBM50019"
                     /db_xref="GeneID:8997111"
     CDS             14358..14981
                     /locus_tag="BMQ_pBM50019"
                     /EC_number="1.13.11.39"
                     /codon_start=1
                     /transl_table=11
                     /product="biphenyl-2,3-diol 1,2-dioxygenase III"
                     /protein_id="YP_003566038.1"
                     /db_xref="GI:294509110"
                     /db_xref="GeneID:8997111"
                     /translation="MSNQENKKITPILHHIGLTTGRFEEMISWYNNVLGMEPVHYSEN
                     PAGDIGMKVKALWVTNDEANHRIAMIGIPGLTSDMNRSKHSRIQHIAFEYDTLDDLLD
                     TYIRLKNLGITPHVTADQGVSIAFYYNDPDGNTVELTMDTFGDWSKSKEFMKKSPTFA
                     KKPMGKYIDVEKILLAREQGLSANEIHERAYAGEYEPNTPMDPQKML"
     gene            complement(15064..15183)
                     /locus_tag="BMQ_pBM50020"
                     /db_xref="GeneID:8997112"
     CDS             complement(15064..15183)
                     /locus_tag="BMQ_pBM50020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566039.1"
                     /db_xref="GI:294509111"
                     /db_xref="GeneID:8997112"
                     /translation="MHYFKCIAYLLEVCAFLLSGTCNMNTALKEINYKIASLF"
     gene            complement(15288..16280)
                     /locus_tag="BMQ_pBM50021"
                     /db_xref="GeneID:8997113"
     CDS             complement(15288..16280)
                     /locus_tag="BMQ_pBM50021"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase GFO/IDH/MOCA family"
                     /protein_id="YP_003566040.1"
                     /db_xref="GI:294509112"
                     /db_xref="GeneID:8997113"
                     /translation="MKKANLCFIGAGFHASTNIYPSAIEAGAAIQAVSTRNIERSKAT
                     LQRFGSKGTPYDDYKKMLQYEECDGVVVVAQPEDQPSLVMDCIRAGKNVFVDKPLGMS
                     ADEAAEIADAADEAGVTVMVGFMKRYAPCYTKLKEIIENGSLGNARSFQAKFAVDSTP
                     FCKDDEQFIKFAAIHIVDLIRYLFGEVLYVSGFKNSDNGFISHSITLKFKNGVVGSLY
                     FTGMTAWSRESENILVTFDNGFAFADEVNSLTIHKSQTFSDLPWKSLEEADTVFTPSA
                     SPMSGTYRDLYLRGFVGEMTHFIDCCKNKRKPTSNGRDNVHTMSLCDRILSELI"
     gene            complement(16520..16651)
                     /locus_tag="BMQ_pBM50022"
                     /db_xref="GeneID:8997114"
     CDS             complement(16520..16651)
                     /locus_tag="BMQ_pBM50022"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566041.1"
                     /db_xref="GI:294509113"
                     /db_xref="GeneID:8997114"
                     /translation="MTEIFIFYYLRKKHSPFNQMNANENHFPIALEKFTHDYKEQFL"
     gene            16714..17244
                     /locus_tag="BMQ_pBM50023"
                     /db_xref="GeneID:8997115"
     CDS             16714..17244
                     /locus_tag="BMQ_pBM50023"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor, sigma-70 family"
                     /protein_id="YP_003566042.1"
                     /db_xref="GI:294509114"
                     /db_xref="GeneID:8997115"
                     /translation="MSTIKKEERPVSDVTFEDLFKQYYVYVVKQIVWIVKNQMIAEEL
                     AQEVFLQLYRNDWKSIENVPGWLLKSSTYVAYNYLRSEKRHQARINKTIQYHEAQHIS
                     SLDDDWIRKEEITKVQNVLSNMNERERTILLLKFSSFQYKEIAEVLQINISSIGTLLV
                     RAKQKFRKIYKQLEEA"
     gene            17248..18225
                     /locus_tag="BMQ_pBM50024"
                     /db_xref="GeneID:8997116"
     CDS             17248..18225
                     /locus_tag="BMQ_pBM50024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566043.1"
                     /db_xref="GI:294509115"
                     /db_xref="GeneID:8997116"
                     /translation="MNCYDKGFIQAYIDGELSHDTRKEFTKHLDTCEICQDVLIEISK
                     LNRWEDVVLEEETRHLSQEINIDVDQAWKTFESRTKLENVSYINQKTEQKRGLFTNMN
                     KKSKRFMYTAVAAAGLFTTAMIPQVQVAATNVASYFSNEISNDKVVNEGIHDENGVTQ
                     DMMKDGQFIPIDKKITDQGVTVHFKELYVADSRISIHYKIEKADGSLVPFEFDTTGLD
                     LKNDGKTNEQQEENPEYQEKDGSFSQLPFIQGASGLPFKLMAAGEELEYVGIRDKDRP
                     EGIITFVEGPEGKDSFKQPLTLNVDINKIGKVAGSWKGQIQIDPAKLKK"
     gene            complement(18233..18394)
                     /locus_tag="BMQ_pBM50025"
                     /db_xref="GeneID:8997117"
     CDS             complement(18233..18394)
                     /locus_tag="BMQ_pBM50025"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566044.1"
                     /db_xref="GI:294509116"
                     /db_xref="GeneID:8997117"
                     /translation="MSGPKNKESLPCPYWDVFMVIRLKKIKYDINVTNIRKNISMVLD
                     THRSILFFI"
     gene            18531..18659
                     /locus_tag="BMQ_pBM50026"
                     /db_xref="GeneID:8997118"
     CDS             18531..18659
                     /locus_tag="BMQ_pBM50026"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566045.1"
                     /db_xref="GI:294509117"
                     /db_xref="GeneID:8997118"
                     /translation="MNAFFSYIIKKVFCHKTWISGFSIIRESNKSEVLTGMLTKKD"
     gene            18794..19243
                     /locus_tag="BMQ_pBM50027"
                     /db_xref="GeneID:8997119"
     CDS             18794..19243
                     /locus_tag="BMQ_pBM50027"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_003566046.1"
                     /db_xref="GI:294509118"
                     /db_xref="GeneID:8997119"
                     /translation="MNRGEKIAKARREMNLTQDQLAEMLEVTRQTISKWESNLAYPES
                     VKLGKLAEVLNVTCDYLLRENQATSTSTSIEVTMNNSGNYTLDWSKLYPILNEYQNMI
                     DCPHYFEKIYGMVKEIMVKYKYSSEDTFLILKDLLYQIYLQMEKKVQ"
     gene            19366..19503
                     /locus_tag="BMQ_pBM50028"
                     /db_xref="GeneID:8997120"
     CDS             19366..19503
                     /locus_tag="BMQ_pBM50028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566047.1"
                     /db_xref="GI:294509119"
                     /db_xref="GeneID:8997120"
                     /translation="MVKNKNRALVYQCSVFILVPRLLIMLTTFVYRIQLKNRKNYLRI
                     R"
     gene            19549..19689
                     /locus_tag="BMQ_pBM50029"
                     /db_xref="GeneID:8997121"
     CDS             19549..19689
                     /locus_tag="BMQ_pBM50029"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566048.1"
                     /db_xref="GI:294509120"
                     /db_xref="GeneID:8997121"
                     /translation="MGSLLKEVKNMYIHKNEVYFKFYLNVCFETYKKGKSILILFQIN
                     LK"
     gene            19743..19889
                     /locus_tag="BMQ_pBM50030"
                     /db_xref="GeneID:8997122"
     CDS             19743..19889
                     /locus_tag="BMQ_pBM50030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566049.1"
                     /db_xref="GI:294509121"
                     /db_xref="GeneID:8997122"
                     /translation="MSINKEVFYRGKRFKIIHIYSSGYCELRKVNDPFKVELALLNDI
                     LLTG"
     gene            complement(20095..20304)
                     /gene="gsiB"
                     /locus_tag="BMQ_pBM50031"
                     /db_xref="GeneID:8997123"
     CDS             complement(20095..20304)
                     /gene="gsiB"
                     /locus_tag="BMQ_pBM50031"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose starvation-inducible protein B"
                     /protein_id="YP_003566050.1"
                     /db_xref="GI:294509122"
                     /db_xref="GeneID:8997123"
                     /translation="MTTNKNNDKMSREEAGRMGGKATSKNHDKEFYQEIGEKGGEATS
                     KNHDKEFYQEIGEKGGKANNKRNND"
     gene            complement(20385..20498)
                     /locus_tag="BMQ_pBM50032"
                     /db_xref="GeneID:8997124"
     CDS             complement(20385..20498)
                     /locus_tag="BMQ_pBM50032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566051.1"
                     /db_xref="GI:294509123"
                     /db_xref="GeneID:8997124"
                     /translation="MYFIDTLILKKSISTNISKIFQKEELQNKKRKMILNY"
     gene            20728..20886
                     /locus_tag="BMQ_pBM50033"
                     /db_xref="GeneID:8997125"
     CDS             20728..20886
                     /locus_tag="BMQ_pBM50033"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566052.1"
                     /db_xref="GI:294509124"
                     /db_xref="GeneID:8997125"
                     /translation="MDNKHNLLLCPGEVNCLREGYKNCEKELIKSEIHKDIILLSDEI
                     KVDYKVNR"
     gene            21038..21211
                     /locus_tag="BMQ_pBM50034"
                     /db_xref="GeneID:8997126"
     CDS             21038..21211
                     /locus_tag="BMQ_pBM50034"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566053.1"
                     /db_xref="GI:294509125"
                     /db_xref="GeneID:8997126"
                     /translation="MGEQTYSDIQRKKTSIIDSLIHLGIYKKGNKQLYELTLHELETE
                     YHIVNPEIQDISF"
     gene            21256..21438
                     /locus_tag="BMQ_pBM50035"
                     /db_xref="GeneID:8997127"
     CDS             21256..21438
                     /locus_tag="BMQ_pBM50035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566054.1"
                     /db_xref="GI:294509126"
                     /db_xref="GeneID:8997127"
                     /translation="MFLKKLIKNGLITVKYYENGSLQTYKGRVYNLNLHEQTLSLKDE
                     KQNIFFIRLSGIEDIY"
     gene            21574..21711
                     /locus_tag="BMQ_pBM50036"
                     /db_xref="GeneID:8997128"
     CDS             21574..21711
                     /locus_tag="BMQ_pBM50036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566055.1"
                     /db_xref="GI:294509127"
                     /db_xref="GeneID:8997128"
                     /translation="MRENKQIWSDFIEEDRFELHSYLTYLFKQCHDENLRQLEDENIE
                     E"
     gene            21927..22190
                     /locus_tag="BMQ_pBM50037"
                     /db_xref="GeneID:8997129"
     CDS             21927..22190
                     /locus_tag="BMQ_pBM50037"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566056.1"
                     /db_xref="GI:294509128"
                     /db_xref="GeneID:8997129"
                     /translation="MNTTVNELYDFGTVLRRKLLNNNLYAHYLSDAMRRENHFDFLYY
                     FLTATVDSQTPIPEHVSAVFLKVLSDKEKLSDLTPFIMGLIGK"
     gene            22680..22886
                     /locus_tag="BMQ_pBM50038"
                     /db_xref="GeneID:8997130"
     CDS             22680..22886
                     /locus_tag="BMQ_pBM50038"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566057.1"
                     /db_xref="GI:294509129"
                     /db_xref="GeneID:8997130"
                     /translation="MLTKVSELSQRIYLSECIINKRRELVDLGMDYGLLNKKTIQCSQ
                     DLDQLINLYMQGSKKTEYKFYYIL"
     gene            23082..23273
                     /locus_tag="BMQ_pBM50039"
                     /db_xref="GeneID:8997131"
     CDS             23082..23273
                     /locus_tag="BMQ_pBM50039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566058.1"
                     /db_xref="GI:294509130"
                     /db_xref="GeneID:8997131"
                     /translation="MSKQAEAIKEVKLLNAEIDLCNRIKNLLNQGKLRDLQLKKEYTE
                     YEILQIALNRLMNELTFRY"
     gene            complement(23463..23816)
                     /locus_tag="BMQ_pBM50040"
                     /db_xref="GeneID:8997132"
     CDS             complement(23463..23816)
                     /locus_tag="BMQ_pBM50040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566059.1"
                     /db_xref="GI:294509131"
                     /db_xref="GeneID:8997132"
                     /translation="MVTEGLTPTTLVKNLSALPTPCNDVVYYPTHLTVLGIQGEYSVF
                     QAFSRKSGLAYIAITHPDTTKFIFAGSRNSMYELYQVIPWPEYKISNGELTFYYKTAP
                     SLQTLEDYFNNIKKQ"
     gene            complement(24194..24313)
                     /locus_tag="BMQ_pBM50041"
                     /db_xref="GeneID:8997133"
     CDS             complement(24194..24313)
                     /locus_tag="BMQ_pBM50041"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566060.1"
                     /db_xref="GI:294509132"
                     /db_xref="GeneID:8997133"
                     /translation="MSRKSIIFIVRLSLKFNYERSLKNTPFYERFGKKIRFLP"
     gene            24294..24422
                     /locus_tag="BMQ_pBM50042"
                     /db_xref="GeneID:8997134"
     CDS             24294..24422
                     /locus_tag="BMQ_pBM50042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566061.1"
                     /db_xref="GI:294509133"
                     /db_xref="GeneID:8997134"
                     /translation="MIDFLLKRKVRKCILLRKLNLILFQIVKGIKLRIFLELLKLF"
     gene            complement(24658..24846)
                     /locus_tag="BMQ_pBM50043"
                     /db_xref="GeneID:8997135"
     CDS             complement(24658..24846)
                     /locus_tag="BMQ_pBM50043"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566062.1"
                     /db_xref="GI:294509134"
                     /db_xref="GeneID:8997135"
                     /translation="MINKIKVKFLRERFSANSINIFDVFLPENRELSFNEQIMLLRVL
                     LNQACYFFYYIQVISRRN"
     gene            complement(24966..25439)
                     /locus_tag="BMQ_pBM50044"
                     /db_xref="GeneID:8997136"
     CDS             complement(24966..25439)
                     /locus_tag="BMQ_pBM50044"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566063.1"
                     /db_xref="GI:294509135"
                     /db_xref="GeneID:8997136"
                     /translation="MFRIILFIHILVGVICLVTGFAAMIAPKKKGFHTNLGEIYHFSF
                     IIVFLTTIVMAVMHWSSSSYLLYIGIFSYSLALLGYLAGKFKWKNWVAIHIGSILGSY
                     IAILTAVLVVNVNRIPILNNYNPLIFWLLPTVIGSPIIYLIRKKYEIDLNQEKSV"
     gene            complement(25870..27621)
                     /locus_tag="BMQ_pBM50045"
                     /db_xref="GeneID:8997137"
     CDS             complement(25870..27621)
                     /locus_tag="BMQ_pBM50045"
                     /codon_start=1
                     /transl_table=11
                     /product="drug resistance transporter, EmrB/QacA
                     subfamily"
                     /protein_id="YP_003566064.1"
                     /db_xref="GI:294509136"
                     /db_xref="GeneID:8997137"
                     /translation="MDHKLQSNLNSFPILLLMCLGIFICLLDTTIMNIALPAIQNDLN
                     TTLETSSWMLNTYTMTIAVLSIPMGRLAEIYGKMKFFILGLIIFACGSAFCGLSDNGE
                     MLIFARFCQSLGASILVPVATIIGVESLPLKKRHISLSLLGATQGLSTALGPSIGGLI
                     AQNLGWNWVFFVNIPICIVALVIAFIILPFKLEKRVKAKIDWAGLILAAIGIFNLNLV
                     LIKGNTWGWTSFTSLCCFFIFIVSLIMFIIVERKIKDPMVDLNLFKDRLYVGATLAVS
                     SAYLFLVGVMVLLPQFLTSFQDKTEIQAALLITPISATIFIVVNFVGFLVKKIGYVIP
                     IMIGYIIVAASYFQLEHLNTASTVSEIIIIGVTLGIGFSFIISPATMASVSSFEGEML
                     TSSQSVFTMLRQIGVVLAVAIFVSSITHEVDSKKQNVISYAKEQTSNIDVSPEKRLEI
                     LKSTEKKIDTDSTFSNVIEAPTVSASERQDLIDKNVKDTLSQYPAAEQEKIKEQITNQ
                     VTNQVNQDILKVNKEIKIYTENVTSYTRKEFSSVFSIVFGHALPFIFIGLLISILYRK
                     SKKSKVIKNKEVTALGE"
     gene            27600..27731
                     /locus_tag="BMQ_pBM50046"
                     /db_xref="GeneID:8997138"
     CDS             27600..27731
                     /locus_tag="BMQ_pBM50046"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566065.1"
                     /db_xref="GI:294509137"
                     /db_xref="GeneID:8997138"
                     /translation="MIVIYDPFLHLLSSFLQNTEYKFTKSTIVNSNCFSIKLQYQKS"
     gene            complement(27703..28110)
                     /locus_tag="BMQ_pBM50047"
                     /db_xref="GeneID:8997139"
     CDS             complement(27703..28110)
                     /locus_tag="BMQ_pBM50047"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566066.1"
                     /db_xref="GI:294509138"
                     /db_xref="GeneID:8997139"
                     /translation="MKAEIQDLWDNLVFHYEHQEEFQLIILDNKKVKYMWDNYNASLL
                     KILHKKDLHYATSNGRFIERIGARLAVKLAYGKRYPKENLKNIFIASDTWGAPSLWYQ
                     THEIKRVVVSLTHIPNYSGACLHNINSFDIVTL"
     gene            complement(28100..30529)
                     /locus_tag="BMQ_pBM50048"
                     /db_xref="GeneID:8997140"
     CDS             complement(28100..30529)
                     /locus_tag="BMQ_pBM50048"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-ketoacyl synthase domain protein"
                     /protein_id="YP_003566067.1"
                     /db_xref="GI:294509139"
                     /db_xref="GeneID:8997140"
                     /translation="MKIAVTGIGILSALGNNQYEFWDNIQSGKTGIREMVQLDSSELL
                     TNYAGEVRNLSPEKMMTQEEIEETERCTQLSFLAASEALKQADIPAGFYNTFKQGVIL
                     GTSLGGIPNGEKFHKQWIREGYEHTDPNLLLSYPLHTAADFLSVRFNLKGPKVAISTA
                     CSAGSNAIGYGIELIKSGKADMLIVGGADPLSMLSLAGFNSLKALSDEPCSPYSQSKG
                     ITLAEGAGVLILERLDRVKERGGKILSLVTGFGLTSDAYHPTAPNPGGAGAFKSMQMA
                     LERSNITSQDIDYVNGHGTGTRANDSAETTALKNLFSNTDKNVPVSSTKSMIGHTLGA
                     AGAVEGITCVLSLMKQTAPPTISFTNNPYNMDFIPNVSRPMAINTVLSNSFAFGGNNA
                     SLIFKKYEEEKQQTEVLSGIKQKVLITGIGCVQPLGIGKDELWESIEKGNSAINPIDF
                     EKEKYIGKLGASVSEKKYLKYINPSLIRRLDLLGKLSLASSKMALNDSGIKINRDNSD
                     KIAVIYGTSSGPLQTVEDIHRTIVVDGVKKVNPSQFPNTVMNAAAGHICSTFQIKGPS
                     TTICTGNVAGSQSITYAYHMINEGLIDAALVVVADEYTETIHAGYDRLGVLGNAPYPF
                     ERDSDGMALSCGSTALFLESEKHAKERKASVYGQIKGYGITSDAYKLAGNNPNGKAYS
                     YAMSDALKESELSVDDIDAIFSDARGLRSMDLTEVNAIRHLGGAKIPVTTLSNKNGYN
                     LSGMTPLHIVAALQTFNNHKIPGLKVKNPIYNLNFAKENQKLHSANNFLFNSANFGGT
                     YTSVVVGRYES"
     gene            complement(30541..31623)
                     /locus_tag="BMQ_pBM50049"
                     /db_xref="GeneID:8997141"
     CDS             complement(30541..31623)
                     /locus_tag="BMQ_pBM50049"
                     /codon_start=1
                     /transl_table=11
                     /product="aminomethyl transferase"
                     /protein_id="YP_003566068.1"
                     /db_xref="GI:294509140"
                     /db_xref="GeneID:8997141"
                     /translation="MTYRKSPANESINVITKVVGNQNVPSVFSSLEEEYKAIREEVAV
                     LDFSFNTFLKVSGDSASSFLQELITKDLDYLTEEQTVTCLMLDEDGHLVTELIVYVME
                     NEYLLEIEPSLSEKAEDYLQSHIKDGVLIENLAGKLQMIQLEGPKSWEVVQTLLPFPI
                     EILPYKNFAPFHFEGHNLYIARLGYTAEYGYKVFGDEAGIDLFWKALFAYDLSEINVQ
                     QIGLDAHDVCRLEVRFPDLSKEATSNKLIVESGVNWMLDFNKDFIGKDKNLEGLTSGL
                     CQELVCFTSESAVAKNQDILVDGNKVGYIQHTLYSPGINGSIGVAYLDEKYVASGLTF
                     TLDNDMTINTVSSPMIYPKSLSIRIG"
     gene            complement(31651..32151)
                     /locus_tag="BMQ_pBM50050"
                     /db_xref="GeneID:8997142"
     CDS             complement(31651..32151)
                     /locus_tag="BMQ_pBM50050"
                     /codon_start=1
                     /transl_table=11
                     /product="FabA-like domain protein"
                     /protein_id="YP_003566069.1"
                     /db_xref="GI:294509141"
                     /db_xref="GeneID:8997142"
                     /translation="MTNLLEKKSLKLPLELDQIKNMIPHRYPFLLIDRVNELNPGVSG
                     VAIKNVTANEPFFQGHFPGEAIMPGVLIIEAMAQLIAVIYVSKALVEVESQETSNDIN
                     YADRVGYLAAVKNIKFKNKVVPGDQLVLRAKVVGKMGVLSQVQVWAEVNGKTVVEGSI
                     SVSEKM"
     gene            complement(32148..32447)
                     /locus_tag="BMQ_pBM50051"
                     /db_xref="GeneID:8997143"
     CDS             complement(32148..32447)
                     /locus_tag="BMQ_pBM50051"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier domain protein"
                     /protein_id="YP_003566070.1"
                     /db_xref="GI:294509142"
                     /db_xref="GeneID:8997143"
                     /translation="MSTITQNDLLEQVNERKQLCQQIKTEIVERLSLNIEPAWIADNQ
                     PLFGRGLELDSIDTLEISIALQEVFDVMLTDDNMDVLGSVNKIADFITSQRNENL"
     gene            complement(32471..33211)
                     /locus_tag="BMQ_pBM50052"
                     /db_xref="GeneID:8997144"
     CDS             complement(32471..33211)
                     /locus_tag="BMQ_pBM50052"
                     /EC_number="1.1.1.100"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-acyl carrier protein reductase"
                     /protein_id="YP_003566071.1"
                     /db_xref="GI:294509143"
                     /db_xref="GeneID:8997144"
                     /translation="MFKDKVVLVTGASKGIGRATALYFLNEGAKVIINYSKEGNHIKE
                     LKEMVSNKEDQTLFFCADVSNVSSVREMFKAIKNKWGQLDILVSNAGITRDSWLMMMG
                     DKNWDDVLNINLKGTFFCIREASKMMAAKKQGVIINVSSTSGLKGQPGQANYSASKGG
                     IIAMTKTLSRELASYNIRVNCIAPGFIHTGMTNNMPQNTLDSYIQHIPLGRIGEANEV
                     AETIGFLASPKASYITGQCIVVDGGLTT"
     gene            complement(33204..34163)
                     /locus_tag="BMQ_pBM50053"
                     /db_xref="GeneID:8997145"
     CDS             complement(33204..34163)
                     /locus_tag="BMQ_pBM50053"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl transferase domain protein"
                     /protein_id="YP_003566072.1"
                     /db_xref="GI:294509144"
                     /db_xref="GeneID:8997145"
                     /translation="MNKKVAVIFPGQGSQVMGMGKDLISLPLFAQRLEKVAELANLTL
                     DEFFQPKNMKIIEKTEIVQPYIFVISVTLHELISKEYSLKPILFGGHSLGEFSALVAS
                     GMLSFEAGFELVKVRGSLMGEACNKTKGGMLAVLSPEKELFSLLHDEVKEQHNTIKIA
                     NYNSANQLVISGADESIKEFKNVIENKLKARAIPLKVSGAFHSVLMNEANKDFSHYLD
                     FTKFQAPLAPIVMNVSGEAELNKSNIFSLIKEQMISSVLWKKSMETIESFQPDLVLEI
                     GPGRVLSSLIKSSHRNLNVSNIGNRSDLLRFKKQLEREVEIVV"
     gene            complement(34185..34532)
                     /locus_tag="BMQ_pBM50054"
                     /db_xref="GeneID:8997146"
     CDS             complement(34185..34532)
                     /locus_tag="BMQ_pBM50054"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheinyl transferase superfamily"
                     /protein_id="YP_003566073.1"
                     /db_xref="GI:294509145"
                     /db_xref="GeneID:8997146"
                     /translation="MISVGIDLVDIERFKLALSRSGELFVSRILNNYEIAKYDSYQWA
                     ILFSAKECAIKMIKQIPKDFRLRDIQVDILSKDELLVTFDESLYKQVDLPTNSIKGTY
                     KVFKDCIVTHLIA"
     gene            complement(34529..34966)
                     /locus_tag="BMQ_pBM50055"
                     /db_xref="GeneID:8997147"
     CDS             complement(34529..34966)
                     /locus_tag="BMQ_pBM50055"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase family protein"
                     /protein_id="YP_003566074.1"
                     /db_xref="GI:294509146"
                     /db_xref="GeneID:8997147"
                     /translation="MKWLETKARVRWSEVDSQSIVYYGNYFLYFDLGREYVAEKVELE
                     YLTEEFDVITLDTTAKYRQPARYGDELIIRTRMIHPSPAEMASPMGFTFQFEYQILKS
                     QGKLLLAEGTSRHALKDKITHKLYVKVPKEKKEKFLSVFEIYK"
     gene            complement(34993..35730)
                     /locus_tag="BMQ_pBM50056"
                     /db_xref="GeneID:8997148"
     CDS             complement(34993..35730)
                     /locus_tag="BMQ_pBM50056"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, short chain
                     dehydrogenase/reductase family"
                     /protein_id="YP_003566075.1"
                     /db_xref="GI:294509147"
                     /db_xref="GeneID:8997148"
                     /translation="MEVAIVTGAGSGIGRATAIQLSSQDYRVYALDKDEKSIKDFEKT
                     KNITPIVCDVLKENDINSFFSRFSSKEKHLDLLFNGVGAMKLGGLLDTSEDDWDFGFH
                     INLKSALVFSKRAYNYLLESKNPSIINISSVLGETYEEKAAIYTVMKSALVTLTKCLA
                     KELAPKKIRVNAISPGPIQTSFVRSFSQETKKIQGASKLVMKLSHTPIGRTGKPEEVA
                     KLVSYLASPQASFITGSCISIDGGWSI"
     gene            36663..36797
                     /locus_tag="BMQ_pBM50057"
                     /db_xref="GeneID:8997149"
     CDS             36663..36797
                     /locus_tag="BMQ_pBM50057"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566076.1"
                     /db_xref="GI:294509148"
                     /db_xref="GeneID:8997149"
                     /translation="MSCVPERDIMLTTNVYLIQHKKRKNPCRWSGVFSVTYQGIKNDT
                     "
     gene            complement(36837..37235)
                     /locus_tag="BMQ_pBM50058"
                     /db_xref="GeneID:8997150"
     CDS             complement(36837..37235)
                     /locus_tag="BMQ_pBM50058"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase, GNAT family"
                     /protein_id="YP_003566077.1"
                     /db_xref="GI:294509149"
                     /db_xref="GeneID:8997150"
                     /translation="MVIEYKVNASISAKEVADIFKSSGIKRPVNELERIERMIKNSDI
                     NLTAWNNQQLIGIARAITDYSYCCYLSDLAIHKDYQNKGIGKELVQRLQDIIGEEVAL
                     ILLASSVAMDYYPHIGFEKSENAFRIPRKK"
     gene            complement(37417..38643)
                     /locus_tag="BMQ_pBM50059"
                     /db_xref="GeneID:8997151"
     CDS             complement(37417..38643)
                     /locus_tag="BMQ_pBM50059"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter, major facilitator family"
                     /protein_id="YP_003566078.1"
                     /db_xref="GI:294509150"
                     /db_xref="GeneID:8997151"
                     /translation="MIPITKEAKVRTGIWKGKFIYLWVASIFSSLSISMYLTIEQWYV
                     VNYLNLKSSLGIILMATTIPRVLLMVIGGVVSDKYRRSKVIFFSLLTRCFMLLLMALF
                     YTNNLLSLSVLFIFALLFGASDAFFWSARDSIVPGIVHKEQLVRANSVIQTTNQLSVM
                     FGPVLGATLLSLFSYSTIFLIIAFTLLISIILLQFIKEKKTLRPKKTSILRDLAEGIN
                     YVKDSSFLLTVMVTFIIVNLFFIGPLMLSIPILAEDRFKGNAFYLSIFQSSFASGMLL
                     GAIVMGWLNIKRNRGKLAISFIFLEGLLLMIFSQGINLWLAAAILLAIGCCVSSINIL
                     IVSLIQEKTPSTIVGRVMSVNTMVSMGLIPVSYGLVSTLLSINVDIKFILLCAGIVIV
                     LFSVLLLLKASDLKNT"
     gene            complement(38736..39317)
                     /locus_tag="BMQ_pBM50060"
                     /db_xref="GeneID:8997152"
     CDS             complement(38736..39317)
                     /locus_tag="BMQ_pBM50060"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, ArsR family"
                     /protein_id="YP_003566079.1"
                     /db_xref="GI:294509151"
                     /db_xref="GeneID:8997152"
                     /translation="MQLDKLVNYYKAVGDPTRIRIISLLKKGHLHGQAIAYKLGLQPS
                     TITHHISKLRDVGLVYQRRQGNIIYFYLDTERLEYNSKAILNIGEESMENQDSKINDK
                     DKLSIIKSFINSDGTLKQIPSQRKKKNVILAYLIRDLHQGKMYKEKDLNEYIKNYHED
                     YATIRRELIMQHFMYRQNGEYELNPKEMWPVTF"
     gene            39500..40165
                     /locus_tag="BMQ_pBM50061"
                     /db_xref="GeneID:8997153"
     CDS             39500..40165
                     /locus_tag="BMQ_pBM50061"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566080.1"
                     /db_xref="GI:294509152"
                     /db_xref="GeneID:8997153"
                     /translation="MLDYIWIDGDLPILSQLPNDFNSAAILFHPFIQMPSGWEKSKRE
                     NPYQHIYPSDEEMLKLGEPISWKEVMVKSNLKSYKELFRVLQYLTGAPSDEYKKLASY
                     VKSNPDFYYPEEDRTSLFILNSLVKILCSKGANTLYFSEPIHDTNGSFKVNDMSSLEI
                     ANLSPNESIITDENMDFAFMGIYDSFITLLLAKDTNIEDTIKSLNLEAFICDKETYFN
                     SFI"
     gene            40299..40595
                     /locus_tag="BMQ_pBM50062"
                     /db_xref="GeneID:8997154"
     CDS             40299..40595
                     /locus_tag="BMQ_pBM50062"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566081.1"
                     /db_xref="GI:294509153"
                     /db_xref="GeneID:8997154"
                     /translation="MLGETFTLFRPIYYLITIFLVCNFVYVVFLSNKIKANSYILFNS
                     LFFVIIGAMLLFQQGIIVDETNQSGDPVIFDLTILFGVLFIASFIFRNIKKRKV"
     gene            40799..41128
                     /gene="csaA"
                     /locus_tag="BMQ_pBM50063"
                     /db_xref="GeneID:8997155"
     CDS             40799..41128
                     /gene="csaA"
                     /locus_tag="BMQ_pBM50063"
                     /codon_start=1
                     /transl_table=11
                     /product="export-related chaperone CsaA"
                     /protein_id="YP_003566082.1"
                     /db_xref="GI:294509154"
                     /db_xref="GeneID:8997155"
                     /translation="MATIDDFFKLDIRIGTVVKAEPFPEARKPAIKLEIDFGELGVKC
                     SSAQITRRYKPEQLIGSQVVAVVNFPPMRIAGFKSEVLVMGGIPEEGDVVLLKPSEFV
                     KNGTPIA"
     gene            41429..42307
                     /locus_tag="BMQ_pBM50064"
                     /db_xref="GeneID:8997156"
     CDS             41429..42307
                     /locus_tag="BMQ_pBM50064"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein (DUF6)"
                     /protein_id="YP_003566083.1"
                     /db_xref="GI:294509155"
                     /db_xref="GeneID:8997156"
                     /translation="MKNTLLGSIYLALAASIWGGMYVVVKVVVAVIPPLELVWIRYVI
                     AILALFIIGLIKRQSWRINKRHIPLIVAIGVIGNAISIVTQEYGTMLSSAQMGAIITS
                     STPAFMVIFARLILKERLNMKKGISVGLATIGVLLIVGNGHINMSSQLGGLSLLMAAL
                     TWALMSILIKRVPSSYSPVVITTYSILVAILVLTPFVYKGLGEIHISKLIDPTIGGGL
                     LYLGIVSTALAFILWNRGLQLLNASSGGLFFFFQPLVGTLLGWLLLGESIGGTFWIGS
                     FLILSGVLLVIKEKTN"
     gene            42441..42584
                     /locus_tag="BMQ_pBM50065"
                     /db_xref="GeneID:8997157"
     CDS             42441..42584
                     /locus_tag="BMQ_pBM50065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566084.1"
                     /db_xref="GI:294509156"
                     /db_xref="GeneID:8997157"
                     /translation="MTTNRQFYFLWYTNISSPCLLRNCYIKGNQTEKFQTFNIIIFLT
                     TYI"
     gene            42602..42724
                     /locus_tag="BMQ_pBM50066"
                     /db_xref="GeneID:8997158"
     CDS             42602..42724
                     /locus_tag="BMQ_pBM50066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566085.1"
                     /db_xref="GI:294509157"
                     /db_xref="GeneID:8997158"
                     /translation="MSFIQKSKYINKLIKIKVLLFTLPDDKYGLFLHTIQILMY"
     gene            43331..43639
                     /locus_tag="BMQ_pBM50067"
                     /db_xref="GeneID:8997159"
     CDS             43331..43639
                     /locus_tag="BMQ_pBM50067"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566086.1"
                     /db_xref="GI:294509158"
                     /db_xref="GeneID:8997159"
                     /translation="MPNIQVVEKSSHAKIAIDEFLRAGFNTDEIHLLTCNSANTINSY
                     ENELCSTNFVNPDTNILQVDEDVFFSKMQSFGISKRDAERYKESMDKGSIMVIVSKAV
                     "
     gene            43649..43795
                     /locus_tag="BMQ_pBM50068"
                     /db_xref="GeneID:8997160"
     CDS             43649..43795
                     /locus_tag="BMQ_pBM50068"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566087.1"
                     /db_xref="GI:294509159"
                     /db_xref="GeneID:8997160"
                     /translation="MQNIKTILRIFETKIGIKKVQKRFFLIPSELLTLFNKTLLFICL
                     YKEF"
     gene            complement(43957..45414)
                     /locus_tag="BMQ_pBM50069"
                     /db_xref="GeneID:8997161"
     CDS             complement(43957..45414)
                     /locus_tag="BMQ_pBM50069"
                     /EC_number="3.4.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="intracellular serine protease"
                     /protein_id="YP_003566088.1"
                     /db_xref="GI:294509160"
                     /db_xref="GeneID:8997161"
                     /translation="MKKKILHTVLSITVGVGILSVGGVPTQAKSKNQEMNNTYAIAFK
                     SRLPENYQEVIQKAGGKVTKVLPEVGGIEAQSDQPSFLKNLKGNSSIEAANREIPLSL
                     DKTAVSPYNYESSIISQQNSESYWDSQWDIQRVTNNGKSYDLETGGYKNKDGSITHKA
                     VVGVIDTGIDESHPDLKNNIIGGRNLVPAGMDESETGDPTDIKDRNGHGTHVAGIIGA
                     NGKVKGVGPELGIRSYRVFYSEQALGLPAWIIDGIIAATNDKVDVINMSLRFYNNTKM
                     TIEGESYKSVAETLLWKRAIQYAVKNGVTVVAGSGNESLNLDDKKEVNEFLNKMYEPY
                     GMSVKGPATVVPAQMPGVINVSASTKWSTQQLAFYSNYGNSAIDVAAPGGDYGQKYAE
                     TNDPAAADPSNLILSTWPTYLGTSYELNAGTSMATPQVAGIAGVIKAAHPEYKPAQIT
                     ARIKQTAFDYGKKGQDALFGSGEANAYRALENIKK"
     gene            45625..45867
                     /locus_tag="BMQ_pBM50070"
                     /db_xref="GeneID:8997162"
     CDS             45625..45867
                     /locus_tag="BMQ_pBM50070"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_003566089.1"
                     /db_xref="GI:294509161"
                     /db_xref="GeneID:8997162"
                     /translation="MLQLNYGRNWCILKNNVKTFRVQADLTQHQLAEKVGVTRQTISL
                     IEKGKYNPTLKLCLEICYVVNRTLDEIFWIDQEENK"
     gene            45864..46295
                     /locus_tag="BMQ_pBM50071"
                     /db_xref="GeneID:8997163"
     CDS             45864..46295
                     /locus_tag="BMQ_pBM50071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566090.1"
                     /db_xref="GI:294509162"
                     /db_xref="GeneID:8997163"
                     /translation="MKVIRDERLVIKNLKNIRIAFAFQTLAMAGILIYDGITRGFNNV
                     TDNPLWLVLILTSVILGYLNLGISVDSYESEKQLRKTPYYLIVIGCLTIGIIFGLLTK
                     ITSNSSVQDSTIIGLVIFLCFLGTFSFWHFLIKKRSKDEDE"
     gene            46481..46804
                     /locus_tag="BMQ_pBM50072"
                     /db_xref="GeneID:8997164"
     CDS             46481..46804
                     /locus_tag="BMQ_pBM50072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566091.1"
                     /db_xref="GI:294509163"
                     /db_xref="GeneID:8997164"
                     /translation="MYIWSNSEGAISLLYSRPVFIFFIVVLAALFIIILMQNKKQLVT
                     GLHVITIIIISLFISGLILFLEGIIVDDLNLSEDTISSYMFLIIVALCVINSVTYSFK
                     NKKLQ"
     gene            47060..47221
                     /locus_tag="BMQ_pBM50073"
                     /db_xref="GeneID:8997165"
     CDS             47060..47221
                     /locus_tag="BMQ_pBM50073"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566092.1"
                     /db_xref="GI:294509164"
                     /db_xref="GeneID:8997165"
                     /translation="MIPAILTVIAAIVLFYIGYVEVRGFEGAAYLFLSVFLILFAIIS
                     FVMAKKPLR"
     gene            47357..47626
                     /locus_tag="BMQ_pBM50074"
                     /db_xref="GeneID:8997166"
     CDS             47357..47626
                     /locus_tag="BMQ_pBM50074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566093.1"
                     /db_xref="GI:294509165"
                     /db_xref="GeneID:8997166"
                     /translation="MQNRFSKYSLWLSIAGIIIAIGQYFTPLYNLNILYIGIVIYLIG
                     FVCGVIAVGKHEKGLMKYFSLYSFVLIPVFIFFGFLFLAFQIGEK"
     gene            complement(47841..49391)
                     /locus_tag="BMQ_pBM50075"
                     /db_xref="GeneID:8997167"
     CDS             complement(47841..49391)
                     /locus_tag="BMQ_pBM50075"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 2 family protein"
                     /protein_id="YP_003566094.1"
                     /db_xref="GI:294509166"
                     /db_xref="GeneID:8997167"
                     /translation="MKHKKRILVASPIHQKPEILTLFLESLKHLKKEEMIVDFYFIDD
                     NENVDSSRLLIQFQECIQSVIVEKSDYQDVYSRDGQTHHWNEHLVWKVAGFKNSIIQY
                     AKEKNYDYLFLVDSDLLLFPETIVHLVQQEKDIISEVFWTRWQPDSMEQPQVWLYDEY
                     TQYHKQPGEDLSTEQIKVRYQEFIAKVRTPGVYEVGGLGACTLISQNALQKGVNFNKI
                     PNLTFWGEDRHFCIRAAAMGLSLYVDTRYPAYHIYRDTNIKEGQEFIKKITARQKTIQ
                     SNIYVPTTKKTKLTLSMVIKNEENRFLKEVLRSYVPYIDDVVIIDDGSTDNSVEVCKE
                     VLKTVPYKIIRNEVSKFSNEVELRKQQWEETVNTEPNWILNMDADEIFEDKFDRDIQQ
                     LLTQRDYDLYSFRLYDFWNDTHYREDDYWQSHFYYRPFLVRYRNDFSYTWQETPQHCG
                     RFPNNIFQLPNSISDLRVKHYGWSKLEYRLEKYKRYLTLDPHAQYGTKEQYESILDEN
                     PNLIKWEE"
     gene            complement(49381..50481)
                     /locus_tag="BMQ_pBM50076"
                     /db_xref="GeneID:8997168"
     CDS             complement(49381..50481)
                     /locus_tag="BMQ_pBM50076"
                     /EC_number="2.4.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 2 family protein"
                     /protein_id="YP_003566095.1"
                     /db_xref="GI:294509167"
                     /db_xref="GeneID:8997168"
                     /translation="MVSISLCMIVKNEEDSIGRCLESIYQLVDEINIIDTGSNDQTKK
                     IASKYTNRIYDFEWVHDFSKARNYAFEKATKDYILWLDADDVFLEEDQQKLLALKLNL
                     ESSVDSVTMKYILATDEYGNVTSSLRRNRLVKRRNGFRWIGAVHEYLEVWGNIMNSEV
                     AVTHKSIHHDSDRNLKIYEKKLLTGEDFSPRDLYYFANELKDHRQFKRAIEFYEKFLS
                     TEKGWIEDNIAACRNLADCYLEIFDKERMIKSLLRSFTYTAPRPEICCRLAHYFIEKN
                     DYQSAVFWYGSATKTGVTSDNLGIQNQAYSTWIPHIQLCVCYDALGDYEKANHHNELA
                     GTYRPNDPKYLHNKGYLETKIPIEKVGVGNET"
     gene            50892..53756
                     /locus_tag="BMQ_pBM50077"
                     /db_xref="GeneID:8997169"
     CDS             50892..53756
                     /locus_tag="BMQ_pBM50077"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566096.1"
                     /db_xref="GI:294509168"
                     /db_xref="GeneID:8997169"
                     /translation="MSIQNLIVNGGFETGTLSSWLIANTVITSEYSHSGFYSARLQGG
                     ATFSYISQFVPIEPGERLEILASLATVGQAPAIFITIQVFYYDNQSNLLENGLLVTVP
                     GNQIPNVENHTWLENYHTTTAAPPGSTQAFIVINTLPQVETSDVLVDDVAVLVVNNNG
                     AIGATGATGATGATGATGITGATGVTGATGITGITGVTGATGATGATGVTGATGATGI
                     TGITGITGITGITGVTGATGITGITGITGVTGATGATGATGVTGATGITGATGVTGVT
                     GVTGITGVTGVTGVTGVTGATGITGVTGETGVTGETGATGVTGITGATGITGVTGITG
                     ATGVTGVTGVTGVTGATGITGVTGETGVTGETGATGVTGITGATGITGVTGITGATGV
                     TGATGVTGITGVTGITGVTGVTGVTGITGVTGATGATGITGATGATGITGVTGITGVT
                     GVTGVTGITGVTGATGATGITGATGATGITGVTGATGITGATGITGATGVTGVTGVTG
                     VTGATGATGITGATGITGATGVTGATGVTGVTGATGATGVTGITGVTGVTGATGVTGV
                     TGVTGVTGATGVTGVTGITGITGVTGVTGITGVTGATGATGVTGATGVTGVTGATGAT
                     GVTGITGVTGATGVTGATGITGATGITGATGATGITGVTGATGVTGATGITGATGVTG
                     ATGATGITGVTGATGATGVTGVTGITGVTGVTGITGVTGVTGVTGITGVTGATGATGV
                     TGVTGITGVTGVTGITGVTGVTGVTGITGVTGATGATGITGATGATGATGITGVTGAT
                     GITGVTGVTGATGATGATGPTASSPTLAFSEAPGTIAIFPPLNTEVTVASVTQNVLIN
                     QQLKIDYALAVEIITTANWSIVFEMRLYRDTTLIDTRIFNRSATQAGTQRFPLASTQV
                     NIAPTTTTSTYSVRIIVTAATSITSATAINRDLNIITFTP"
     gene            53811..53978
                     /locus_tag="BMQ_pBM50078"
                     /db_xref="GeneID:8997170"
     CDS             53811..53978
                     /locus_tag="BMQ_pBM50078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566097.1"
                     /db_xref="GI:294509169"
                     /db_xref="GeneID:8997170"
                     /translation="MYIRDSYHVDVLEKNSEKLVYDQELYSKYYSVIEKLYKIKFQNW
                     IQDQKRTCYCR"
     gene            54305..54919
                     /locus_tag="BMQ_pBM50079"
                     /db_xref="GeneID:8997171"
     CDS             54305..54919
                     /locus_tag="BMQ_pBM50079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566098.1"
                     /db_xref="GI:294509170"
                     /db_xref="GeneID:8997171"
                     /translation="MGDISEGKFSYVDYWEENYSNGGTSGKGSYGVLAQFKGDVINQF
                     IKGKRIHKVIEFGCGDGNQLKYMNYPSYLGMDISPTSIDICSKMFGKDKTKSFLLYNP
                     KYFINNGYFKSDLVVCLDVLYHITNEDDFWKTLDDIFSCKPFYIILYTRVTKPEEFVY
                     GIPTIQDRDILSCLSRYQDYKLIQIIEQKYKELSGASFIILEKV"
     gene            54955..55602
                     /locus_tag="BMQ_pBM50080"
                     /db_xref="GeneID:8997172"
     CDS             54955..55602
                     /locus_tag="BMQ_pBM50080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566099.1"
                     /db_xref="GI:294509171"
                     /db_xref="GeneID:8997172"
                     /translation="MSIFTSRFILKTDPYSKHFVFNLPKTWETRPHEYEWAKNFAETE
                     DIVLDAACGLSHPLKFYLAGKCKEVYACDIDARILSKSSILKDIRDTYGTIIENSFLN
                     HYFHHIHFCHSSLSKLPYQDKSFDKIFCISVLEHLSKVDIEQTFKEFRRTLKDEGLLI
                     VTFDYPTINLEALKILLDKVKFKFYGDYSLDKPDNLLVSTIWGELNCFRAVLIKN"
     gene            55742..57058
                     /locus_tag="BMQ_pBM50081"
                     /db_xref="GeneID:8997173"
     CDS             55742..57058
                     /locus_tag="BMQ_pBM50081"
                     /codon_start=1
                     /transl_table=11
                     /product="collagen triple helix repeat domain protein"
                     /protein_id="YP_003566100.1"
                     /db_xref="GI:294509172"
                     /db_xref="GeneID:8997173"
                     /translation="MAYKRATKVRYFSSNHDNNYLKKGNCKEKDCIDITGSQIRRLLT
                     ILDSLKDIIPLMLRNPNTGNINTLSNLMNRLITLLNELKPNSSAVTYLITTAQSLLSS
                     LTTTLLPPMRLVSLLQKLINRLILLITLLCLNSETYILLLKNLNQLEAILAQYTSIGI
                     TGATGPTGATGIRGTPGPPGGPGVTGITGVTGPTGATGVTGDPGITGATGSTGATGIT
                     GAAGVTGVTGITGTTGVTGDPGIAGATGITGVTGVTGDPGIAGATGSTGATGITGATG
                     VTGATGITGATGVTGATGITGATGTSLTTNSMFAGNTVGSTILVVLGGTSVPLPSNQN
                     LDSFTVNGTNTTFTVPATGRYYITYQINTTAALLAGSRLILNGTTPIPGSTISPAVAA
                     SSYNNDVIVSLTVGDTITLQLFGLLATVVLTGGGSTGAALTIIRLS"
     gene            57329..57976
                     /locus_tag="BMQ_pBM50082"
                     /db_xref="GeneID:8997174"
     CDS             57329..57976
                     /locus_tag="BMQ_pBM50082"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566101.1"
                     /db_xref="GI:294509173"
                     /db_xref="GeneID:8997174"
                     /translation="MKNIEVSQKYLLLVLNDKGGVAPIGSLRIRAFMVASGILELVLD
                     DIVSLSDNQVTVKQELPSDKEYLRSIYNKISTEKSIHLKKLGRELISKRELFKELFNS
                     VGDSLVELDVVTKTNGGILGQSSHYIGSENSKKQIVEQMRAELLEEGPVTTDTVVLSS
                     LLIGSRTLKNYFSKFEDKDLNDKLTMLRKDTRNKEIFALIDSISHTITTIIASVG"
     gene            57991..58254
                     /locus_tag="BMQ_pBM50083"
                     /db_xref="GeneID:8997175"
     CDS             57991..58254
                     /locus_tag="BMQ_pBM50083"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MerR family"
                     /protein_id="YP_003566102.1"
                     /db_xref="GI:294509174"
                     /db_xref="GeneID:8997175"
                     /translation="MSRRRSLEDILQSEYVSIGELSRLTDSRYSTLKYYTEAGLIPFE
                     QSDENLTRRYPREASVQRIETIKQLKKSGLSISEISDWVVNND"
     gene            complement(58498..58680)
                     /locus_tag="BMQ_pBM50084"
                     /db_xref="GeneID:8997176"
     CDS             complement(58498..58680)
                     /locus_tag="BMQ_pBM50084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566103.1"
                     /db_xref="GI:294509175"
                     /db_xref="GeneID:8997176"
                     /translation="MNQRDQKRLAITRELMENAKKRLDLSYELEQDLENLGLQRRMKQ
                     LDLENKLLKEQNNELA"
     gene            complement(59316..59693)
                     /locus_tag="BMQ_pBM50085"
                     /db_xref="GeneID:8997177"
     CDS             complement(59316..59693)
                     /locus_tag="BMQ_pBM50085"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566104.1"
                     /db_xref="GI:294509176"
                     /db_xref="GeneID:8997177"
                     /translation="MSERQNAFTIKTNRLSDEVYNRLATYAKSRKLGEYISSLILRDL
                     DDSSTGRKAIEDKKTYEMLEHIKNELADLKTLAKTTGFVGNDSFKEEEPSKVPQLKEG
                     KIADLENISGSLDDDDLEEYNDF"
     gene            complement(59711..60895)
                     /locus_tag="BMQ_pBM50086"
                     /db_xref="GeneID:8997178"
     CDS             complement(59711..60895)
                     /locus_tag="BMQ_pBM50086"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566105.1"
                     /db_xref="GI:294509177"
                     /db_xref="GeneID:8997178"
                     /translation="MKISRFNKDCGNSVDMNIMDGYLFDFPTNVVELQKEAADSFFTD
                     AVTAPEEFKKRILLSTTIKGEEKERYFLVGDIAASQLLANNHINKLHNKITSHIPYIT
                     FLAAIAYYHALHAKNKKDNTIEIDYFSTMLPIWLLKKESTFGAAQKAMANRFLGDHTF
                     TVHTPGFENTLKVLVEESACLKEGESARFALKKDLTLQDREDANEYVECETVMVDIGG
                     GSIDVVILPEGLKAANSRESFQSIEGIPYLAHIDKLRKEKFLELFTDLRAFDQFILDN
                     YSKQKFVLKNENTGESIDLTSTIKSSLREYVEILLAKLNDVAPPPANKLRKYVYCGGV
                     APTLEVAIMNSMREKIGEERTEKYHKVPQDSRHLNLFGLEIRSIGYVQKKQAAEKKAV
                     KS"
     gene            61345..61470
                     /locus_tag="BMQ_pBM50087"
                     /db_xref="GeneID:8997179"
     CDS             61345..61470
                     /locus_tag="BMQ_pBM50087"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566106.1"
                     /db_xref="GI:294509178"
                     /db_xref="GeneID:8997179"
                     /translation="MILILYYMCTTSFTIKTYRILFYFLWLYFYNENALFFIIGI"
     gene            complement(61493..62743)
                     /locus_tag="BMQ_pBM50088"
                     /db_xref="GeneID:8997180"
     CDS             complement(61493..62743)
                     /locus_tag="BMQ_pBM50088"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter, major facilitator family"
                     /protein_id="YP_003566107.1"
                     /db_xref="GI:294509179"
                     /db_xref="GeneID:8997180"
                     /translation="MEEKLPVNHSTNLFGNRVFQAIIISGLFLQIGIWVRNFAVLLFI
                     MEKTNGDPFAVSLISVAEFAPIFIFSFIGGTFADRWRPKRTMVWCDILSAISVFAVLV
                     TLILGSWHIVFFATLISAILSQFSQPSGMKLFKMHLPEEQMQVGMSVYQTVFAIFMVL
                     GPILGTFAFQAFGISLSIAITGTAFLLSAAALTFLPSDRKMEEENGTTSLLSEMKSGI
                     KYVLGKKELSLLGLCFLAAGLGIGFIQPLSIFLVTEQLGLAKENLQWLLTANGIGMIL
                     GGAVVMIFAKTVAPQRLLAFGMVGNAIGFAIMGLSVNLWLTLGAQFLNGLMLPCIQIG
                     INTMILQRTEAAFIGRVNGILSPLFTGAMVLTMSVAGILKEQFSLVAIFEAAAVLFII
                     GLLFILPLYNLKEETKQEGIELGE"
     gene            complement(63134..63403)
                     /locus_tag="BMQ_pBM50089"
                     /db_xref="GeneID:8997181"
     CDS             complement(63134..63403)
                     /locus_tag="BMQ_pBM50089"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566108.1"
                     /db_xref="GI:294509180"
                     /db_xref="GeneID:8997181"
                     /translation="MKGQQWSTRFNDVKETIQSIIYTWNPLSLHASEEYEYEATWILP
                     MVYKVENVESLAIEITDILNQSFNSTLIKEECIGIAQQIWEQIRE"
     misc_feature    complement(63155..63346)
                     /locus_tag="BMQ_pBM50089"
                     /note="Domain of unknown function (DUF1871); Region:
                     DUF1871; pfam08958"
                     /db_xref="CDD:149887"
     gene            complement(63542..64204)
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /db_xref="GeneID:8997182"
     CDS             complement(63542..64204)
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-H factor"
                     /protein_id="YP_003566109.1"
                     /db_xref="GI:294509181"
                     /db_xref="GeneID:8997182"
                     /translation="MNMIAGVEIREKKMTLNDEEIVQAFQKGDEDVFNVLVKKYEYLV
                     WSKVKRYFLLGGDREDLLQEARLGLYKAVRDFKTEGMSSFRGFADLCITRQLITAIKA
                     SARQKHSPLNNALSLNIPKNSKRLEDDLILMEMLPHPRAVSPEQATVEKENKREREQM
                     LQEILSPIEQDVFTLYLKGQTYMQISQNLNLPQKSVDNALYRIKKKMKHQMQYLYLQQ
                     SS"
     misc_feature    complement(63584..64162)
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /note="RNA polymerase factor sigma-70; Validated; Region:
                     PRK08295"
                     /db_xref="CDD:181361"
     misc_feature    complement(63887..64099)
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(63584..63733)
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /note="Sigma-70, region 4; Region: Sigma70_r4_2;
                     pfam08281"
                     /db_xref="CDD:203898"
     misc_feature    complement(order(63593..63595,63599..63604,63608..63616,
                     63620..63625,63629..63631,63659..63664,63707..63709))
                     /gene="sigH"
                     /locus_tag="BMQ_pBM50090"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            64272..64526
                     /locus_tag="BMQ_pBM50091"
                     /db_xref="GeneID:8997183"
     CDS             64272..64526
                     /locus_tag="BMQ_pBM50091"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566110.1"
                     /db_xref="GI:294509182"
                     /db_xref="GeneID:8997183"
                     /translation="MSKKQRVERIFREEEVSHYIKPYIMYMTCIIWTIFNLVYDFKKA
                     NRRFLACFTRCYWINDSDTAIVKISKFVLVLIDIGQILIR"
     gene            64532..64720
                     /locus_tag="BMQ_pBM50092"
                     /db_xref="GeneID:8997184"
     CDS             64532..64720
                     /locus_tag="BMQ_pBM50092"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566111.1"
                     /db_xref="GI:294509183"
                     /db_xref="GeneID:8997184"
                     /translation="MLLLSSFYLPSMKKEDSFAFKLLLFFTFHFLCCIPFSVECAPMF
                     RAKNFVSSFYNFSFLLLS"
     gene            complement(65363..65548)
                     /locus_tag="BMQ_pBM50093"
                     /db_xref="GeneID:8997185"
     CDS             complement(65363..65548)
                     /locus_tag="BMQ_pBM50093"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566112.1"
                     /db_xref="GI:294509184"
                     /db_xref="GeneID:8997185"
                     /translation="MINVPSRVTSFKVFFEKNKTEVSDLFLFSSHVHNQKSHLFLLTI
                     QVIYACFFIIYESIFIL"
     gene            66551..66673
                     /locus_tag="BMQ_pBM50094"
                     /db_xref="GeneID:8997186"
     CDS             66551..66673
                     /locus_tag="BMQ_pBM50094"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003566113.1"
                     /db_xref="GI:294509185"
                     /db_xref="GeneID:8997186"
                     /translation="MRRGKKIPLPYSKKLIYDKGDSYSNIGSLVAKYTCFDIFC"
CONTIG      join(CP001988.1:1..66985)
//
DBGET integrated database retrieval system