GenomeNet

Database: RefSeq
Entry: NC_014500
LinkDB: NC_014500
Original site: NC_014500 
LOCUS       NC_014500            4922802 bp    DNA     circular CON 06-JUL-2013
DEFINITION  Dickeya dadantii 3937 chromosome, complete genome.
ACCESSION   NC_014500
VERSION     NC_014500.1  GI:307128764
DBLINK      Project: 52537
KEYWORDS    RefSeq.
SOURCE      Dickeya dadantii 3937
  ORGANISM  Dickeya dadantii 3937
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Dickeya.
REFERENCE   1  (bases 1 to 4922802)
  AUTHORS   Glasner,J.D., Yang,C.H., Reverchon,S., Hugouvieux-Cotte-Pattat,N.,
            Condemine,G., Bohin,J.P., Van Gijsegem,F., Yang,S., Franza,T.,
            Expert,D., Plunkett,G. III, San Francisco,M.J., Charkowski,A.O.,
            Py,B., Bell,K., Rauscher,L., Rodriguez-Palenzuela,P., Toussaint,A.,
            Holeva,M.C., He,S.Y., Douet,V., Boccara,M., Blanco,C., Toth,I.,
            Anderson,B.D., Biehl,B.S., Mau,B., Flynn,S.M., Barras,F.,
            Lindeberg,M., Birch,P.R., Tsuyumu,S., Shi,X., Hibbing,M., Yap,M.N.,
            Carpentier,M., Dassa,E., Umehara,M., Kim,J.F., Rusch,M., Soni,P.,
            Mayhew,G.F., Fouts,D.E., Gill,S.R., Blattner,F.R., Keen,N.T. and
            Perna,N.T.
  TITLE     Genome Sequence of the Plant-Pathogenic Bacterium Dickeya dadantii
            3937
  JOURNAL   J. Bacteriol. 193 (8), 2076-2077 (2011)
   PUBMED   21217001
REFERENCE   2  (bases 1 to 4922802)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-SEP-2010) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4922802)
  CONSRTM   International Erwinia Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (14-MAY-2010) Department of Genetics, University of
            Wisconsin, 425 Henry Mall, Madison, WI 53706, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002038.
            Source DNA and bacteria strain is available from Jeremy Glasner,
            jglasner@wisc.edu.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4922802
                     /organism="Dickeya dadantii 3937"
                     /mol_type="genomic DNA"
                     /strain="3937"
                     /db_xref="taxon:198628"
     gene            complement(32..475)
                     /gene="mioC"
                     /locus_tag="Dda3937_00155"
                     /db_xref="GeneID:9735696"
     CDS             complement(32..475)
                     /gene="mioC"
                     /locus_tag="Dda3937_00155"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="5.1 cell processes; cell division"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding protein MioC"
                     /protein_id="YP_003880781.1"
                     /db_xref="GI:307128765"
                     /db_xref="ASAP:ABF-0014799"
                     /db_xref="ERIC:ABF-0014799"
                     /db_xref="GeneID:9735696"
                     /translation="MADITLISGSTLGSAEYVTEHLESLLQQHDFTTTLLHGPELDEV
                     TPENLWLVVTSTHGAGDLPDNLQPFYDDLQTKRPDLSAVRYGAIGIGSSEYDTFCGAI
                     VKVDQLLQDLGARRIGDMLKIDITQHDIPEDPAEVWLGSWVNLLK"
     misc_feature    complement(38..475)
                     /gene="mioC"
                     /locus_tag="Dda3937_00155"
                     /note="FMN-binding protein MioC; Provisional; Region:
                     PRK09004"
                     /db_xref="CDD:181608"
     gene            complement(567..1031)
                     /gene="asnC"
                     /locus_tag="Dda3937_00156"
                     /db_xref="GeneID:9731388"
     CDS             complement(567..1031)
                     /gene="asnC"
                     /locus_tag="Dda3937_00156"
                     /function="asnC regulates the expression of the genes
                     asnA, asnC and gidA involved in the synthesis of
                     asparagine"
                     /function="1.5.1.6 metabolism; building block
                     biosynthesis; amino acids; asparagine"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.2 regulation; genetic unit regulated;
                     regulon"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="asparagine is a repressor of the activator AsnC;
                     AsnC belongs to the AsnC family of transcriptional
                     regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional dual regulator"
                     /protein_id="YP_003880782.1"
                     /db_xref="GI:307128766"
                     /db_xref="ASAP:ABF-0014800"
                     /db_xref="ERIC:ABF-0014800"
                     /db_xref="GeneID:9731388"
                     /translation="MAADTYTMDELDRGILNALMENARTPYAELAKQFSVSPGTIHVR
                     VEKMKQAGIIVGTRLDVNPKQLGYDVCCFIGIILKSAKDYPSAVEKLSNLEEVVEAYY
                     TTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
     misc_feature    complement(570..1025)
                     /gene="asnC"
                     /locus_tag="Dda3937_00156"
                     /note="DNA-binding transcriptional regulator AsnC;
                     Provisional; Region: PRK11179"
                     /db_xref="CDD:183019"
     misc_feature    complement(<858..1007)
                     /gene="asnC"
                     /locus_tag="Dda3937_00156"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(858..866,882..887,891..896,903..908,
                     912..923,948..950,954..959,996..1004))
                     /gene="asnC"
                     /locus_tag="Dda3937_00156"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(945..947,957..959))
                     /gene="asnC"
                     /locus_tag="Dda3937_00156"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(597..812)
                     /gene="asnC"
                     /locus_tag="Dda3937_00156"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     gene            complement(1178..2653)
                     /gene="viaA"
                     /locus_tag="Dda3937_00157"
                     /gene_synonym="yieM"
                     /db_xref="GeneID:9731389"
     CDS             complement(1178..2653)
                     /gene="viaA"
                     /locus_tag="Dda3937_00157"
                     /gene_synonym="yieM"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor A"
                     /protein_id="YP_003880783.1"
                     /db_xref="GI:307128767"
                     /db_xref="ASAP:ABF-0014801"
                     /db_xref="ERIC:ABF-0014801"
                     /db_xref="GeneID:9731389"
                     /translation="MLTLESLEMLLSIDENDLLDDVIITLMATPQLMMFFDKYPRLKA
                     AVMRDLPEWKENLRQRLRNTQAPPELEKEFTCYQQTQLISDHTFQSNLPDIMSTLHNV
                     DSPFLNQAEKLVHSASHSSESRISSSQHSLFMQRWRLSLTLQTLNLHQQIMEQERDQL
                     LDEIQKRLTISGALEPILADNDTAAGRLWDLSASKRMKQPFNALLEVGAFLRQQPELQ
                     RLAERLGRSRETKSVLSQDAPKEAFQVMVREPAFAPEQVSGIHQSDDILRLLPTELST
                     LGISELEFEFYRRLSEHRLLTYRLQGESWREKTLERPVVHQHNEQQPRGPFIVCVDTS
                     GSMGGFNERCAKAFCLALMRIALADNRRCYIMLFSTGIVSYDLTSESGLEEAIRFLSQ
                     TFRGGTDLNSCLSALLEKMDSQSWQDADAVIISDFIAQRLPDELVNEVKRRQHRLQHR
                     FHAVAMSAHGKPGILRIFDHIWRFDTGLKSRLLRRFQHEKV"
     misc_feature    complement(1199..2605)
                     /gene="viaA"
                     /locus_tag="Dda3937_00157"
                     /gene_synonym="yieM"
                     /note="Uncharacterized protein containing a von Willebrand
                     factor type A (vWA) domain [General function prediction
                     only]; Region: COG2425"
                     /db_xref="CDD:225281"
     misc_feature    complement(1238..1681)
                     /gene="viaA"
                     /locus_tag="Dda3937_00157"
                     /gene_synonym="yieM"
                     /note="VWA YIEM type: Von Willebrand factor type A (vWA)
                     domain was originally found in the blood coagulation
                     protein von Willebrand factor (vWF). Typically, the vWA
                     domain is made up of approximately 200 amino acid residues
                     folded into a classic a/b...; Region: VWA_YIEM_type;
                     cd01462"
                     /db_xref="CDD:238739"
     misc_feature    complement(order(1376..1378,1460..1462,1646..1648,
                     1652..1654,1658..1660))
                     /gene="viaA"
                     /locus_tag="Dda3937_00157"
                     /gene_synonym="yieM"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238739"
     gene            complement(2659..4155)
                     /gene="ravA"
                     /locus_tag="Dda3937_00158"
                     /gene_synonym="yieN"
                     /db_xref="GeneID:9731390"
     CDS             complement(2659..4155)
                     /gene="ravA"
                     /locus_tag="Dda3937_00158"
                     /gene_synonym="yieN"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="YP_003880784.1"
                     /db_xref="GI:307128768"
                     /db_xref="ASAP:ABF-0014802"
                     /db_xref="ERIC:ABF-0014802"
                     /db_xref="GeneID:9731390"
                     /translation="MIQPTALADRISRLSHALEHGLYERQHAIRLCLLAALSGESVFL
                     LGPPGIAKSLIARRLKYAFRHARAFEYLMTRFSTPEEVFGPLSIQALKDEGRYQRLTT
                     GYLPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGNSEEPIPMRLLVTASNELPEA
                     DSSLEALYDRMLIRIWLDRVQDKHNFRAMLTASPGEQDNLVSPALSVSDEEYQQWQSH
                     IDHIPLPENCFELIYQLRQRLDSQDGSPYVSDRRWKKAIRLLQACAFFSGRETITPVD
                     LILLKDCLWHDLGTHDLVEQQLQQLMSEQAYQQRALLYRLQQLNVKRQQYQQQQSEQQ
                     AFRVERQVNFFGRKPHHTLPESLTSTELTLMLQKPLLLNDYTVTHVVLDREALAGWLQ
                     KGGEIRGKLNGVGFSQRLDMEVDERQHLIIRDISLQSTVLSLPGVLKGELPEEMLQEY
                     ETLKIQLREQRRLFERHQPCLFVPKEWLARIEESLQQVDEQIEQSQRE"
     misc_feature    complement(2662..4155)
                     /gene="ravA"
                     /locus_tag="Dda3937_00158"
                     /gene_synonym="yieN"
                     /note="regulatory ATPase RavA; Provisional; Region:
                     PRK13531"
                     /db_xref="CDD:184118"
     misc_feature    complement(3631..4089)
                     /gene="ravA"
                     /locus_tag="Dda3937_00158"
                     /gene_synonym="yieN"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(3997..4020)
                     /gene="ravA"
                     /locus_tag="Dda3937_00158"
                     /gene_synonym="yieN"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(3691..3693,3814..3816,3994..4017))
                     /gene="ravA"
                     /locus_tag="Dda3937_00158"
                     /gene_synonym="yieN"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(3811..3828)
                     /gene="ravA"
                     /locus_tag="Dda3937_00158"
                     /gene_synonym="yieN"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(3646..3648)
                     /gene="ravA"
                     /locus_tag="Dda3937_00158"
                     /gene_synonym="yieN"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(2668..2829)
                     /gene="ravA"
                     /locus_tag="Dda3937_00158"
                     /gene_synonym="yieN"
                     /note="Protein of unknown function (DUF3763); Region:
                     DUF3763; pfam12592"
                     /db_xref="CDD:193091"
     gene            4431..6299
                     /gene="trkD"
                     /locus_tag="Dda3937_00159"
                     /gene_synonym="kup"
                     /db_xref="GeneID:9731391"
     CDS             4431..6299
                     /gene="trkD"
                     /locus_tag="Dda3937_00159"
                     /gene_synonym="kup"
                     /function="4.2.A.72 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The K+ uptake permease (KUP) Family"
                     /function="5.5.1 cell processes; adaptation to stress;
                     osmotic pressure"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.96 transport; substrate; K+"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="YP_003880785.1"
                     /db_xref="GI:307128769"
                     /db_xref="ASAP:ABF-0014803"
                     /db_xref="ERIC:ABF-0014803"
                     /db_xref="GeneID:9731391"
                     /translation="MNSEHKRSLPAITLAAIGVVYGDIGTSPLYTLRECLSGQFGFGV
                     EPDSVFGFLSLIFWLLVLVVSLKYLSYVMRADNAGEGGILTLMSLAGRNTSDKVTAMV
                     VIMGLIGGSFFYGEVVITPAISVMSAIEGLDIVAPSLDTYIVPISIVVLTLLFMIQKH
                     GTGRVGSLFAPIMTVWFLSLGVLGARSIIANPEVLQALNPKWAINFFIQYKAVSFFAL
                     GAVVLAITGVEALYADMGHFGKLPIRIAWFSAVLPSLVLNYFGQGALLLKNPEAIKNP
                     FFLLAPDWALIPLLVLATLATIIASQAVISGVFSLTRQAVRLGYLPPMRIVHTSDMES
                     GQIYIPFINWLLYVAVVIVIVSFEHSSNLAAAYGIAVTGTMVLTSILSCTVAVKNWHW
                     YRHLVWLLLVALLAIDLPMFLANVVKIISGGWLPLALGMVMFTIMTTWKSERFRLLRR
                     IHEHGNSLDAMITSLEKNPPVRVTGTAVYLSRATHVIPFALLHNLKHNKVLHERVVLL
                     TMRTEDAPYVHNARRVSVEQLSPTFWRVVASYGWRETPNVEEVFHRCWQDGLTCQMME
                     TTFFLSNESLMMGNRPWYLRVRGKLFMMLSRNALRAADQFEIPPNRLIELGIQVEI"
     misc_feature    4431..6296
                     /gene="trkD"
                     /locus_tag="Dda3937_00159"
                     /gene_synonym="kup"
                     /note="potassium transport protein Kup; Provisional;
                     Region: trkD; PRK10745"
                     /db_xref="CDD:182693"
     gene            6696..7115
                     /gene="rbsD"
                     /locus_tag="Dda3937_02355"
                     /gene_synonym="rbsP"
                     /db_xref="GeneID:9731392"
     CDS             6696..7115
                     /gene="rbsD"
                     /locus_tag="Dda3937_02355"
                     /gene_synonym="rbsP"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.48 transport; substrate; D-ribose"
                     /note="end of contig51"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter"
                     /protein_id="YP_003880786.1"
                     /db_xref="GI:307128770"
                     /db_xref="ASAP:ABF-0018135"
                     /db_xref="ERIC:ABF-0018135"
                     /db_xref="GeneID:9731392"
                     /translation="MKKGALLNSDISSVISRLGHTDQIVIADAGLPIPETTTRIDLAL
                     THNVPGFLQVLNVVTAEMQVEAAILAQEIIEKNTQLHDALLKQLAQLEQHQGNTISLH
                     YVSHEDFKKQSGQSRAIIRTGECSPYANVILCAGVTF"
     misc_feature    6696..7112
                     /gene="rbsD"
                     /locus_tag="Dda3937_02355"
                     /gene_synonym="rbsP"
                     /note="D-ribose pyranase; Provisional; Region: PRK11797"
                     /db_xref="CDD:183318"
     gene            7123..8628
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /db_xref="GeneID:9731393"
     CDS             7123..8628
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /function="4.3.A.1.am transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, ATP binding and membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose ABC transporter ATP-binding protein"
                     /protein_id="YP_003880787.1"
                     /db_xref="GI:307128771"
                     /db_xref="ASAP:ABF-0018137"
                     /db_xref="ERIC:ABF-0018137"
                     /db_xref="GeneID:9731393"
                     /translation="MQPLLQLQGITKTFPGVKALSGAALNVYPGKVMALVGENGAGKS
                     TMMKVLTGIYRKDAGSIHFLGKDVDFSGPKASQEAGIGIIHQELNLIPQLTIAENIFL
                     GREFTNRLGRIDWKQMYAEADKLLKRLNLRYDSRRLVGELSIGDQQMVEIAKVLSFES
                     RVIIMDEPTDALTDTETASLFSVIKELQSQGCGIVYISHRLKEIFEICDDVTVFRDGQ
                     FIGERPVSELQEDSLIEMMVGRKLEDQYPRLNQAPGEVRLQVSELSGPGVENVSFTLR
                     KGEILGVAGLMGAGRTELMKVLYGALPRTHGKVHLDGKDVVTRSPQDGLASGIVYISE
                     DRKHDGLVLGMSVKENMSLTALRYFSNAAGSLRHGDEQQAVNDFIRMFNIRTPSMSQP
                     IGLLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFKQEGLSIIL
                     VSSEMPEVLGMSDRIIVMHEGRLSGEFPIEQATQETLMAAAVGKQYGVKQE"
     misc_feature    7123..8625
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /note="D-ribose transporter ATP binding protein;
                     Provisional; Region: PRK10762"
                     /db_xref="CDD:236755"
     misc_feature    7135..7788
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    7231..7254
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(7240..7245,7249..7257,7378..7380,7618..7623,
                     7717..7719)
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    7369..7380
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    7546..7575
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    7606..7623
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    7630..7641
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    7705..7725
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    7882..8541
                     /gene="rbsA"
                     /locus_tag="Dda3937_02356"
                     /gene_synonym="rbsP; rbsT"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            8636..9604
                     /gene="rbsC"
                     /locus_tag="Dda3937_02357"
                     /gene_synonym="rbsP; rbsT"
                     /db_xref="GeneID:9731394"
     CDS             8636..9604
                     /gene="rbsC"
                     /locus_tag="Dda3937_02357"
                     /gene_synonym="rbsP; rbsT"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.48 transport; substrate; D-ribose"
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose ABC transporter permease"
                     /protein_id="YP_003880788.1"
                     /db_xref="GI:307128772"
                     /db_xref="ASAP:ABF-0018138"
                     /db_xref="ERIC:ABF-0018138"
                     /db_xref="GeneID:9731394"
                     /translation="MSSQTITAKRWLSKEWLMEQKSLIALLILIAVVSSMSPNFFTLN
                     NLFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASIVGLEINALVAVF
                     AALALGAVIGAGTGIVIAKGRVQAFIATLVMMLLLRGVTMVYTNGSPINTGFSDSADA
                     LGWFGIGRPLGIPTPIWIMAVVFLATWYMLHHTRIGRYIYALGGNEAATRLSGISVDR
                     VKVVVYALCGLLSALAGIIEVARLSSAQPTAGTGYELDAIAAVVLGGTSLSGGKGRVV
                     GTLIGALILGFLNNGLNLLGVSSYYQMIVKAVVILLAVLVDNKGSK"
     misc_feature    8792..9586
                     /gene="rbsC"
                     /locus_tag="Dda3937_02357"
                     /gene_synonym="rbsP; rbsT"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    9254..9310
                     /gene="rbsC"
                     /locus_tag="Dda3937_02357"
                     /gene_synonym="rbsP; rbsT"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            9631..10518
                     /gene="rbsB"
                     /locus_tag="Dda3937_02358"
                     /gene_synonym="prlB; rbsP"
                     /db_xref="GeneID:9731395"
     CDS             9631..10518
                     /gene="rbsB"
                     /locus_tag="Dda3937_02358"
                     /gene_synonym="prlB; rbsP"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="4.S.48 transport; substrate; D-ribose"
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_003880789.1"
                     /db_xref="GI:307128773"
                     /db_xref="ASAP:ABF-0018139"
                     /db_xref="ERIC:ABF-0018139"
                     /db_xref="GeneID:9731395"
                     /translation="MNLKKIATLVSAVALSAAVSTNALAKDTIALVVSTLNNPFFVSL
                     KDGAQKEADKLGYNLVILDSQNNPAKELSNVQDLTVRGTKLLLINPTDSNAVGNAVKL
                     ANQAKIPVITLDRVAASGEVVSHVASDNAFGGKVAGDFIAKKLGEGAKVIQLEGLAGT
                     SAARERGAGFMKSAEKNKFAMLASQPADFDRTKGLNVMQNLLTAHPDVKAVFAQNDEM
                     ALGALRALQTAGRDDVLVVGFDGTADGVKAVEGGKLAATVAQRPEQIGIIGVETADKV
                     LKGEKVQPIIPVDLKLVTK"
     misc_feature    9631..10515
                     /gene="rbsB"
                     /locus_tag="Dda3937_02358"
                     /gene_synonym="prlB; rbsP"
                     /note="D-ribose transporter subunit RbsB; Provisional;
                     Region: PRK10653"
                     /db_xref="CDD:182620"
     misc_feature    9712..10512
                     /gene="rbsB"
                     /locus_tag="Dda3937_02358"
                     /gene_synonym="prlB; rbsP"
                     /note="Periplasmic sugar-binding domain of the
                     thermophilic Thermoanaerobacter tengcongensis ribose
                     binding protein (ttRBP) and its mesophilic homologs;
                     Region: PBP1_ribose_binding; cd06323"
                     /db_xref="CDD:107318"
     misc_feature    order(9742..9744,9748..9753,9895..9897,9970..9975,
                     10114..10116,10126..10128,10195..10197,10273..10275,
                     10348..10350,10408..10410)
                     /gene="rbsB"
                     /locus_tag="Dda3937_02358"
                     /gene_synonym="prlB; rbsP"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107318"
     misc_feature    order(10120..10122,10132..10134,10168..10173,10180..10185,
                     10237..10239)
                     /gene="rbsB"
                     /locus_tag="Dda3937_02358"
                     /gene_synonym="prlB; rbsP"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107318"
     gene            10604..11530
                     /gene="rbsK"
                     /locus_tag="Dda3937_02359"
                     /db_xref="GeneID:9731396"
     CDS             10604..11530
                     /gene="rbsK"
                     /locus_tag="Dda3937_02359"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="YP_003880790.1"
                     /db_xref="GI:307128774"
                     /db_xref="ASAP:ABF-0018141"
                     /db_xref="ERIC:ABF-0018141"
                     /db_xref="GeneID:9731396"
                     /translation="MKSGKLVVLGSINADHILNLAQFPRPGETVIGKQYGVAFGGKGA
                     NQAVAAGRSGADIEFIACVGADDIGERIRQQLIKDRIDVSAVEAISGQTTGVALIFVN
                     GEAENMIGIHAGANAAVTPDYLNRYQQKIIDASALLMQLESPLETVTAAARLAHDHGT
                     KVILNPAPACSLPDELLSLVDMITPNETEAQILTGVAVETEDDAQRAAQVLHDKGIAT
                     VLITLGSRGVWLSEQGKGQRIPGFRVKAVDTIAAGDTFNGALVTALLESRPMEAAVKF
                     AHAAAAIAVTRHGAQPSVPWREEIDAFLNAQE"
     misc_feature    10616..11491
                     /gene="rbsK"
                     /locus_tag="Dda3937_02359"
                     /note="Ribokinase catalyses the phosphorylation of ribose
                     to ribose-5-phosphate using ATP. This reaction is the
                     first step in the ribose metabolism. It traps ribose
                     within the cell after uptake and also prepares the sugar
                     for use in the synthesis of nucleotides...; Region:
                     ribokinase; cd01174"
                     /db_xref="CDD:238579"
     misc_feature    order(10640..10642,10646..10648,10721..10729,10736..10738,
                     10892..10894,10898..10900,10928..10930,10934..10936,
                     11027..11029,11351..11356,11363..11365,11471..11473)
                     /gene="rbsK"
                     /locus_tag="Dda3937_02359"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238579"
     misc_feature    order(10649..10651,10655..10657,10670..10690,10727..10729,
                     10889..10891,10895..10903,10919..10942,11105..11107)
                     /gene="rbsK"
                     /locus_tag="Dda3937_02359"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238579"
     misc_feature    order(11159..11161,11267..11275,11282..11284,11321..11323,
                     11339..11341,11348..11350,11357..11362,11369..11371,
                     11435..11437,11444..11449,11456..11458)
                     /gene="rbsK"
                     /locus_tag="Dda3937_02359"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238579"
     gene            11534..12538
                     /gene="rbsR"
                     /locus_tag="Dda3937_02360"
                     /db_xref="GeneID:9731397"
     CDS             11534..12538
                     /gene="rbsR"
                     /locus_tag="Dda3937_02360"
                     /function="RbsR controls the expression of genes involved
                     in ribose catabolism"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="The inducer for rbsR is ribose;
                     RbsR belongs to the LacI family of transcriptional
                     regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose operon repressor"
                     /protein_id="YP_003880791.1"
                     /db_xref="GI:307128775"
                     /db_xref="ASAP:ABF-0018142"
                     /db_xref="ERIC:ABF-0018142"
                     /db_xref="GeneID:9731397"
                     /translation="MATMKDVARLAGVSTSTVSHVINNNRYVSDAIRDRVMKAVEELN
                     YAPSALARSLKINQTRTIGMLLTASSNPFYAEVVRGVERCCYERGYSLILCNTEGDHH
                     RLSRSLETLLQKRVDGLLLMCTESHMPSPDIIRRYPSIPVVMMDWAPFEGSSDVIKDN
                     SLQGGEMATHYLISQGYRNIACIAGPQDKTTAHNRLEGYRKAMYQAGLPILPGYEVVG
                     DFEFETGFRAMQQLLALPERPDAVFTSNDAMAVGVYRALHDAGLSIPDDMAVVGYDDI
                     ELARYLSPPLTTIHQPKDELGELAIDTLLHRLEHPDTEHNVLVLTPELIVRDSVGKRS
                     "
     misc_feature    11543..12523
                     /gene="rbsR"
                     /locus_tag="Dda3937_02360"
                     /note="transcriptional repressor RbsR; Provisional;
                     Region: PRK10423"
                     /db_xref="CDD:182448"
     misc_feature    11546..11698
                     /gene="rbsR"
                     /locus_tag="Dda3937_02360"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(11546..11548,11570..11584,11588..11593,11600..11602,
                     11615..11620,11627..11629,11666..11668,11675..11677,
                     11684..11689,11693..11698)
                     /gene="rbsR"
                     /locus_tag="Dda3937_02360"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    11666..11695
                     /gene="rbsR"
                     /locus_tag="Dda3937_02360"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    11714..12520
                     /gene="rbsR"
                     /locus_tag="Dda3937_02360"
                     /note="Ligand-binding domain of purine repressor, PurR,
                     which functions as the master regulatory protein of de
                     novo purine nucleotide biosynthesis in Escherichia coli;
                     Region: PBP1_PurR; cd06275"
                     /db_xref="CDD:107270"
     misc_feature    order(11741..11743,11789..11791,11801..11803,11807..11815,
                     11852..11854,11873..11875,12200..12202,12284..12286,
                     12296..12298,12308..12310,12365..12367,12371..12376,
                     12515..12517)
                     /gene="rbsR"
                     /locus_tag="Dda3937_02360"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107270"
     misc_feature    order(11750..11752,12098..12100,12104..12106,12116..12118,
                     12191..12193,12353..12355)
                     /gene="rbsR"
                     /locus_tag="Dda3937_02360"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107270"
     gene            12976..14517
                     /locus_tag="Dda3937_04660"
                     /db_xref="GeneID:9731398"
     rRNA            12976..14517
                     /locus_tag="Dda3937_04660"
                     /product="16S ribosomal RNA"
                     /function="2.2.6 information transfer; RNA related; rRNA,
                     stable RNA"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /db_xref="ASAP:ABF-0047228"
                     /db_xref="ERIC:ABF-0047228"
                     /db_xref="GeneID:9731398"
     gene            14604..14679
                     /locus_tag="Dda3937_04671"
                     /db_xref="GeneID:9731399"
     tRNA            14604..14679
                     /locus_tag="Dda3937_04671"
                     /product="tRNA-Glu"
                     /note="anticodon TTC, Cove score 59.80"
                     /db_xref="ASAP:ABF-0047290"
                     /db_xref="ERIC:ABF-0047290"
                     /db_xref="GeneID:9731399"
     gene            14874..17781
                     /locus_tag="Dda3937_04661"
                     /db_xref="GeneID:9731400"
     rRNA            14874..17781
                     /locus_tag="Dda3937_04661"
                     /product="23S ribosomal RNA"
                     /function="2.2.6 information transfer; RNA related; rRNA,
                     stable RNA"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /db_xref="ASAP:ABF-0047229"
                     /db_xref="ERIC:ABF-0047229"
                     /db_xref="GeneID:9731400"
     gene            17888..18007
                     /locus_tag="Dda3937_04662"
                     /db_xref="GeneID:9731401"
     rRNA            17888..18007
                     /locus_tag="Dda3937_04662"
                     /product="5S ribosomal RNA"
                     /function="2.2.6 information transfer; RNA related; rRNA,
                     stable RNA"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /db_xref="ASAP:ABF-0047230"
                     /db_xref="ERIC:ABF-0047230"
                     /db_xref="GeneID:9731401"
     gene            complement(18263..18790)
                     /gene="mobB"
                     /locus_tag="Dda3937_01107"
                     /db_xref="GeneID:9731402"
     CDS             complement(18263..18790)
                     /gene="mobB"
                     /locus_tag="Dda3937_01107"
                     /function="1.5.3.4 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier;
                     molybdenum"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobB"
                     /protein_id="YP_003880792.1"
                     /db_xref="GI:307128776"
                     /db_xref="ASAP:ABF-0016291"
                     /db_xref="ERIC:ABF-0016291"
                     /db_xref="GeneID:9731402"
                     /translation="MTEIPLLAITAHSGTGKTTLLKQLIPLLNAMGIRVGIIKHTHHD
                     MDVDKPGKDSYELRKAGADQTLVASNTRWALMTETPEQQEPDLYFLASRMDSSKLDLI
                     LVEGFKHEPVDKILLYRCGSGRDIAALIDADTLAVATDTALTLALPCLDLNQPAQIAA
                     FIRDWLRRRTGAAGD"
     misc_feature    complement(18305..18781)
                     /gene="mobB"
                     /locus_tag="Dda3937_01107"
                     /note="Molybdenum is an essential trace element in the
                     form of molybdenum cofactor (Moco) which is associated
                     with the metabolism of nitrogen, carbon and sulfur by
                     redox active enzymes. In E. coli, the synthesis of Moco
                     involves genes from several loci: moa; Region: MobB;
                     cd03116"
                     /db_xref="CDD:239390"
     misc_feature    complement(order(18737..18745,18758..18760))
                     /gene="mobB"
                     /locus_tag="Dda3937_01107"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:239390"
     gene            complement(18783..19373)
                     /gene="mobA"
                     /locus_tag="Dda3937_01108"
                     /db_xref="GeneID:9731403"
     CDS             complement(18783..19373)
                     /gene="mobA"
                     /locus_tag="Dda3937_01108"
                     /function="1.5.3.4 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier;
                     molybdenum"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobA"
                     /protein_id="YP_003880793.1"
                     /db_xref="GI:307128777"
                     /db_xref="ASAP:ABF-0016292"
                     /db_xref="ERIC:ABF-0016292"
                     /db_xref="GeneID:9731403"
                     /translation="MDANTMITGVILAGGQSSRMGGNDKGLIELEGKPLYQHVLDRLK
                     PQVDTLLINANRHQERYQQSGYPVIGDINRNFSGPLAGIFTGLSLAKTDWVVFVPCDV
                     PALPVDLVSRLLPLNDNYLAAYATDGSREHPTLLAIHTSLIGKLEAYLSNGDRKLMLF
                     LEQIGAKAVSFADQPLSFRNLNTPEDLARWQEPHHD"
     misc_feature    complement(18813..19355)
                     /gene="mobA"
                     /locus_tag="Dda3937_01108"
                     /note="MobA catalyzes the formation of molybdopterin
                     guanine dinucleotide; Region: MobA; cd02503"
                     /db_xref="CDD:133000"
     misc_feature    complement(order(19071..19073,19077..19079,19128..19130,
                     19137..19142,19161..19163,19215..19217,19299..19301,
                     19326..19328,19332..19340))
                     /gene="mobA"
                     /locus_tag="Dda3937_01108"
                     /note="GTP binding site; other site"
                     /db_xref="CDD:133000"
     gene            19469..19738
                     /gene="yihD"
                     /locus_tag="Dda3937_01109"
                     /db_xref="GeneID:9731404"
     CDS             19469..19738
                     /gene="yihD"
                     /locus_tag="Dda3937_01109"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880794.1"
                     /db_xref="GI:307128778"
                     /db_xref="ASAP:ABF-0016293"
                     /db_xref="ERIC:ABF-0016293"
                     /db_xref="GeneID:9731404"
                     /translation="MKCHRLNELIELLHPAWQKEPDLNLVQFLQKLAQEAGFKGALSD
                     LTDDILIYHLKLRDADSAQPIPGLQKDYEEDFKTALLRARGVIKD"
     misc_feature    19469..19726
                     /gene="yihD"
                     /locus_tag="Dda3937_01109"
                     /note="Protein of unknown function (DUF1040); Region:
                     DUF1040; pfam06288"
                     /db_xref="CDD:148100"
     gene            19780..20766
                     /gene="rdoA"
                     /locus_tag="Dda3937_01110"
                     /gene_synonym="yihE"
                     /db_xref="GeneID:9731405"
     CDS             19780..20766
                     /gene="rdoA"
                     /locus_tag="Dda3937_01110"
                     /gene_synonym="yihE"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of disulfide oxidoreductase A"
                     /protein_id="YP_003880795.1"
                     /db_xref="GI:307128779"
                     /db_xref="ASAP:ABF-0016294"
                     /db_xref="ERIC:ABF-0016294"
                     /db_xref="GeneID:9731405"
                     /translation="MHDSVFNFHTLSPDVVMDALWSVDIRVDSGLTALNSYENRVYQF
                     SDEERKRYVVKFYRPQRWNAAQISEEHHFAAELFDDEVPVVAPLALQGSTLHEHDGFW
                     FAVFPSVGGRQYEMDNDDQLEEVGRYLGRIHQTGSRNLFSTRPTIGLLEYLDDPLVTL
                     TDSSLISDAQKAPFLTVTTRLIDEVKQHWNTHWQARRLHGDCHPGNILWRDGPLFVDL
                     DDARNGPAVQDLWMLLHGDRQEQRIQLDILLDAYSEFASFDEAELALIEPLRAMRMVH
                     YLAWVARRWHDPAFPRSFPWMQEADFWAKQATIFTEQVRLLQEPPLQLTPMY"
     misc_feature    19780..20751
                     /gene="rdoA"
                     /locus_tag="Dda3937_01110"
                     /gene_synonym="yihE"
                     /note="serine/threonine protein kinase; Provisional;
                     Region: PRK11768"
                     /db_xref="CDD:236974"
     misc_feature    19888..20547
                     /gene="rdoA"
                     /locus_tag="Dda3937_01110"
                     /gene_synonym="yihE"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     gene            20789..21412
                     /gene="dsbA"
                     /locus_tag="Dda3937_01111"
                     /gene_synonym="iarA; ppfA"
                     /db_xref="GeneID:9731406"
     CDS             20789..21412
                     /gene="dsbA"
                     /locus_tag="Dda3937_01111"
                     /gene_synonym="iarA; ppfA"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /function="2.3.4 information transfer; protein related;
                     chaperoning, folding"
                     /function="5.5 cell processes; adaptation to stress"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /codon_start=1
                     /transl_table=11
                     /product="protein disulfide isomerase I"
                     /protein_id="YP_003880796.1"
                     /db_xref="GI:307128780"
                     /db_xref="ASAP:ABF-0016295"
                     /db_xref="ERIC:ABF-0016295"
                     /db_xref="GeneID:9731406"
                     /translation="MKKLWLALAGMVLAFSASAADFSDGKQYATLDKPVPQSPQVLEF
                     FSFYCPHCYQFAQVYHIPDAIQKALPADAKLTKYHVDFLGELGKELTQAWAVAIALGV
                     EDKVSPLMFDAVQKTQTVKQPQDIRQVFVAAGVKAEDYDSALNSFVVKSLVAQQEKAA
                     ADLQLRGVPAVFVNGKYMIKSDGLDTSSMDNYVKQYADVVKFLLSQK"
     misc_feature    20858..21394
                     /gene="dsbA"
                     /locus_tag="Dda3937_01111"
                     /gene_synonym="iarA; ppfA"
                     /note="DsbA family, DsbA subfamily; DsbA is a monomeric
                     thiol disulfide oxidoreductase protein containing a redox
                     active CXXC motif imbedded in a TRX fold. It is involved
                     in the oxidative protein folding pathway in prokaryotes,
                     and is the strongest thiol...; Region: DsbA_DsbA; cd03019"
                     /db_xref="CDD:239317"
     misc_feature    order(20933..20935,20939..20944,21293..21295)
                     /gene="dsbA"
                     /locus_tag="Dda3937_01111"
                     /gene_synonym="iarA; ppfA"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239317"
     misc_feature    21032..21040
                     /gene="dsbA"
                     /locus_tag="Dda3937_01111"
                     /gene_synonym="iarA; ppfA"
                     /note="hinge region; other site"
                     /db_xref="CDD:239317"
     misc_feature    order(21053..21079,21092..21148,21158..21184,21200..21229)
                     /gene="dsbA"
                     /locus_tag="Dda3937_01111"
                     /gene_synonym="iarA; ppfA"
                     /note="alpha helical domain; other site"
                     /db_xref="CDD:239317"
     gene            21791..24625
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /db_xref="GeneID:9731407"
     CDS             21791..24625
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="YP_003880797.1"
                     /db_xref="GI:307128781"
                     /db_xref="ASAP:ABF-0016297"
                     /db_xref="ERIC:ABF-0016297"
                     /db_xref="GeneID:9731407"
                     /translation="MVQIAENPLILVDGSSYLYRAYHAFPPLTNGAGEPTGAMYGVLN
                     MLRSLLQQYHPSHVAVVFDAKGKTFRDDLFEHYKSHRPPMPDDLRAQIEPLHRMVKAM
                     GLPLLSVSGVEADDVIGTLAQQAERAGKPVLISTGDKDMAQLVTPNITLINTMNNTIL
                     GPDEVCAKYGIPPSLIIDFLALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDTLYADL
                     DKIASLTFRGAKTMAAKLEQNKELAYLSYQLATIKTDVELELGCEQLTVNEPDVAELH
                     ELFTRYEFKRWLADVEDGKWLQGGRKSQPAVPFVKATVEATPKEAASVLSQDGYVTIL
                     DEKVLLDWLERIKTAALFSFDTETDGLDTLTANLVGVSLAIKPGEAAYLPLGHITSRV
                     YSSNIYSSTVSPATRMSTQLDRDRVLALLKPLLEDDGIRKIGQNLKFDKGVMARYGID
                     LRGIAFDTMLESYVLDSVAGRHDMDSLSERYLQHKTITFEEIAGKGKNQLTFDQIPLA
                     QASVYAAEDADVTLRLHETLWAKLEPQQELRKVFQNIDMPLVPVLSRIERTGVLIDTT
                     ILAEHSRELTQRLAELEVQAHELAGEAFNLSSPKQLGAILYEKLQLPVIKKTPKGAPS
                     TNEEVLAELALDYPLPKLILEHRGLAKLKSTYTDKLPQMINPLTRRVHTSYHQAVTAT
                     GRLSSSDPNLQNIPVRNEEGRRIRQAFIAPEGYRILAADYSQIELRIMAHLSRDAGLL
                     RAFSHGLDIHRATAAEVFGLPLDRVTTEQRRSAKAINFGLIYGMSAFGLSRQLAIPRS
                     EAQKYMNLYFERYPGVQEYMERTRQQAVDQGYVSTLDGRRLYLPDIHSRNVNSRKAAE
                     RAAINAPMQGTAADIIKKAMIAIDAWLRQEKPLVTMLMQVHDELVFEVHHSVLDEASA
                     KIRNLMEGCMQLDVPLQVDIGTGSNWDQAH"
     misc_feature    21806..24622
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="DNA polymerase I; Provisional; Region: PRK05755"
                     /db_xref="CDD:235591"
     misc_feature    21815..22285
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="PIN domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: PIN_53EXO; cd09859"
                     /db_xref="CDD:189029"
     misc_feature    order(21827..21829,21977..21979,22127..22129,22133..22138,
                     22202..22204,22208..22210)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="active site"
                     /db_xref="CDD:189029"
     misc_feature    order(21827..21829,22133..22135,22202..22204)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    21995..22033
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="putative 5' ssDNA interaction site; other site"
                     /db_xref="CDD:189029"
     misc_feature    order(22127..22129,22136..22138)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="metal binding site 3; metal-binding site"
                     /db_xref="CDD:189029"
     misc_feature    order(22202..22204,22208..22210)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    22307..22546
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="H3TH domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: H3TH_53EXO; cd09898"
                     /db_xref="CDD:188618"
     misc_feature    order(22337..22360,22364..22393,22397..22408)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:188618"
     misc_feature    order(22343..22345,22352..22354)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:188618"
     misc_feature    22823..23455
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="DEDDy 3'-5' exonuclease domain of Escherichia coli
                     DNA polymerase I and similar bacterial family-A DNA
                     polymerases; Region: DNA_polA_I_Ecoli_like_exo; cd06139"
                     /db_xref="CDD:176651"
     misc_feature    order(22853..22864,22871..22873,23093..23098,23102..23110,
                     23207..23212,23255..23260,23327..23329,23339..23341)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="active site"
                     /db_xref="CDD:176651"
     misc_feature    order(22853..22855,22859..22861,23108..23110,23327..23329,
                     23339..23341)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176651"
     misc_feature    order(22856..22864,22871..22873,23093..23098,23102..23107,
                     23207..23212,23255..23260,23327..23329,23339..23341)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176651"
     misc_feature    23480..24613
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="Polymerase I functions primarily to fill DNA gaps
                     that arise during DNA repair, recombination and
                     replication; Region: DNA_pol_A_pol_I_C; cd08637"
                     /db_xref="CDD:176474"
     misc_feature    order(23729..23731,23741..23743,23750..23755,23828..23836,
                     23840..23842,23846..23857,23951..23956,24038..24040,
                     24098..24100,24110..24112,24362..24364,24383..24385,
                     24476..24484)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="active site"
                     /db_xref="CDD:176474"
     misc_feature    order(23729..23731,23741..23743,23750..23755,23828..23836,
                     23840..23842,23846..23857,24134..24136,24359..24364,
                     24371..24373,24383..24385,24476..24484)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176474"
     misc_feature    order(23951..23956,23960..23962,24038..24040,24098..24100,
                     24110..24112,24482..24484)
                     /gene="polA"
                     /locus_tag="Dda3937_01112"
                     /gene_synonym="resA"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176474"
     gene            24873..24981
                     /gene="spf"
                     /locus_tag="Dda3937_04680"
                     /db_xref="GeneID:9731408"
     ncRNA           24873..24981
                     /gene="spf"
                     /locus_tag="Dda3937_04680"
                     /ncRNA_class="antisense_RNA"
                     /product="Spot 42 RNA"
                     /note="secondary structure conserved; genome context
                     conserved;
                     match to Rfam Spot_42 (RF00021) with bit score = 42.62;
                     Rfam sequence is longer (includes conserved flanking
                     sequence)"
                     /function="antisense regulator of galK translation"
                     /db_xref="ASAP:ABF-0061314"
                     /db_xref="ERIC:ABF-0061314"
                     /db_xref="GeneID:9731408"
     gene            complement(25090..25917)
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /db_xref="GeneID:9731409"
     CDS             complement(25090..25917)
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /function="5.1 cell processes; cell division"
                     /function="5.2 cell processes; cell cycle physiology"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="YP_003880798.1"
                     /db_xref="GI:307128782"
                     /db_xref="ASAP:ABF-0016300"
                     /db_xref="ERIC:ABF-0016300"
                     /db_xref="GeneID:9731409"
                     /translation="MRRNLAESIPIKKCSKSSVLVLFFQSVKTVTPRQKQINSAFLIG
                     CRYNQPHNTVIQIETQTVTQQYNYHVTHFVTSAPDIRHLPADSGIEVAFAGRSNAGKS
                     SALNTLTNQKSLARTSKTPGRTQLINLFEVADGVRLVDLPGYGYAEVPEEMKRKWQRA
                     LGEYLQKRDCLKGLVVLMDIRHPLKDLDQQMLEWAVDVGLPVLVLLTKADKLAQGARK
                     SQLNMVREAVLPFMGDIQVEAFSSLKKTGVDKLRQKLDSWFSTLPSAELQSQPESDL"
     misc_feature    complement(25129..25719)
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /note="Predicted GTPase [General function prediction
                     only]; Region: COG0218"
                     /db_xref="CDD:223296"
     misc_feature    complement(25141..25650)
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /note="YihA (EngB) GTPase family; Region: YihA_EngB;
                     cd01876"
                     /db_xref="CDD:206665"
     misc_feature    complement(25612..25635)
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /note="G1 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(order(25192..25197,25288..25290,25294..25296,
                     25498..25500,25546..25554,25561..25569,25609..25629))
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206665"
     misc_feature    complement(25537..25557)
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(25546..25548)
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /note="G2 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(25489..25500)
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /note="G3 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(order(25405..25410,25417..25461,25480..25491))
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(25288..25299)
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /note="G4 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(25189..25197)
                     /gene="yihA"
                     /locus_tag="Dda3937_01113"
                     /gene_synonym="engB"
                     /note="G5 box; other site"
                     /db_xref="CDD:206665"
     gene            25958..26491
                     /gene="yihI"
                     /locus_tag="Dda3937_01114"
                     /db_xref="GeneID:9731410"
     CDS             25958..26491
                     /gene="yihI"
                     /locus_tag="Dda3937_01114"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880799.1"
                     /db_xref="GI:307128783"
                     /db_xref="ASAP:ABF-0016301"
                     /db_xref="ERIC:ABF-0016301"
                     /db_xref="GeneID:9731410"
                     /translation="MKQPSKGAERKASAPKIKRKSREQLDLEARDRKRQKKHRGHAAG
                     SRAQPSGDHQQNAASGKAKDPRIGSKKPVSLLPEGTTVAVKAPVPAAEKPVRQSPQDE
                     LEMLENDPRLDALLDRLEKGETLSAKEQSWLDETLDRIDILMEQLGISLDDDEEDEEQ
                     EEDMLQLLRRGNPKDGY"
     misc_feature    25961..26482
                     /gene="yihI"
                     /locus_tag="Dda3937_01114"
                     /note="Der GTPase activator; Provisional; Region:
                     PRK05244"
                     /db_xref="CDD:235370"
     gene            26673..28046
                     /gene="hemN"
                     /locus_tag="Dda3937_01115"
                     /db_xref="GeneID:9731411"
     CDS             26673..28046
                     /gene="hemN"
                     /locus_tag="Dda3937_01115"
                     /function="1.5.3.12 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; heme,
                     porphyrine"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase, SAM and NAD(P)H
                     dependent, oxygen-independent"
                     /protein_id="YP_003880800.1"
                     /db_xref="GI:307128784"
                     /db_xref="ASAP:ABF-0016303"
                     /db_xref="ERIC:ABF-0016303"
                     /db_xref="GeneID:9731411"
                     /translation="MPEQTIDWDLSLIQKYNYSGPRYTSYPTALEFSDSYDNAAFAQA
                     VARYPNRPLSLYLHIPFCHRLCYFCGCNKLVTRQLHKADEYLDRLALEIRQRAPLFAG
                     RVVTQMHWGGGTPTFLNKTQISRLMGLLRQYFHFAEQAEMSLEVDPREIELDVLDHLR
                     AEGFNRLSMGVQDFNKEVQRLVNREQDEAFIFALIERAKALGFASTNIDLIYGLPKQT
                     PDSFAFTLQRVAALRPDRLSVFNYAHLPSLFAAQRKIKEADLPDAEQKLAILQQTIQS
                     LTAAGYQFIGMDHFARPDDELAVAQREGKLHRNFQGYTTQGDTDLLGLGVSAISMIGD
                     SYAQNQKELKQYYADVEQHGHALWRGLALTRDDCLRRDVIKALICHFQLEFAAIERAY
                     GLSFGEYFREDLALLAPMAQDGLVDILPDRIQVTPKGRLLIRNICMCFDVYLRSKMRE
                     RQFSRVI"
     misc_feature    26682..28043
                     /gene="hemN"
                     /locus_tag="Dda3937_01115"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK09249"
                     /db_xref="CDD:236430"
     misc_feature    26856..27413
                     /gene="hemN"
                     /locus_tag="Dda3937_01115"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(26856..26858,26862..26864,26868..26870,26874..26882,
                     27003..27005,27009..27014,27105..27113,27180..27182,
                     27303..27305,27393..27398)
                     /gene="hemN"
                     /locus_tag="Dda3937_01115"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    27759..27965
                     /gene="hemN"
                     /locus_tag="Dda3937_01115"
                     /note="HemN C-terminal domain; Region: HemN_C; pfam06969"
                     /db_xref="CDD:253997"
     gene            complement(28390..29802)
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /db_xref="GeneID:9731412"
     CDS             complement(28390..29802)
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /function="GlnG is involved in the activation of nitrogen
                     assimilatory genes such as glnA , argT, hisY, nagP,
                     nifL..."
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="1.5.1.2 metabolism; building block
                     biosynthesis; amino acids; glutamine"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="GlnG is phosphorylated by the sensor-histidine
                     kinase GlnL in response to ammonia availability"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(I)"
                     /protein_id="YP_003880801.1"
                     /db_xref="GI:307128785"
                     /db_xref="ASAP:ABF-0016307"
                     /db_xref="ERIC:ABF-0016307"
                     /db_xref="GeneID:9731412"
                     /translation="MQRGIVWIVDDDSSIRWVLERALTGAGLTCATFDNGTQALNALT
                     TQTPDVLLSDIRMPGMDGLALLQQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYL
                     PKPFDIDEAVALVERAISHYMEQQQPVRSQPISGPTTDIIGEAPAMQDVFRIIGRLSR
                     SSISVLINGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAF
                     TGANQIRQGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAAVKVDVR
                     IIAATHQNLELRVQEGKFREDLFHRLNVIRVHLPPLRERREDIPRLARYFLQATAREL
                     GVEPKNLHPETEAALTRLPWPGNVRQLENTCRWLTVMAAGQEVLIQDLPPELFETTAP
                     DATVHVMPDSWATLLAQWADRALRSGHQNLLAEAQPEMERTLLTTALRHTQGHKQEAA
                     RLLGWGRNTLTRKLKELGME"
     misc_feature    complement(28393..29802)
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="nitrogen regulation protein NR(I); Provisional;
                     Region: glnG; PRK10923"
                     /db_xref="CDD:182842"
     misc_feature    complement(29446..29781)
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(29488..29493,29500..29502,29557..29559,
                     29617..29619,29641..29643,29770..29775))
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(29641..29643)
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(29617..29625,29629..29634))
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(29485..29493)
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(28870..29379)
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(29275..29298)
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(28957..28959,29083..29085,29272..29295))
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(29080..29097)
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(28900..28902)
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(28402..28521)
                     /gene="glnG"
                     /locus_tag="Dda3937_01116"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(29811..30860)
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /db_xref="GeneID:9731413"
     CDS             complement(29811..30860)
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="1.5.1.2 metabolism; building block
                     biosynthesis; amino acids; glutamine"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /function="3.1.3.2 regulation; type of regulation;
                     posttranscriptional; covalent modification,
                     demodification, maturation"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="sensory histidine kinase in two-component
                     regulatory system with GlnG"
                     /protein_id="YP_003880802.1"
                     /db_xref="GI:307128786"
                     /db_xref="ASAP:ABF-0016308"
                     /db_xref="ERIC:ABF-0016308"
                     /db_xref="GeneID:9731413"
                     /translation="MATGTLPDAGQILNSLINSILLLDKDLAIHYSNPAAQQLLAQSS
                     RKLSGTPLPELLGYFSLNLDLMRESLDSGQGFTDNEVTLVVDGRAHIMSLTAQRIQHD
                     FILLEMAPMDNQRRLSQEQLQHAQQQAARDLVRGLAHEIKNPLGGLRGAAQLLSKALP
                     DPALMEYTKVIIEQADRLRNLVDRLLGPQQPGLHVTQSIHQVAERVFQLVSMEKADNV
                     TLVRDYDPSLPELMHDPDQIEQVLLNITRNAMQALGEEGGTITIRTRTAFQLTLHGVR
                     YRLVARIDIEDDGPGVPAHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFNS
                     WPGHTEFSVYLPIRQ"
     misc_feature    complement(29817..30860)
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /note="nitrogen regulation protein NR(II); Provisional;
                     Region: glnL; PRK11073"
                     /db_xref="CDD:182947"
     misc_feature    complement(30555..30815)
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(30600..30602,30615..30617,30693..30698,
                     30735..30737,30753..30755,30765..30767))
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(30573..30575,30579..30581,30663..30668,
                     30675..30677,30693..30695,30705..30707))
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(30303..30470)
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(30306..30308,30318..30320,30327..30329,
                     30339..30341,30348..30350,30360..30362,30408..30410,
                     30417..30419,30429..30431,30438..30440,30450..30452,
                     30462..30464))
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(30444..30446)
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(29826..30149)
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(29838..29840,29844..29846,29859..29861,
                     29865..29867,29913..29924,29985..29990,29994..29996,
                     30000..30002,30006..30008,30108..30110,30117..30119,
                     30129..30131))
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(30117..30119)
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(29916..29918,29922..29924,29988..29990,
                     29994..29996))
                     /gene="glnL"
                     /locus_tag="Dda3937_01117"
                     /gene_synonym="glnR; ntrB"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(31065..32474)
                     /gene="glnA"
                     /locus_tag="Dda3937_01118"
                     /db_xref="GeneID:9731414"
     CDS             complement(31065..32474)
                     /gene="glnA"
                     /locus_tag="Dda3937_01118"
                     /function="1.5.1.2 metabolism; building block
                     biosynthesis; amino acids; glutamine"
                     /function="1.8.3 metabolism; metabolism of other
                     compounds; nitrogen metabolism"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="YP_003880803.1"
                     /db_xref="GI:307128787"
                     /db_xref="ASAP:ABF-0016310"
                     /db_xref="ERIC:ABF-0016310"
                     /db_xref="GeneID:9731414"
                     /translation="MSVEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNADFF
                     EDGKMFDGSSIGGWKGINESDMVLMPDATTAVLDPFFEESTLIIRCDILEPGTMQGYD
                     RDPRSIAKRAEDFLRSSGIADTVLFGPEPEFFLFDDVRFGSSISGSHVAIDDIEGAWN
                     SSTKYEDGNKGHRPAVKGGYFPVPPVDSAQDLRSAMCLTMEQMGLVVEAHHHEVATAG
                     QNEVATRFNTMTKKADEIQIYKYVVHNVAHAFGKTATFMPKPMFGDNGSGMHCHMSLA
                     KDGTNLFSGDKYGGLSETALYYIGGVIKHAKAINALSNPTTNSYKRLVPGYEAPVMLA
                     YSARNRSASIRIPVVSSPKARRIEVRFPDPAANPYLCFAALLMAGLDGIINKIHPGDA
                     MDKNLYDLPPEEAKEIPTVAGSLEEALNALNADREFLTRGGVFTDDAIDAYIELRIAE
                     NDRVRMTPHPVEFELYYSV"
     misc_feature    complement(31068..32474)
                     /gene="glnA"
                     /locus_tag="Dda3937_01118"
                     /note="glutamine synthetase; Provisional; Region: glnA;
                     PRK09469"
                     /db_xref="CDD:181884"
     misc_feature    complement(32190..32435)
                     /gene="glnA"
                     /locus_tag="Dda3937_01118"
                     /note="Glutamine synthetase, beta-Grasp domain; Region:
                     Gln-synt_N; pfam03951"
                     /db_xref="CDD:252271"
     misc_feature    complement(31338..32171)
                     /gene="glnA"
                     /locus_tag="Dda3937_01118"
                     /note="Glutamine synthetase, catalytic domain; Region:
                     Gln-synt_C; pfam00120"
                     /db_xref="CDD:249604"
     gene            32852..34675
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /db_xref="GeneID:9731415"
     CDS             32852..34675
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /function="5.10 cell processes; defense/survivial"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="YP_003880804.1"
                     /db_xref="GI:307128788"
                     /db_xref="ASAP:ABF-0016313"
                     /db_xref="ERIC:ABF-0016313"
                     /db_xref="GeneID:9731415"
                     /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTLGERNEATERVMD
                     SNDLEKERGITILAKNTAINWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLLVDAM
                     DGPMPQTRFVTQKAFAYGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLGATDEQLDF
                     PIVYASALNGIAGLDHNDMAEDMTPLFEAIVKHVEAPNVDLNGPFQMQISQLDYNNYV
                     GVIGIGRIKRGVVKPNQQVSIIDSEGKVRNGKVSQVLGHLGLQRIESTLAEAGDIIAI
                     TGLGELNISDTICETSCVEALPALSVDEPTVTMYFCVNTSPFCGKEGKYVTSRQILDR
                     LRKELVHNVALRVEETEDPDAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFRTI
                     DGRRQEPFEQVTVDIEEQHQGSVMEALGLRKGEMRDMIPDGKGRVRLDYVIPSRGLIG
                     FRTDFMTMTSGTGLLYSTFSHYDDIRPGEIGQRQNGVLISNGQGKAVAYALFSLQDRG
                     KLFLGHGAEVYEGQIIGIHTRSNDLTVNCLTGKKLTNMRASGTDEATVLVPPVKMTLE
                     QALEFIDDDELVEVTPTSIRLRKRHLTENDRRRANRSAKDE"
     misc_feature    32852..34663
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="Predicted membrane GTPase involved in stress
                     response [Signal transduction mechanisms]; Region: TypA;
                     COG1217"
                     /db_xref="CDD:224138"
     misc_feature    32861..33442
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="Tyrosine phosphorylated protein A (TypA)/BipA
                     family belongs to ribosome-binding GTPases; Region:
                     TypA_BipA; cd01891"
                     /db_xref="CDD:206678"
     misc_feature    32885..32908
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="G1 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    order(32888..32890,32894..32896,32906..32911,32918..32920,
                     32927..32932,33026..33031,33083..33088,33155..33160,
                     33266..33268,33278..33280)
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206678"
     misc_feature    order(32894..32911,33233..33238,33242..33244,33347..33355)
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206678"
     misc_feature    32993..33028
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206678"
     misc_feature    33014..33016
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="G2 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    33071..33082
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="G3 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    33077..33133
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206678"
     misc_feature    33233..33244
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="G4 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    33347..33355
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="G5 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    33464..33718
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="BipA_TypA_II: domain II of BipA (also called TypA)
                     having homology to domain II of the elongation factors
                     (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein
                     with global regulatory properties in Escherichia coli.
                     BipA is phosphorylated on a...; Region: BipA_TypA_II;
                     cd03691"
                     /db_xref="CDD:239662"
     misc_feature    34043..34279
                     /gene="bipA"
                     /locus_tag="Dda3937_01119"
                     /gene_synonym="typA; yihK"
                     /note="BipA_TypA_C: a C-terminal portion of BipA or TypA
                     having homology to the C terminal domains of the
                     elongation factors EF-G and EF-2. A member of the ribosome
                     binding GTPase superfamily, BipA is widely distributed in
                     bacteria and plants.  BipA is a highly...; Region:
                     BipA_TypA_C; cd03710"
                     /db_xref="CDD:239681"
     gene            34898..35509
                     /gene="yihX"
                     /locus_tag="Dda3937_01120"
                     /db_xref="GeneID:9731416"
     CDS             34898..35509
                     /gene="yihX"
                     /locus_tag="Dda3937_01120"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase-like hydrolase"
                     /protein_id="YP_003880805.1"
                     /db_xref="GI:307128789"
                     /db_xref="ASAP:ABF-0016317"
                     /db_xref="ERIC:ABF-0016317"
                     /db_xref="GeneID:9731416"
                     /translation="MLYIFDLGNVVIDIDFNRVVGVWSSLSGAPLAALRERFVLGNTF
                     EQHERGEISDEEFASRLCHELGITLSFEQFSTGWQAIFIGVRKDVIDIMHRLRQEGHR
                     VVILSNTNRLHCQFWPGEYPEVQQAVDRLYLSQDIGQRKPEAAIYHHVLREEGVDASE
                     ALFFDDNAANVDAANALGIRSILVSDRQVVPDFFASQVFKQES"
     misc_feature    34898..35494
                     /gene="yihX"
                     /locus_tag="Dda3937_01120"
                     /note="?-D-glucose-1-phosphatase; Provisional; Region:
                     PRK09456"
                     /db_xref="CDD:181872"
     misc_feature    34907..35449
                     /gene="yihX"
                     /locus_tag="Dda3937_01120"
                     /note="Haloacid dehalogenase-like hydrolase; Region:
                     HAD_2; pfam13419"
                     /db_xref="CDD:257744"
     gene            35517..35954
                     /gene="dtd"
                     /locus_tag="Dda3937_01121"
                     /gene_synonym="yihZ"
                     /db_xref="GeneID:9731417"
     CDS             35517..35954
                     /gene="dtd"
                     /locus_tag="Dda3937_01121"
                     /gene_synonym="yihZ"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="D-Tyr-tRNA(Tyr) deacylase"
                     /protein_id="YP_003880806.1"
                     /db_xref="GI:307128790"
                     /db_xref="ASAP:ABF-0016318"
                     /db_xref="ERIC:ABF-0016318"
                     /db_xref="GeneID:9731417"
                     /translation="MIALIQRVSGASVAVDGAIVGEIDHGLLVLLGVEQDDDEQKAAR
                     LCEKVIGYRIFSDDNGKMNLNVQQAGGSLLVVSQFTLAADTQKGMRPSFSRGAAPAEA
                     DRLYQYFVGQCRERGLTTETGRFAADMKVSLVNDGPVTFWLQV"
     misc_feature    35517..35951
                     /gene="dtd"
                     /locus_tag="Dda3937_01121"
                     /gene_synonym="yihZ"
                     /note="D-Tyrosyl-tRNAtyr deacylases; a class of
                     tRNA-dependent hydrolases which are capable of hydrolyzing
                     the ester bond of D-Tyrosyl-tRNA reducing the level of
                     cellular D-Tyrosine while recycling the peptidyl-tRNA;
                     found in bacteria and in eukaryotes but not...; Region:
                     Dtyr_deacylase; cd00563"
                     /db_xref="CDD:238316"
     misc_feature    order(35535..35537,35745..35759,35793..35795,35937..35939)
                     /gene="dtd"
                     /locus_tag="Dda3937_01121"
                     /gene_synonym="yihZ"
                     /note="putative active site [active]"
                     /db_xref="CDD:238316"
     misc_feature    order(35646..35648,35655..35663,35667..35678,35745..35750,
                     35754..35759,35763..35771,35775..35789,35793..35795,
                     35895..35948)
                     /gene="dtd"
                     /locus_tag="Dda3937_01121"
                     /gene_synonym="yihZ"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238316"
     misc_feature    order(35658..35660,35673..35675,35775..35777,35784..35786)
                     /gene="dtd"
                     /locus_tag="Dda3937_01121"
                     /gene_synonym="yihZ"
                     /note="putative tRNAtyr binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238316"
     gene            35988..36929
                     /gene="yiiD"
                     /locus_tag="Dda3937_01122"
                     /db_xref="GeneID:9731418"
     CDS             35988..36929
                     /gene="yiiD"
                     /locus_tag="Dda3937_01122"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_003880807.1"
                     /db_xref="GI:307128791"
                     /db_xref="ASAP:ABF-0016319"
                     /db_xref="ERIC:ABF-0016319"
                     /db_xref="GeneID:9731418"
                     /translation="MYYLRVPESAEELDAYYQFRWEMLRKPLHQPLGSERDAYDALAH
                     HQTIVDGHGKLVAVGRLSINADNEASIRFLAVHPDVQRKGLGTLMAMALESVARQEGV
                     KRVVCSAREDAMAFFSRLGFVNQGEITTPMTTPVRHFLMIKPVATLDDILHRPDWCGQ
                     LQQAWYNHIPLSEKMGVRISQYTGQKFITTMPETGNQNPHHTLFAGSMFSLATLTGWG
                     LIWLLLRERQLGGTIILADAHIRYSTPVTGRPSAVADLGSLSGDLDRLARGRKARVQL
                     QVELFGNDKKGAVFEGIYIVLPPDPNELLEQGGSAIR"
     misc_feature    35994..36356
                     /gene="yiiD"
                     /locus_tag="Dda3937_01122"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    36129..36311
                     /gene="yiiD"
                     /locus_tag="Dda3937_01122"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(36207..36215,36243..36248)
                     /gene="yiiD"
                     /locus_tag="Dda3937_01122"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     misc_feature    36459..36881
                     /gene="yiiD"
                     /locus_tag="Dda3937_01122"
                     /note="Putative thioesterase (yiiD_Cterm); Region:
                     YiiD_Cterm; pfam09500"
                     /db_xref="CDD:255399"
     gene            complement(36993..38735)
                     /gene="yicH"
                     /locus_tag="Dda3937_01123"
                     /db_xref="GeneID:9731419"
     CDS             complement(36993..38735)
                     /gene="yicH"
                     /locus_tag="Dda3937_01123"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880808.1"
                     /db_xref="GI:307128792"
                     /db_xref="ASAP:ABF-0016320"
                     /db_xref="ERIC:ABF-0016320"
                     /db_xref="GeneID:9731419"
                     /translation="MKLIGKLLLTLLLLALLAVVVLYVLAQTEWGARHISQWVNQRTE
                     YQVSFRKMAHDWSSPGRIQLLDVSFGHKDQPVTLVAQSVSMGFSVRQITEPRHFSSLM
                     LEGGTLNLGQTGFTLPIEADVLQLKAMALHAQDGDWRLRGEQVTGGITPWQPEPGYLL
                     GKKAAFQLSAHSLLLNDLPASKVLVQGQFNNQQLTLDNFGADVARGELTGNASRAEDG
                     SWLVNNLRLSNVRLQTRQSMADFWQPVTRLPAVTVNRFDLIDARIEGQNWAFTDLDVT
                     LQNVTFRQNDWQSDDGSLSFNATDIVNGNMHLVDPIVSLDLSKQGVNIKQFSTRWEGG
                     LLRTSGNWQRSNQRLTLDELVVAGMEYTLPADWRQRWQQTLPDWLAEVELRKFTANHN
                     LLIDINPAFPFQLTALDGVGSNLLLARNHQWGVWQGALTLNASDATFNKVDVRRPSLA
                     LNANDNQITLTDLSAFTQSGLLEAKAVIAQQPARAFTLDLTGKAVAFDVLTRWGWPVP
                     ATAPTGNTNLQLHLNGRLEAASPLRPTLNGTLQGIDSAGHAISQAMHQGTTADSAPAT
                     STPPPAPAAPAAQP"
     misc_feature    complement(37113..38657)
                     /gene="yicH"
                     /locus_tag="Dda3937_01123"
                     /note="AsmA family; Region: AsmA; pfam05170"
                     /db_xref="CDD:253057"
     misc_feature    complement(<37113..37394)
                     /gene="yicH"
                     /locus_tag="Dda3937_01123"
                     /note="AsmA-like C-terminal region; Region: AsmA_2;
                     pfam13502"
                     /db_xref="CDD:257822"
     gene            complement(38891..40279)
                     /gene="yicE"
                     /locus_tag="Dda3937_01124"
                     /db_xref="GeneID:9731420"
     CDS             complement(38891..40279)
                     /gene="yicE"
                     /locus_tag="Dda3937_01124"
                     /function="4.2.A.40 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Nucleobase:Cation Symporter-2 (NCS2) Family"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.162 transport; substrate; purine/xanthine"
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine permease"
                     /protein_id="YP_003880809.1"
                     /db_xref="GI:307128793"
                     /db_xref="ASAP:ABF-0016321"
                     /db_xref="ERIC:ABF-0016321"
                     /db_xref="GeneID:9731420"
                     /translation="MSLSTTELPQADAATPANSELIYRLEDRPPLPQTLFAACQHLLA
                     MFVAVITPALLICQALGLPAQDTQHIISMSLFASGLASILQIKTWGPVGSGLLSIQGT
                     SFNFVTPLIMGGMALKNGGADVPTMMAALFGTLMVASCTEILLSRVLHLARRIITPLV
                     SGIVVMIIGLSLIQVGLTSIGGGFAAMSNHTFGAPKNLLLAAIVLAVIIILNRQRNPY
                     LRVASLVIAMAVGYLAAWLMGMLPESAGTSSHALINVPTPLYYGLGFDWNLLIPLMLV
                     FMVTSLETIGDITATSDVSEQPVSGPLYMKRLKGGVLANGLNSCLSAVFNTFPNSCFG
                     QNNGVIQLTGVASRYVGFVVALMLIVLGLFPAVSGFVQHIPEPVLGGATIVMFGTIAA
                     SGVRIVSREPLNRRAIMIIALSLAVGLGVSQQPLILQFAPEWLKTLLSSGIAAGGITA
                     IVLNLVFPQEKE"
     misc_feature    complement(38894..40231)
                     /gene="yicE"
                     /locus_tag="Dda3937_01124"
                     /note="Xanthine/uracil permeases [Nucleotide transport and
                     metabolism]; Region: UraA; COG2233"
                     /db_xref="CDD:225142"
     misc_feature    complement(38909..40216)
                     /gene="yicE"
                     /locus_tag="Dda3937_01124"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     gene            complement(40461..42542)
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /db_xref="GeneID:9731421"
     CDS             complement(40461..42542)
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /function="2.1.3 information transfer; DNA related; DNA
                     recombination"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="YP_003880810.1"
                     /db_xref="GI:307128794"
                     /db_xref="ASAP:ABF-0016322"
                     /db_xref="ERIC:ABF-0016322"
                     /db_xref="GeneID:9731421"
                     /translation="MDSRLLHTQPLSTLAGVGASQAEKLARLGLETVQDLLLHLPLRY
                     EDRTHLYLINDVLPGMYATVEGDVLRSDITFGRRRMLTCQISDGSGMLTLRFFNFNAA
                     MKNSLSPGQRVLAYGEVRRGKLGGEMIHPEYRVQGESATVELQETLTPVYPTTEGIRQ
                     ATLRKLTDQALELLNTHPIDELLPQEMRHGLISLPDALRTLHRPPPDVQLAELEQGKH
                     PAQQRLVMEELLAHHLSMLAVRAGAQRHRALALGPKDNLKQQLLAALPFSPTGAQQRV
                     VAEIEQDMNKPFPMMRLVQGDVGSGKTLVAALAALQAIAHGKQVALMAPTELLAEQHA
                     ANFRRWFEPLGVEVGWLAGKQKGKARQAQQEAIASGQVSMVVGTHAIFQQQVQFNGLA
                     LVIIDEQHRFGVHQRLALWEKGEEQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDE
                     LPPGRTPVTTVAIPDTRRDDIIQRVRNACLQEGRQAYWVCTLIEESELLEAQAAEATC
                     QELKAALPDLTIGLVHGRMKAQEKQAVMAAFKTNQLHLLVATTVIEVGVDVPNASLMI
                     IENPERLGLAQLHQLRGRVGRGAVASHCVLLYKSPLSKTAQMRLQVLRDSNDGFVIAQ
                     RDLEIRGPGELLGTRQTGNAAFRVADLLRDQALIPQVQRVSRHLHEHYPEHARALIDR
                     WLPERTRYTNA"
     misc_feature    complement(40464..42542)
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /note="ATP-dependent DNA helicase RecG; Provisional;
                     Region: PRK10917"
                     /db_xref="CDD:236794"
     misc_feature    complement(<42432..>42530)
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /note="Y-family of DNA polymerases; Region: PolY; cl12025"
                     /db_xref="CDD:264514"
     misc_feature    complement(42138..42356)
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /note="RecG_wedge_OBF: A subfamily of OB folds
                     corresponding to the OB fold found in the N-terminal
                     (wedge) domain of Escherichia coli RecG. RecG is a
                     branched-DNA-specific helicase, which catalyzes the
                     interconversion of a DNA replication fork to a...; Region:
                     RecG_wedge_OBF; cd04488"
                     /db_xref="CDD:239934"
     misc_feature    complement(order(42138..42140,42195..42197,42201..42203,
                     42207..42209,42354..42356))
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239934"
     misc_feature    complement(order(42159..42161,42237..42239,42252..42254,
                     42303..42305))
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /note="ssDNA binding site; other site"
                     /db_xref="CDD:239934"
     misc_feature    complement(41253..41669)
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(41634..41648)
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(41343..41354)
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(40752..41153)
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(40887..40895,40968..40973,41061..41072))
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(40782..40784,40791..40793,40803..40805,
                     40869..40871))
                     /gene="recG"
                     /locus_tag="Dda3937_01125"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            complement(42542..43234)
                     /gene="trmH"
                     /locus_tag="Dda3937_01126"
                     /gene_synonym="spoU"
                     /db_xref="GeneID:9731422"
     CDS             complement(42542..43234)
                     /gene="trmH"
                     /locus_tag="Dda3937_01126"
                     /gene_synonym="spoU"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (Guanosine-2'-O-)-methyltransferase"
                     /protein_id="YP_003880811.1"
                     /db_xref="GI:307128795"
                     /db_xref="ASAP:ABF-0016323"
                     /db_xref="ERIC:ABF-0016323"
                     /db_xref="GeneID:9731422"
                     /translation="MTPERYTRIREMLNNRQPDLTVCMEQVHKPHNVSAVIRTADAVG
                     VHQVHAVWPTNRMRTLVSTAAGSNSWVQVETHRTVQDAVGHLKTQGMQILATNLSASA
                     VDFREVDYTRPTCILLGQEKTGITADALALADQDIIIPMVGMVQSLNVSVASALILYE
                     AQRQRQLAGMYQRECSPLDEEEQQRLLFEGGYPVLARVARRKGLPRPFIDHTGQVIAD
                     APWWAAMQSTEQ"
     misc_feature    complement(42548..43234)
                     /gene="trmH"
                     /locus_tag="Dda3937_01126"
                     /gene_synonym="spoU"
                     /note="tRNA guanosine-2'-O-methyltransferase; Provisional;
                     Region: PRK11081"
                     /db_xref="CDD:236837"
     misc_feature    complement(42758..43180)
                     /gene="trmH"
                     /locus_tag="Dda3937_01126"
                     /gene_synonym="spoU"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     misc_feature    complement(42572..42748)
                     /gene="trmH"
                     /locus_tag="Dda3937_01126"
                     /gene_synonym="spoU"
                     /note="SpoU, rRNA methylase, C-terminal; Region:
                     SpoU_methylas_C; pfam12105"
                     /db_xref="CDD:152540"
     gene            complement(43241..45343)
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /db_xref="GeneID:9731423"
     CDS             complement(43241..45343)
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /function="1.7.33 metabolism; central intermediary
                     metabolism; nucleotide and nucleoside conversions"
                     /function="3.1.3.4 regulation; type of regulation;
                     posttranscriptional; proteases, cleavage of compounds"
                     /function="5.5.3 cell processes; adaptation to stress;
                     starvation response"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP
                     pyrophosphokinase/Guanosine-3',5'-bis(diphosphate)
                     3'-pyrophosphohydrolase"
                     /protein_id="YP_003880812.1"
                     /db_xref="GI:307128796"
                     /db_xref="ASAP:ABF-0016324"
                     /db_xref="ERIC:ABF-0016324"
                     /db_xref="GeneID:9731423"
                     /translation="MYLFESLNLLIQRYLPEDQIKRLKQAYLVARDAHEGQTRSSGEP
                     YITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSK
                     LDKLKFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIAR
                     ETLEIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILS
                     EIEGRLKEAGISCRVSGREKHLYSIYCKMHLKEQRFHSIMDIYAFRVIVREVDTCYRV
                     LGQVHSLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMG
                     VAAHWAYKEGESSSTTAQVRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFT
                     PEGRIVELPAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQALSSGQTIEIITAPG
                     ARPNAAWLNFVVSSKARAKIRQMLKNLKRDDSVSLGRRLINHALGSGRKLSDIPEQNI
                     QRELERMKLASLDDLLAEIGLGNAMSVVVARNLLEEHAETGAAGIRKLPIKGADGVLI
                     TFAKCCRPIPGDPIIAHVSPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDEVTEQEFM
                     TEIKVDMFNHQGALANLTAAISSSNSNIQSINTEERDGRVYSAFIRLTTRDRIHLANI
                     MRKIRVMPDVIKVNRNRN"
     misc_feature    complement(43244..45343)
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /note="bifunctional (p)ppGpp synthetase II/
                     guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase;
                     Provisional; Region: PRK11092"
                     /db_xref="CDD:236843"
     misc_feature    complement(44846..45217)
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(44927..44929,45125..45130,45200..45202))
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(45125..45127)
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(44345..44704)
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /note="Nucleotidyltransferase (NT) domain of RelA- and
                     SpoT-like ppGpp synthetases and hydrolases; Region:
                     NT_Rel-Spo_like; cd05399"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(44348..44353,44375..44377,44381..44383,
                     44387..44389,44423..44425,44435..44437,44441..44443,
                     44447..44449,44462..44464,44468..44470,44552..44554,
                     44564..44569,44630..44632,44636..44638))
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /note="synthetase active site [active]"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(44351..44353,44381..44383,44387..44389,
                     44423..44425,44435..44437,44441..44443,44447..44449,
                     44462..44464,44468..44470,44636..44638))
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143389"
     misc_feature    complement(order(44387..44389,44567..44569))
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143389"
     misc_feature    complement(44003..44182)
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /note="TGS_RelA_SpoT: The RelA (SpoT) protein, also
                     referred to as ppGpp hydrolase/synthetase, is a
                     ribosome-associated protein that is activated during amino
                     acid starvation and thought to mediate the stringent
                     response. RelA contains a TGS domain, named after...;
                     Region: TGS_RelA_SpoT; cd01668"
                     /db_xref="CDD:133438"
     misc_feature    complement(43253..43465)
                     /gene="spoT"
                     /locus_tag="Dda3937_01127"
                     /note="ACT  domain found C-terminal of the RelA/SpoT
                     domains; Region: ACT_RelA-SpoT; cd04876"
                     /db_xref="CDD:153148"
     gene            complement(45368..45643)
                     /gene="rpoZ"
                     /locus_tag="Dda3937_01128"
                     /gene_synonym="spoS"
                     /db_xref="GeneID:9731424"
     CDS             complement(45368..45643)
                     /gene="rpoZ"
                     /locus_tag="Dda3937_01128"
                     /gene_synonym="spoS"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit omega"
                     /protein_id="YP_003880813.1"
                     /db_xref="GI:307128797"
                     /db_xref="ASAP:ABF-0016325"
                     /db_xref="ERIC:ABF-0016325"
                     /db_xref="GeneID:9731424"
                     /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQIQVGGKEPLVPEEND
                     KYTVIALREIEEGLINGQILDTRERQEQQEQEAAEIQAVTAIAEGRR"
     misc_feature    complement(45464..45643)
                     /gene="rpoZ"
                     /locus_tag="Dda3937_01128"
                     /gene_synonym="spoS"
                     /note="DNA-directed RNA polymerase, omega subunit; Region:
                     rpoZ; TIGR00690"
                     /db_xref="CDD:188073"
     gene            complement(45698..46321)
                     /gene="gmk"
                     /locus_tag="Dda3937_01129"
                     /db_xref="GeneID:9731425"
     CDS             complement(45698..46321)
                     /gene="gmk"
                     /locus_tag="Dda3937_01129"
                     /function="1.5.2.1 metabolism; building block
                     biosynthesis; nucleotide; purine biosynthesis"
                     /function="1.7.33 metabolism; central intermediary
                     metabolism; nucleotide and nucleoside conversions"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="YP_003880814.1"
                     /db_xref="GI:307128798"
                     /db_xref="ASAP:ABF-0016326"
                     /db_xref="ERIC:ABF-0016326"
                     /db_xref="GeneID:9731425"
                     /translation="MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAM
                     RPGEVHGEHYFFVPVDEFKRMIEEDDFLEYAEVFGNYYGTSRAAIEQVLSTGVDVFLD
                     IDWQGARQIRERMPQARSIFILPPSQEELERRLRGRGQDSEEVIARRMKQAVAEMSHY
                     AEYDYLIVNDDFDLALLDLKTIIRAERLRLSRQKVRHDALITKLLAD"
     misc_feature    complement(45764..46315)
                     /gene="gmk"
                     /locus_tag="Dda3937_01129"
                     /note="Guanylate kinase; Region: Guanylate_kin; pfam00625"
                     /db_xref="CDD:250008"
     misc_feature    complement(45944..46306)
                     /gene="gmk"
                     /locus_tag="Dda3937_01129"
                     /note="Guanosine monophosphate kinase (GMPK, EC 2.7.4.8),
                     also known as guanylate kinase (GKase), catalyzes the
                     reversible phosphoryl transfer from adenosine triphosphate
                     (ATP) to guanosine monophosphate (GMP) to yield adenosine
                     diphosphate (ADP) and guanosine...; Region: GMPK; cd00071"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(46076..46078,46091..46093,46160..46162,
                     46187..46189,46196..46198,46217..46219,46271..46273,
                     46289..46291))
                     /gene="gmk"
                     /locus_tag="Dda3937_01129"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(46271..46273,46289..46291))
                     /gene="gmk"
                     /locus_tag="Dda3937_01129"
                     /note="G-X2-G-X-G-K; other site"
                     /db_xref="CDD:238026"
     gene            46625..48310
                     /gene="yicF"
                     /locus_tag="Dda3937_01130"
                     /db_xref="GeneID:9731426"
     CDS             46625..48310
                     /gene="yicF"
                     /locus_tag="Dda3937_01130"
                     /function="2.1 information transfer; DNA related"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase"
                     /protein_id="YP_003880815.1"
                     /db_xref="GI:307128799"
                     /db_xref="ASAP:ABF-0016328"
                     /db_xref="ERIC:ABF-0016328"
                     /db_xref="GeneID:9731426"
                     /translation="MMRYRYALAAVLFAVSGLAEAASCPAWSSTRAEQEITQLGQQLT
                     QWDNAYYEQGQSPVDDQVYDQLRQTLATWQVCFQADAGRFAISLPTTGRRQHPVAHTG
                     LKKLSEPTELKQWIAQHNDLWVQPKIDGVAVTLVYEQGKLVAAISRGNGRQGEDWTDK
                     VRQMNSVPQQLSAMSGRQVFQGELYLQVTDHRQQQVGGINARAQVAGEMRRKQPSPLL
                     SRIGVFVWAWPDGPADMPARLAKLRELGFGLTADYTQPVSSLEAAAQWRERWYRAPLP
                     FVTDGVVVRQAQEPAGRYWQDTPAEWAVAWKYPLVNRVTEVTGVDVEVGRTGRMTVVL
                     QLQPVILDDKTVSRVNLGSVSRWRQWDVLPGDRVSISLAGLGIPRLDAVVWRGAVREA
                     ITVPATSPFDVFSCLQWSRECQPQFLARLVWMSGRNGLSLSGISEATWQRLTQRGALV
                     DVVSWLALEPAQLAAAGDFGEQQAERIHRQFQLARRQPLRNWLLALGLPVPSRVRHAL
                     DGASLEQLQQRSAAEWQQFSGIGVRRAQRIRDFLHHTDIVRQLAWLNEHGVKS"
     misc_feature    46625..48307
                     /gene="yicF"
                     /locus_tag="Dda3937_01130"
                     /note="NAD-dependent DNA ligase LigB; Reviewed; Region:
                     ligB; PRK08097"
                     /db_xref="CDD:236150"
     misc_feature    46724..47551
                     /gene="yicF"
                     /locus_tag="Dda3937_01130"
                     /note="NAD+ dependent DNA ligase adenylation domain. DNA
                     ligases catalyze the crucial step of joining the breaks in
                     duplex DNA during DNA replication, repair and
                     recombination, utilizing either ATP or NAD(+) as a
                     cofactor, but using the same basic reaction...; Region:
                     LIGANc; cl03295"
                     /db_xref="CDD:261674"
     misc_feature    order(46931..46933,46997..46999,47003..47005,47066..47068,
                     47171..47173,47300..47302,47471..47473,47477..47479)
                     /gene="yicF"
                     /locus_tag="Dda3937_01130"
                     /note="nucleotide binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238062"
     misc_feature    order(47003..47005,47009..47014)
                     /gene="yicF"
                     /locus_tag="Dda3937_01130"
                     /note="K-X-D-G motif; other site"
                     /db_xref="CDD:238062"
     misc_feature    47003..47005
                     /gene="yicF"
                     /locus_tag="Dda3937_01130"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238062"
     misc_feature    47564..47779
                     /gene="yicF"
                     /locus_tag="Dda3937_01130"
                     /note="NAD-dependent DNA ligase OB-fold domain; Region:
                     DNA_ligase_OB; pfam03120"
                     /db_xref="CDD:145978"
     gene            48605..50359
                     /gene="eptB"
                     /locus_tag="Dda3937_01131"
                     /gene_synonym="yhjW"
                     /db_xref="GeneID:9731427"
     CDS             48605..50359
                     /gene="eptB"
                     /locus_tag="Dda3937_01131"
                     /gene_synonym="yhjW"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent hydrolase"
                     /protein_id="YP_003880816.1"
                     /db_xref="GI:307128800"
                     /db_xref="ASAP:ABF-0016330"
                     /db_xref="ERIC:ABF-0016330"
                     /db_xref="GeneID:9731427"
                     /translation="MAPELSNISSVCLQDIFTSGVWSGMKSLLALSQSKLSWLLAIYI
                     GFFLNLPVFYRRVDAFPFFTENPVAKYIPLLVESMACILFTFFLMRILSLGGRRFFRV
                     MASLLVLISVAASYYMTFFNVVIGYGIIAAVMTTDIDLSKEVVGLFFVLWVAALSLPP
                     VFLIWKNRLQQTLIEQLRTSGRRRIALLGLVASAALVWLPLRYLAQINTSAEKLSNQD
                     LPSYGGVVAHSYLPANWLSAFGLFAYARYDENQDDDELIDPSKQFTYQAPPGIDDTYV
                     VFIIGETTRWDHMGLLGYERDTTPQLAKEKNLLAFRGHSCDTSTKLSMRCMFVREGGT
                     SDNPQRTLREKNIFAVMKSLGFSSELFAMQSEVWFYNNIQADNYAFREMIASEKRNEG
                     KAVDDMLLVDEMSQSLMRYPNGKHLVVLHTKGSHYLYSMRYPRSYARYQPECMGVDAS
                     CSREQLINAFDNSVLYTDAVIKRVIDQLRDKKALLVYASDHGESIDDNYHLHGTPRQM
                     APPEQFRSPIMLWASDKYLAQPRNQQAFEQLRAQQQQGKVLRHEEIFDSMLGCLGYTS
                     PDGGIQEKNNWCNMPGRG"
     misc_feature    48677..50356
                     /gene="eptB"
                     /locus_tag="Dda3937_01131"
                     /gene_synonym="yhjW"
                     /note="phosphoethanolamine transferase; Provisional;
                     Region: PRK11560"
                     /db_xref="CDD:183198"
     misc_feature    48851..>49195
                     /gene="eptB"
                     /locus_tag="Dda3937_01131"
                     /gene_synonym="yhjW"
                     /note="Domain of unknown function (DUF1705); Region:
                     DUF1705; pfam08019"
                     /db_xref="CDD:149223"
     misc_feature    49430..50296
                     /gene="eptB"
                     /locus_tag="Dda3937_01131"
                     /gene_synonym="yhjW"
                     /note="Sulfatase; Region: Sulfatase; pfam00884"
                     /db_xref="CDD:250201"
     gene            50513..50589
                     /locus_tag="Dda3937_04245"
                     /db_xref="GeneID:9731428"
     tRNA            50513..50589
                     /locus_tag="Dda3937_04245"
                     /product="tRNA-Pro"
                     /note="anticodon CGG, Cove score 85.85"
                     /db_xref="ASAP:ABF-0020906"
                     /db_xref="ERIC:ABF-0020906"
                     /db_xref="GeneID:9731428"
     gene            complement(51020..51736)
                     /locus_tag="Dda3937_01132"
                     /db_xref="GeneID:9731429"
     CDS             complement(51020..51736)
                     /locus_tag="Dda3937_01132"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880817.1"
                     /db_xref="GI:307128801"
                     /db_xref="ASAP:ABF-0016334"
                     /db_xref="ERIC:ABF-0016334"
                     /db_xref="GeneID:9731429"
                     /translation="MVLRAHMIIRSHTAIRSHTAIRSYTAIRSHMILRTAMLLLGGLL
                     TVNMGHASDTSMDIHRQWSVCQYKTLASRKEECFAALSQLAQEQTESHPDRADYLIWS
                     AMVDSSWAGVKDGMEALNLAGQAKSTLEKAIALDPHALNGAAYTILGVLYYQVPGWPL
                     GFGDEKKAEQYLKMALKINPASIDANFFYGDFLLKAGRKNEARQYLTAAQNAAPRPGR
                     EIADLGRRAEAEKALVQLKY"
     misc_feature    complement(51095..51367)
                     /locus_tag="Dda3937_01132"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(51110..51112,51119..51121,51131..51133,
                     51167..51169,51212..51214,51221..51223,51233..51235,
                     51290..51292,51341..51343,51350..51352,51362..51364))
                     /locus_tag="Dda3937_01132"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(51095..51316)
                     /locus_tag="Dda3937_01132"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    complement(order(51149..51154,51161..51166,51173..51178,
                     51275..51280,51287..51292,51296..51301))
                     /locus_tag="Dda3937_01132"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            complement(51748..52542)
                     /locus_tag="Dda3937_01133"
                     /db_xref="GeneID:9731430"
     CDS             complement(51748..52542)
                     /locus_tag="Dda3937_01133"
                     /function="1.7 metabolism; central intermediary
                     metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_003880818.1"
                     /db_xref="GI:307128802"
                     /db_xref="ASAP:ABF-0016335"
                     /db_xref="ERIC:ABF-0016335"
                     /db_xref="GeneID:9731430"
                     /translation="MKLKNKRILLTGASSNTGQELALSLAARGARLYLVGRNEKALLA
                     LQQRLPDAGHHNILLADLCDEQDRDALAECFPENVRLDVLINNIDTSTFGLFEEQSHD
                     VIRRQLTLNTEVPILLTHSLLDCINKPGIIMNIGSTLDGIGYPGYSAYCASKFALRGF
                     SEALHRELSSKGIKVLHLAPRAIDAGRNAPKTHALTQALGYHSDKPAWVADQVVNALE
                     RETVRRWLGWPEKLFVRLNALVPAVVDNAIRRQLAAIQHYARAQKK"
     misc_feature    complement(51760..52542)
                     /locus_tag="Dda3937_01133"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK09072"
                     /db_xref="CDD:236372"
     misc_feature    complement(51808..52536)
                     /locus_tag="Dda3937_01133"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(52003..52005,52081..52083,52093..52095,
                     52132..52140,52276..52284,52429..52437,52492..52494,
                     52498..52503,52507..52509))
                     /locus_tag="Dda3937_01133"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(52081..52083,52093..52095,52132..52134,
                     52210..52212))
                     /locus_tag="Dda3937_01133"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(52547..53185)
                     /locus_tag="Dda3937_01134"
                     /db_xref="GeneID:9731431"
     CDS             complement(52547..53185)
                     /locus_tag="Dda3937_01134"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="Long-chain-fatty-acid--CoA ligase/long-chain
                     acyl-CoA synthetase"
                     /protein_id="YP_003880819.1"
                     /db_xref="GI:307128803"
                     /db_xref="ASAP:ABF-0016337"
                     /db_xref="ERIC:ABF-0016337"
                     /db_xref="GeneID:9731431"
                     /translation="MSFYQQLQSATSTSQQLMMSAPVIDACRQGTITGDMYIAFLTQA
                     YHHVSYTVPLLMAASGRLPRHQAWVREAIEEYINAEYDHKASILHKIRACGGKTETLG
                     QNAAAQWIELMAAYLYDQIQRDNPMSIFGLIHVLEGIQANIAPDMIRQIDAEQDLPVN
                     AINGLQEQDPCPNVFAALMDNINDSADQTAIIHAAHVVYQLYGDMLRSLTEH"
     misc_feature    complement(52559..53182)
                     /locus_tag="Dda3937_01134"
                     /note="Heme oxygenase catalyzes the rate limiting step in
                     the degradation of heme to bilirubin, it is essential for
                     recycling of iron from heme. Heme is used as a substrate
                     and cofactor for its own degradation to biliverdin, iron,
                     and carbon monoxide. This...; Region: HemeO; cl17299"
                     /db_xref="CDD:266613"
     misc_feature    complement(order(52589..52591,52784..52786,53141..53143,
                     53153..53155,53162..53164))
                     /locus_tag="Dda3937_01134"
                     /note="heme binding pocket [chemical binding]; other site"
                     /db_xref="CDD:238143"
     misc_feature    complement(53141..53143)
                     /locus_tag="Dda3937_01134"
                     /note="heme ligand [chemical binding]; other site"
                     /db_xref="CDD:238143"
     gene            53451..54629
                     /locus_tag="Dda3937_01135"
                     /db_xref="GeneID:9731432"
     CDS             53451..54629
                     /locus_tag="Dda3937_01135"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS superfamily transporter"
                     /protein_id="YP_003880820.1"
                     /db_xref="GI:307128804"
                     /db_xref="ASAP:ABF-0016339"
                     /db_xref="ERIC:ABF-0016339"
                     /db_xref="GeneID:9731432"
                     /translation="MSTSRRAHQLAILVVMISASLVGLVQGYSIPLVTLKLTALGYGS
                     ALTGMMSALPAIGVFVSSWVAAPVAMRLPVGRLLALSTWGMGVSLTLSFYLDNVALLA
                     APRFLMGFCCGLIIVIGESWVSGHTAEHRRGVLVGLYATAFTGLQLLGPLLISLTGLD
                     DPTGLLLILALHGVCLLMVPGSSFSGLALSAHRQHNLFSLLLAAPALAAAVFAFAFFD
                     GAVLSMLPLYGMAHGYEEQLAVLLVTVLFIGDALLQVPLGWVSDKLGTVRVHLACGGL
                     FVLMLVGLPFSYGTGWVWANVFLLGAVAGSIYTLALVRAGKQFSGVNLVAINALFGVL
                     WGVGSFSGPLVSGSLMQWYGRDGLIAVLGVLGLLFLAANALSATQRNAAGQTDPELAE
                     "
     misc_feature    53484..54512
                     /locus_tag="Dda3937_01135"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    53493..54479
                     /locus_tag="Dda3937_01135"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(53526..53528,53535..53543,53547..53552,53601..53603,
                     53610..53615,53622..53624,53634..53639,53643..53648,
                     53784..53789,53796..53801,53808..53813,53820..53822,
                     53856..53861,53868..53873,53889..53891,54090..54092,
                     54099..54104,54111..54116,54123..54125,54165..54167,
                     54177..54179,54189..54191,54198..54200,54210..54212,
                     54351..54353,54360..54365,54372..54374,54384..54389,
                     54396..54398,54429..54434,54441..54446,54453..54458,
                     54465..54467)
                     /locus_tag="Dda3937_01135"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            54672..55562
                     /locus_tag="Dda3937_01136"
                     /db_xref="GeneID:9731433"
     CDS             54672..55562
                     /locus_tag="Dda3937_01136"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_003880821.1"
                     /db_xref="GI:307128805"
                     /db_xref="ASAP:ABF-0016340"
                     /db_xref="ERIC:ABF-0016340"
                     /db_xref="GeneID:9731433"
                     /translation="MDRLATLETFICVYESGSFSAASRRLGIGQPAISKAIMQLEQQL
                     AVKLLLRSTRGLTPTEAGQRFYEQVAPALQQLHEAQDGVRGGNGELSGYLRVSAPVTF
                     ARLHVLPRLHVFMSQHPQLKVDIILDDRPVDLIAEGIDVALRLGEMKDSGLTARKIGS
                     APMRLLATPAYFAARGTPASPEALEDHDAVIYLQTDAPGNWLFCRDDRQCRVTMSGRI
                     RTSAAEGVREAVLAGNGLTVASAWMFAPELASGAVTTALADWHIGVMDLWAVYPGGRL
                     TSARARAFTEFVAQHLSVPA"
     misc_feature    54678..55550
                     /locus_tag="Dda3937_01136"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    54681..54860
                     /locus_tag="Dda3937_01136"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    54945..55535
                     /locus_tag="Dda3937_01136"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    order(54975..54977,54987..54989,55104..55106,55146..55148,
                     55152..55154,55338..55340,55389..55391,55470..55472)
                     /locus_tag="Dda3937_01136"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    order(54978..54983,54993..54998,55002..55007,55014..55016,
                     55026..55028,55032..55052,55233..55235,55320..55334,
                     55353..55358,55365..55367)
                     /locus_tag="Dda3937_01136"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            55662..56900
                     /locus_tag="Dda3937_01137"
                     /db_xref="GeneID:9731434"
     CDS             55662..56900
                     /locus_tag="Dda3937_01137"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_003880822.1"
                     /db_xref="GI:307128806"
                     /db_xref="ASAP:ABF-0016341"
                     /db_xref="ERIC:ABF-0016341"
                     /db_xref="GeneID:9731434"
                     /translation="MPCDGASGLRGTPPSDRQPRRMTMSTLSYSDDTVRTGKPLIFAM
                     AAASGVAVANIYYNQPMLGLMTASFPGSGATSMIPTATQLGYALGLLMLVPLGDKFER
                     RRLIVWQFLLLALASVLAALAPSAPVLLVASVLIGVGATVAQQIVPVAATVASEGQRG
                     AVVGTVMSGLLSGILLSRTLAGLVADAAGWRAMFWLSVPLALAGAALMGRMLPVLPPS
                     SALSWRSLMRSLLTLWRAEPALRRATWIQGALFASFSAFWSILALYLASGSHPLGAAA
                     AGLFGVIGVAGITAAPVAGRLADRIGSRPVILLGALLTLLAWGVFGLWGAVAGLIVGV
                     ILLDLGVQSALIAHQHVIYGLQPTARGRINTLFMGGMFLGGALGSSGAMAAWQAGGWM
                     PVTLFAGGVTLLALVAASRR"
     misc_feature    55779..56888
                     /locus_tag="Dda3937_01137"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     misc_feature    55875..56888
                     /locus_tag="Dda3937_01137"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(55896..55898,55905..55910,55917..55919,55929..55934,
                     55938..55943,56079..56084,56091..56096,56103..56108,
                     56112..56114,56148..56153,56160..56165,56181..56183,
                     56412..56414,56421..56426,56433..56438,56445..56447,
                     56487..56489,56499..56501,56511..56513,56520..56522,
                     56532..56534,56673..56675,56682..56687,56694..56696,
                     56706..56711,56718..56720,56748..56753,56760..56765,
                     56772..56777,56784..56786)
                     /locus_tag="Dda3937_01137"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(57019..58296)
                     /locus_tag="Dda3937_01138"
                     /db_xref="GeneID:9731435"
     CDS             complement(57019..58296)
                     /locus_tag="Dda3937_01138"
                     /function="1.7.9 metabolism; central intermediary
                     metabolism; glucose metabolism"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine acid phosphatase"
                     /protein_id="YP_003880823.1"
                     /db_xref="GI:307128807"
                     /db_xref="ASAP:ABF-0016342"
                     /db_xref="ERIC:ABF-0016342"
                     /db_xref="GeneID:9731435"
                     /translation="MLFTRKTVAGLLLSALPWLGAQAETAPSGWALEKVVEISRHGVR
                     PPTEGNVKTIQEGTGRDWPTWLTHYGELTGHGYAAAVLKGQYEGQYLRQHGLLTHNCP
                     APDDVFVWASPLQRTQETAMALMDGVFPGCGVVIRGPESEDNDPLFHAETAGVLVDQE
                     QVKVDLQKAMQGKSAEQIQAEWQPAIDRLKQAVCLPDKPCPAFSAKWELKESKKGNTS
                     LHGPEALANMAETIRLAYSNNNPLGQVAFGNARTATAVGSLMSLLTANYDFTNDLPYV
                     ARRGGSVLMNQIALALNPEHQADAPPDAKWLLYVAHDTNIAKLRAMLGFTWQMGDYPR
                     GNIPPAGSLIFERWRNPQGQRFVRIYFQAQSLDQIRGLTALDNDHPPLRSEFSMGGCQ
                     KTDVGTLCPYDAVMKRLNGSVDRTALLPVRYTL"
     misc_feature    complement(57211..58203)
                     /locus_tag="Dda3937_01138"
                     /note="Histidine phosphatase domain found in histidine
                     acid phosphatases and phytases; contains a His residue
                     which is phosphorylated during the reaction; Region:
                     HP_HAP_like; cd07061"
                     /db_xref="CDD:132717"
     misc_feature    complement(order(57358..57363,57949..57951,58165..58167,
                     58174..58179))
                     /locus_tag="Dda3937_01138"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132717"
     gene            58560..59504
                     /locus_tag="Dda3937_01139"
                     /db_xref="GeneID:9731436"
     CDS             58560..59504
                     /locus_tag="Dda3937_01139"
                     /function="4.3.A.1 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The ATP-binding Cassette (ABC) Superfamily +
                     ABC-type Uptake Permeases"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_003880824.1"
                     /db_xref="GI:307128808"
                     /db_xref="ASAP:ABF-0016344"
                     /db_xref="ERIC:ABF-0016344"
                     /db_xref="GeneID:9731436"
                     /translation="MRINRGVIYGDVMKANKIPTLFNRGGFGGSGFIGFGFIAPLLIP
                     LLLFWVIPFFCSLYISLTDWDYISPDYHLVGVDNYRDLLLSDDFTGALVNTLTFAIAV
                     VIPVVVLGLGFALLLHRQCRGQRCYQAMIFSPWITPTVAVSVVWSWVFDSRAGLANQL
                     LGLFGVAGVPWLERPGSAMLAVVIVTVWQGIGWTMMFFISALNRIPAELYEAARLDGG
                     SRARRLLTITLPLISPTTFFLLIVNLVNAVQAFDQFQMLTQGGPGNSTRTLMYLFYQQ
                     AFQQFSMGPAAATAVMILLLAGSLSLVNTLIARRWVYF"
     misc_feature    <59037..59459
                     /locus_tag="Dda3937_01139"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(59037..59039,59043..59045,59118..59123,59130..59132,
                     59136..59138,59145..59150,59154..59156,59166..59171,
                     59178..59180,59229..59231,59271..59276,59283..59285,
                     59304..59315,59322..59327,59376..59381,59409..59414,
                     59421..59426,59430..59435,59442..59447,59454..59459)
                     /locus_tag="Dda3937_01139"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(59043..59045,59103..59105,59322..59324,59370..59372,
                     59379..59381,59409..59411)
                     /locus_tag="Dda3937_01139"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(59181..59219,59235..59240,59250..59252)
                     /locus_tag="Dda3937_01139"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            59510..60403
                     /locus_tag="Dda3937_01140"
                     /db_xref="GeneID:9731437"
     CDS             59510..60403
                     /locus_tag="Dda3937_01140"
                     /function="4.3.A.1 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The ATP-binding Cassette (ABC) Superfamily +
                     ABC-type Uptake Permeases"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-D-glucosamine ABC transporter permease"
                     /protein_id="YP_003880825.1"
                     /db_xref="GI:307128809"
                     /db_xref="ASAP:ABF-0016345"
                     /db_xref="ERIC:ABF-0016345"
                     /db_xref="GeneID:9731437"
                     /translation="MGMVSSPITLAEPGVSTAARRPAFRRRGMLKHLLLMMAGLLMVF
                     PFVWMLSGALKTNDEIFRHPLQLLPSHPDFSSFAAVWRETHFGLFMYNSLTVALLTSL
                     LVVINSVLFAYAIVQWRGKASRLLYGVVMACYMLPGAVTYIPCYIILAKLHLLDTHIG
                     LIFSNAVSAMGVFYLHQALKKIHPSLLEAARIDGAGEWSLLRTIVLPQIKPVLATLFL
                     LIFITNYNSYMWPSLVITSPSLNLISIGIRQYFISGGDYGFNWSNIMAASAIVVMPML
                     FLFLLCQRIILSGFSDNGVKE"
     misc_feature    59636..60397
                     /locus_tag="Dda3937_01140"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    59777..60337
                     /locus_tag="Dda3937_01140"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(59825..59830,59837..59842,59855..59857,59885..59896,
                     59900..59929,59936..59941,59945..59947,60011..60013,
                     60017..60019,60026..60031,60035..60037,60047..60052,
                     60059..60061,60110..60112,60152..60157,60164..60166,
                     60185..60196,60203..60208,60254..60259,60287..60292,
                     60299..60304,60308..60313,60320..60325,60332..60337)
                     /locus_tag="Dda3937_01140"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(59903..59947,60185..60202)
                     /locus_tag="Dda3937_01140"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(59945..59947,60005..60007,60203..60205,60248..60250,
                     60257..60259,60287..60289)
                     /locus_tag="Dda3937_01140"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(60062..60100,60116..60121,60131..60133)
                     /locus_tag="Dda3937_01140"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            60403..61683
                     /locus_tag="Dda3937_01141"
                     /db_xref="GeneID:9731438"
     CDS             60403..61683
                     /locus_tag="Dda3937_01141"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="solute binding protein"
                     /protein_id="YP_003880826.1"
                     /db_xref="GI:307128810"
                     /db_xref="ASAP:ABF-0016346"
                     /db_xref="ERIC:ABF-0016346"
                     /db_xref="GeneID:9731438"
                     /translation="MMTVCKGLRFVGGALCALLLTVQAQAATEVNFWYSGGTKPQKMM
                     LTLIDEFNRSQDQYVVKGALQGNYDETWQKMQAGMAAQNAPAFALLTASQGTALAERK
                     LLRDLRPYMDDSFHFTDFIGAFRRQVTRPDGSVYGLPAYGTTQVLYYNKAVLAQHGFT
                     PDDLKTWQGLAKVATAVTQKDAGGDTRYYGWEPMWGPGNLIDAALSNGGRILSEDGKK
                     VLIDSPAWVEVWDSFRRWIHDERIMRIYHGGQGWEYWYKTIDDVMKDRALGYTGSSGD
                     QGDLDFQRLAALPQPGWGNHPAAPQAGALIFVMPTGTPDAAAKGAFAFMRFYTSAVNT
                     ARWSMFTGYIPVRESVLQDADYQKYVAANPQAAVPVQQAKSASMDFIDPTKGKILDAL
                     TVAADQVEIENKPAQQALTEAARKAQKALDRINE"
     misc_feature    60403..61671
                     /locus_tag="Dda3937_01141"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    60541..61494
                     /locus_tag="Dda3937_01141"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_8; pfam13416"
                     /db_xref="CDD:257741"
     gene            61676..63106
                     /locus_tag="Dda3937_01142"
                     /db_xref="GeneID:9731439"
     CDS             61676..63106
                     /locus_tag="Dda3937_01142"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880827.1"
                     /db_xref="GI:307128811"
                     /db_xref="ASAP:ABF-0016347"
                     /db_xref="ERIC:ABF-0016347"
                     /db_xref="GeneID:9731439"
                     /translation="MNKPELTLAGCLTTGRGQVAFTVPEGIDCLTLTAHNHNKSYLYA
                     FVYDARQQLRANLLIEPTAKSVTIAARRALPLGGIPGPLPPGAWRLVLCSIPAQASHP
                     TQADYQITVAFDPPLPPPDEMLLTVALRGDHQVCFDYSACLEPASRWYRGDLHAHTRL
                     SDGHNSLTAAVALAQAQQLDFMFLTEHNLCHPALPTGGRTLFLPALEVTTDIGHFNVH
                     GPRRVLTLEDGDMAPETLIRQGLSLNVTGDGNISINHPMMPPWHWQYAAMPLARINTL
                     EVCCDPSWPTSAAATERALQLLSTLWNGGWRIAAVGGSDCHLRPDERYDGTTQPSVYG
                     DPTTLVFAHGLSGDAILHGLRQGRVYIDRQCGLRFRFDDGEVLPGQNVGARTVQATLA
                     VEDDRPGYVAECVAGGTVISRHALGRDEVSVALPLASWPWCRIDIRGPDGGFAGLINP
                     LYNGTHPIFSCQTFTTWGEAVARLPK"
     misc_feature    62126..>62173
                     /locus_tag="Dda3937_01142"
                     /note="Polymerase and Histidinol Phosphatase domain;
                     Region: PHP; cl17102"
                     /db_xref="CDD:266516"
     gene            63156..64259
                     /locus_tag="Dda3937_01143"
                     /db_xref="GeneID:9731440"
     CDS             63156..64259
                     /locus_tag="Dda3937_01143"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenical-resistance protein ACR3"
                     /protein_id="YP_003880828.1"
                     /db_xref="GI:307128812"
                     /db_xref="ASAP:ABF-0016349"
                     /db_xref="ERIC:ABF-0016349"
                     /db_xref="GeneID:9731440"
                     /translation="MEQATVGSGWCLAVINGIVSATCRTKDINDALMPTSLLSRWSGW
                     LERRQTVIYLLTLLVAAVLAWRWTPPDALASAINPALALMLFVTFLQLPLSRLLAALT
                     HLRFMLALVATNFVAIPLLVAVLLRLWPLEPLVAVGVAIILLCPCVDYVVTFSHQGGA
                     DSRLLLAATPVLLVLQMLLLPLWLPLLLPQTTAVDIGMAPFLHAFIVLMALPLLLAAV
                     VQRWAARYAAGAAVTNWLGLLPVPATALVLALIIAFVVPRLGLATGAVRQALPVYLLF
                     AVLAPALSWLMARLWSLPAPSGRALVFSGATRNALVILPLALAIPDALPVIPAVVVTQ
                     TLVELLAELVYIRWVPRLRFAGGQPHSSAPSGK"
     misc_feature    63372..64214
                     /locus_tag="Dda3937_01143"
                     /note="Sodium Bile acid symporter family; Region: SBF;
                     cl19217"
                     /db_xref="CDD:267570"
     gene            64272..65327
                     /locus_tag="Dda3937_01144"
                     /db_xref="GeneID:9731441"
     CDS             64272..65327
                     /locus_tag="Dda3937_01144"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880829.1"
                     /db_xref="GI:307128813"
                     /db_xref="ASAP:ABF-0016350"
                     /db_xref="ERIC:ABF-0016350"
                     /db_xref="GeneID:9731441"
                     /translation="MQAFKPLRGPERLIRMGQWAVALLFAYFLVMISAAVLEDLPSLT
                     REPDRGSFIDQTAVDAQKARMAPIQAAQETLDNALADKREAREIATNDYAKAKASFDN
                     WRATRSSTELSDQNPEVIKRNHELDRLLALQRQLDGQLADLQKQRAQLQLQLAPITLA
                     VSRLYGDADARYGEALRKAELQAFFIRLAFVGPLLLAALWLFRRYRKGNQWPFVWGFI
                     LFALFGFFVELVPYLPSFGGYIRYGVGVVLTYFGGRALLRRLQAYLERKKQEQAASQE
                     ERKESIHYEAALTSLARNQCPSCDRPLILQNGATPAFCMHCGLQLLSPCPSCGLRKNA
                     FYHYCPDCGEPAETSEN"
     misc_feature    <64383..>64724
                     /locus_tag="Dda3937_01144"
                     /note="Bacterial conjugation TrbI-like protein; Region:
                     TrbI; cl04242"
                     /db_xref="CDD:262070"
     misc_feature    64860..>65045
                     /locus_tag="Dda3937_01144"
                     /note="CobD/Cbib protein; Region: CobD_Cbib; cl00561"
                     /db_xref="CDD:260499"
     misc_feature    65154..65300
                     /locus_tag="Dda3937_01144"
                     /note="Predicted Zn-ribbon RNA-binding protein with a
                     function in translation [Translation, ribosomal structure
                     and biogenesis]; Region: COG2888; cl19729"
                     /db_xref="CDD:268082"
     misc_feature    65157..65300
                     /locus_tag="Dda3937_01144"
                     /note="Double zinc ribbon; Region: DZR; pfam12773"
                     /db_xref="CDD:257289"
     gene            complement(65612..66100)
                     /locus_tag="Dda3937_01145"
                     /db_xref="GeneID:9731442"
     CDS             complement(65612..66100)
                     /locus_tag="Dda3937_01145"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_003880830.1"
                     /db_xref="GI:307128814"
                     /db_xref="ASAP:ABF-0016352"
                     /db_xref="ERIC:ABF-0016352"
                     /db_xref="GeneID:9731442"
                     /translation="MSLVDFTPADYPRLIRWVDSAELNLLWGGPTYSFPLTATQITDH
                     LANPQFVPYLFEHQGDIVGFVELSQVEPHHSRLCRVFIDPAYRGRGLARAMLQAAIRQ
                     AVERFEAQAVSLSVFIPKIIRVAGQNAWRFEQRNALALQGKTHNESCNAATQRISRSL
                     HQ"
     misc_feature    complement(65696..66094)
                     /locus_tag="Dda3937_01145"
                     /note="Acetyltransferases, including N-acetylases of
                     ribosomal proteins [Translation, ribosomal structure and
                     biogenesis]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     misc_feature    complement(65783..65944)
                     /locus_tag="Dda3937_01145"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(65822..65827,65855..65863))
                     /locus_tag="Dda3937_01145"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(66100..67518)
                     /gene="dsdA"
                     /locus_tag="Dda3937_01146"
                     /db_xref="GeneID:9731443"
     CDS             complement(66100..67518)
                     /gene="dsdA"
                     /locus_tag="Dda3937_01146"
                     /function="1.5.1.11 metabolism; building block
                     biosynthesis; amino acids; serine"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="D-serine dehydratase"
                     /protein_id="YP_003880831.1"
                     /db_xref="GI:307128815"
                     /db_xref="ASAP:ABF-0016354"
                     /db_xref="ERIC:ABF-0016354"
                     /db_xref="GeneID:9731443"
                     /translation="MIRSGYARRLQETTIMADAVYGKSLPQWFHDFPLLEPLVNRQPV
                     CWFNPAAASVSDALGDVPLTGADVADASRRLQRFAPFLRQAFPELEASHGIIESELVP
                     VPAFAAAIARQAGLDAPPSVLLKLDSHLPVAGSVKARGGIYEVLYHAEQLALRHGLLR
                     ESDDYRRLLDDDCQQWFRRHKVAVGSTGNLGMSIGIASARLGFDTTVHMSADARQWKK
                     DRLRAHGVRVVEYDGDYGQAVAQGRREALSDPSCHFIDDENSTSLFLGYAVAGERLKA
                     QFAAQGRVVNAEHPLFVYLPCGVGGAPGGISFGLKLAFGDHVHCIFAEPTESPCMLMG
                     VYTGLHDQLAVQDFGISNRTTADGLAVGRPSGFVGKAMQRLIDGYYTLTDDDMLALLH
                     VMHDTQQILLEPSALAGAPGFLRLLQENQGYRQRAPLTPQRCRQGTHVIWATGGGMVP
                     EEEMMRYLQAGAASRLNGKETP"
     misc_feature    complement(66124..67452)
                     /gene="dsdA"
                     /locus_tag="Dda3937_01146"
                     /note="D-serine dehydratase; Provisional; Region:
                     PRK02991"
                     /db_xref="CDD:235096"
     misc_feature    complement(order(66184..66189,66304..66306,66613..66627,
                     66952..66954,67108..67113))
                     /gene="dsdA"
                     /locus_tag="Dda3937_01146"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:107202"
     misc_feature    complement(67108..67110)
                     /gene="dsdA"
                     /locus_tag="Dda3937_01146"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107202"
     gene            complement(67601..68200)
                     /locus_tag="Dda3937_01147"
                     /db_xref="GeneID:9731444"
     CDS             complement(67601..68200)
                     /locus_tag="Dda3937_01147"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880832.1"
                     /db_xref="GI:307128816"
                     /db_xref="ASAP:ABF-0016356"
                     /db_xref="ERIC:ABF-0016356"
                     /db_xref="GeneID:9731444"
                     /translation="MQISFKKYEQYLSIFSPPCLPPDLLRRAHPQRVAARIELAVASS
                     RTRRHTSIDRRRLAYRLHPVRVRQQIFRHNPADFRPLRLGKFTIAIRRIRRNSQPAQR
                     QHQQQSACRQPVYFHDYLLPSGDPLWQAHSPHEMGLPHSVSEPCHSRFAAPRPRSVSA
                     VPSGDTQSGYRSGGKFVVKAGYAGIKILYRVEKLSYLYD"
     gene            68310..68576
                     /locus_tag="Dda3937_01148"
                     /db_xref="GeneID:9731445"
     CDS             68310..68576
                     /locus_tag="Dda3937_01148"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880833.1"
                     /db_xref="GI:307128817"
                     /db_xref="ASAP:ABF-0016359"
                     /db_xref="ERIC:ABF-0016359"
                     /db_xref="GeneID:9731445"
                     /translation="MKAIKNFVAVIALATVSFGTFAATTSTATEVQQSASLSVGTVST
                     TANTLDGLQASLSEKASAAGAKSFRIISATGNENQMRGVAELYN"
     misc_feature    68421..68573
                     /locus_tag="Dda3937_01148"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; pfam07338"
                     /db_xref="CDD:254164"
     gene            complement(68527..68778)
                     /locus_tag="Dda3937_04428"
                     /db_xref="GeneID:9731446"
     CDS             complement(68527..68778)
                     /locus_tag="Dda3937_04428"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880834.1"
                     /db_xref="GI:307128818"
                     /db_xref="ASAP:ABF-0046835"
                     /db_xref="ERIC:ABF-0046835"
                     /db_xref="GeneID:9731446"
                     /translation="MAFEPLLVVRAMQWKRNDTVYPARNYSLTRQDSPFVRQHGCLST
                     ASAARRRPLLVWIIVADDNEKLIISYTVQLRRASDFRCR"
     gene            complement(69021..70172)
                     /locus_tag="Dda3937_01149"
                     /db_xref="GeneID:9731447"
     CDS             complement(69021..70172)
                     /locus_tag="Dda3937_01149"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator FrcR for fructose
                     utilization, ROK family"
                     /protein_id="YP_003880835.1"
                     /db_xref="GI:307128819"
                     /db_xref="ASAP:ABF-0016361"
                     /db_xref="ERIC:ABF-0016361"
                     /db_xref="GeneID:9731447"
                     /translation="MQTCEGNRTEPGQGIPMEKRELTATHRKLLGLLRRSGSLSRSAL
                     AAASGLTTAAVSMMTRDMLNLGLLEESDRAQGRRGPPQINLRPAAHAGYVLGVYAEYD
                     LICLILMDYAGQCVAETTLHGDFRIVDSVADTLADAIRTLLDAQPQARDRLLAVSLAL
                     PARFDGGAMPVWIAPGLAAWRGVDIARQLGDRLGCPVLVENDANCAAIGELHFGSAAP
                     DDSFFYLYIGKGIGGALILNGELHRGKQGNAGEIGALRTRAQPRPSFDDLHDCLLAAG
                     EPLPFTTADADWQALAASPAGEGWVQRAAGELYGLLYSVTALLDPSCLYLGGTLPAPF
                     MAGLQAAVMTQTPAPDDDAPLTLPPVRLSTLPTQNSAAFGAAALALNQY"
     misc_feature    complement(<69939..70124)
                     /locus_tag="Dda3937_01149"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(69939..70109)
                     /locus_tag="Dda3937_01149"
                     /note="MarR family; Region: MarR_2; cl17246"
                     /db_xref="CDD:266584"
     misc_feature    complement(69159..69902)
                     /locus_tag="Dda3937_01149"
                     /note="Transcriptional regulator/sugar kinase
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: NagC; COG1940"
                     /db_xref="CDD:224851"
     misc_feature    complement(69402..69863)
                     /locus_tag="Dda3937_01149"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cd00012"
                     /db_xref="CDD:212657"
     misc_feature    complement(order(69486..69497,69567..69569,69858..69860))
                     /locus_tag="Dda3937_01149"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            70225..71595
                     /locus_tag="Dda3937_01150"
                     /db_xref="GeneID:9731448"
     CDS             70225..71595
                     /locus_tag="Dda3937_01150"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_003880836.1"
                     /db_xref="GI:307128820"
                     /db_xref="ASAP:ABF-0016362"
                     /db_xref="ERIC:ABF-0016362"
                     /db_xref="GeneID:9731448"
                     /translation="MRKLVSLSLSVLLASGLIAHSAVADVIKLKLWTLNDRNAPMRTV
                     NIEEAAGVLNQQFAAAGVDRKIVIDTHASAVQGWDDLALDTLKAFGVNQGPDIVLLPH
                     EWIGEFARNGYAMPMDGQIKANPWVYADILPVLWEAMKYQGKVYGVPQDAEIRMFFYN
                     KDMLRKIGKDEAFIDSLPARVDSGEFTMDDLTALAKEVVDRHAAPIGMLHRPNVGIDY
                     LMVFAACGAKFMDEKTGKLLFAKKEVETALSWYARNVAAGVTPTDNTAMSWDTIQTAF
                     KQEKAFLFHQGIWAMAWQVNDNFGPAWPADKAGYTHKIGWIPAPAAVKGGKPANLSHP
                     IAYVVSNKSQYKDLAAQLVAIASLPYYNNRHAVSSYHTAISYAQTAMPQYTDNWALSE
                     AGKMMKNITFVPNHARFGDYNRVLFKGLQAVETKRMTPAQAVDFIADELETQLGKDVE
                     IVDSLH"
     misc_feature    70285..71565
                     /locus_tag="Dda3937_01150"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    70387..71286
                     /locus_tag="Dda3937_01150"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            71592..72566
                     /locus_tag="Dda3937_01151"
                     /db_xref="GeneID:9731449"
     CDS             71592..72566
                     /locus_tag="Dda3937_01151"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="YP_003880837.1"
                     /db_xref="GI:307128821"
                     /db_xref="ASAP:ABF-0016363"
                     /db_xref="ERIC:ABF-0016363"
                     /db_xref="GeneID:9731449"
                     /translation="MIEGAAGERASPALTSEVAMPVTLSNRPAGVHPARWLAPAISVL
                     AVFFVAPMLLNLVIAFSDMGSNLQISAFGTDNLMRLLVADKRLPAILLTTLVYVVSTL
                     LLFNLGLGIVLAIATTAVPPALGALFRGIWFLPRISPSVLYALLWIWAADPSPHSLIN
                     QVVVGVFRLPPLNLRNDHPMILIVVANGLVGTSFAMVILASTIRAIPAHLWHAARVDG
                     AGEWSVIRHVVLPALKSPVCFIALYQALSLMVTYEYILLITGGGPVYDTTTYALYIYR
                     RAFESGAYGYGAMLALGLMVFGGLLTLLQWRMMNMRAQFTPPRIEVMR"
     misc_feature    71694..72533
                     /locus_tag="Dda3937_01151"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    71862..72485
                     /locus_tag="Dda3937_01151"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(71913..71918,71925..71930,71943..71945,71973..71984,
                     71988..72017,72024..72029,72033..72035,72156..72161,
                     72165..72167,72171..72173,72180..72185,72189..72191,
                     72201..72206,72213..72215,72264..72266,72306..72311,
                     72318..72320,72345..72356,72363..72368,72405..72410,
                     72438..72443,72450..72455,72459..72464,72471..72476,
                     72483..72485)
                     /locus_tag="Dda3937_01151"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(71991..72035,72345..72362)
                     /locus_tag="Dda3937_01151"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(72033..72035,72141..72143,72363..72365,72399..72401,
                     72408..72410,72438..72440)
                     /locus_tag="Dda3937_01151"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(72216..72254,72270..72275,72285..72287)
                     /locus_tag="Dda3937_01151"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            72506..73609
                     /locus_tag="Dda3937_01152"
                     /db_xref="GeneID:9731450"
     CDS             72506..73609
                     /locus_tag="Dda3937_01152"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="YP_003880838.1"
                     /db_xref="GI:307128822"
                     /db_xref="ASAP:ABF-0016364"
                     /db_xref="ERIC:ABF-0016364"
                     /db_xref="GeneID:9731450"
                     /translation="MADDEHARAVYSAAYRGDAMTTMNAVDWARQAARSRWNRVGFLA
                     SVVLFLTLVSIPIVTPYLWLLAISFTHRDGDSEYQVLWRLLTIAALAYGLLLAVAWRA
                     RTEQRARRLRWLVGLAALLVFGLWVAPQLTLHNYRFLWNPDVQATGMQSGTLPSVWTA
                     LGNSLLFAGGHTLLVTLLAVPADYALSRLGFRRREGVLKALLLLHAFPVMALTVALFI
                     QLYWMGLLNSLWGVMLVMCALELPFAIFVMKNFFDGVSWDIEMSAITDGASRFQAFRL
                     VVLPQVTGGIIAIATFAFLRGWEEYIFVRTLLIDSGRMTMSLYLFWASQDSMGADSGL
                     IAAVGVIYILPVLALYLLTQKYLTQMSVGGIKG"
     misc_feature    72881..73603
                     /locus_tag="Dda3937_01152"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    72986..73546
                     /locus_tag="Dda3937_01152"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(73034..73039,73046..73051,73064..73066,73094..73105,
                     73109..73138,73145..73150,73154..73156,73217..73222,
                     73226..73228,73232..73234,73241..73246,73250..73252,
                     73262..73267,73274..73276,73325..73327,73367..73372,
                     73379..73381,73400..73411,73421..73426,73463..73468,
                     73496..73501,73508..73513,73517..73522,73529..73534,
                     73541..73546)
                     /locus_tag="Dda3937_01152"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(73112..73156,73400..73417)
                     /locus_tag="Dda3937_01152"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(73154..73156,73202..73204,73421..73423,73457..73459,
                     73466..73468,73496..73498)
                     /locus_tag="Dda3937_01152"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(73277..73315,73331..73336,73346..73348)
                     /locus_tag="Dda3937_01152"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            73593..74717
                     /locus_tag="Dda3937_01153"
                     /db_xref="GeneID:9731451"
     CDS             73593..74717
                     /locus_tag="Dda3937_01153"
                     /function="4.S.173 transport; substrate; sugar"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose ABC transporter ATP-binding protein"
                     /protein_id="YP_003880839.1"
                     /db_xref="GI:307128823"
                     /db_xref="ASAP:ABF-0016365"
                     /db_xref="ERIC:ABF-0016365"
                     /db_xref="GeneID:9731451"
                     /translation="MELKAEMMAEIVLDGVTKAWGDTPVLHPVNLTLADGEFVAILGP
                     SGCGKSTTLFLLAGLYAPTQGQILFDGQRVNGVDARDRNVGVVFQSYALYPHLSVYDN
                     IAFPLRFKPAERAERDQRVREAAALVQVTELLERKPSALSGGQQQRVALARALVKRPS
                     LLLLDEPLSNLDATLRMTMRTELKAIHARSRATTLMVTHDQLEAMTLASRIICMNQGR
                     VEQIGTPQQLYRQPANTFVAGFIGSPPICLLPGQANGRWLTVGEISWGLSSTYHGALT
                     LGIRPEDVTLTPLGAGPLSGRIEHIEPMGREVLYRLHTSLGPLQALAAGSTAQYDAGM
                     LVGVSPSVDALLLFDADGNRLPDVGVVLPADVVSACRTAG"
     misc_feature    73614..74645
                     /locus_tag="Dda3937_01153"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    73623..74318
                     /locus_tag="Dda3937_01153"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    73719..73742
                     /locus_tag="Dda3937_01153"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(73728..73733,73737..73745,73857..73859,74085..74090,
                     74187..74189)
                     /locus_tag="Dda3937_01153"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    73848..73859
                     /locus_tag="Dda3937_01153"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    74013..74042
                     /locus_tag="Dda3937_01153"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    74073..74090
                     /locus_tag="Dda3937_01153"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    74097..74108
                     /locus_tag="Dda3937_01153"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    74175..74195
                     /locus_tag="Dda3937_01153"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    74421..74636
                     /locus_tag="Dda3937_01153"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            74745..75608
                     /locus_tag="Dda3937_01154"
                     /db_xref="GeneID:9731452"
     CDS             74745..75608
                     /locus_tag="Dda3937_01154"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="YP_003880840.1"
                     /db_xref="GI:307128824"
                     /db_xref="ASAP:ABF-0016366"
                     /db_xref="ERIC:ABF-0016366"
                     /db_xref="GeneID:9731452"
                     /translation="MHIVSYNIQYGLGRDGRYDLARIADEVRGADIICMQEVERFWQR
                     SGMMDQPAELAALLGEYHWVYGANLDMDASTVSADGRVVNRRRQFGTLTLSRRPILSS
                     RNFPLPKFGTLTQHSIQQGVLETVIDTGAGAIRIYNTHLSHLCAGTRLPQVEAMLALF
                     ARAPDEGGAWCGGHPDPSAGWTEGRMPLMPLEMILMGDLNCLPDSEEYSRLVGPVSPH
                     HGRLVRHRGLMDAWVAAGQPESSGSTHPSVGGRIDHCLLTPSLGLTVRRCWADTENQG
                     SDHHPLWVELQ"
     misc_feature    74745..75602
                     /locus_tag="Dda3937_01154"
                     /note="Exonuclease-Endonuclease-Phosphatase (EEP) domain
                     superfamily; Region: EEP; cl00490"
                     /db_xref="CDD:260458"
     misc_feature    order(74763..74765,74853..74855,75162..75164,75336..75338,
                     75342..75344,75501..75503,75576..75581)
                     /locus_tag="Dda3937_01154"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197306"
     misc_feature    order(74853..74855,75576..75578)
                     /locus_tag="Dda3937_01154"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197306"
     misc_feature    order(75162..75164,75342..75344,75579..75581)
                     /locus_tag="Dda3937_01154"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197306"
     gene            75807..76073
                     /locus_tag="Dda3937_01155"
                     /db_xref="GeneID:9731453"
     CDS             75807..76073
                     /locus_tag="Dda3937_01155"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880841.1"
                     /db_xref="GI:307128825"
                     /db_xref="ASAP:ABF-0016369"
                     /db_xref="ERIC:ABF-0016369"
                     /db_xref="GeneID:9731453"
                     /translation="MKAIKNFVAVIALATVSFGTFAATTSTATEVQQSASLSVGTVSA
                     TAATLDGLQASLSQKAGAAGAKSFRIISATSGENQMHGVAELYN"
     misc_feature    75918..76070
                     /locus_tag="Dda3937_01155"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; pfam07338"
                     /db_xref="CDD:254164"
     gene            complement(76197..76829)
                     /locus_tag="Dda3937_01156"
                     /db_xref="GeneID:9731454"
     CDS             complement(76197..76829)
                     /locus_tag="Dda3937_01156"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880842.1"
                     /db_xref="GI:307128826"
                     /db_xref="ASAP:ABF-0016371"
                     /db_xref="ERIC:ABF-0016371"
                     /db_xref="GeneID:9731454"
                     /translation="MRKITKGTEPASLTAWKRANPTGRYDDLTETERQDIRDACAKEQ
                     FYLCAYCCKPISGDNSDTMNEHVQARKLAPHRSLDFTNIAASCTTPNQCDAAHGSQPF
                     SLTPLMAECETELQFMISGRVSGTTARAQDAIRVLNLGDNETHNKKLIEIRKQFIDSL
                     LWTNGIDPDEGLEDDDLLTAVINDFSSPQNGRLTPYAPVLVNILRGWLSA"
     misc_feature    complement(76398..76757)
                     /locus_tag="Dda3937_01156"
                     /note="TIGR02646 family protein; Region: TIGR02646"
                     /db_xref="CDD:131694"
     gene            complement(76813..78342)
                     /locus_tag="Dda3937_01157"
                     /db_xref="GeneID:9731455"
     CDS             complement(76813..78342)
                     /locus_tag="Dda3937_01157"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_003880843.1"
                     /db_xref="GI:307128827"
                     /db_xref="ASAP:ABF-0016372"
                     /db_xref="ERIC:ABF-0016372"
                     /db_xref="GeneID:9731455"
                     /translation="MDVSLPEDLYTAQATQRLPKERMMKIKQFRLHNVGRFTSLDALI
                     APTADYPSNVTVLVGNNGAGKTSILQALATSLSWLVARVRSEKGSGSGINEGTITNGH
                     TSAAIEVMAQDTPPLSGHAADNDAEYHWTLAKTRSGKKGQHTSQLNAVSALADHYRSA
                     LTQNEQSSLPLIAFYPVERSVLDIPLKIKNKHHFQQVDGYDNALNQGVDFRRFFEWFR
                     EREDIENENDGVVLTNLFESNPEGVLKVFEDIEDADYRVDKLEIFDWAGLSEEFKKLN
                     NALKLMQEVQDKAKDPQLNAVRSAITAFMPGFSNLKVRRKPRLHMSVDKNGEAFNVLQ
                     LSQGEKSLMALVGDIARRLAIMNPTLDNPLHGQGIVLIDEVDMHLHPSWQRSIIERLT
                     TTFPHCQFILTTHSPLVISDYKDVLVYSLDNGELTVVPSQYGQDANSVLLEVMDTHIR
                     NARIAEKFSDLLDMIQRQQLTPAKALLDELTAELPATNLELTKARLLLRKQELRGEKN
                     H"
     misc_feature    complement(77113..78270)
                     /locus_tag="Dda3937_01157"
                     /note="AAA ATPase domain; Region: AAA_15; pfam13175"
                     /db_xref="CDD:257543"
     misc_feature    complement(77665..78255)
                     /locus_tag="Dda3937_01157"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:257800"
     misc_feature    complement(78145..78168)
                     /locus_tag="Dda3937_01157"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(78142..78150,78154..78159))
                     /locus_tag="Dda3937_01157"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(77068..>77349)
                     /locus_tag="Dda3937_01157"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cd00267"
                     /db_xref="CDD:213179"
     misc_feature    complement(77341..77349)
                     /locus_tag="Dda3937_01157"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(77311..77340)
                     /locus_tag="Dda3937_01157"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(77221..77238)
                     /locus_tag="Dda3937_01157"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(77203..77214)
                     /locus_tag="Dda3937_01157"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(77122..77142)
                     /locus_tag="Dda3937_01157"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(78371..79555)
                     /gene="yhiN"
                     /locus_tag="Dda3937_01158"
                     /db_xref="GeneID:9731456"
     CDS             complement(78371..79555)
                     /gene="yhiN"
                     /locus_tag="Dda3937_01158"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase with FAD/NAD(P)-binding domain"
                     /protein_id="YP_003880844.1"
                     /db_xref="GI:307128828"
                     /db_xref="ASAP:ABF-0016373"
                     /db_xref="ERIC:ABF-0016373"
                     /db_xref="GeneID:9731456"
                     /translation="MEQFDVIIIGAGAAGLFCAAQAGQRGLRALLVDNGKKPGRKILM
                     SGGGRCNFTNLYAEPAAYLSNNPHFCKSALARYTQWDFIDLVNRHGIAYHEKTLGQLF
                     CDDSAQQIVDMLMKECETGKVTLRLRSEVSSVEKSEQFQVTLNTGVVQAPAVVVATGG
                     LSMPGLGATPFGYQLATQFGLKVLPTRAALVPFTLHKPLLEQLQTLSGVSVPAVVTAE
                     NGTTFRENILFTHRGLSGPAVLQLSSYWQPGEFVTINLLPNLDLTECLNNERLAHPNQ
                     SLKNTLAQWLPKRLVESLQALGQLPDVTLKQLNKPQQAEVETTLQQWRVQPNGTEGYR
                     TAEVTLGGVDTRELSSKTMEANNVPGLYFIGEVVDVTGWLGGYNFQWAWSSAWACAQA
                     LG"
     misc_feature    complement(78374..79555)
                     /gene="yhiN"
                     /locus_tag="Dda3937_01158"
                     /note="Predicted flavoproteins [General function
                     prediction only]; Region: COG2081"
                     /db_xref="CDD:224992"
     misc_feature    complement(<79145..79543)
                     /gene="yhiN"
                     /locus_tag="Dda3937_01158"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(78380..>79090)
                     /gene="yhiN"
                     /locus_tag="Dda3937_01158"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            79859..81367
                     /gene="pitA"
                     /locus_tag="Dda3937_01159"
                     /db_xref="GeneID:9731457"
     CDS             79859..81367
                     /gene="pitA"
                     /locus_tag="Dda3937_01159"
                     /function="4.2.A.20 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Inorganic Phosphate Transporter (PiT) Family"
                     /function="4.S.155 transport; substrate; phosphate"
                     /function="1.8.1 metabolism; metabolism of other
                     compounds; phosphorous metabolism"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="low-affinity phosphate transporter"
                     /protein_id="YP_003880845.1"
                     /db_xref="GI:307128829"
                     /db_xref="ASAP:ABF-0016375"
                     /db_xref="ERIC:ABF-0016375"
                     /db_xref="GeneID:9731457"
                     /translation="MLHLFAGLDFHTGLMLVLALLFVLFYEAINGFHDTANAVATVIY
                     TRAMRAQLAVVMAGVFNFLGVLLGGLSVAYAIVHLLPTDLLLNVSSTHGLAMVFSMLL
                     AAIIWNLGTWYFGLPASSSHTLIGSIIGIGLTNALVTHTSVVDALNIPKMVSIFLSLL
                     VSPVVGMIIAGLMVYLLRRYWSNNKKRQRVHLTPAEREKQDGKRKPPFWTRTALILSA
                     VGVSFSHGANDGQKGIGLIMLVLIGVAPAGFMLNMNASGYDISRTRDAVLNLQAYYQS
                     HSAALTQVIDLSHPVIPAPENVIPSTGNKPDFHCDTSRAMIAIDRVQGLLNNIKSYDE
                     LAADDRARARRLLMCMADTLDRVVKLPETSSDDKRLLNNLRSDLLYTVEYAPLWIIVA
                     VALALSLGTMVGWKRVAVTIGEKIGRKGMTYAQGVSAQVTAAMSIGIASYTGMPVSTT
                     HVLSSAVAGTMIVDGGGVQGKTVKSILLAWVFTLPVSMLLSGVLYWLSLKLI"
     misc_feature    79934..81364
                     /gene="pitA"
                     /locus_tag="Dda3937_01159"
                     /note="Phosphate/sulphate permeases [Inorganic ion
                     transport and metabolism]; Region: PitA; COG0306"
                     /db_xref="CDD:223383"
     gene            complement(81499..81837)
                     /gene="uspB"
                     /locus_tag="Dda3937_01160"
                     /gene_synonym="yhiO"
                     /db_xref="GeneID:9731458"
     CDS             complement(81499..81837)
                     /gene="uspB"
                     /locus_tag="Dda3937_01160"
                     /gene_synonym="yhiO"
                     /function="5.5.6 cell processes; adaptation to stress;
                     other (mechanical, nutritional, oxidative stress)"
                     /function="7.3 location of gene products; inner membrane"
                     /function="5.5 cell processes; adaptation to stress"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="6.1 cell structure; membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein B"
                     /protein_id="YP_003880846.1"
                     /db_xref="GI:307128830"
                     /db_xref="ASAP:ABF-0016377"
                     /db_xref="ERIC:ABF-0016377"
                     /db_xref="GeneID:9731458"
                     /translation="MMISTFALFWALCVVCVINMARYYSSLRVLLLILRDCDPLLYQY
                     VDGGGFFTSHGQPSKQLRLVRYIYAQRYLDHHDPEFIRRCARVRGQFLLTSALCGLVV
                     VSLIALIIWH"
     misc_feature    complement(81502..81834)
                     /gene="uspB"
                     /locus_tag="Dda3937_01160"
                     /gene_synonym="yhiO"
                     /note="universal stress protein UspB; Provisional; Region:
                     PRK04960"
                     /db_xref="CDD:235323"
     gene            81876..82418
                     /locus_tag="Dda3937_04429"
                     /db_xref="GeneID:9731459"
     CDS             81876..82418
                     /locus_tag="Dda3937_04429"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880847.1"
                     /db_xref="GI:307128831"
                     /db_xref="ASAP:ABF-0046836"
                     /db_xref="ERIC:ABF-0046836"
                     /db_xref="GeneID:9731459"
                     /translation="MSGPADITSVGIYATRYSRDVMGLPGHGELPGCSSSPLYPCLEK
                     DLQGPPQFHCRRALRFFSISDARFLPAKNITTSFDLAPAFFAVGSVLFNYTFYIWARG
                     FTVVDSFTVVESTGIVDSIGIVDSIGANGRPLQGKWLPAFSEPLQNMWRCDLWNITPN
                     WWGVMLITVIGYQTGRRNIC"
     gene            82453..82887
                     /gene="uspA"
                     /locus_tag="Dda3937_01161"
                     /db_xref="GeneID:9731460"
     CDS             82453..82887
                     /gene="uspA"
                     /locus_tag="Dda3937_01161"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /function="5.5 cell processes; adaptation to stress"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress global response regulator"
                     /protein_id="YP_003880848.1"
                     /db_xref="GI:307128832"
                     /db_xref="ASAP:ABF-0016379"
                     /db_xref="ERIC:ABF-0016379"
                     /db_xref="GeneID:9731460"
                     /translation="MAYKHILIAVDLSPESKVLVEKAVSMARPYDAKVSLIHVDVNYS
                     DLYTGLIDVNLGDMQQRISEETQNALKELADNAGYPISETLSGSGDLGQVLVDAIRKY
                     DVDLVLCGHHQDFWSKLMSSARQLINTVHIDMLIVPLREEEE"
     misc_feature    82465..82863
                     /gene="uspA"
                     /locus_tag="Dda3937_01161"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    order(82477..82485,82567..82569,82777..82782,82783..82788,
                     82813..82821)
                     /gene="uspA"
                     /locus_tag="Dda3937_01161"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            complement(82990..84996)
                     /locus_tag="Dda3937_01162"
                     /db_xref="GeneID:9731461"
     CDS             complement(82990..84996)
                     /locus_tag="Dda3937_01162"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="serine chemoreceptor protein"
                     /protein_id="YP_003880849.1"
                     /db_xref="GI:307128833"
                     /db_xref="ASAP:ABF-0016380"
                     /db_xref="ERIC:ABF-0016380"
                     /db_xref="GeneID:9731461"
                     /translation="MSIELISYPSSIQTPQVSPSATGKKTLSTRALVLITTVFIITCG
                     FILTIGFLLWQSGQQQKTTAQQLLEQTAYTSAYSVQNRLDVALFAARDLVQSVISLRE
                     AGAPDRATAEQLLKNALKSHPDLLSMSLAWEPNAFDGKDQQYVSQPEQDPKGRFVRYV
                     DRDGSGKVALHNLTDYETPGSGDYYLLPGKLQKEVILEPYSYPYNGVDVLLTSIAVPI
                     MIDGKFYGSVTADFSLDTLQQMVNGIKPYQGAGYATMLSASGAYIAHPDKTRIAKKLE
                     GDPPLMDSITAGKPYTRQRFNSFTNAEMMNAYVPVTIGNTGTPWMLGVSVPEQVVMAE
                     SVRLRYIGALMTLLSILVVSGVIGLIFTRKVLRPVGGEPADAAAIALAVAQGNLTLHI
                     PVQPKDTSSIFYAMSEMQQQLRTIVEQLMSTSESVSHGAAEISAGNVDLASRTEQQAA
                     ALEETAASMEQITATVKQNADNAHSATRLTQNAAHIAQRGDEIVSQVVTVMGSIDESS
                     KKISEITGIISSIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSASAVKD
                     ITALIGESAERVGHGVGMVENAGKTMRDMLTAVTSVNDIMSEIVAASDEQSRGISQVT
                     QAVHEMDGVTQQNAALVQQATAAAASLEDQARQLAQLVQVFRIH"
     misc_feature    complement(84172..84411)
                     /locus_tag="Dda3937_01162"
                     /note="Cache domain; Region: Cache_1; pfam02743"
                     /db_xref="CDD:251508"
     misc_feature    complement(83608..>83784)
                     /locus_tag="Dda3937_01162"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(82999..83733)
                     /locus_tag="Dda3937_01162"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(83062..83661)
                     /locus_tag="Dda3937_01162"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(83065..83070,83077..83079,83086..83091,
                     83098..83100,83107..83112,83116..83121,83128..83133,
                     83137..83142,83149..83151,83158..83163,83170..83172,
                     83179..83184,83191..83196,83200..83205,83212..83214,
                     83221..83226,83233..83235,83242..83247,83284..83289,
                     83296..83301,83305..83310,83317..83322,83329..83331,
                     83338..83343,83350..83352,83359..83361,83371..83373,
                     83392..83394,83401..83403,83413..83415,83422..83427,
                     83434..83436,83443..83445,83452..83457,83464..83469,
                     83476..83478,83485..83490,83494..83496,83506..83511,
                     83515..83520,83527..83529,83536..83541,83548..83553,
                     83560..83562,83569..83574,83581..83583,83590..83595,
                     83599..83604,83611..83613,83620..83625,83632..83637))
                     /locus_tag="Dda3937_01162"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(83326..83427)
                     /locus_tag="Dda3937_01162"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            85230..86045
                     /gene="yidA"
                     /locus_tag="Dda3937_02521"
                     /db_xref="GeneID:9731462"
     CDS             85230..86045
                     /gene="yidA"
                     /locus_tag="Dda3937_02521"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="multifunctional Erythrose 4-P, mannose 1-P, and
                     alpha-D-glucose-1-P phosphatase"
                     /protein_id="YP_003880850.1"
                     /db_xref="GI:307128834"
                     /db_xref="ASAP:ABF-0018382"
                     /db_xref="ERIC:ABF-0018382"
                     /db_xref="GeneID:9731462"
                     /translation="MAIKLIAIDMDGTLLTPENQISPAVKQAIVAAREKGVYVALATG
                     RPFIGVERYLKQLGLQQEGHYCITNNGALVQRTATGECVAQTTLSFDDYLHFEALSRE
                     LGVHFHALDFNYVYTANKDISAYTVHESHLTSMPLKYRAVEEMDPSLRFPKVMMIDEP
                     EVLDAAIARIPREDFARYTIMKSAAFYLEILDKRVNKGEGVKMLAQHLGLERDEVMAL
                     GDQENDLAMIEFAGLGVAMGNAIDVVKAASQFVTRSNSEDGVAYAIEKFVLNV"
     misc_feature    85230..86039
                     /gene="yidA"
                     /locus_tag="Dda3937_02521"
                     /note="sugar phosphate phosphatase; Provisional; Region:
                     PRK10513"
                     /db_xref="CDD:182509"
     misc_feature    85242..>85454
                     /gene="yidA"
                     /locus_tag="Dda3937_02521"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(85254..85262,85356..85361)
                     /gene="yidA"
                     /locus_tag="Dda3937_02521"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    85254..85271
                     /gene="yidA"
                     /locus_tag="Dda3937_02521"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    85356..85358
                     /gene="yidA"
                     /locus_tag="Dda3937_02521"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <85785..86012
                     /gene="yidA"
                     /locus_tag="Dda3937_02521"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            complement(86351..87535)
                     /gene="uxuA"
                     /locus_tag="Dda3937_02522"
                     /db_xref="GeneID:9731463"
     CDS             complement(86351..87535)
                     /gene="uxuA"
                     /locus_tag="Dda3937_02522"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /codon_start=1
                     /transl_table=11
                     /product="mannonate dehydratase"
                     /protein_id="YP_003880851.1"
                     /db_xref="GI:307128835"
                     /db_xref="ASAP:ABF-0018384"
                     /db_xref="ERIC:ABF-0018384"
                     /db_xref="GeneID:9731463"
                     /translation="MEHTWRWYGPNDPVSLDDARQAGATGIVTALHHIPNGEVWSIEE
                     IKKRQAQLAEKGLIWSVVESVPIHEAIKTQTGDYRKYIANYQQSLRNLGACGIDTVCY
                     NFMPVLDWTRTDLEYPLPDGSRALRFDHTAFAAFELHLLKRDGAAADYTDDEQRQAAA
                     YFAAMSDADKDKLTRNIIAGLPGAEEGYTLDQFRAQLAQYDGIDKAKLREHMAEFLRA
                     IVPVAEEAGIVLAVHPDDPPRPILGLPRIVSTIEDMQWLKDAVDSIHNGFTMCTGSYG
                     VRADNDLVKMIETFADRIHFTHLRATCREDNPKSFHEAAHLHGDVDMVKVVKAILAEE
                     YRRRQQGNTRAIPMRPDHGHQMLDDLKKKTNPGYSAIGRLKGLAEVRGVELAIKQTFF
                     ND"
     misc_feature    complement(86354..87535)
                     /gene="uxuA"
                     /locus_tag="Dda3937_02522"
                     /note="mannonate dehydratase; Provisional; Region:
                     PRK03906"
                     /db_xref="CDD:235172"
     misc_feature    complement(86357..87535)
                     /gene="uxuA"
                     /locus_tag="Dda3937_02522"
                     /note="mannonate dehydratase; Region: uxuA; TIGR00695"
                     /db_xref="CDD:129778"
     gene            87797..88489
                     /locus_tag="Dda3937_02523"
                     /db_xref="GeneID:9731464"
     CDS             87797..88489
                     /locus_tag="Dda3937_02523"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator NanR"
                     /protein_id="YP_003880852.1"
                     /db_xref="GI:307128836"
                     /db_xref="ASAP:ABF-0018385"
                     /db_xref="ERIC:ABF-0018385"
                     /db_xref="GeneID:9731464"
                     /translation="MLPTLKVERLYRQISNLLINCIRNGQFAAGQLLPSERELAKQLG
                     VSRSSIREALIALEITGWVEIRTGNGVYVNDPLPDAPPAAPPEEEFSLRAFIQARQVY
                     EAMMAELAAVHATDEQRAALQDITRDLSRLHVNDAQFLHEDKRFHLLISEMSGNEVLQ
                     DMMDYLWNKRQSSRFVRLETLYADSDFPRTMNQDHADIAEAIVARDPARARASMERHL
                     QHVYDHLFSGDK"
     misc_feature    87797..88471
                     /locus_tag="Dda3937_02523"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    87824..88018
                     /locus_tag="Dda3937_02523"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(87827..87829,87896..87898,87902..87907,87929..87943,
                     87947..87952,87959..87961,87989..87994,87998..88009)
                     /locus_tag="Dda3937_02523"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    88082..88456
                     /locus_tag="Dda3937_02523"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            complement(88792..89796)
                     /locus_tag="Dda3937_02524"
                     /db_xref="GeneID:9731465"
     CDS             complement(88792..89796)
                     /locus_tag="Dda3937_02524"
                     /function="8.3.1 extrachromosomal; transposon related;
                     transposases"
                     /note="IS1111 family"
                     /codon_start=1
                     /transl_table=11
                     /product="ISEch4 transposase"
                     /protein_id="YP_003880853.1"
                     /db_xref="GI:307128837"
                     /db_xref="ASAP:ABF-0018386"
                     /db_xref="ERIC:ABF-0018386"
                     /db_xref="GeneID:9731465"
                     /translation="MQNVTLIGIDLGKHSFHVHAQDKNGNALLRKKFSRNQLTAFLST
                     CTASTVVMESCAGAHFMARHISQFGHQVKLISPQFVRPFVKSNKNDFIDAEAICEAAS
                     RPSMRFVTPRTEDQQAMSAFHRVRDTLVRERVKTTNQMHAFLLEFGISMPRGIAIIRR
                     LAVVLEEHELPPYLARLLMRLHQHYACLTEQIKELEQELKIHIAGDDTAQRLLTIPGV
                     GLITASLLATKLGDGKSYASSRDFAASTGLVPRQYSTGGKSTLMGISKRGDKNLRRLL
                     VQCARAFMQRLEHNQGRLADWVKTQLSRHHSNVVACGLANKLARIAWSVTTHRTAFIQ
                     "
     misc_feature    complement(88828..89784)
                     /locus_tag="Dda3937_02524"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    complement(89380..89778)
                     /locus_tag="Dda3937_02524"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    complement(88939..89172)
                     /locus_tag="Dda3937_02524"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(89920..90177)
                     /gene="ybiJ"
                     /locus_tag="Dda3937_02525"
                     /db_xref="GeneID:9731466"
     CDS             complement(89920..90177)
                     /gene="ybiJ"
                     /locus_tag="Dda3937_02525"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880854.1"
                     /db_xref="GI:307128838"
                     /db_xref="ASAP:ABF-0018387"
                     /db_xref="ERIC:ABF-0018387"
                     /db_xref="GeneID:9731466"
                     /translation="MKNVKTIAIAATLATLSFGAFAAQSVSYEQAQQLDKIGSVSATA
                     NDLSSLQAKLAHQAEAAGASAYTITYAGGDNTLRGNAVIYK"
     misc_feature    complement(89923..90177)
                     /gene="ybiJ"
                     /locus_tag="Dda3937_02525"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; cl11507"
                     /db_xref="CDD:264403"
     gene            90607..91893
                     /locus_tag="Dda3937_02526"
                     /db_xref="GeneID:9731467"
     CDS             90607..91893
                     /locus_tag="Dda3937_02526"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880855.1"
                     /db_xref="GI:307128839"
                     /db_xref="ASAP:ABF-0018389"
                     /db_xref="ERIC:ABF-0018389"
                     /db_xref="GeneID:9731467"
                     /translation="MKNKDNQITHNAFSHQLTNINIWSCDGKWLIYDVRPHGSSFTGL
                     TIERVNVETRRREVLYRAGQGAHVGVATGSPAAPQRYVFIHGPENPDEHWRYDFHHRR
                     GVVMHDDDRRQATTLDACVLTSPYLAGALRGGSHVHVFSPDGSRLSFTYNDHVLHERD
                     PALDLRNVGVAVPLHPVVAPHRHPREHDGSHFCVLVSDTTPQPRSGSDDINRAYEEGW
                     VGTAGYLRPDGRRQRWALAFIGDTLSARGEKVPEVFLVDLPEQLDDYARPGDRPLGGT
                     DAALPAPPAGVRQRRLTFTADRSYPGVVNQPRHWLRSSPDGSQIAFLMKDDRGVVQLW
                     TVSPNGGAPRQVTQGDWPVQSAFSWHPDGRHLAFICDNSVMLCEVATGRLIRQTARSE
                     TPPVGDAVVFSPNGDRIAYLRDIDGYNQIFVVTVMR"
     misc_feature    90802..91167
                     /locus_tag="Dda3937_02526"
                     /note="Protein of unknown function (DUF3748); Region:
                     DUF3748; pfam12566"
                     /db_xref="CDD:193082"
     misc_feature    91750..91875
                     /locus_tag="Dda3937_02526"
                     /note="WD40-like Beta Propeller Repeat; Region: PD40;
                     pfam07676"
                     /db_xref="CDD:203719"
     gene            92176..93762
                     /gene="lcfK"
                     /locus_tag="Dda3937_02527"
                     /db_xref="GeneID:9731468"
     CDS             92176..93762
                     /gene="lcfK"
                     /locus_tag="Dda3937_02527"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribulokinase"
                     /protein_id="YP_003880856.1"
                     /db_xref="GI:307128840"
                     /db_xref="ASAP:ABF-0018391"
                     /db_xref="ERIC:ABF-0018391"
                     /db_xref="GeneID:9731468"
                     /translation="MKNGCFIGVDVGSASVRAGVFDGAGQRLAFAVRPIEQFHPRTHM
                     VEQSSADIWQAVGACVREALSVAAVAPSLVRAIGFDATCSLVAVGPQGQSVSMAEQHD
                     PQRDIIMWMDHRAAVETADINATGDEALRYVGGEVSIEMELPKILWLKRHFPARYQQV
                     WRFFDLADYLVWRATGADAASVCTLTCKWNYLAHENRFSDSLLQAVGLADLPQKIPPR
                     ILQLGEAAGTLAADVARDWGLPENVVVAGGIIDAHAGGLALVGSEPQGSLAVISGTSN
                     CHMLVSRQPVEVPGVWGPYWGAMLPQWWLNEGGQSAAGALVEWTLRQHAQWPALTAQA
                     EQQRRSPYALLNEWVASLEQREPLPTRHLHVLADHHGNRSPRANPDARGMVMGLTLEQ
                     GPDALARLYLATLQAIAYGTRHIIEALNQAGHQITRLTMCGGATKNPLWLREYAAITG
                     CDIQLASEEDAVTLGAALLGAVACGAYPSLPQAAQALVQPGPLIRADRRNQPFHDAKY
                     QIYLQMYDYQQAAQQQMSRH"
     misc_feature    92188..93723
                     /gene="lcfK"
                     /locus_tag="Dda3937_02527"
                     /note="Yersinia Pseudotuberculosis carbohydrate
                     kinase-like subgroup; belongs to the FGGY family of
                     carbohydrate kinases; Region: FGGY_YpCarbK_like; cd07782"
                     /db_xref="CDD:212663"
     misc_feature    92191..93726
                     /gene="lcfK"
                     /locus_tag="Dda3937_02527"
                     /note="Ribulose kinase [Energy production and conversion];
                     Region: AraB; COG1069"
                     /db_xref="CDD:223995"
     misc_feature    order(92191..92193,92197..92199,92203..92205,92224..92226,
                     92230..92232,92236..92238,92248..92253,92263..92265,
                     92398..92415,92566..92577,92596..92598,92719..92724,
                     92731..92733,92737..92739,92752..92754,92839..92841,
                     92848..92850,92905..92907,92911..92913,92935..92937,
                     92944..92949,93034..93036,93046..93072,93292..93294,
                     93304..93306,93559..93567,93571..93576,93580..93597,
                     93631..93636)
                     /gene="lcfK"
                     /locus_tag="Dda3937_02527"
                     /note="N- and C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212663"
     misc_feature    order(92203..92205,92209..92220,92224..92226,92419..92424,
                     92503..92505,92926..92931,92989..92997,93004..93006,
                     93115..93117,93127..93129,93196..93198,93472..93480,
                     93487..93489,93559..93561)
                     /gene="lcfK"
                     /locus_tag="Dda3937_02527"
                     /note="active site"
                     /db_xref="CDD:212663"
     misc_feature    order(92203..92205,92209..92220,92224..92226,92926..92928,
                     92989..92997,93115..93120,93124..93129,93196..93201,
                     93205..93207,93472..93480,93487..93489)
                     /gene="lcfK"
                     /locus_tag="Dda3937_02527"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:212663"
     misc_feature    order(92203..92205,92212..92214,92926..92928)
                     /gene="lcfK"
                     /locus_tag="Dda3937_02527"
                     /note="catalytic site [active]"
                     /db_xref="CDD:212663"
     misc_feature    order(92203..92205,92926..92928)
                     /gene="lcfK"
                     /locus_tag="Dda3937_02527"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212663"
     misc_feature    order(92209..92214,92419..92424,92503..92505,92593..92595,
                     92737..92739,92926..92931,92995..92997,93004..93006,
                     93094..93096)
                     /gene="lcfK"
                     /locus_tag="Dda3937_02527"
                     /note="carbohydrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212663"
     misc_feature    order(93118..93120,93130..93132,93139..93141,93259..93261,
                     93265..93267,93280..93285,93319..93336,93358..93366)
                     /gene="lcfK"
                     /locus_tag="Dda3937_02527"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212663"
     gene            93813..95483
                     /locus_tag="Dda3937_02528"
                     /db_xref="GeneID:9731469"
     CDS             93813..95483
                     /locus_tag="Dda3937_02528"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="C-compound and carbohydrate metabolism"
                     /protein_id="YP_003880857.1"
                     /db_xref="GI:307128841"
                     /db_xref="ASAP:ABF-0018392"
                     /db_xref="ERIC:ABF-0018392"
                     /db_xref="GeneID:9731469"
                     /translation="MLEQRVSLTLNLPASPRRLSVGEREVLLVTNADLRESANLTCWP
                     TQQQFEGRLQSALEQLGYRMTRAHAVDSARGHGFISSQREGSDVFAALDPDAPVIVLL
                     TAWQYSHHVAPSLVHHRGPVLLLANFDGTWPGLVGMLCMAGCLTSLGRDYSRLWSATF
                     DDDAFRQGLATWLRDGTVSHKTGYLRPVAASHPVLATPAGQIGRQVGEYILRHKAIIG
                     LFDTFCMGMINGVFPQQAMVTIGMPIESLSQSALLVEMAKVPYALRESCLAWYEQRGM
                     RFEFGDDGSRQLTRDQVLEQCAMMIAMARFTQRFGLAAVGVQYQQGLKDSCAASDFAE
                     GAIGNAERFPLPDEQGEPIRPDVAIPCINEVDMGSAIPQVMLWHLLHGLGLPAETTLH
                     DIRWGSEHQGVFYWDLEISGAVPFAHLKGGIAGATGYRQPPMFFPYGGSTIAGQGKAG
                     RFVWARAHYEGTQVMMHIGTGTAVELPADEFERRRRATNYEWPLLNAVLDGVTRDDLM
                     AGHQSNHLTVAYVDEDKLAEVLKAFVAQALTQHIQVWTAGDAHRLLVE"
     misc_feature    93936..95411
                     /locus_tag="Dda3937_02528"
                     /note="L-fucose isomerase (FucIase) and L-arabinose
                     isomerase (AI) family; composed of FucIase, AI and similar
                     proteins. FucIase converts L-fucose, an aldohexose, to its
                     ketose form, which prepares it for aldol cleavage (similar
                     to the isomerization of glucose...; Region:
                     L-fuc_L-ara-isomerases; cl00947"
                     /db_xref="CDD:260715"
     misc_feature    order(94059..94061,94071..94073,94080..94082,94140..94142,
                     94254..94259,94455..94457,94479..94481,94512..94514,
                     94521..94523,94542..94562,94572..94574,94743..94745,
                     94773..94778)
                     /locus_tag="Dda3937_02528"
                     /note="hexamer (dimer of trimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238323"
     misc_feature    order(94125..94127,94770..94772,94902..94904,94989..94991,
                     95352..95357)
                     /locus_tag="Dda3937_02528"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238323"
     misc_feature    order(94125..94127,94131..94139,94239..94241,94248..94253,
                     94278..94280,94284..94289,94314..94316,94485..94490,
                     94494..94496,94770..94775,94995..94997,95001..95003,
                     95004..95006,95187..95189,95310..95312,95319..95321,
                     95346..95348)
                     /locus_tag="Dda3937_02528"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238323"
     misc_feature    order(94902..94904,94989..94991,95355..95357)
                     /locus_tag="Dda3937_02528"
                     /note="Mn binding site [ion binding]; other site"
                     /db_xref="CDD:238323"
     gene            95487..96446
                     /locus_tag="Dda3937_02529"
                     /db_xref="GeneID:9731470"
     CDS             95487..96446
                     /locus_tag="Dda3937_02529"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.5.1.7 metabolism; building block
                     biosynthesis; amino acids; lysine, diaminopimelate"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase"
                     /protein_id="YP_003880858.1"
                     /db_xref="GI:307128842"
                     /db_xref="ASAP:ABF-0018394"
                     /db_xref="ERIC:ABF-0018394"
                     /db_xref="GeneID:9731470"
                     /translation="MTYDNPSFNDENKYAGIWPVMLTPFDARGEIDYASLARLVEWYL
                     DAGVHGLFAACQSSEMFFLSDAETRELVRFIVAQVDGRVPVVASGHTASAFSQQVDQL
                     NGVAETGVDGVILISNRLALAGEPDEQALARLQALTAQLPAQVDLGIYECPYPYKRLL
                     SDETVAWCARSGRYTFIKDTCCDLPTIRRRLQLAQNSRLHLANANSQTLLASLQAGCQ
                     AYSGVMANFHPQLYVWLFEHWREHPAAAQQLADYLGTAALAEFLDYPACAKFYQQQCG
                     TFSTHVCRVRNSAAYGESFFPQAIESMLRLGQTLETQLPASLR"
     misc_feature    95535..96314
                     /locus_tag="Dda3937_02529"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    order(95544..95546,95640..95642,95649..95657,95934..95936,
                     96018..96020)
                     /locus_tag="Dda3937_02529"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    order(95640..95642,95649..95657,95934..95936,96018..96020,
                     96147..96149)
                     /locus_tag="Dda3937_02529"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    order(95652..95654,95667..95672,95766..95771,95841..95846,
                     95871..95873,95883..95885)
                     /locus_tag="Dda3937_02529"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    96018..96020
                     /locus_tag="Dda3937_02529"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            96385..97509
                     /locus_tag="Dda3937_02530"
                     /db_xref="GeneID:9731471"
     CDS             96385..97509
                     /locus_tag="Dda3937_02530"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880859.1"
                     /db_xref="GI:307128843"
                     /db_xref="ASAP:ABF-0018395"
                     /db_xref="ERIC:ABF-0018395"
                     /db_xref="GeneID:9731471"
                     /translation="MRACSGWARRWRRSSRHRSGNLKDTLMKLTMTTQQFVLPEGHDY
                     FGNCHASTVAVLPEGRLRVAWFAGEKEGSGDTAIWLACAEQGRWLQPVRVAWEDGVAH
                     WNPVLHWQAGTLWLFYKVGADVHHWQTRVAVSTDDGASWSAPRLLVPGDSAPRGPVKN
                     KLLVMSNGEWLAPASVEDDRHWDAFVDLSGDRGRSWQTAPIPLTHRTPGERDGEALWQ
                     GLEQAALWENDLTRVFQWDGVIQPSAWESSPGQVHVLMRSTRGALYRSDSDDYGRRWR
                     EAYAIDLPNNNSGVDLAHLGAGRLVLVYNPVTGNWRHRYPLTVACSTDNGEHWENSID
                     LEQEPGEFSYPAIIADGDTLHVTYTWNRKNIVYCALIFSG"
     misc_feature    96463..97494
                     /locus_tag="Dda3937_02530"
                     /note="Predicted neuraminidase (sialidase) [Carbohydrate
                     transport and metabolism]; Region: COG4692"
                     /db_xref="CDD:227036"
     misc_feature    96559..97452
                     /locus_tag="Dda3937_02530"
                     /note="BNR repeat-like domain; Region: BNR_2; pfam13088"
                     /db_xref="CDD:257491"
     gene            97623..98972
                     /locus_tag="Dda3937_02531"
                     /db_xref="GeneID:9731472"
     CDS             97623..98972
                     /locus_tag="Dda3937_02531"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.2.A.1 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Major Facilitator Superfamily (MFS)"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS superfamily transporter"
                     /protein_id="YP_003880860.1"
                     /db_xref="GI:307128844"
                     /db_xref="ASAP:ABF-0018396"
                     /db_xref="ERIC:ABF-0018396"
                     /db_xref="GeneID:9731472"
                     /translation="MSISVELSQHQAMHNKSNIRRVVISSWIGNTIEFYDFLLYGLAS
                     ALVFGKLFFPTVSPMAAMLASFATFGVGFIARPLGGIFFGHMGDTLGRKLTLLITLGG
                     MGMATFLIGCLPTYHQIGVWAPVLLVVLRFVQGFLVGGEWGGAMLMVVETAPANRRGL
                     LGSIPQTGGFSGQLLATAIFAMVSTLPEDQLMSWGWRVPFMLSVALVLVGLYMRRKVD
                     ETPVFQQVQQQQQQQTHEQEPVRRQSPVVEVLRKQWRSVCLIMVLRFAESVPFFLATV
                     FAVSYATVQLGVPKQTMLNVIMATCVMAFPMHALFGALSDRVGRRPIYIFGALCAAAM
                     AFPFFYLLESGSFGLMVLGYILLINIAHNSINAVQPAFFTELFGPKVRYSGASIGAQL
                     GAIVAGGFTPFIAKGLTAMDNESWTLVATYVTVAALVAAFAAWKAPETSHRDMTKDV"
     misc_feature    97707..98888
                     /locus_tag="Dda3937_02531"
                     /note="metabolite-proton symporter; Region: 2A0106;
                     TIGR00883"
                     /db_xref="CDD:233168"
     misc_feature    97827..98846
                     /locus_tag="Dda3937_02531"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(97827..97829,97836..97841,97848..97850,97860..97865,
                     97869..97874,98034..98039,98046..98051,98058..98063,
                     98070..98072,98106..98111,98118..98123,98139..98141,
                     98424..98426,98433..98438,98445..98450,98457..98459,
                     98499..98501,98511..98513,98523..98525,98532..98534,
                     98544..98546,98697..98699,98706..98711,98718..98720,
                     98730..98735,98742..98744,98769..98771,98778..98783,
                     98790..98795,98802..98804)
                     /locus_tag="Dda3937_02531"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            99073..100077
                     /gene="lcfR"
                     /locus_tag="Dda3937_02532"
                     /db_xref="GeneID:9731473"
     CDS             99073..100077
                     /gene="lcfR"
                     /locus_tag="Dda3937_02532"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /codon_start=1
                     /transl_table=11
                     /product="Fructose repressor FruR, LacI family"
                     /protein_id="YP_003880861.1"
                     /db_xref="GI:307128845"
                     /db_xref="ASAP:ABF-0018397"
                     /db_xref="ERIC:ABF-0018397"
                     /db_xref="GeneID:9731473"
                     /translation="MAKTVEQIASALKLSVTTVRLVLNGKAEQYRISAKTQQRIHQYV
                     TEYGYTVNHVARSLKLNKTETLGLIVPRLSNLFFSTLAEKLETRCREVGYQLMISCSY
                     SDPQYENRLVEALLQRNVDGLFVVPSSLQAAQHHAKVVKKPLVLLDRDFGIDQLPLVM
                     SDNLQGGAALTEAMLAAQPAAPLFFMAGDVQQSAIRDRLRGYRQSVQQAGLTPAVLEA
                     SHNRREDGMLMMEQFLRQHDAPPPAFIASSLPVLEGMLSVVRERYGYIPAHINIGTFD
                     EHAMLGFLPNTLWSMRQNEDAWTEQAFAAMQQALNGEAQPHKAVIPMTLIHRRQAERH
                     "
     misc_feature    99082..100056
                     /gene="lcfR"
                     /locus_tag="Dda3937_02532"
                     /note="D-fructose-responsive transcription factor; Region:
                     fruct_sucro_rep; TIGR02417"
                     /db_xref="CDD:131470"
     misc_feature    99091..99249
                     /gene="lcfR"
                     /locus_tag="Dda3937_02532"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(99112..99126,99130..99135,99142..99144,99166..99171,
                     99178..99180,99217..99219,99226..99228,99235..99240,
                     99244..99249)
                     /gene="lcfR"
                     /locus_tag="Dda3937_02532"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    99217..99246
                     /gene="lcfR"
                     /locus_tag="Dda3937_02532"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    99265..100050
                     /gene="lcfR"
                     /locus_tag="Dda3937_02532"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     gene            complement(100071..100442)
                     /gene="yidQ"
                     /locus_tag="Dda3937_02533"
                     /db_xref="GeneID:9731474"
     CDS             complement(100071..100442)
                     /gene="yidQ"
                     /locus_tag="Dda3937_02533"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880862.1"
                     /db_xref="GI:307128846"
                     /db_xref="ASAP:ABF-0018398"
                     /db_xref="ERIC:ABF-0018398"
                     /db_xref="GeneID:9731474"
                     /translation="MMTILKNASLSFVLSGGILVTCGGCSSVMTHSGGEQGYYSGTKS
                     SMTTLKNEDTSWAMMPMVALDVPFSAMLDTLLLPYDYYRTHSDHHNTSARDRLEEYER
                     RKPAGDPPPTMIPVSANNAGQ"
     misc_feature    complement(100098..100430)
                     /gene="yidQ"
                     /locus_tag="Dda3937_02533"
                     /note="Protein of unknown function (DUF1375); Region:
                     DUF1375; cl11456"
                     /db_xref="CDD:264378"
     gene            100743..101156
                     /gene="ibpA"
                     /locus_tag="Dda3937_02534"
                     /gene_synonym="hslT; htpN"
                     /db_xref="GeneID:9731475"
     CDS             100743..101156
                     /gene="ibpA"
                     /locus_tag="Dda3937_02534"
                     /gene_synonym="hslT; htpN"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="5.5.2 cell processes; adaptation to stress;
                     temperature extremes"
                     /function="5.5.6 cell processes; adaptation to stress;
                     other (mechanical, nutritional, oxidative stress)"
                     /function="2.3.4 information transfer; protein related;
                     chaperoning, folding"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock chaperone"
                     /protein_id="YP_003880863.1"
                     /db_xref="GI:307128847"
                     /db_xref="ASAP:ABF-0018399"
                     /db_xref="ERIC:ABF-0018399"
                     /db_xref="GeneID:9731475"
                     /translation="MRNPDFSPLYRSAIGFDRLFNLLEAGQSQGNGGYPPYNVELVDE
                     NQYRIAIAVAGFAESELEITAHDNMLIVKGSHSGDATPRNYLYQGIAERNFERKFQLA
                     EHIQINGANLENGLLFIDLQRVIPETLKPRRIEIK"
     misc_feature    100743..101153
                     /gene="ibpA"
                     /locus_tag="Dda3937_02534"
                     /gene_synonym="hslT; htpN"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    100845..101111
                     /gene="ibpA"
                     /locus_tag="Dda3937_02534"
                     /gene_synonym="hslT; htpN"
                     /note="Alpha-crystallin domain (ACD) found in Escherichia
                     coli inclusion body-associated proteins IbpA and IbpB, and
                     similar proteins.  IbpA and IbpB are 16 kDa small heat
                     shock proteins (sHsps). sHsps are molecular chaperones
                     that suppress protein aggregation...; Region:
                     ACD_IbpA-B_like; cd06470"
                     /db_xref="CDD:107227"
     misc_feature    order(100851..100865,100890..100892,100896..100898,
                     100902..100907,101031..101033,101085..101090)
                     /gene="ibpA"
                     /locus_tag="Dda3937_02534"
                     /gene_synonym="hslT; htpN"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     gene            101307..101756
                     /gene="ibpB"
                     /locus_tag="Dda3937_02535"
                     /gene_synonym="hslS; htpE"
                     /db_xref="GeneID:9731476"
     CDS             101307..101756
                     /gene="ibpB"
                     /locus_tag="Dda3937_02535"
                     /gene_synonym="hslS; htpE"
                     /function="5.5.2 cell processes; adaptation to stress;
                     temperature extremes"
                     /function="5.5.6 cell processes; adaptation to stress;
                     other (mechanical, nutritional, oxidative stress)"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock chaperone"
                     /protein_id="YP_003880864.1"
                     /db_xref="GI:307128848"
                     /db_xref="ASAP:ABF-0018401"
                     /db_xref="ERIC:ABF-0018401"
                     /db_xref="GeneID:9731476"
                     /translation="MRNYDLSPLLRQWIGFDKLASAMGSQEAVEFPPYNIEKVDDNHY
                     RITLALAGFRQSELDIEVEGQRLTVKGAPTLPEKKAQYLHQGLVFKPFSLSFTLAEHL
                     HVSDAQFQHGLLHIDLIRDVPQALQPQRIAIGRRAPELQEKAPDEQA"
     misc_feature    101307..101705
                     /gene="ibpB"
                     /locus_tag="Dda3937_02535"
                     /gene_synonym="hslS; htpE"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    101400..101666
                     /gene="ibpB"
                     /locus_tag="Dda3937_02535"
                     /gene_synonym="hslS; htpE"
                     /note="Alpha-crystallin domain (ACD) found in Escherichia
                     coli inclusion body-associated proteins IbpA and IbpB, and
                     similar proteins.  IbpA and IbpB are 16 kDa small heat
                     shock proteins (sHsps). sHsps are molecular chaperones
                     that suppress protein aggregation...; Region:
                     ACD_IbpA-B_like; cd06470"
                     /db_xref="CDD:107227"
     misc_feature    order(101406..101420,101445..101447,101451..101453,
                     101457..101462,101586..101588,101640..101645)
                     /gene="ibpB"
                     /locus_tag="Dda3937_02535"
                     /gene_synonym="hslS; htpE"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     gene            102416..103843
                     /gene="ybhI"
                     /locus_tag="Dda3937_02536"
                     /db_xref="GeneID:9731477"
     CDS             102416..103843
                     /gene="ybhI"
                     /locus_tag="Dda3937_02536"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="1.7.8 metabolism; central intermediary
                     metabolism; gluconeogenesis"
                     /function="1.3.5 metabolism; energy metabolism, carbon;
                     fermentation"
                     /function="4.2.A.47 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Divalent Anion:Na+ Symporter (DASS) Family"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate/malate translocator"
                     /protein_id="YP_003880865.1"
                     /db_xref="GI:307128849"
                     /db_xref="ASAP:ABF-0018407"
                     /db_xref="ERIC:ABF-0018407"
                     /db_xref="GeneID:9731477"
                     /translation="MSGVGMSANNSRLVKLLIILGIAVIFWFVPVPEGVSPAAWHLLA
                     IFIATVIGLILSPYPLGAIAIFSITAVAALGLLPVKDVLVGFGDPTIWMIACAFFISR
                     SFIKTGFGRRIGFLFISKLGNSSLGLAYGLVFTDLLFSPAMPSTSARCGGIITPLFRS
                     IAEAYGSTPEQGTQRRIGSFLVQTIFQCNAITSAMFMTSMAGNPLISKLATQFGVHLT
                     WTEWAAATLVPGLLSLIVIPLVLYRFYPPELKKTPEMRELAKVRLHEMGPMSRNEWIV
                     LCVFLGLVVFWVLGSTLNIDATLTALGGLSVLLLTRALSWEDVTGEKEAWHTVVWFAV
                     LMMLATQLNKMGLIAWLGGIAGHAVAGMHWLPMVGLLLLVYYYSHYFMASAVAHISAM
                     YAIFVSIAIAAGAPPVLTVLAFAAFSNLFMATTHYSGGPAPIMFGCGYLSLGTWWKIG
                     FLVGLVVIPIWLGIGSLWWKVLGMW"
     misc_feature    102446..103840
                     /gene="ybhI"
                     /locus_tag="Dda3937_02536"
                     /note="Sodium:sulfate symporter transmembrane region;
                     Region: Na_sulph_symp; pfam00939"
                     /db_xref="CDD:250243"
     misc_feature    102503..103822
                     /gene="ybhI"
                     /locus_tag="Dda3937_02536"
                     /note="anion transporter; Region: dass; TIGR00785"
                     /db_xref="CDD:233126"
     misc_feature    order(102566..102574,102593..102634,102677..102730,
                     102797..102820,102827..102853,102857..102907,
                     102935..102937,102950..103021,103100..103144,
                     103241..103279,103301..103345,103382..103387,
                     103391..103441,103520..103534,103544..103576,
                     103646..103705,103778..103816)
                     /gene="ybhI"
                     /locus_tag="Dda3937_02536"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     gene            104003..105616
                     /gene="dcuS"
                     /locus_tag="Dda3937_02537"
                     /db_xref="GeneID:9731478"
     CDS             104003..105616
                     /gene="dcuS"
                     /locus_tag="Dda3937_02537"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="3.1.3.2 regulation; type of regulation;
                     posttranscriptional; covalent modification,
                     demodification, maturation"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /codon_start=1
                     /transl_table=11
                     /product="Fumarate respiration sensor kinase protein DcuS"
                     /protein_id="YP_003880866.1"
                     /db_xref="GI:307128850"
                     /db_xref="ASAP:ABF-0018408"
                     /db_xref="ERIC:ABF-0018408"
                     /db_xref="GeneID:9731478"
                     /translation="MSKKKTPLKLGTSIILMVSAVIGSVLLVVYALLFFRITELTETH
                     LKDKAFAIARTVANSPIVVDDLKGIGDPMLVQRFSEDVKSRNHLLFVIVTDMDGIRHS
                     HPEPGQIGRHFIGDDLYPALLGLENTAVNRGVLDPALRVFTPVFDKNNQQLGVVAVGI
                     SLSSVQSVINENRWIIPWTILFGALVGLLGTYFLVKTLKRIMLGFEPFEISNLFEQRN
                     AMLKQIKEGVIAVDTDLRVTIINDEAKRLFSQHGSGETLAIGSTISRWPALMNLEKVL
                     ETGAPRQDEEINFNGNLLLINTVPVVVKGDIIGTIATFRDKTEVSQLLQRLTGMSYYA
                     DALRAQSHEFMNKLHVILGMLHLKYYPQLEEYILKTANNYQAEIGSIIRKVKSPVIAG
                     FLLGKINRARDLGVTLSISEDSLLPDTDDAQATNELITVLGNLIENAMDALSGLENRE
                     ISVTFHHQDGQLHCTVSDDGPGIAPDIQQRIYQEGFSTKGSGRGIGLYLTRQSLEKIG
                     GTIDFESEPDVYTQFFVNIPYQARQFDHD"
     misc_feature    104003..105610
                     /gene="dcuS"
                     /locus_tag="Dda3937_02537"
                     /note="sensory histidine kinase DcuS; Provisional; Region:
                     PRK11086"
                     /db_xref="CDD:236839"
     misc_feature    104153..104497
                     /gene="dcuS"
                     /locus_tag="Dda3937_02537"
                     /note="Sensory domain of two-component sensor kinase;
                     Region: Cache_3; pfam14827"
                     /db_xref="CDD:258964"
     misc_feature    104975..105133
                     /gene="dcuS"
                     /locus_tag="Dda3937_02537"
                     /note="Sensor_kinase_SpoOB-type, alpha-helical domain;
                     Region: SPOB_a; pfam14689"
                     /db_xref="CDD:258827"
     misc_feature    105284..105571
                     /gene="dcuS"
                     /locus_tag="Dda3937_02537"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(105302..105304,105314..105316,105323..105325,
                     105398..105400,105404..105406,105410..105412,
                     105416..105421,105482..105493,105539..105541,
                     105545..105547,105560..105565,105569..105571)
                     /gene="dcuS"
                     /locus_tag="Dda3937_02537"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    105314..105316
                     /gene="dcuS"
                     /locus_tag="Dda3937_02537"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(105410..105412,105416..105418,105482..105484,
                     105488..105490)
                     /gene="dcuS"
                     /locus_tag="Dda3937_02537"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            105629..106351
                     /gene="dcuR"
                     /locus_tag="Dda3937_02538"
                     /db_xref="GeneID:9731479"
     CDS             105629..106351
                     /gene="dcuR"
                     /locus_tag="Dda3937_02538"
                     /function="DcuR controls the genes encoding anaerobic
                     fumarate respiratory system"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator of the two component
                     transcriptional regulatory system DcuR/DcuS"
                     /protein_id="YP_003880867.1"
                     /db_xref="GI:307128851"
                     /db_xref="ASAP:ABF-0018409"
                     /db_xref="ERIC:ABF-0018409"
                     /db_xref="GeneID:9731479"
                     /translation="MINVLIVDDDAMVAELNKCYLNQISGFSCYATVPTLQQARNLLM
                     QPDCEIDLVLLDIYMQQDNGLDLLPTIREFSEHTDVIIISSASDVYTIKKALHYGVVD
                     YLIKPFQFARFEQALTAYREEANLLKHREFVAQSDIDNLIRRTSGTPTVERKKLPKGL
                     TSLTLRTVCEWVEGNQGAEFSTEMLANAIGISRVSCRKYLIYLADTGILDTNILYGST
                     GRPVYLYRLLPEKQDALRQYCE"
     misc_feature    105629..106348
                     /gene="dcuR"
                     /locus_tag="Dda3937_02538"
                     /note="DNA-binding transcriptional activator DcuR;
                     Provisional; Region: PRK10430"
                     /db_xref="CDD:182454"
     misc_feature    105641..105988
                     /gene="dcuR"
                     /locus_tag="Dda3937_02538"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(105650..105655,105794..105796,105818..105820,
                     105878..105880,105935..105937,105944..105949)
                     /gene="dcuR"
                     /locus_tag="Dda3937_02538"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    105794..105796
                     /gene="dcuR"
                     /locus_tag="Dda3937_02538"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(105803..105808,105812..105820)
                     /gene="dcuR"
                     /locus_tag="Dda3937_02538"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    105944..105952
                     /gene="dcuR"
                     /locus_tag="Dda3937_02538"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(106457..107887)
                     /gene="maeN"
                     /locus_tag="Dda3937_02539"
                     /db_xref="GeneID:9731480"
     CDS             complement(106457..107887)
                     /gene="maeN"
                     /locus_tag="Dda3937_02539"
                     /function="1.7.8 metabolism; central intermediary
                     metabolism; gluconeogenesis"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="1.3.5 metabolism; energy metabolism, carbon;
                     fermentation"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.2.A.24 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Citrate:Cation Symporter (CCS) Family"
                     /codon_start=1
                     /transl_table=11
                     /product="malate Na(+) symporter"
                     /protein_id="YP_003880868.1"
                     /db_xref="GI:307128852"
                     /db_xref="ASAP:ABF-0018411"
                     /db_xref="ERIC:ABF-0018411"
                     /db_xref="GeneID:9731480"
                     /translation="MPCAHNTIFHVLQSKLLISVLCRYNRVNIMKNIETEIMSDNTLA
                     TTAPSGLLESLNKTRIGSVPFILFLVISAVVFIAAYASYLPKNMIGGFAVIMTMGFLL
                     AYIGQRIPVLKEIGGPAILCLMVPSILVYFHLFNANTLDTVKLLMKDANFLYFVIASL
                     VVGSILGMNRVILIQGMIRMFIPLVIGTAAAVVTGLLVGKLFGYSFYHTFFFIIVPII
                     GGGIGEGILPLSLAYSAILGQAPDVYVAQLVPAAVVGNIFAIICAGVLARIGVWRSDL
                     NGNGNLVRNEADNALFAVKDAPKTVDFHLMGGGLLLICTFFIVGGLFEKVLHIPGPVL
                     MILIAVLCKYGRVIPSSMETGANSFYKFVSSSLVWPLMIGLGMLYVPLESVVAVFSVG
                     YVVVCGSVVLSMALISFFIAPYLKMYPVEASIVTSCHSGLGGTGDVAILSASNRMSLM
                     PFAQIATRIGGASTVIAATLLLGWLV"
     misc_feature    complement(106475..107713)
                     /gene="maeN"
                     /locus_tag="Dda3937_02539"
                     /note="2-hydroxycarboxylate transporter family; Region:
                     2HCT; pfam03390"
                     /db_xref="CDD:251919"
     gene            109081..110688
                     /gene="dppA"
                     /locus_tag="Dda3937_02540"
                     /db_xref="GeneID:9731481"
     CDS             109081..110688
                     /gene="dppA"
                     /locus_tag="Dda3937_02540"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="4.S.47 transport; substrate; dipeptide"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_003880869.1"
                     /db_xref="GI:307128853"
                     /db_xref="ASAP:ABF-0018415"
                     /db_xref="ERIC:ABF-0018415"
                     /db_xref="GeneID:9731481"
                     /translation="MAKSLMKSRVLKFSLGLLALSVAAGVQAKTLVYCSEGSPEGFNP
                     QLFTSGTTFDASSIPIYNRLVEFKNGTTEIEPGLAEKWDISADGKTYTFHLRKDVKWQ
                     DNKEFKPSRTFNADDVLFSFQRQMDANHPFHKVSGGSYEYFEGMGMPDLISKIEKVDD
                     YTVRFQLTRAEAPFLADLAMDFASIMSAEYGDKMLKAGSPEKIDLDPIGTGPFQLQQY
                     QKDSRILYKRFDSFWGTKPGIDRLVFSITPDASVRYAKLQKDECQVMPYPNPADLASM
                     KQDKNIELLQKPGLNVGYLSFNVEKKPLDNVKVRQALTYAVNKQAIIEAVYQGAGQAA
                     KNLIPPTMWGYNDDVKDYAYDPAKAKALLKEAGLENGFEIDLWAMPVQRPYNPNARRM
                     AEMIQADWAKVGVKAKIVTYEWGEYLKRAKAGEHQTVLMGWTGDNGDPDNFLATLFSC
                     DAAKKGSNYSKWCYKPFEDLIQPARAVSDQAKRIELYKQAQVVMHDQAPALIVAHSTV
                     YEPIRKNVKGYVIEPRGVHSFNHVSVD"
     misc_feature    109111..110685
                     /gene="dppA"
                     /locus_tag="Dda3937_02540"
                     /note="antimicrobial peptide ABC transporter periplasmic
                     binding protein SapA; Provisional; Region: PRK15109"
                     /db_xref="CDD:185064"
     misc_feature    109168..110637
                     /gene="dppA"
                     /locus_tag="Dda3937_02540"
                     /note="The substrate-binding component of an ABC-type
                     dipeptide import system contains the type 2 periplasmic
                     binding fold; Region: PBP2_DppA_like; cd08493"
                     /db_xref="CDD:173858"
     misc_feature    order(110320..110322,110332..110334,110371..110382,
                     110386..110388)
                     /gene="dppA"
                     /locus_tag="Dda3937_02540"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173858"
     gene            110917..111936
                     /gene="dppB"
                     /locus_tag="Dda3937_02541"
                     /db_xref="GeneID:9731482"
     CDS             110917..111936
                     /gene="dppB"
                     /locus_tag="Dda3937_02541"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="4.S.47 transport; substrate; dipeptide"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter"
                     /protein_id="YP_003880870.1"
                     /db_xref="GI:307128854"
                     /db_xref="ASAP:ABF-0018416"
                     /db_xref="ERIC:ABF-0018416"
                     /db_xref="GeneID:9731482"
                     /translation="MLQFILRRLGLVIPTFIGITLLTFAFVHLIPGDPVMIMAGERGI
                     SPERHAQLMAELGLDKPLWEQYLHYINGVLHGDLGMSLKSRIPVWDEFVPRFKATLEL
                     GVCAMIFAVIVGIPVGVLAAVKRGSVFDHTAVSIALTGYSMPIFWWGMMLIMLVSVQL
                     NLTPVSGRVGDTVFLDDSLPLTGFMLIDTLIWGAEGDFKDAVMHMLLPAVVLGTIPLA
                     VIVRMTRSAMLEVLGEDYIRTARAKGLGRLRVIVVHALRNAMLPVVTVIGLQVGTMLA
                     GAILTETIFSWPGLGRWLIDALQRRDYPVVQSGVLLVATMIILVNLLVDVLYGVVNPR
                     IRHKK"
     misc_feature    110917..111933
                     /gene="dppB"
                     /locus_tag="Dda3937_02541"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    111202..111894
                     /gene="dppB"
                     /locus_tag="Dda3937_02541"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(111250..111255,111262..111267,111280..111282,
                     111313..111324,111328..111357,111364..111369,
                     111373..111375,111559..111564,111568..111570,
                     111574..111576,111583..111588,111592..111594,
                     111604..111609,111616..111618,111667..111669,
                     111709..111714,111721..111723,111742..111753,
                     111760..111765,111790..111795,111844..111849,
                     111856..111861,111865..111870,111877..111882,
                     111889..111894)
                     /gene="dppB"
                     /locus_tag="Dda3937_02541"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(111331..111375,111742..111759)
                     /gene="dppB"
                     /locus_tag="Dda3937_02541"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(111373..111375,111544..111546,111760..111762,
                     111784..111786,111793..111795,111844..111846)
                     /gene="dppB"
                     /locus_tag="Dda3937_02541"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(111619..111657,111673..111678,111688..111690)
                     /gene="dppB"
                     /locus_tag="Dda3937_02541"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            111949..112851
                     /gene="dppC"
                     /locus_tag="Dda3937_02542"
                     /db_xref="GeneID:9731483"
     CDS             111949..112851
                     /gene="dppC"
                     /locus_tag="Dda3937_02542"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="4.S.47 transport; substrate; dipeptide"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter"
                     /protein_id="YP_003880871.1"
                     /db_xref="GI:307128855"
                     /db_xref="ASAP:ABF-0018417"
                     /db_xref="ERIC:ABF-0018417"
                     /db_xref="GeneID:9731483"
                     /translation="MTHVTESAATTAPKPMTPLQEFWHYFKRNKGAVVGLVYIILMLV
                     VAIGASVLAPHSPAEQFRDALLKPPVWQEGGSWQYIFGTDDVGRDVLSRLMYGARLSL
                     LVGCLVVVMSLILGVVFGLVAGYFGGAVDAAIMRLVDIMLALPSLLLALVLVAIFGPS
                     IVNASLALTFVSLPHYVRLTRAAVLVEVNRDYVTASRVAGAGPLRQMFVNILPNCLAP
                     LIVQASMGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAI
                     LLTVLAFNLMGDGLRDALDPKLKQ"
     misc_feature    111949..112848
                     /gene="dppC"
                     /locus_tag="Dda3937_02542"
                     /note="dipeptide transporter; Provisional; Region:
                     PRK10913"
                     /db_xref="CDD:182833"
     misc_feature    111991..112155
                     /gene="dppC"
                     /locus_tag="Dda3937_02542"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    112240..112788
                     /gene="dppC"
                     /locus_tag="Dda3937_02542"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(112288..112293,112300..112305,112318..112320,
                     112348..112359,112363..112392,112399..112404,
                     112408..112410,112459..112464,112468..112470,
                     112474..112476,112483..112488,112492..112494,
                     112504..112509,112516..112518,112567..112569,
                     112609..112614,112621..112623,112642..112653,
                     112660..112665,112705..112710,112744..112749,
                     112756..112761,112765..112770,112777..112782)
                     /gene="dppC"
                     /locus_tag="Dda3937_02542"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(112366..112410,112642..112659)
                     /gene="dppC"
                     /locus_tag="Dda3937_02542"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(112408..112410,112444..112446,112660..112662,
                     112699..112701,112708..112710,112744..112746)
                     /gene="dppC"
                     /locus_tag="Dda3937_02542"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(112519..112557,112573..112578,112588..112590)
                     /gene="dppC"
                     /locus_tag="Dda3937_02542"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            112880..113860
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /db_xref="GeneID:9731484"
     CDS             112880..113860
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="4.S.47 transport; substrate; dipeptide"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="YP_003880872.1"
                     /db_xref="GI:307128856"
                     /db_xref="ASAP:ABF-0018418"
                     /db_xref="ERIC:ABF-0018418"
                     /db_xref="GeneID:9731484"
                     /translation="MALLNVEKLSVHFGDEGLPFRAVDRISYQVEQGQVVGIVGESGS
                     GKSVSSLAIMGLIDFPGKVMADRLEFNQRDLQTLSDRERRQLVGAEVAMIFQDPMTSL
                     NPCYTVGFQIMEAIKVHQGGNRKTRRQRAIDLLNQVGIPDPESRLDVYPHQLSGGMSQ
                     RVMIAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQKENMALILITHDLALVA
                     EAAHHIIVMYAGQVVESGKASDIFRAPRHPYTQALLRALPEFAVDKSRLASLPGVVPG
                     KYDRPNGCLLNPRCPYASDRCRQEEPEMRDIPGRQVKCHTPLDDAGRPTV"
     misc_feature    112880..113857
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /note="dipeptide transporter ATP-binding subunit;
                     Provisional; Region: dppD; PRK11022"
                     /db_xref="CDD:182906"
     misc_feature    112886..113587
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    112997..113020
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(113006..113011,113015..113023,113165..113167,
                     113411..113416,113513..113515)
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    113156..113167
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    113339..113368
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    113399..113416
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    113423..113434
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    113501..113521
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    113570..113824
                     /gene="dppD"
                     /locus_tag="Dda3937_02543"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            113857..114864
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /db_xref="GeneID:9731485"
     CDS             113857..114864
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="4.S.47 transport; substrate; dipeptide"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="YP_003880873.1"
                     /db_xref="GI:307128857"
                     /db_xref="ASAP:ABF-0017600"
                     /db_xref="ERIC:ABF-0017600"
                     /db_xref="GeneID:9731485"
                     /translation="MSQTMNAAGQPYLLQAIDLKKHYPVKKGLFAPERLVKALDGVSF
                     TLERGKTLAVVGESGCGKSTLGRLLTMIETPSHGELYYQGQDLLKPDPAAQKLRRQKI
                     QIVFQNPYASLNPRKKVGQILEEPLVINTDLSKAERREKALAMMAKVGLKTEHYDRYP
                     HMFSGGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQDLGLSYVF
                     ISHDLSVVEHIADEVMVMYLGRCVEKGSKDAIFSNPRHPYTQALLSATPRLNPDARRE
                     RIKLTGELPSPLSPPPGCAFNARCQHRFGTCTQLQPQLKPHGEQLVACFAVEQEDSQV
                     S"
     misc_feature    113884..114855
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /note="dipeptide transporter ATP-binding subunit;
                     Provisional; Region: dppF; PRK11308"
                     /db_xref="CDD:236898"
     misc_feature    113893..114591
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    114022..114045
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(114031..114036,114040..114048,114175..114177,
                     114415..114420,114517..114519)
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    114166..114177
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    114343..114372
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    114403..114420
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    114427..114438
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    114505..114525
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    114580..114834
                     /gene="dppF"
                     /locus_tag="Dda3937_01979"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(114970..115503)
                     /locus_tag="Dda3937_01980"
                     /db_xref="GeneID:9731486"
     CDS             complement(114970..115503)
                     /locus_tag="Dda3937_01980"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880874.1"
                     /db_xref="GI:307128858"
                     /db_xref="ASAP:ABF-0017601"
                     /db_xref="ERIC:ABF-0017601"
                     /db_xref="GeneID:9731486"
                     /translation="MNKLLPLALLLSAASYAADAPAPKHADADTLKAELTAPSAAPAA
                     EEEEEEYVDTDAAAKQAIAFYQWYLGQIMQNKLPIQDNDPALEKYVARDTVKALRTSK
                     VSTDVDFFLRSNGPDEEDWLPNVRVVGTDVDPVCVNLYMELGKRSPKRLVSCYVQENS
                     VWKLRSVTDLDEMFTKK"
     misc_feature    complement(114997..115323)
                     /locus_tag="Dda3937_01980"
                     /note="Protein of unknown function (DUF3828); Region:
                     DUF3828; pfam12883"
                     /db_xref="CDD:257374"
     gene            complement(115562..115876)
                     /locus_tag="Dda3937_01981"
                     /db_xref="GeneID:9731487"
     CDS             complement(115562..115876)
                     /locus_tag="Dda3937_01981"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="HipA protein"
                     /protein_id="YP_003880875.1"
                     /db_xref="GI:307128859"
                     /db_xref="ASAP:ABF-0017602"
                     /db_xref="ERIC:ABF-0017602"
                     /db_xref="GeneID:9731487"
                     /translation="MMAGTNGLDNWRLSPFYDVVYSPSPQGEHMTAFNGHGSRITLST
                     MEQLAGQAGLSKAKAVLDMADELYDVAKGFHQEASHFNLPAPLITTIQREIDSKWRQL
                     RE"
     misc_feature    complement(115760..>115846)
                     /locus_tag="Dda3937_01981"
                     /note="Toxin module HipA, protein kinase of
                     phosphatidylinositol 3/4-kinase superfamily [General
                     function prediction only]; Region: HipA; COG3550"
                     /db_xref="CDD:226080"
     gene            complement(115906..116178)
                     /locus_tag="Dda3937_01982"
                     /db_xref="GeneID:9731488"
     CDS             complement(115906..116178)
                     /locus_tag="Dda3937_01982"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.5 regulation; type of regulation;
                     transcriptional level; action unknown"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880876.1"
                     /db_xref="GI:307128860"
                     /db_xref="ASAP:ABF-0017603"
                     /db_xref="ERIC:ABF-0017603"
                     /db_xref="GeneID:9731488"
                     /translation="MLSLHTAYDIQQNLKQHLKAMRKHRKLSVDALARQSGVPNSTIR
                     KFEATGNISLRQFLMLYEVLGNLNDLNTLINQAHTPTSIEEVLKNA"
     misc_feature    complement(115984..116127)
                     /locus_tag="Dda3937_01982"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(116035..116037,116110..116112,
                     116122..116124))
                     /locus_tag="Dda3937_01982"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(116038..116040,116113..116115))
                     /locus_tag="Dda3937_01982"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(116035..116037,116047..116049,
                     116056..116058,116089..116094))
                     /locus_tag="Dda3937_01982"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(116276..117616)
                     /locus_tag="Dda3937_01983"
                     /db_xref="GeneID:9731489"
     CDS             complement(116276..117616)
                     /locus_tag="Dda3937_01983"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.5 regulation; type of regulation;
                     transcriptional level; action unknown"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_003880877.1"
                     /db_xref="GI:307128861"
                     /db_xref="ASAP:ABF-0017604"
                     /db_xref="ERIC:ABF-0017604"
                     /db_xref="GeneID:9731489"
                     /translation="MRALAQQHGTSATTAMKVLRTLEDEHFALARSKSGFFVADTRRG
                     NAMAPVPQPVALPVLDEQTELHLSLVGTECRVRLDLANGDNALYPLKKMGRLIRQASY
                     TNPMMLGNDVKGSGYLPLKEEIARRALNYGCHLHPDDILITNGCIEALSLSLRAVTHS
                     GDAVAVQSPCYFVLLQMLRNLGLRVVEVGQDASGHVDAEQLESLFSRRQVSAFISLTN
                     INNPLGTSLPDTYKRRIAEAADRYGIALIEDDTFADTAFGEQRPFPLRAFSPNVLLCN
                     GFSKTVGPGIRIGWVSGAHWQRKLAALKFTSTMGTSLTPQVALAELLRNGGYDAHLRK
                     LRRELARQVARLRQAVLHYFPADTQVSQPEGGYAIWVTLPPGCCSSRELFSRARQEGI
                     GIAPGHIFATDRRYDHCLRLNAGFGWNEEVHDAIRLLARWVLENRTERPSGLMT"
     misc_feature    complement(116312..117616)
                     /locus_tag="Dda3937_01983"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(117500..>117613)
                     /locus_tag="Dda3937_01983"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    complement(order(117509..117520,117524..117529,
                     117557..117559,117566..117571,117575..117589,
                     117611..117613))
                     /locus_tag="Dda3937_01983"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(116324..117385)
                     /locus_tag="Dda3937_01983"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(116756..116758,116777..116782,
                     116786..116788,116861..116863,116954..116956,
                     117104..117106,117176..117184))
                     /locus_tag="Dda3937_01983"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(116663..116665,116672..116674,
                     116756..116764,116882..116884,117074..117076,
                     117173..117175))
                     /locus_tag="Dda3937_01983"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(116777..116779)
                     /locus_tag="Dda3937_01983"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(117829..118254)
                     /locus_tag="Dda3937_01984"
                     /db_xref="GeneID:9731490"
     CDS             complement(117829..118254)
                     /locus_tag="Dda3937_01984"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880878.1"
                     /db_xref="GI:307128862"
                     /db_xref="ASAP:ABF-0017606"
                     /db_xref="ERIC:ABF-0017606"
                     /db_xref="GeneID:9731490"
                     /translation="MPRNHAGQHRFTPLSECIMTDAHYVLFYVDNPARSARFYSQLLE
                     LAPVEQSPTFAMFALKADLVLGLWSKHTVEPAVAQPGFSGELAFRLPDQAAVDACYAR
                     WTAQDVTVIQIPTTVDFGYTFTVQDPDGHRLRVFAYPNA"
     misc_feature    complement(117844..118185)
                     /locus_tag="Dda3937_01984"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_11; cd07261"
                     /db_xref="CDD:176682"
     misc_feature    complement(order(117847..117855,117859..117861,
                     117883..117885,117889..117891,117898..117900,
                     117904..117906,117910..117912,117919..117924,
                     117946..117951,117958..117963,117985..118011,
                     118018..118020,118051..118053,118060..118065,
                     118069..118074,118078..118080,118093..118098,
                     118108..118110,118120..118134,118171..118185))
                     /locus_tag="Dda3937_01984"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:176682"
     gene            complement(118322..119023)
                     /locus_tag="Dda3937_01985"
                     /db_xref="GeneID:9731491"
     CDS             complement(118322..119023)
                     /locus_tag="Dda3937_01985"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.5 regulation; type of regulation;
                     transcriptional level; action unknown"
                     /note="This protein contains a Winged helix DNA-binding
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="YP_003880879.1"
                     /db_xref="GI:307128863"
                     /db_xref="ASAP:ABF-0017607"
                     /db_xref="ERIC:ABF-0017607"
                     /db_xref="GeneID:9731491"
                     /translation="MSRAQRLLALIQLLRSHRFAVPGPQLADKLGISLRTLYRDIATL
                     QSQGAPIIGEAGLGYVLQPGFTLPPLMFTDEEIEALVLGSRWVARQADPRLQEGARNA
                     LMKIAAVLPEALRDTLDGTTLLVAPTNQTARDSVDLQPLRQAIRDGRKVTLHYQDGQG
                     NTSTRLIWPFVLGYFEQVRVLGAWCETRQAFRHFRTDRILAFTVEADTYPVSRRRLFK
                     QWREQQGIQLPKEGY"
     misc_feature    complement(<118331..119023)
                     /locus_tag="Dda3937_01985"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG2378"
                     /db_xref="CDD:225253"
     misc_feature    complement(118847..119002)
                     /locus_tag="Dda3937_01985"
                     /note="HTH domain; Region: HTH_11; pfam08279"
                     /db_xref="CDD:254705"
     misc_feature    complement(<118346..118612)
                     /locus_tag="Dda3937_01985"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            119163..120095
                     /gene="eamA"
                     /locus_tag="Dda3937_01986"
                     /db_xref="GeneID:9731492"
     CDS             119163..120095
                     /gene="eamA"
                     /locus_tag="Dda3937_01986"
                     /function="4.S.40 transport; substrate;
                     cysteine/O-acetyl-L-serine/cysteine metabolites"
                     /function="4.2.A.7 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Drug/Metabolite Transporter (DMT) Superfamily"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid metabolite efflux pump"
                     /protein_id="YP_003880880.1"
                     /db_xref="GI:307128864"
                     /db_xref="ASAP:ABF-0017608"
                     /db_xref="ERIC:ABF-0017608"
                     /db_xref="GeneID:9731492"
                     /translation="MILKSRKKMTIKDQLLALCVVVVWGVNFVVMKIGLHDMPPFLLA
                     GLRFLLVALPAVLLVPRPALPLRWLAAYGMTISFGQFAFLFCAIKMGMPVGMASLVIQ
                     SQAFFTLMLGAWWLGERLQWNQWLGILVAALGMVVLAEGNAANASLPGMTLTTLLLTL
                     AAAASWACGNICNKQIMRHHPVNAMSLVVWSALIPVGPFLLCSWLFEGADTIVASLTS
                     IRLPTVLALMYLSFISTLIGYAIWGNLLARYETWRVAPLSLLVPVVGILSAALLLGEH
                     LSTGQLLGALLVMLGLLVNVFGARLWPLRSARQP"
     misc_feature    119187..120065
                     /gene="eamA"
                     /locus_tag="Dda3937_01986"
                     /note="O-acetylserine/cysteine export protein;
                     Provisional; Region: PRK11453"
                     /db_xref="CDD:183142"
     misc_feature    119253..119576
                     /gene="eamA"
                     /locus_tag="Dda3937_01986"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    119655..120053
                     /gene="eamA"
                     /locus_tag="Dda3937_01986"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            120285..120557
                     /locus_tag="Dda3937_01987"
                     /db_xref="GeneID:9731493"
     CDS             120285..120557
                     /locus_tag="Dda3937_01987"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880881.1"
                     /db_xref="GI:307128865"
                     /db_xref="ASAP:ABF-0017609"
                     /db_xref="ERIC:ABF-0017609"
                     /db_xref="GeneID:9731493"
                     /translation="MVYLSSDVNPLISSVITRRLTIYGVKFQSGGLCFFKQLARGNFT
                     YGLFVYFSGVIYLHHKYRYKTNPKRLFFALFPSAIFAVTLFQGNVS"
     misc_feature    <120405..>120542
                     /locus_tag="Dda3937_01987"
                     /note="oligosaccharyl transferase, archaeosortase A
                     system-associated; Region: archaeo_STT3; TIGR04154"
                     /db_xref="CDD:234485"
     gene            120558..121163
                     /locus_tag="Dda3937_01988"
                     /db_xref="GeneID:9731494"
     CDS             120558..121163
                     /locus_tag="Dda3937_01988"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880882.1"
                     /db_xref="GI:307128866"
                     /db_xref="ASAP:ABF-0017610"
                     /db_xref="ERIC:ABF-0017610"
                     /db_xref="GeneID:9731494"
                     /translation="MKSYDDMQRFKDKAQIKDINFMDMSGQVLQSETVVWPIMKQLLR
                     NQTGDDTLSGAQPVSIAQPVPVSQHVLSAPASPRRVTPSSSLNVNADPSGGNQHSLFN
                     AIAASLPSAESVSAPAPQPIAPPTPVSQPQPAALTIETVPPATVRPHPLASAPAVSEA
                     SAASEAGRFRQLFSRHHHDEIHSVSKTMLLKPLLEKIALCR"
     gene            121154..121969
                     /gene="yhjQ"
                     /locus_tag="Dda3937_01989"
                     /db_xref="GeneID:9731495"
     CDS             121154..121969
                     /gene="yhjQ"
                     /locus_tag="Dda3937_01989"
                     /function="5.1 cell processes; cell division"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome (plasmid) partitioning protein ParA"
                     /protein_id="YP_003880883.1"
                     /db_xref="GI:307128867"
                     /db_xref="ASAP:ABF-0017611"
                     /db_xref="ERIC:ABF-0017611"
                     /db_xref="GeneID:9731495"
                     /translation="MPLVCVCSPKGGVGKTTMAANLAYALARGGSKVLAIDFDMQNAL
                     RLHFGVPLGDERGYVAKSGETADWSQSILTTDDNIFVLPYGNVTEDQRLAFEHNLASD
                     PLFLKRGLSTVMNYPGLVIVADFPPGPSPALKAMTDLADLHLVVMMADTASLSLMPHI
                     EGNKLTGQALNRRKGSYLLLNQTDNRRAISSQVSSFVQQRMPDKLIGSVHRDESVAEA
                     NASQRSIFDFSPVSAAAFDIELIGKRVAALLDIRIGNGEVHAEFPAYQAVPAS"
     misc_feature    121154..121903
                     /gene="yhjQ"
                     /locus_tag="Dda3937_01989"
                     /note="cellulose synthase operon protein YhjQ; Region:
                     cellulose_yhjQ; TIGR03371"
                     /db_xref="CDD:234188"
     misc_feature    121163..>121276
                     /gene="yhjQ"
                     /locus_tag="Dda3937_01989"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    121181..121201
                     /gene="yhjQ"
                     /locus_tag="Dda3937_01989"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    121199..121201
                     /gene="yhjQ"
                     /locus_tag="Dda3937_01989"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     operon          122078..131056
                     /operon="bcsABCD"
                     /db_xref="ASAP:ABF-0174118"
                     /db_xref="ERIC:ABF-0174118"
     gene            122078..124168
                     /gene="bcsA"
                     /locus_tag="Dda3937_01990"
                     /gene_synonym="yhjO"
                     /operon="bcsABCD"
                     /db_xref="GeneID:9731496"
     CDS             122078..124168
                     /gene="bcsA"
                     /locus_tag="Dda3937_01990"
                     /gene_synonym="yhjO"
                     /operon="bcsABCD"
                     /function="6.3 cell structure; surface antigens (ECA, O
                     antigen of LPS)"
                     /function="7.3 location of gene products; inner membrane"
                     /function="6.1 cell structure; membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase"
                     /protein_id="YP_003880884.1"
                     /db_xref="GI:307128868"
                     /db_xref="ASAP:ABF-0017612"
                     /db_xref="ERIC:ABF-0017612"
                     /db_xref="GeneID:9731496"
                     /translation="MKKILFLTLLLLLLPVAAVIVITPMDSEKQYIFGLISLALMFLL
                     GLSKRRQVTIILIVLSVLTSTRYIYWRATETLHFNSEIEAILGIGLFIAELYVWVILI
                     LGFLQTAWPLERVIEPMPEDTGLWPTVDVYIPTYNESLDVVRDTVLAAQCIDYPRDKM
                     KIYLLDDGRRSEFAVFASQAGVGYITRDNNAHAKAGNLNHALKLTQGDLICVFDCDHV
                     AKRIFLQATVGPFLSDPKLALLQTPHYFYSPDPFERNLRAARDMPNEGALFYGPVQQG
                     NDLWNAAFFCGSCAVIRRAALDEIGGFAVETVTEDAHTAIKMQRKGWKSAFLSIPLAA
                     GLATERLVLHVIQRTRWARGMTQIFRVDNPLLGRGLTWQQRLCYLNAMLHFQFGLPRV
                     VFLTAPLAYLLFNLNIIHASAAMIFAYALPHLVVSMYLNSRMNGRFRYSFWGEIYETV
                     MAFHLVIPTLVTLFSPTRGKFNVTDKGGLLDEGFFDFRIVRPHIVAAILLGAGVLAGI
                     TRIVAHDYFNVDPYVIVLNVVWALLSLLTLLAAIAVARETKQVRKTIRVDVDVPAIIH
                     YASGIASRATTINLSMGGVQLKAPDQRHKSDEIEAVELLLQSSEICLPVQLVAADDDI
                     IRLQFVDIPLAQRRALVRVVLSRADAWMNPPWPQDRPLRSLWAVVRTVCAFFWMSLRG
                     RGRKADLKKEDVAA"
     misc_feature    122120..124138
                     /gene="bcsA"
                     /locus_tag="Dda3937_01990"
                     /gene_synonym="yhjO"
                     /note="cellulose synthase catalytic subunit (UDP-forming);
                     Region: CelA; TIGR03030"
                     /db_xref="CDD:234095"
     misc_feature    122456..123154
                     /gene="bcsA"
                     /locus_tag="Dda3937_01990"
                     /gene_synonym="yhjO"
                     /note="CESA_CelA_like are involved in the elongation of
                     the glucan chain of cellulose; Region: CESA_CelA_like;
                     cd06421"
                     /db_xref="CDD:133043"
     misc_feature    122717..122725
                     /gene="bcsA"
                     /locus_tag="Dda3937_01990"
                     /gene_synonym="yhjO"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133043"
     misc_feature    123725..124003
                     /gene="bcsA"
                     /locus_tag="Dda3937_01990"
                     /gene_synonym="yhjO"
                     /note="PilZ domain; Region: PilZ; pfam07238"
                     /db_xref="CDD:254119"
     gene            124072..126678
                     /gene="bcsB"
                     /locus_tag="Dda3937_01991"
                     /gene_synonym="yhjN"
                     /operon="bcsABCD"
                     /db_xref="GeneID:9731497"
     CDS             124072..126678
                     /gene="bcsB"
                     /locus_tag="Dda3937_01991"
                     /gene_synonym="yhjN"
                     /operon="bcsABCD"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.6 metabolism; macromolecules (cellular
                     constituent) biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic di-GMP-binding protein"
                     /protein_id="YP_003880885.1"
                     /db_xref="GI:307128869"
                     /db_xref="ASAP:ABF-0017613"
                     /db_xref="ERIC:ABF-0017613"
                     /db_xref="GeneID:9731497"
                     /translation="MGGSAHRLRVLLDEFARPWQEGGPEEGGRRRMMTPRFMKALLSL
                     CVGSVLTLGGNGALAAGDAADEPLPAMLSPGGGNPQPAATEPAPVTDSAPALAPAPTT
                     ALPTMPPITSPLISPETPSADVPPPPSLTTPSMLLPAPVGDQTAAGYQPLSSSVSVAQ
                     MGQTHGITLAGGQAQAGVIFTLPGDQVVTNARLDLALRVSPELAALNTSMQLMLNGQP
                     LGTVPLNAATGDSTLFQLDIPAAMVVSSNNLSFRINDADRLLCERDSATRYNLTILPT
                     TTLNLEGQQLDIGTRLENFPRPFIDPLQMTPATVPMVFPADVTPEQVGAASLVASWLG
                     MRMDGYGVTFPVIRDALPEKSGMVFGRPGDKVGTLTLPEVAGPTLQLIDNPVNPVYKL
                     MLVVGKDDEQLRQAAYRLVSQPLTGDASTLSVAQQTIPFRRAYDAPRWISTDRPVRLS
                     ELLRNDQSMTVSGLWHEALRINFRAAPDLFLWDGDTIPVKVDYRFPSESWIDESRSYL
                     NVMLNGTFLRNLTVNKVGVLQQLWREMGGDTRQENYTLKVDPYLIYGYNQFQLYFNIR
                     AKDDAPCSVLLNNNIKSQIADSASIDLSRTRHFTLLPNLSYFVGVAFPFTRQADYAQT
                     VMLLPEKPTNAEIGLLLDLAGRASDATGVSLNHNRVMFGLPTNAADRQKLENSDVLAV
                     TTLPQAAFNQHLLSGSPYTVNDRTFGVKEPGAWERARTLLTGDWDRTPLDADRYFSSN
                     EAWRGFLSYRSPWNPERVVVVATGSGDEQLLRLYDDLNSPNINAAVRGDTAIITDENG
                     VRSFRVGPQFPSGEMPWYMMIVWYANQHSVLLALAALLLAAAVGLSLASILRRLAEKR
                     LSTRRDAGSDKK"
     misc_feature    124273..126648
                     /gene="bcsB"
                     /locus_tag="Dda3937_01991"
                     /gene_synonym="yhjN"
                     /note="cellulose synthase regulator protein; Provisional;
                     Region: PRK11114"
                     /db_xref="CDD:236851"
     gene            126690..130586
                     /gene="bcsC"
                     /locus_tag="Dda3937_01992"
                     /gene_synonym="yhjL"
                     /operon="bcsABCD"
                     /db_xref="GeneID:9731498"
     CDS             126690..130586
                     /gene="bcsC"
                     /locus_tag="Dda3937_01992"
                     /gene_synonym="yhjL"
                     /operon="bcsABCD"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.6 metabolism; macromolecules (cellular
                     constituent) biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase operon protein C"
                     /protein_id="YP_003880886.1"
                     /db_xref="GI:307128870"
                     /db_xref="ASAP:ABF-0017614"
                     /db_xref="ERIC:ABF-0017614"
                     /db_xref="GeneID:9731498"
                     /translation="MKMTTLTARIRRSLSLTGVVVGGVLSASALAAQANPALQALFEQ
                     ADYWHQRSHDDLARDALQKILRVDADNPRALYLMALYAQNSGDGAEAAKWRERLSKAS
                     PQDPLLQALDNARQAATIPQAQLALARQQARSGNISAALQTWRNLFSGSQPPASIAAE
                     YYLTMAGDRTLLPQAIDHLREFAAAHPQDTNAAVALGKALTYQEPTRREGVQILSGLA
                     SGSADADQAMRQALLWLGPKADDAPFYQLYQQRHPQDTAVMDYYRKNVGGSEKDKGFT
                     ALNSGDLSNAQTAFSQVLQANPEDADALAGMGYAAQRRGDFAAAASYLERAARQGGEN
                     SAQRQQQADDARFYAQLANAQQAMKNGDTAQALTLSEPLAQAGGDKGLTAKLFRADVL
                     RRTNNFPQAERLYRDVLQTDADNRNAKEGLYYVLREQNRADEANTLFAALPENVRRSM
                     APRPVATSAPVRNEAKQALAAGDTVRAIGLLQQGIQRFPNDGWLKLDLARIYQQQGNM
                     AAATSLMQPLFRAGAGADDLYAAALFASENNAWQQASTLLSRIPPRNQNEDTRSLARR
                     VNFNLQMATAQVYLSRGENAAAANTLRALSVTPPDNPADAGKLAKSLAAAGDTAAAVA
                     VVRNNMQRGVQGNAGDYADQVGVLNQAGLSDEAQSWLSRPELVARSSATQLDGLRTGF
                     VVREADRLRENQQYAQAYDKLARALQRDPKNTDLMFAMARLYQSGKMNKEAADVYDYL
                     LSHDTPTQEARVGAINVALERHDANKAHALSTGLQGEQTPERLLLLARIADAEGNRDQ
                     AMAYLKTARSKAVGLEGAAPGAAPAIGGLAMTDNPFIDRSTPTATRVASSSSSYGSVM
                     PWQQRNGVATGDTAAGATTQQQAATLTQINGMMADLERDTGGWVQTGVQIRARDGESG
                     LSRLTEAKVPLTWSSGSFGDARINFSVTPMTLSAGTSSGDSNRQFGTGALAQVVNASA
                     QTLVNELGRNFNFSSLSSAQVLNILQNSTNKPNIDQVTVDSQGKQNASGAELNLSLIS
                     KNYKLDLGSTPLGQDLNTLVGGIQWSPKLTDFLTLVVTGERRAVTDSLLSYVGAKDAL
                     TGKRWGQVTKNGGNVLLSYDNGDIGFYGGGGAYSYLGENVKNNTGVMANAGAYIRPFH
                     DRDRELKTGVSLSWMNFSQNLGYYSYGQGGYFSPQDYVSVSLPVEWSQKYDDLSVKAG
                     VAVGYQSYSRDRSAYFPNNPDWQTLLESAESLGLAKESHYAGDSKSGIGYNVHVGADY
                     RVTKDVTVGGQMGYDTFGNYNETTARLYFRYGLGGK"
     misc_feature    126804..130580
                     /gene="bcsC"
                     /locus_tag="Dda3937_01992"
                     /gene_synonym="yhjL"
                     /note="cellulose synthase subunit BcsC; Provisional;
                     Region: PRK11447"
                     /db_xref="CDD:183140"
     misc_feature    127500..127790
                     /gene="bcsC"
                     /locus_tag="Dda3937_01992"
                     /gene_synonym="yhjL"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(127500..127505,127512..127517,127602..127607,
                     127611..127616,127623..127628,127734..127739,
                     127746..127751,127758..127763)
                     /gene="bcsC"
                     /locus_tag="Dda3937_01992"
                     /gene_synonym="yhjL"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(127509..127511,127545..127547,127557..127559,
                     127566..127568,127611..127613,127647..127649,
                     127659..127661,127668..127670,127743..127745,
                     127779..127781)
                     /gene="bcsC"
                     /locus_tag="Dda3937_01992"
                     /gene_synonym="yhjL"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    128757..128981
                     /gene="bcsC"
                     /locus_tag="Dda3937_01992"
                     /gene_synonym="yhjL"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(128784..128786,128796..128798,128805..128807,
                     128850..128852,128886..128888,128898..128900,
                     128907..128909,128946..128948)
                     /gene="bcsC"
                     /locus_tag="Dda3937_01992"
                     /gene_synonym="yhjL"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(128841..128846,128850..128855,128862..128867,
                     128937..128942,128949..128954,128961..128966)
                     /gene="bcsC"
                     /locus_tag="Dda3937_01992"
                     /gene_synonym="yhjL"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    129432..130568
                     /gene="bcsC"
                     /locus_tag="Dda3937_01992"
                     /gene_synonym="yhjL"
                     /note="Cellulose synthase operon protein C C-terminus
                     (BCSC_C); Region: BCSC_C; pfam05420"
                     /db_xref="CDD:253187"
     gene            130589..131056
                     /gene="bcsD"
                     /locus_tag="Dda3937_01993"
                     /operon="bcsABCD"
                     /db_xref="GeneID:9731499"
     CDS             130589..131056
                     /gene="bcsD"
                     /locus_tag="Dda3937_01993"
                     /operon="bcsABCD"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.6 metabolism; macromolecules (cellular
                     constituent) biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880887.1"
                     /db_xref="GI:307128871"
                     /db_xref="ASAP:ABF-0017615"
                     /db_xref="ERIC:ABF-0017615"
                     /db_xref="GeneID:9731499"
                     /translation="MSDLQQHALNYYRQQQLPSGWADLFGVIVNGMMDNAGEREGLAF
                     LRHIGGQLAERYPLPAAVTVVDLEREINRVLSLFHWGCVDLRPYENRLEIYHLALPAS
                     VNSSGSVRWRMAMAAVLQGLYSRWLREQGGVESVPLSCEETDSESTLLFRYQH"
     misc_feature    130688..131026
                     /gene="bcsD"
                     /locus_tag="Dda3937_01993"
                     /note="Cellulose synthase subunit D; Region: Cellsynth_D;
                     pfam03500"
                     /db_xref="CDD:252002"
     gene            131069..132067
                     /gene="celY"
                     /locus_tag="Dda3937_01994"
                     /db_xref="GeneID:9731500"
     CDS             131069..132067
                     /gene="celY"
                     /locus_tag="Dda3937_01994"
                     /function="7.5 location of gene products; extracellular"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="1.2.4 metabolism; macromolecule degradation;
                     polysaccharides"
                     /codon_start=1
                     /transl_table=11
                     /product="endoglucanase Y"
                     /protein_id="YP_003880888.1"
                     /db_xref="GI:307128872"
                     /db_xref="ASAP:ABF-0017616"
                     /db_xref="ERIC:ABF-0017616"
                     /db_xref="GeneID:9731500"
                     /translation="MGKPMWRCWALMLMVWFSASATAANGWEIYKSRFMTTDGRIQDT
                     GNKNVSHTEGQGFAMLMAVHYDDRIAFDNLWNWTQSHLRNTTSGLFYWRYDPSAANPV
                     VDKNNASDGDVLIAWALLKAGNKWQDNRYLQASDSIQKAIIASNIIQFAGRTVMLPGA
                     YGFNKNSYVILNPSYFLFPAWRDFANRSHLQVWRQLIDDSLSLVGEMRFGQVGLPTDW
                     AALNADGSMAPATAWPSRFSYDAIRIPLYLYWYDAKTTALVPFQLYWRNYPRLTTPAW
                     VDVLSSNTATYNMQGGLLAVRDLTMGNLDGLSDLPGASEDYYSSSLRLLVMLARGK"
     misc_feature    131120..132064
                     /gene="celY"
                     /locus_tag="Dda3937_01994"
                     /note="Glycosyl hydrolases family 8; Region:
                     Glyco_hydro_8; pfam01270"
                     /db_xref="CDD:201700"
     gene            132468..133754
                     /gene="dctA"
                     /locus_tag="Dda3937_01995"
                     /db_xref="GeneID:9731501"
     CDS             132468..133754
                     /gene="dctA"
                     /locus_tag="Dda3937_01995"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="4.2.A.23 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Dicarboxylate/Amino Acid:Cation (Na+ or H+) Symporter
                     (DAACS) Family"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.134 transport; substrate;
                     Na+/dicarboxylate"
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylic acid, orotate and citrate
                     transporter"
                     /protein_id="YP_003880889.1"
                     /db_xref="GI:307128873"
                     /db_xref="ASAP:ABF-0017617"
                     /db_xref="ERIC:ABF-0017617"
                     /db_xref="GeneID:9731501"
                     /translation="MKKSIFKSLYFQVLAAITIGILLGHFYPALGQQMQPLGDGFVKL
                     IKMVIAPVIFCTVVTGIAGMESMKAVGRTGAVALLYFEVVSTLALIIGLVVVNVLQPG
                     AGMNVDPAALNVAAVANYATEAGKQGVVPFLMDVIPSSVIGAFASGNILQVLLFAVMF
                     GFALHRLGDKGVLIFDVIESFSKVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGTLVQ
                     LGQLIICFYITCILFVVLVLGSIARATGFSIFKFIRYIREELLIVLGTSSSESALPRM
                     LEKMEKLGCKKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLV
                     VLLLSSKGAAGVTGSGFIVLAATISAVGHLPLAGLALILGIDRFMSEARALTNLVGNG
                     VATVVVAKWCKQLDSKQMNDVLSGRNDGPAAESRPS"
     misc_feature    132468..133742
                     /gene="dctA"
                     /locus_tag="Dda3937_01995"
                     /note="C4-dicarboxylate transporter DctA; Reviewed;
                     Region: PRK01663"
                     /db_xref="CDD:234968"
     gene            134031..135494
                     /gene="yhjJ"
                     /locus_tag="Dda3937_01996"
                     /db_xref="GeneID:9731502"
     CDS             134031..135494
                     /gene="yhjJ"
                     /locus_tag="Dda3937_01996"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-dependent peptidase"
                     /protein_id="YP_003880890.1"
                     /db_xref="GI:307128874"
                     /db_xref="ASAP:ABF-0017619"
                     /db_xref="ERIC:ABF-0017619"
                     /db_xref="GeneID:9731502"
                     /translation="MQGTKFGLFVGGVLLATAVGNVQAEALQPDPAWQQGKLDNGFSW
                     QLLATPQRPSDRIELRLMINTGSLTENAQQTGFSHFIPRLALLPRDTFSAGQLPSLWQ
                     QSESETRPLPPATTSYDFTSYNLSLPNNRPDLLKDALSWLADTAGQLQINDKRIASAM
                     KMIDPVATAPTNPQDPSWRYRLKGSSLLSYAPGQPLKASVNAEQLSKYYKTWYTPDAM
                     TLYVVGNVDSRAIAEQIDRVFSPLQGKRVTPSPLPTLSAMPSTPISLMDSSVKQDILS
                     LVWDMPWQPIRDSQALARYWHSDLAREALFWHMQQVLTKSPLKDTNVRFDCNVVYGRA
                     QCAIHLDNVNVTSESAQAGVTFLSKELLALRDKGLSQAEFDALMARKTEELSKLFATY
                     ARASTDILMDQRLRSQKNGVVDIAPEQYQKLRQNYLSSVTLEMLNQELHQQLSQEATL
                     VMLQPQGEPEANMKALRETYMSIMQPDNGAASAAPAQ"
     misc_feature    134094..135392
                     /gene="yhjJ"
                     /locus_tag="Dda3937_01996"
                     /note="Predicted Zn-dependent peptidases [General function
                     prediction only]; Region: PqqL; COG0612"
                     /db_xref="CDD:223685"
     misc_feature    134187..>134465
                     /gene="yhjJ"
                     /locus_tag="Dda3937_01996"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    134625..135161
                     /gene="yhjJ"
                     /locus_tag="Dda3937_01996"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            complement(135723..136748)
                     /locus_tag="Dda3937_01997"
                     /db_xref="GeneID:9731503"
     CDS             complement(135723..136748)
                     /locus_tag="Dda3937_01997"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="YP_003880891.1"
                     /db_xref="GI:307128875"
                     /db_xref="ASAP:ABF-0017622"
                     /db_xref="ERIC:ABF-0017622"
                     /db_xref="GeneID:9731503"
                     /translation="MADNTPQAPQGEFVLFTSADGQTRVECRFESDTLWLSQAMIAEL
                     YGKAKATISEHIKNIFTEGELDENSVVRLYRTTAADGKSYNVQYFSLPLVLAVGYRVR
                     SSRGTQFRQWATQTLQEYLIKGFVMDDERLKNPPVGHSAVPDYFDEMLERIRDIRASE
                     RRVYLRVKEIFTMAADYEPSNQETNRFFQTIQNKLHYACTHMTAAELIASRVDASKPD
                     MGLTSYKGDEVRKTDVTIAKNYLREDEIKELNRIVNMWLDFAEDQALRRKQVFLQDWA
                     DKLDQFLSFNDRDVLSGAGKISKKDADDKAKVEFERFAAQRRRLKEAEGAQANIAALK
                     AILKKDK"
     misc_feature    complement(135735..136718)
                     /locus_tag="Dda3937_01997"
                     /note="Virulence protein [General function prediction
                     only]; Region: COG3943"
                     /db_xref="CDD:226452"
     gene            complement(136767..137036)
                     /locus_tag="Dda3937_01998"
                     /db_xref="GeneID:9731504"
     CDS             complement(136767..137036)
                     /locus_tag="Dda3937_01998"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system
                     restriction subunit"
                     /protein_id="YP_003880892.1"
                     /db_xref="GI:307128876"
                     /db_xref="ASAP:ABF-0017623"
                     /db_xref="ERIC:ABF-0017623"
                     /db_xref="GeneID:9731504"
                     /translation="MGDEPGRRNFANGTIARVTENPIVVEQVEKHDKTIALKGDLPQA
                     VKQAVVQALLKEGDIARTLLKDPQVMASYVELIFDMMKQRSRATQ"
     gene            complement(136931..137359)
                     /locus_tag="Dda3937_01999"
                     /db_xref="GeneID:9731505"
     CDS             complement(136931..137359)
                     /locus_tag="Dda3937_01999"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system
                     methyltransferase subunit"
                     /protein_id="YP_003880893.1"
                     /db_xref="GI:307128877"
                     /db_xref="ASAP:ABF-0017624"
                     /db_xref="ERIC:ABF-0017624"
                     /db_xref="GeneID:9731505"
                     /translation="MNLQDKEQSAKLSSAIWRMADDLWGDFKHTDFARIILPFLLLRR
                     IECVLEPTREEVRKFYLAEKQSGIDLGLVLPEVARFSFYNTSEYSLETLGASDTGDNL
                     ELYISQWAMNLAVVTLPMAPLPVLPKTRLWLNRLKNMIRR"
     misc_feature    complement(<137108..137341)
                     /locus_tag="Dda3937_01999"
                     /note="Type I restriction-modification system
                     methyltransferase subunit [Defense mechanisms]; Region:
                     HsdM; COG0286"
                     /db_xref="CDD:223363"
     misc_feature    complement(<137054..137326)
                     /locus_tag="Dda3937_01999"
                     /note="HsdM N-terminal domain; Region: HsdM_N; pfam12161"
                     /db_xref="CDD:256881"
     gene            complement(137428..137928)
                     /locus_tag="Dda3937_02000"
                     /db_xref="GeneID:9731506"
     CDS             complement(137428..137928)
                     /locus_tag="Dda3937_02000"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880894.1"
                     /db_xref="GI:307128878"
                     /db_xref="ASAP:ABF-0017626"
                     /db_xref="ERIC:ABF-0017626"
                     /db_xref="GeneID:9731506"
                     /translation="MKVTKLDNQLLEKATDIFAKLGLPIEQAINVFLAKSVQAKGFPF
                     SVALESESQPEGSSQSKITNAEITEVIHDLVENTLPLSEIENLTQLTYCRNTFGLSFP
                     VLKLAKSPRPEDIRSAAKDAKERNRYSTTRVAQRADKTYVICTQWTDRHRNAFCRWQG
                     IFSHNE"
     misc_feature    complement(137656..137919)
                     /locus_tag="Dda3937_02000"
                     /note="RelB antitoxin; Region: RelB; cl01171"
                     /db_xref="CDD:260818"
     gene            complement(138241..139173)
                     /gene="kdgK"
                     /locus_tag="Dda3937_02001"
                     /db_xref="GeneID:9731507"
     CDS             complement(138241..139173)
                     /gene="kdgK"
                     /locus_tag="Dda3937_02001"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxygluconokinase"
                     /protein_id="YP_003880895.1"
                     /db_xref="GI:307128879"
                     /db_xref="ASAP:ABF-0017629"
                     /db_xref="ERIC:ABF-0017629"
                     /db_xref="GeneID:9731507"
                     /translation="MTTKNIAIIGECMIELSQKGADLNRGFGGDTLNTAVYISRQVKP
                     DALDVHYVTALGTDSFSSEMMASWQKEGVKTDLIQRLDNKLPGLYFIETDATGERTFY
                     YWRNDAAARYWLESPDADTISQQLAQFDYIYLSGISLAILNQASRARLLTVLRACRAN
                     GGKVIFDNNYRPRLWQSKEETRQAYSDMLACTDIAFLTLDDEDMLWGELPVDEVLKRT
                     HGAGVMEVVIKRGADACLVSIQGEALLEVPAIKLPKEKVVDTTAAGDSFSAGYLSVRL
                     NGGSAQDAAKRGHLTASTVIQYRGAIIPLEAMPA"
     misc_feature    complement(138268..139158)
                     /gene="kdgK"
                     /locus_tag="Dda3937_02001"
                     /note="2-keto-3-deoxygluconate kinase (KdgK)
                     phosphorylates 2-keto-3-deoxygluconate (KDG) to form
                     2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the
                     common intermediate product, that allows organisms to
                     channel D-glucuronate and/or D-galacturinate into the...;
                     Region: KdgK; cd01166"
                     /db_xref="CDD:238571"
     misc_feature    complement(order(138271..138273,138379..138381,
                     138388..138390,138661..138663,138763..138765,
                     138859..138861,138865..138867,138907..138909,
                     139075..139077,139084..139089))
                     /gene="kdgK"
                     /locus_tag="Dda3937_02001"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238571"
     misc_feature    complement(order(138295..138297,138307..138309,
                     138373..138375,138382..138390,138415..138417,
                     138472..138474,138487..138489))
                     /gene="kdgK"
                     /locus_tag="Dda3937_02001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238571"
     gene            complement(139170..139496)
                     /locus_tag="Dda3937_04430"
                     /db_xref="GeneID:9731508"
     CDS             complement(139170..139496)
                     /locus_tag="Dda3937_04430"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880896.1"
                     /db_xref="GI:307128880"
                     /db_xref="ASAP:ABF-0046840"
                     /db_xref="ERIC:ABF-0046840"
                     /db_xref="GeneID:9731508"
                     /translation="MPASPSCWWIRWEKIQPPPWSSLMKWKPTTGVSAERASPSAASR
                     RHDRKHNVSIGNSPLRIGITTGFPDPHHEKIKHRFIAIDSMPCNVETGASFRLVHLLF
                     FTGQLS"
     gene            complement(139357..139560)
                     /locus_tag="Dda3937_02002"
                     /db_xref="GeneID:9731509"
     CDS             complement(139357..139560)
                     /locus_tag="Dda3937_02002"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="4-oxalocrotonate tautomerase"
                     /protein_id="YP_003880897.1"
                     /db_xref="GI:307128881"
                     /db_xref="ASAP:ABF-0017631"
                     /db_xref="ERIC:ABF-0017631"
                     /db_xref="GeneID:9731509"
                     /translation="MPFVNIRITKDGVTAEQKKQLIAGVTQLLVDTLGKNPATTVVII
                     DEVETDNWGIGGESVTERRQQAS"
     misc_feature    complement(139381..139557)
                     /locus_tag="Dda3937_02002"
                     /note="4-Oxalocrotonate Tautomerase:  Catalyzes the
                     isomerization of unsaturated ketones. The structure is a
                     homohexamer that is arranged as a trimer of dimers. The
                     hexamer contains six active sites, each formed by residues
                     from three monomers, two from one...; Region:
                     4Oxalocrotonate_Tautomerase; cd00491"
                     /db_xref="CDD:238274"
     misc_feature    complement(order(139444..139446,139552..139557))
                     /locus_tag="Dda3937_02002"
                     /note="active site 1 [active]"
                     /db_xref="CDD:238274"
     misc_feature    complement(order(139462..139467,139477..139479,
                     139486..139491,139498..139500,139537..139557))
                     /locus_tag="Dda3937_02002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238274"
     misc_feature    complement(order(139387..139413,139420..139425,
                     139429..139443,139447..139452,139483..139485,
                     139492..139497,139504..139509,139540..139542,
                     139546..139548))
                     /locus_tag="Dda3937_02002"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238274"
     misc_feature    complement(order(139405..139407,139540..139542))
                     /locus_tag="Dda3937_02002"
                     /note="active site 2 [active]"
                     /db_xref="CDD:238274"
     gene            complement(139606..140592)
                     /gene="yhjD"
                     /locus_tag="Dda3937_02003"
                     /db_xref="GeneID:9731510"
     CDS             complement(139606..140592)
                     /gene="yhjD"
                     /locus_tag="Dda3937_02003"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880898.1"
                     /db_xref="GI:307128882"
                     /db_xref="ASAP:ABF-0017633"
                     /db_xref="ERIC:ABF-0017633"
                     /db_xref="GeneID:9731510"
                     /translation="MPVKPNQPRPSTKQDPSSGASRQRFGYVTGWLHRIRSVPAIAHF
                     IRAGDRFNDRMGNQFGAAITYFSFLSLIPILMVSFATAGFVLASNPDLLTGLINRIVN
                     SISDPSLARTLKNTVNTAVRQRTTVGLTGLLIALYSGVNWIGNLREAIHAQSRDVWER
                     QPHEEEKIYLRYLWDFLSLIGLLLALVITLFLTSVAGSAQATIVRALGLNGIDWLRPV
                     MTLIALSISIFANYLLFLWILWVLPRHNPRRGPLLRGTLMAAIGFEALKFAMTVALPE
                     LATSPSGAAFGSVIGLMTFFYFFARLTLFCAAWIATADPKTDINTQAPLPGA"
     misc_feature    complement(139645..140469)
                     /gene="yhjD"
                     /locus_tag="Dda3937_02003"
                     /note="inner membrane protein YhjD; Region: TIGR00766"
                     /db_xref="CDD:188082"
     gene            140717..142021
                     /gene="yhhS"
                     /locus_tag="Dda3937_02004"
                     /db_xref="GeneID:9731511"
     CDS             140717..142021
                     /gene="yhhS"
                     /locus_tag="Dda3937_02004"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_003880899.1"
                     /db_xref="GI:307128883"
                     /db_xref="ASAP:ABF-0017635"
                     /db_xref="ERIC:ABF-0017635"
                     /db_xref="GeneID:9731511"
                     /translation="MSCLYSESQHCPPRSPVDATRKRADSSMPVSTPPVSTPPKPSPG
                     GLRLNLRIMSVVMFNFASYLNIGLPLAVLPGYVHEHLGFSAFWAGLVISLQYFSTLLS
                     RPRAGRHADEKGPKQVVVFGLSGVLLSGVFYALAAWNDGSPVLALALLCVGRLVLGIG
                     QSFAGTGATLWGVGVVGSLHIGRVISWNGVATYGAMAIGAPLGVWIYHLGGLRLLAIV
                     IVLVAGAAILLALPRPAVTVTPGKKLPFREVLGKVWLYGVILSLASAGFGVISTFITL
                     FYASRQWDGAALTLSLFSCAFVGTRLLFPNVINRFGGLRVALACFLVESAGLLLVWLA
                     SHPLMAEAGAFFAGAGFSLVFPALGVVAVKAVSAQNQGSALATYTIFLDLSLGVVGPA
                     AGVMMAYTDIDAIYLAAAGLALVGLLLTVRLYQRGGRDAKAV"
     misc_feature    140822..142012
                     /gene="yhhS"
                     /locus_tag="Dda3937_02004"
                     /note="major facilitator superfamily transporter;
                     Provisional; Region: PRK05122"
                     /db_xref="CDD:235348"
     misc_feature    140870..141934
                     /gene="yhhS"
                     /locus_tag="Dda3937_02004"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(140912..140914,140921..140929,140933..140938,
                     140990..140992,140999..141004,141011..141013,
                     141023..141028,141032..141037,141197..141202,
                     141209..141214,141221..141226,141233..141235,
                     141269..141274,141281..141286,141302..141304,
                     141506..141508,141515..141520,141527..141532,
                     141539..141541,141572..141574,141584..141586,
                     141596..141598,141605..141607,141617..141619,
                     141758..141760,141767..141772,141779..141781,
                     141791..141796,141803..141805,141836..141841,
                     141848..141853,141860..141865,141872..141874)
                     /gene="yhhS"
                     /locus_tag="Dda3937_02004"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(142077..142742)
                     /gene="dcrB"
                     /locus_tag="Dda3937_02005"
                     /gene_synonym="drcB; yhhR"
                     /db_xref="GeneID:9731512"
     CDS             complement(142077..142742)
                     /gene="dcrB"
                     /locus_tag="Dda3937_02005"
                     /gene_synonym="drcB; yhhR"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /note="lipoproteine"
                     /codon_start=1
                     /transl_table=11
                     /product="DcrB protein"
                     /protein_id="YP_003880900.1"
                     /db_xref="GI:307128884"
                     /db_xref="ASAP:ABF-0017636"
                     /db_xref="ERIC:ABF-0017636"
                     /db_xref="GeneID:9731512"
                     /translation="MITKRLFLRPESGAIAPLLFLFVMFLFVIKERIPMPNLAKYIGI
                     GLLAATLAACDGNSDKKTSAPAASPAAEKTTAQNVSLLSGKLTFTLPDGLSDQSGKLG
                     NQNNNMHVYADQSGQKAIIVIVGDDTPLDLPALGQRLEQQQRGRDANLQVLGNKTAEI
                     NGHQIQQLDSVLTSNGQKAFSSIVLAKADSRLLTLQITLPADNLQQAQADAGKIINTL
                     KLN"
     misc_feature    complement(142080..142640)
                     /gene="dcrB"
                     /locus_tag="Dda3937_02005"
                     /gene_synonym="drcB; yhhR"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11615"
                     /db_xref="CDD:183232"
     gene            complement(142826..143497)
                     /gene="yhhQ"
                     /locus_tag="Dda3937_02006"
                     /db_xref="GeneID:9731513"
     CDS             complement(142826..143497)
                     /gene="yhhQ"
                     /locus_tag="Dda3937_02006"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880901.1"
                     /db_xref="GI:307128885"
                     /db_xref="ASAP:ABF-0017638"
                     /db_xref="ERIC:ABF-0017638"
                     /db_xref="GeneID:9731513"
                     /translation="MFQFSAQQRLTALCWLSLFHILVIISSNYLVQLPITLFGFHTTW
                     GAFTFPFIFLASDLTVRIFGAPLARRIILTVMVPALVASYLVSSLFYKGEWQGFSALS
                     QVNPMVARIAAASLMAYLLGQILDVQVFNRLRRLKAWWVAPAASAVLGNLSDTVAFFF
                     IAFYRSTDPFMATHWMEIATVDYFFKIAINLIFFLPMYGVLLNMVLRRLSQPGSNAPY
                     QDQTA"
     misc_feature    complement(142871..143497)
                     /gene="yhhQ"
                     /locus_tag="Dda3937_02006"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11212"
                     /db_xref="CDD:183041"
     gene            144107..144352
                     /gene="sirA"
                     /locus_tag="Dda3937_02007"
                     /gene_synonym="tusA; yhhP"
                     /db_xref="GeneID:9731514"
     CDS             144107..144352
                     /gene="sirA"
                     /locus_tag="Dda3937_02007"
                     /gene_synonym="tusA; yhhP"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur transfer protein"
                     /protein_id="YP_003880902.1"
                     /db_xref="GI:307128886"
                     /db_xref="ASAP:ABF-0017639"
                     /db_xref="ERIC:ABF-0017639"
                     /db_xref="GeneID:9731514"
                     /translation="MTDIFANPDRTLDAQGLRCPEPVMMVRKTVRQMDAGQTLLILAD
                     DPATTRDIPGFCRYMEHELLAQMTEQLPYRYLLRKGA"
     misc_feature    144137..144343
                     /gene="sirA"
                     /locus_tag="Dda3937_02007"
                     /gene_synonym="tusA; yhhP"
                     /note="SirA (also known as UvrY,  and YhhP) belongs to a
                     family of two-component response regulators that controls
                     secondary metabolism and virulence. The other member of
                     this two-component system is a sensor kinase called BarA
                     which phosphorylates SirA.  A...; Region: SirA; cd03423"
                     /db_xref="CDD:239515"
     misc_feature    order(144140..144145,144152..144154,144161..144172,
                     144176..144178)
                     /gene="sirA"
                     /locus_tag="Dda3937_02007"
                     /gene_synonym="tusA; yhhP"
                     /note="CPxP  motif; other site"
                     /db_xref="CDD:239515"
     gene            complement(144435..145064)
                     /gene="yhhN"
                     /locus_tag="Dda3937_02008"
                     /db_xref="GeneID:9731515"
     CDS             complement(144435..145064)
                     /gene="yhhN"
                     /locus_tag="Dda3937_02008"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880903.1"
                     /db_xref="GI:307128887"
                     /db_xref="ASAP:ABF-0017640"
                     /db_xref="ERIC:ABF-0017640"
                     /db_xref="GeneID:9731515"
                     /translation="MLWSFIAVFFSGWLYVDASYRGPVWQRWLFKPVTLLLMMLMVWQ
                     TPMLGIPGYLVVLGLAATLIGDALMQLSGDRLRFALSTYLASHLLYTISFFASRPSLG
                     FFWPLPLTLLILSALLLALLWSRLEAERLTVTALVLVTAFMAWVAGEHYFALGNESNF
                     SLLLGTLLLFAGHAIWLVNHFRVNFRAHQALVAICYFGGHFLIVRSLYV"
     misc_feature    complement(144441..145064)
                     /gene="yhhN"
                     /locus_tag="Dda3937_02008"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3714"
                     /db_xref="CDD:226237"
     gene            145336..145662
                     /locus_tag="Dda3937_02009"
                     /db_xref="GeneID:9731516"
     CDS             145336..145662
                     /locus_tag="Dda3937_02009"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880904.1"
                     /db_xref="GI:307128888"
                     /db_xref="ASAP:ABF-0017641"
                     /db_xref="ERIC:ABF-0017641"
                     /db_xref="GeneID:9731516"
                     /translation="MSNEPVLYRIQFINNGKNYQLYVRELVQSNLFGFIEIADFVFDN
                     PSTVLVDPTTEKLKTEFAGVDRSYIPLQAVIRIDAVTGRERDSARISELGDNVTHFPS
                     LPGKKP"
     misc_feature    145351..145641
                     /locus_tag="Dda3937_02009"
                     /note="Domain of unknown function (DUF1820); Region:
                     DUF1820; pfam08850"
                     /db_xref="CDD:149796"
     gene            complement(145723..146010)
                     /gene="yhhL"
                     /locus_tag="Dda3937_02010"
                     /db_xref="GeneID:9731517"
     CDS             complement(145723..146010)
                     /gene="yhhL"
                     /locus_tag="Dda3937_02010"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880905.1"
                     /db_xref="GI:307128889"
                     /db_xref="ASAP:ABF-0017643"
                     /db_xref="ERIC:ABF-0017643"
                     /db_xref="GeneID:9731517"
                     /translation="MSIWINLGRLLMLGIWGFLVMNLIHPFPRPLNIFMILAMGFMLL
                     MHGVQFLLLKASQPKDAPPLSGLLQLRIFLFGVFELLDWQRKQPAPPRKRR"
     misc_feature    complement(145738..146004)
                     /gene="yhhL"
                     /locus_tag="Dda3937_02010"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10910"
                     /db_xref="CDD:182831"
     gene            complement(145994..146617)
                     /gene="yhhF"
                     /locus_tag="Dda3937_02011"
                     /gene_synonym="rsmD"
                     /db_xref="GeneID:9731518"
     CDS             complement(145994..146617)
                     /gene="yhhF"
                     /locus_tag="Dda3937_02011"
                     /gene_synonym="rsmD"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA m(2)G966 methyltransferase"
                     /protein_id="YP_003880906.1"
                     /db_xref="GI:307128890"
                     /db_xref="ASAP:ABF-0017644"
                     /db_xref="ERIC:ABF-0017644"
                     /db_xref="GeneID:9731518"
                     /translation="MVKHQATSAPGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETL
                     FNWLAPVIQQSRCLDCFAGSGALGLEALSRYAAHATLLEAERNVARQLTQNLSLLRAD
                     NAEVVNADTLQWLAKPASAQPYDVVFLDPPFRRGLLDDTLRLLETGGWLAQETWIYIE
                     TEAENRTLAIPPTWTLHREKTAGQVSYRLYIRHASDAASGGNDEHLD"
     misc_feature    complement(146165..146452)
                     /gene="yhhF"
                     /locus_tag="Dda3937_02011"
                     /gene_synonym="rsmD"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(146228..146230,146285..146293,
                     146366..146371,146420..146440))
                     /gene="yhhF"
                     /locus_tag="Dda3937_02011"
                     /gene_synonym="rsmD"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            146929..148269
                     /gene="ftsY"
                     /locus_tag="Dda3937_02012"
                     /db_xref="GeneID:9731519"
     CDS             146929..148269
                     /gene="ftsY"
                     /locus_tag="Dda3937_02012"
                     /function="5.1 cell processes; cell division"
                     /function="4.3.A.5 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The Type II (General) Secretory Pathway
                     (IISP) Family"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle protein"
                     /protein_id="YP_003880907.1"
                     /db_xref="GI:307128891"
                     /db_xref="ASAP:ABF-0017646"
                     /db_xref="ERIC:ABF-0017646"
                     /db_xref="GeneID:9731519"
                     /translation="MAKEKKRGFFSWLGLGRQDEDKTEQPQPAPEAPQADDATPAAPE
                     PAQNTSDEAPEQPAPNNTALAETGETPAPESQPTETAAEIPPTPVEPPETVALVAEPT
                     ADAEPQTDTVAEDGVEPEPETVIVPAAPVVSQEQERPTKEGFFARLKRSLVKTRQNLG
                     SGFVGLFRGKKIDDDLFDELEEQLLIADVGVETTRKIIDRLTEHASRKQLKDAEALIA
                     LLKAEMSDILAKVDAPLDIDSKTPFVILMVGVNGVGKTTTIGKLARQYQAQGKSVMLA
                     AGDTFRAAAVEQLQVWGQRNNVPVVAQHTGADSASVIFDALQAARARGVDVLIADTAG
                     RLQNKSHLMEELKKIVRVMKKLDENAPHEVMLTLDASTGQNAVSQAKLFNETVGLSGI
                     TLTKLDGTAKGGVIFAIADQFGIPIRYIGVGESIDDLRPFKADDFIEALFARED"
     misc_feature    <147058..147333
                     /gene="ftsY"
                     /locus_tag="Dda3937_02012"
                     /note="Mitochondria Localisation Sequence; Region:
                     AIF-MLS; pfam14962"
                     /db_xref="CDD:259099"
     misc_feature    147331..148266
                     /gene="ftsY"
                     /locus_tag="Dda3937_02012"
                     /note="signal recognition particle-docking protein FtsY;
                     Provisional; Region: PRK10416"
                     /db_xref="CDD:236686"
     misc_feature    147370..147600
                     /gene="ftsY"
                     /locus_tag="Dda3937_02012"
                     /note="SRP54-type protein, helical bundle domain; Region:
                     SRP54_N; pfam02881"
                     /db_xref="CDD:251589"
     misc_feature    147655..148191
                     /gene="ftsY"
                     /locus_tag="Dda3937_02012"
                     /note="The signal recognition particle (SRP) mediates the
                     transport to or across the plasma membrane in bacteria and
                     the endoplasmic reticulum in eukaryotes. SRP recognizes
                     N-terminal sighnal sequences of newly synthesized
                     polypeptides at the ribosome. The...; Region: SRP;
                     cd03115"
                     /db_xref="CDD:239389"
     misc_feature    147673..147696
                     /gene="ftsY"
                     /locus_tag="Dda3937_02012"
                     /note="P loop; other site"
                     /db_xref="CDD:239389"
     misc_feature    order(147763..147765,147928..147930,148111..148113,
                     148120..148125)
                     /gene="ftsY"
                     /locus_tag="Dda3937_02012"
                     /note="GTP binding site [chemical binding]; other site"
                     /db_xref="CDD:239389"
     gene            148275..148943
                     /gene="ftsE"
                     /locus_tag="Dda3937_02013"
                     /db_xref="GeneID:9731520"
     CDS             148275..148943
                     /gene="ftsE"
                     /locus_tag="Dda3937_02013"
                     /function="5.1 cell processes; cell division"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="4.3.A.5 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The Type II (General) Secretory Pathway
                     (IISP) Family"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_003880908.1"
                     /db_xref="GI:307128892"
                     /db_xref="ASAP:ABF-0017647"
                     /db_xref="ERIC:ABF-0017647"
                     /db_xref="GeneID:9731520"
                     /translation="MIRFEQVSKAYLGGRQALQGVDFHIRPAEMVFLTGHSGAGKSTL
                     LKLICGIERPSAGHILFGGHDISRLKKSEVPFLRRQIGMIFQDHHLLMDRTVYENVAM
                     PLIIAGASAEDIRRRVSAALDKVGLLDKARSYPIQLSGGEQQRVGIARAVVNKPAVLL
                     ADEPTGNLDEALSEGILRLFEEFNRVGVTVLMATHDTGLIARRHYRVLTLSQGRMLGG
                     HDGE"
     misc_feature    148275..148940
                     /gene="ftsE"
                     /locus_tag="Dda3937_02013"
                     /note="cell division protein FtsE; Provisional; Region:
                     PRK10908"
                     /db_xref="CDD:182829"
     misc_feature    148278..148919
                     /gene="ftsE"
                     /locus_tag="Dda3937_02013"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    148377..148400
                     /gene="ftsE"
                     /locus_tag="Dda3937_02013"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(148386..148391,148395..148403,148530..148532,
                     148758..148763,148857..148859)
                     /gene="ftsE"
                     /locus_tag="Dda3937_02013"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    148521..148532
                     /gene="ftsE"
                     /locus_tag="Dda3937_02013"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    148686..148715
                     /gene="ftsE"
                     /locus_tag="Dda3937_02013"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    148746..148763
                     /gene="ftsE"
                     /locus_tag="Dda3937_02013"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    148770..148781
                     /gene="ftsE"
                     /locus_tag="Dda3937_02013"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    148845..148865
                     /gene="ftsE"
                     /locus_tag="Dda3937_02013"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            148933..149904
                     /gene="ftsX"
                     /locus_tag="Dda3937_02014"
                     /gene_synonym="ftsS"
                     /db_xref="GeneID:9731521"
     CDS             148933..149904
                     /gene="ftsX"
                     /locus_tag="Dda3937_02014"
                     /gene_synonym="ftsS"
                     /function="7.3 location of gene products; inner membrane"
                     /function="5.1 cell processes; cell division"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_003880909.1"
                     /db_xref="GI:307128893"
                     /db_xref="ASAP:ABF-0017650"
                     /db_xref="ERIC:ABF-0017650"
                     /db_xref="GeneID:9731521"
                     /translation="MANNTRAQRAGSKTKTRSLQGGWQEQWRYAWANTLRDMLRQPLA
                     TLLTIMVIAISLTLPSICYLVWKNVSQAASQWYPTPQLTVYLDKSLDDNAAEAVIGKI
                     KAEEGVDKVNYLSRNEAMGEFRNWSGFGGALDMLEENPLPAVAVVSPKLGFQNNQTLN
                     TLRDRIAAVQGVDEVRMDDSWFSRLVALTGLVGQIAATIGILMVVAVFLVIGNSVRLS
                     IFSRRDTINVMKLIGATDGFILRPFLHGGALLGLCGAVLSLILSQALVWKLSGAVAQV
                     AAVFGTTFTVRGLGWDETLLLILIAVMIGWLAAWLATVQHLRRFTPE"
     misc_feature    148981..149901
                     /gene="ftsX"
                     /locus_tag="Dda3937_02014"
                     /gene_synonym="ftsS"
                     /note="cell division ABC transporter subunit FtsX;
                     Provisional; Region: ftsX; PRK11026"
                     /db_xref="CDD:182910"
     misc_feature    148999..149901
                     /gene="ftsX"
                     /locus_tag="Dda3937_02014"
                     /gene_synonym="ftsS"
                     /note="putative protein insertion permease FtsX; Region:
                     ftsX; TIGR00439"
                     /db_xref="CDD:129531"
     gene            150265..151122
                     /gene="rpoH"
                     /locus_tag="Dda3937_02015"
                     /gene_synonym="fam; hin; htpR"
                     /db_xref="GeneID:9731522"
     CDS             150265..151122
                     /gene="rpoH"
                     /locus_tag="Dda3937_02015"
                     /gene_synonym="fam; hin; htpR"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.1 regulation; type of regulation;
                     transcriptional level; sigma factors, anti-sigmafactors"
                     /function="5.5.2 cell processes; adaptation to stress;
                     temperature extremes"
                     /function="3.3.3 regulation; genetic unit regulated;
                     stimulon"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="sigma 32 is cleaved by the membrane bound protease
                     FtsH (HflB) and by the cytosolic protease ClpQY (HslVU)"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-32 (sigma H) factor"
                     /protein_id="YP_003880910.1"
                     /db_xref="GI:307128894"
                     /db_xref="ASAP:ABF-0017652"
                     /db_xref="ERIC:ABF-0017652"
                     /db_xref="GeneID:9731522"
                     /translation="MTKDMQTFALVPQGSLEGYIRAANAYPMLTAEEERALAERLHYH
                     GDLDAAKQLILSHLRFVIHVARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLV
                     SFAVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVELVARE
                     LGVTSKDVREMESRMAAQDMTFDPSPEDDAQPGQPMAPMLYLQDKSSDFADGIEEDNW
                     ETHAADKLTYALEGLDERSQHIIRARWLDDDNKSTLQELADHYGVSAERVRQLEKNAM
                     KKLRAAIEA"
     misc_feature    150265..151119
                     /gene="rpoH"
                     /locus_tag="Dda3937_02015"
                     /gene_synonym="fam; hin; htpR"
                     /note="RNA polymerase factor sigma-32; Reviewed; Region:
                     PRK06596"
                     /db_xref="CDD:235838"
     misc_feature    150421..150633
                     /gene="rpoH"
                     /locus_tag="Dda3937_02015"
                     /gene_synonym="fam; hin; htpR"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    150934..151104
                     /gene="rpoH"
                     /locus_tag="Dda3937_02015"
                     /gene_synonym="fam; hin; htpR"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(150964..150966,150994..150996,151021..151026,
                     151054..151056,151060..151065,151069..151077,
                     151081..151086,151090..151092)
                     /gene="rpoH"
                     /locus_tag="Dda3937_02015"
                     /gene_synonym="fam; hin; htpR"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(151241..151678)
                     /gene="yhhK"
                     /locus_tag="Dda3937_02016"
                     /db_xref="GeneID:9731523"
     CDS             complement(151241..151678)
                     /gene="yhhK"
                     /locus_tag="Dda3937_02016"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="YP_003880911.1"
                     /db_xref="GI:307128895"
                     /db_xref="ASAP:ABF-0017653"
                     /db_xref="ERIC:ABF-0017653"
                     /db_xref="GeneID:9731523"
                     /translation="MRLSVERLTKISEQDRHDLAFIWPHQNFDALERDLNHEHRLFAA
                     RFNDRLLAGVIVEIDNNSDSAELTDLQVRTSTRRHGVGKYLVEEVLRACPDVKEWWLD
                     AADHALVSEAVMDTFMQSCGFYPVSGGWEYVVNQEKEMNREEK"
     misc_feature    complement(151286..151675)
                     /gene="yhhK"
                     /locus_tag="Dda3937_02016"
                     /note="Acetyltransferase (GNAT) domain; Region: DUF3749;
                     pfam12568"
                     /db_xref="CDD:204966"
     misc_feature    complement(151400..151558)
                     /gene="yhhK"
                     /locus_tag="Dda3937_02016"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(151430..151435,151463..151471))
                     /gene="yhhK"
                     /locus_tag="Dda3937_02016"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            152061..153194
                     /gene="livK"
                     /locus_tag="Dda3937_02017"
                     /gene_synonym="livJ"
                     /db_xref="GeneID:9731524"
     CDS             152061..153194
                     /gene="livK"
                     /locus_tag="Dda3937_02017"
                     /gene_synonym="livJ"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="4.S.108 transport; substrate;
                     L-leucine/L-valine/L-iso-leucine"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="1.5.1.18 metabolism; building block
                     biosynthesis; amino acids; isoleucine/valine"
                     /function="1.5.1.19 metabolism; building block
                     biosynthesis; amino acids; leucine"
                     /note="Erwinia chrysanthemi has only one high-affinity
                     branched-chain amino acid-binding protein, whereas E. coli
                     has two: LivJ (leucine, isoleucine, valine
                     substrate-binding protein; LIV), and LivK
                     (leucine-specific substrate-binding protein; LS). The E.
                     chrysanthemi protein was named LivK on the basis of gene
                     context and similarity, but it is also very similar to
                     LivJ. There is no experimental evidence regarding the
                     ligand specificity of this protein."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_003880912.1"
                     /db_xref="GI:307128896"
                     /db_xref="ASAP:ABF-0017656"
                     /db_xref="ERIC:ABF-0017656"
                     /db_xref="GeneID:9731524"
                     /translation="MTDGVKRMKLSKGKALLVGCLAAAMSHAVNAADIKVAIVGAMSG
                     PVAQYGDMEFTGARQAIADINAKGGVNGNKLVGVEYDDACDPKQAVAVANKVINDGIH
                     YVIGHLCSSSTQPASDIYEDEGVIMITPAATAPDLTTRGYKLVMRTTGLDSDQGPTAA
                     KYILEHVKPQRIAVVHDKQQYGEGLARAVQDSLKKSKANVVLFEGVTAGDKDFSTLVA
                     RLKKENVDFVYFGGYYPEMGQILRQARAAGLTTKFMGPEGVGNSSLSNIAGAASEGML
                     VTLPKRYDQVPTNQPIVDALKAKKLDPTGPFVWTTYAALQSLTTAMQRTGSTEPAKLA
                     ADLKAKSVDTVMGPLSWDEKGDLKGFEFGVFEWHADGTSSPVK"
     misc_feature    152163..153161
                     /gene="livK"
                     /locus_tag="Dda3937_02017"
                     /gene_synonym="livJ"
                     /note="Type I periplasmic ligand-binding domain of ABC
                     (Atpase Binding Cassette)-type active transport systems
                     that are involved in the transport of all three branched
                     chain aliphatic amino acids (leucine, isoleucine and
                     valine); Region: PBP1_ABC_LIVBP_like; cd06342"
                     /db_xref="CDD:107337"
     misc_feature    order(152184..152186,152211..152213,152223..152225,
                     152232..152234,152784..152786,152847..152849,
                     152856..152858,152865..152870,152958..152960)
                     /gene="livK"
                     /locus_tag="Dda3937_02017"
                     /gene_synonym="livJ"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107337"
     misc_feature    152214..153164
                     /gene="livK"
                     /locus_tag="Dda3937_02017"
                     /gene_synonym="livJ"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     misc_feature    order(152382..152390,152451..152456,152601..152603,
                     152757..152759,152829..152831)
                     /gene="livK"
                     /locus_tag="Dda3937_02017"
                     /gene_synonym="livJ"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107337"
     gene            153273..154199
                     /gene="livH"
                     /locus_tag="Dda3937_02018"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /db_xref="GeneID:9731525"
     CDS             153273..154199
                     /gene="livH"
                     /locus_tag="Dda3937_02018"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="4.S.108 transport; substrate;
                     L-leucine/L-valine/L-iso-leucine"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.5.1.18 metabolism; building block
                     biosynthesis; amino acids; isoleucine/valine"
                     /function="1.5.1.19 metabolism; building block
                     biosynthesis; amino acids; leucine"
                     /function="6.1 cell structure; membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine ABC transporter"
                     /protein_id="YP_003880913.1"
                     /db_xref="GI:307128897"
                     /db_xref="ASAP:ABF-0017657"
                     /db_xref="ERIC:ABF-0017657"
                     /db_xref="GeneID:9731525"
                     /translation="MSEQFLYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHG
                     EVYMIGSYVSFIVIAALMMMGIDAGWLLIGVAFIAAVVISSAYGWSIERVAYKPVRNS
                     KRLIALISAIGMSIFLQNYVSLTQGSRDVALPSLIHGQWVLGESNGFAATLSSMQLTI
                     WIVTFLAMLALTLFIRYSRMGRACRACAEDLKMASLLGISTDRVISLTFVIGAVMAAV
                     AGVLLGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLVLGIAEALTSAYLS
                     TEYKDVVSFALLIGVLLVMPTGILGRPEVEKV"
     misc_feature    153315..154172
                     /gene="livH"
                     /locus_tag="Dda3937_02018"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    153846..153902
                     /gene="livH"
                     /locus_tag="Dda3937_02018"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            154196..155470
                     /gene="livM"
                     /locus_tag="Dda3937_02019"
                     /db_xref="GeneID:9731526"
     CDS             154196..155470
                     /gene="livM"
                     /locus_tag="Dda3937_02019"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="4.S.108 transport; substrate;
                     L-leucine/L-valine/L-iso-leucine"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.5.1.18 metabolism; building block
                     biosynthesis; amino acids; isoleucine/valine"
                     /function="1.5.1.19 metabolism; building block
                     biosynthesis; amino acids; leucine"
                     /function="6.1 cell structure; membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine ABC transporter"
                     /protein_id="YP_003880914.1"
                     /db_xref="GI:307128898"
                     /db_xref="ASAP:ABF-0017658"
                     /db_xref="ERIC:ABF-0017658"
                     /db_xref="GeneID:9731526"
                     /translation="MKLHTLVNAVVSALVLLVLATFVMGMQLSLDGTQLVVHGAEKVR
                     WMWIIAACVLVFLFQLLRPVLAQGAKKVSGPGLVLPSFDGSTPRQKLLALALIIAAVA
                     WPFVVSRGTVDIATLTMIYIILGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLSHYY
                     GLGFWQCLPLAGLTAALSGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTGFTGG
                     PNGISQIPKPTFFGLEFSRSPREGGWDTFHHFFGLTYDPSDRIIFLYMVALLLVLLTL
                     FVINRLLRMPLGRAWEALREDEIACRSLGLSPTKIKLTAFTISAAFAGFAGTLFAARQ
                     GFVSPESFTFVESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDLNEYSMLLLGA
                     LMVLMMIWRPQGLLPMKRTQIKLQVEKKEEQA"
     misc_feature    154196..155452
                     /gene="livM"
                     /locus_tag="Dda3937_02019"
                     /note="leucine/isoleucine/valine transporter permease
                     subunit; Provisional; Region: livM; PRK11301"
                     /db_xref="CDD:236896"
     misc_feature    154256..154504
                     /gene="livM"
                     /locus_tag="Dda3937_02019"
                     /note="Domain of unknown function (DUF3382); Region:
                     DUF3382; pfam11862"
                     /db_xref="CDD:256682"
     misc_feature    154550..155416
                     /gene="livM"
                     /locus_tag="Dda3937_02019"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    155090..155146
                     /gene="livM"
                     /locus_tag="Dda3937_02019"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            155467..156237
                     /gene="livG"
                     /locus_tag="Dda3937_02020"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /db_xref="GeneID:9731527"
     CDS             155467..156237
                     /gene="livG"
                     /locus_tag="Dda3937_02020"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="4.S.108 transport; substrate;
                     L-leucine/L-valine/L-iso-leucine"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="1.5.1.18 metabolism; building block
                     biosynthesis; amino acids; isoleucine/valine"
                     /function="1.5.1.19 metabolism; building block
                     biosynthesis; amino acids; leucine"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine ABC transporter
                     ATP-binding protein"
                     /protein_id="YP_003880915.1"
                     /db_xref="GI:307128899"
                     /db_xref="ASAP:ABF-0017659"
                     /db_xref="ERIC:ABF-0017659"
                     /db_xref="GeneID:9731527"
                     /translation="MSTQPLLSVRGLMMRFGGLLAVNNVELDLHQGEIVSLIGPNGAG
                     KTTVFNCLTGFYRPTGGTILLRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENL
                     LVAQHQHLKSGVFAGLLKTPAFRRAEADAQQRAAVWLERVGLLELANRQAGNLAYGQQ
                     RRLEIARCMVTRPELLMLDEPAAGLNPKETEELNELIIDLRGNHQVSVLLIEHDMKLV
                     MGISDRIYVVNQGTPLANGTPAEIRNNPDVVRAYLGEG"
     misc_feature    155470..156231
                     /gene="livG"
                     /locus_tag="Dda3937_02020"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /note="leucine/isoleucine/valine transporter ATP-binding
                     subunit; Provisional; Region: livG; PRK11300"
                     /db_xref="CDD:183080"
     misc_feature    155485..156210
                     /gene="livG"
                     /locus_tag="Dda3937_02020"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    155581..155604
                     /gene="livG"
                     /locus_tag="Dda3937_02020"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    order(155590..155595,155599..155607,155728..155730,
                     156001..156006,156103..156105)
                     /gene="livG"
                     /locus_tag="Dda3937_02020"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    155719..155730
                     /gene="livG"
                     /locus_tag="Dda3937_02020"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    155929..155958
                     /gene="livG"
                     /locus_tag="Dda3937_02020"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    155989..156006
                     /gene="livG"
                     /locus_tag="Dda3937_02020"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    156013..156024
                     /gene="livG"
                     /locus_tag="Dda3937_02020"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    156091..156111
                     /gene="livG"
                     /locus_tag="Dda3937_02020"
                     /gene_synonym="hrbB; hrbC; hrbD"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            156244..156945
                     /gene="livF"
                     /locus_tag="Dda3937_02021"
                     /db_xref="GeneID:9731528"
     CDS             156244..156945
                     /gene="livF"
                     /locus_tag="Dda3937_02021"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="4.S.108 transport; substrate;
                     L-leucine/L-valine/L-iso-leucine"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="1.5.1.18 metabolism; building block
                     biosynthesis; amino acids; isoleucine/valine"
                     /function="1.5.1.19 metabolism; building block
                     biosynthesis; amino acids; leucine"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine ABC transporter
                     ATP-binding protein"
                     /protein_id="YP_003880916.1"
                     /db_xref="GI:307128900"
                     /db_xref="ASAP:ABF-0017660"
                     /db_xref="ERIC:ABF-0017660"
                     /db_xref="GeneID:9731528"
                     /translation="MLSLNQVSAHYGKIQALHQVSLHINQGEIVTLIGANGAGKTTLL
                     GTLCGEPRASEGSIVFDGKDITDWQTARIMREAIAIVPEGRRVFSRMTVEENLAMGGF
                     FASREQYQQRIARVYDLFPRLYERRIQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEP
                     SLGLAPIIILQIFDTIQQLREEGMTIFLVEQNANQALRLADRGYVLENGRVVLEDTGD
                     ALLANEAVRSAYLGG"
     misc_feature    156244..156942
                     /gene="livF"
                     /locus_tag="Dda3937_02021"
                     /note="leucine/isoleucine/valine transporter ATP-binding
                     subunit; Provisional; Region: livF; PRK11614"
                     /db_xref="CDD:183231"
     misc_feature    156247..156912
                     /gene="livF"
                     /locus_tag="Dda3937_02021"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    156343..156366
                     /gene="livF"
                     /locus_tag="Dda3937_02021"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    order(156352..156357,156361..156369,156490..156492,
                     156715..156720,156814..156816)
                     /gene="livF"
                     /locus_tag="Dda3937_02021"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    156481..156492
                     /gene="livF"
                     /locus_tag="Dda3937_02021"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    156643..156672
                     /gene="livF"
                     /locus_tag="Dda3937_02021"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    156703..156720
                     /gene="livF"
                     /locus_tag="Dda3937_02021"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    156727..156738
                     /gene="livF"
                     /locus_tag="Dda3937_02021"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    156802..156822
                     /gene="livF"
                     /locus_tag="Dda3937_02021"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            157004..158200
                     /locus_tag="Dda3937_02022"
                     /db_xref="GeneID:9731529"
     CDS             157004..158200
                     /locus_tag="Dda3937_02022"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="valine-pyruvate aminotransferase"
                     /protein_id="YP_003880917.1"
                     /db_xref="GI:307128901"
                     /db_xref="ASAP:ABF-0017661"
                     /db_xref="ERIC:ABF-0017661"
                     /db_xref="GeneID:9731529"
                     /translation="MRFDMSTDGLLAQRMARLKSSAIRELLKHSKMDGVISLAGGIPS
                     DALFDFQGLNEATQLAITEQPKSAFQYGLTEGSPLLRERIAELCALRGVHTQAQDIVV
                     TAGSQQALDLVMRATTNPQDIFVVERPTYLAALQTLELAEAQVMSVSSDENGMVVDEL
                     AALLETTRIKGVYLVPNFGNPSGVTLSDARRRQLVALAARHDFLIVEDDPYGELRFTE
                     ERHATLYQLAKEAGHADRVVYTSSFSKILAPGLRLGWAILPDWLLHKVAIIKQAADLH
                     ASSLSQTIVEYYLGTGRLPAQIDKIRQAYRQKGELLSELMASELGDVLSFNQPKGGMF
                     LWARFRQPFDTTAWLQKTLAQGVVFVPGEFFFADNPDQSTLRLSFATATEEQMHEAVA
                     RLRRAL"
     misc_feature    157040..158197
                     /locus_tag="Dda3937_02022"
                     /note="Aspartate/tyrosine/aromatic aminotransferase [Amino
                     acid transport and metabolism]; Region: COG0436"
                     /db_xref="CDD:223513"
     misc_feature    157109..158191
                     /locus_tag="Dda3937_02022"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(157316..157324,157394..157396,157541..157543,
                     157634..157636,157727..157729,157733..157738,
                     157757..157759)
                     /locus_tag="Dda3937_02022"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(157325..157327,157424..157426,157613..157615,
                     157751..157759,157844..157846,157853..157855)
                     /locus_tag="Dda3937_02022"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    157736..157738
                     /locus_tag="Dda3937_02022"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(158331..159950)
                     /locus_tag="Dda3937_02023"
                     /db_xref="GeneID:9731530"
     CDS             complement(158331..159950)
                     /locus_tag="Dda3937_02023"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_003880918.1"
                     /db_xref="GI:307128902"
                     /db_xref="ASAP:ABF-0017662"
                     /db_xref="ERIC:ABF-0017662"
                     /db_xref="GeneID:9731530"
                     /translation="MKLGTLLSISFAAVIIIGFLVASFGRFQLHQLSGNIETLAQNRL
                     VKLVLIHNYKDNINIVANAIRNMVMMTDQAQMAAESKRIRETIDKSTEIINTFSNMTV
                     SPDAKVLLKHLENVRPENIQALKKAEALALENRDEEAKAVILNEFQPAQNKVFNAIDD
                     IINYQKNATADLAHSSEQRADSAGQTMLVLALIAMAIGCLVAWFITRQVRSKLGGEPA
                     DAASIAQQIAQGNLITTIPIRDKDSGSVLAAIDQMRGGLINIVEQVSQSSHAIASGAN
                     EIAAGTNDLSQRTEEQAASLQQTAASMEQISNAVSHNVETIRMAAELANATSQTASKG
                     NQVVGDVVATMADITQSSHQIVEIISLIDNIAFQTNILALNAGVEAARAGEEGKGFAV
                     VAHEVRSLAQHSASAAREIKSLIIESVKKIETGADRVNLAGSTISELLEQSRQVAQLI
                     NEIGITTNEQQQGIAQINTAIAQLDQVTHQNAALVEESACATDNLNHQAAHLVEVISV
                     FVVDDVISRKRLDTPDEHSLVPVAGQQLATH"
     misc_feature    complement(159411..159950)
                     /locus_tag="Dda3937_02023"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(158424..159164)
                     /locus_tag="Dda3937_02023"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(158484..159083)
                     /locus_tag="Dda3937_02023"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(158487..158492,158499..158501,
                     158508..158513,158520..158522,158529..158534,
                     158538..158543,158550..158555,158559..158564,
                     158571..158573,158580..158585,158592..158594,
                     158601..158606,158613..158618,158622..158627,
                     158634..158636,158643..158648,158655..158657,
                     158664..158669,158706..158711,158718..158723,
                     158727..158732,158739..158744,158751..158753,
                     158760..158765,158772..158774,158781..158783,
                     158793..158795,158814..158816,158823..158825,
                     158835..158837,158844..158849,158856..158858,
                     158865..158867,158874..158879,158886..158891,
                     158898..158900,158907..158912,158916..158918,
                     158928..158933,158937..158942,158949..158951,
                     158958..158963,158970..158975,158982..158984,
                     158991..158996,159003..159005,159012..159017,
                     159021..159026,159033..159035,159042..159047,
                     159054..159059))
                     /locus_tag="Dda3937_02023"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(158748..158849)
                     /locus_tag="Dda3937_02023"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            160619..161644
                     /locus_tag="Dda3937_02024"
                     /db_xref="GeneID:9731531"
     CDS             160619..161644
                     /locus_tag="Dda3937_02024"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="TolA protein"
                     /protein_id="YP_003880919.1"
                     /db_xref="GI:307128903"
                     /db_xref="ASAP:ABF-0017664"
                     /db_xref="ERIC:ABF-0017664"
                     /db_xref="GeneID:9731531"
                     /translation="MFQYMSERLCLMARDYTPRLFVFADGHHDRHCTGFPMTSPISFN
                     RSAAGTSAQNARTDNDAGSTARAGAQADASQEQPSVTSVLVQFSDEVRKRIDSAMRTN
                     MSKINESKQDLARGRIEEIKRRIQMLKMMMMMSPGQSVPPGVLREIRQLAAELGQAAK
                     TLNDGGGNGAANAGTAGGEGSSGAVANGVGDASASALSGAMSVSAAGENASAESDGLA
                     DEDQAVGASPAAKSGEEASAQEAEQLQNVVAAITERGAGSQQRRMDAKSVQDAVRELK
                     SLLAMVKNASKNDDKEAQKQIQAINQSIADIEKTVQSMNMTGGGADISVDLSVGPAGN
                     VSIDVQV"
     misc_feature    161324..>161554
                     /locus_tag="Dda3937_02024"
                     /note="Protein of unknown function (DUF3450); Region:
                     DUF3450; pfam11932"
                     /db_xref="CDD:256737"
     gene            complement(161743..163443)
                     /locus_tag="Dda3937_02025"
                     /db_xref="GeneID:9731532"
     CDS             complement(161743..163443)
                     /locus_tag="Dda3937_02025"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_003880920.1"
                     /db_xref="GI:307128904"
                     /db_xref="ASAP:ABF-0017665"
                     /db_xref="ERIC:ABF-0017665"
                     /db_xref="GeneID:9731532"
                     /translation="MTNTHSSLHTRDANLLMTAIPNRIRHIMQILKNMKLGAMLGSGF
                     ILVILIGFIVAIFGRSQLIHVGNNLDYLSNIRLNNLIAMQEIKDNLNAAARIIRESAI
                     QTDAAHLAQEKHDLEQLIDRNNDLLRQLDEKLKLKKSRELLAQINQARPPYSNAVRKV
                     IELSLSGQQEQARALILGDLLTTQTTLFNAMDTMITEHKNDTIAMSQRFMADASYSGT
                     LLLIVTAISALLGALVAWLITRRVKGQLGGEPTYASHIAQQVAQGDLSIDVMLKTSDH
                     HSLLAAMRTMRDSLSHIVSQVRQSSESIATGSQQIAIGNADLSQRTEEQAASLQQTAA
                     SMEQISQTIRQNGDTVREAAQLATTASQTAAKGSEVVSDVIRTMEEITSSSRKIGDII
                     SVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSASAAREIKELITE
                     SMEKVESGSQRVGHAGVTMEEIVSQAHHVAELIKEIGVTTTEQESGIGQIHQAVSQLD
                     QVTQQNAALVEQSASAADSLNAQAGHLVQLMNVFVLDGHAAQPQRSHGGDWRLALASR
                     "
     misc_feature    complement(162856..163347)
                     /locus_tag="Dda3937_02025"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(162424..>162606)
                     /locus_tag="Dda3937_02025"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(161818..162558)
                     /locus_tag="Dda3937_02025"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(161878..162477)
                     /locus_tag="Dda3937_02025"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(161881..161886,161893..161895,
                     161902..161907,161914..161916,161923..161928,
                     161932..161937,161944..161949,161953..161958,
                     161965..161967,161974..161979,161986..161988,
                     161995..162000,162007..162012,162016..162021,
                     162028..162030,162037..162042,162049..162051,
                     162058..162063,162100..162105,162112..162117,
                     162121..162126,162133..162138,162145..162147,
                     162154..162159,162166..162168,162175..162177,
                     162187..162189,162208..162210,162217..162219,
                     162229..162231,162238..162243,162250..162252,
                     162259..162261,162268..162273,162280..162285,
                     162292..162294,162301..162306,162310..162312,
                     162322..162327,162331..162336,162343..162345,
                     162352..162357,162364..162369,162376..162378,
                     162385..162390,162397..162399,162406..162411,
                     162415..162420,162427..162429,162436..162441,
                     162448..162453))
                     /locus_tag="Dda3937_02025"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(162142..162243)
                     /locus_tag="Dda3937_02025"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(163808..165436)
                     /locus_tag="Dda3937_02026"
                     /db_xref="GeneID:9731533"
     CDS             complement(163808..165436)
                     /locus_tag="Dda3937_02026"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_003880921.1"
                     /db_xref="GI:307128905"
                     /db_xref="ASAP:ABF-0017668"
                     /db_xref="ERIC:ABF-0017668"
                     /db_xref="GeneID:9731533"
                     /translation="MRFFKEMKLGSMLGTGFAMVIVIGFLVAIYGQLQLRQLSTNIQT
                     LSKERITNLLLIQEYKDNLNIAARVIRNIALLSDHQQMTFEKQRLDNMAPRNDDIIAI
                     LHKVAVTPEQQALIAQLDQNRPVYEDAVGRAIEKGLENKDDDARNLILTDVRRAQENM
                     FKVIDSLLAYQKSATSTTADDSESRASNAGILMLSLAALIAVTGSLIAWLITRRIKGQ
                     LGGEPTYASHIAQQVAQGDLSVDVMLKTRDHHSLLAAMRTMRDSLSHIVSQVRQSSES
                     IATGSQQIAMGNADLSQRTEEQAASLQQTAASMEQISQTIRQNGETVREAAQLATTAS
                     DTAAKGSEVVSNVIRTMGDITASSRKIGDIISVIDSIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRSLAQRSASAAREIKELITESMEKVESGSQLVGHAGTTMDDIVTQAR
                     HVADLIKEIGVTTTEQESGISQINLAVNQLDQVTQQNAALVEQSASAADSLSDQARHL
                     VQLMNVFVVAGNNRQDEHAAYPPRADLRLALTSG"
     misc_feature    complement(164879..165418)
                     /locus_tag="Dda3937_02026"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(164498..>164680)
                     /locus_tag="Dda3937_02026"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(163892..164632)
                     /locus_tag="Dda3937_02026"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(163952..164551)
                     /locus_tag="Dda3937_02026"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(163955..163960,163967..163969,
                     163976..163981,163988..163990,163997..164002,
                     164006..164011,164018..164023,164027..164032,
                     164039..164041,164048..164053,164060..164062,
                     164069..164074,164081..164086,164090..164095,
                     164102..164104,164111..164116,164123..164125,
                     164132..164137,164174..164179,164186..164191,
                     164195..164200,164207..164212,164219..164221,
                     164228..164233,164240..164242,164249..164251,
                     164261..164263,164282..164284,164291..164293,
                     164303..164305,164312..164317,164324..164326,
                     164333..164335,164342..164347,164354..164359,
                     164366..164368,164375..164380,164384..164386,
                     164396..164401,164405..164410,164417..164419,
                     164426..164431,164438..164443,164450..164452,
                     164459..164464,164471..164473,164480..164485,
                     164489..164494,164501..164503,164510..164515,
                     164522..164527))
                     /locus_tag="Dda3937_02026"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(164216..164317)
                     /locus_tag="Dda3937_02026"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(166251..167912)
                     /locus_tag="Dda3937_02027"
                     /db_xref="GeneID:9731534"
     CDS             complement(166251..167912)
                     /locus_tag="Dda3937_02027"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_003880922.1"
                     /db_xref="GI:307128906"
                     /db_xref="ASAP:ABF-0017672"
                     /db_xref="ERIC:ABF-0017672"
                     /db_xref="GeneID:9731534"
                     /translation="MSIIKNMKLTTMLGTGFAIVLIISFFVSTYGQFQLRQQSDNVNA
                     LAGDQLEGLLLVQELKDNLNSVAISIRNLTLFTAPDQVAQEKQLITKTITRNSEILKR
                     IAELASTPREKALFDVIDQARPASLAATQKALSLIQDNKLDETKAVIMNEVKPAQDTY
                     FKAINDMVSYQKSDTRRSADEAGQSASFAGMLMLTFAGISTVLGIAIAWLIARRIKKL
                     LGGEPAYTSDIASQIASGNLAINVELQSGDTTSLLAAMNDMRARLSGIVQQVHDSSAS
                     ISTGSSEIAIGSNDLSRRTEEQASSVQQTAASMEQISQTIRQNGDTVREAAQLASSAS
                     QTATKGNEVVRNVITTMSDISTSSRKIGDIITVIDSIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRNLAQRSASAAREIKELITTSMEKVESGSQLVAHAGETMVDIVTQAQ
                     HVANLISEIGVTTREQESGISQINQAITQMDSATQQNAALVEESASAADSLSDQAAKL
                     VELMSVFTIHNTFSKTSPRQQSHTSPALKKPALANKGSTHNWEQF"
     misc_feature    complement(167355..167897)
                     /locus_tag="Dda3937_02027"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(167121..167336)
                     /locus_tag="Dda3937_02027"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:250044"
     misc_feature    complement(166365..167066)
                     /locus_tag="Dda3937_02027"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(166428..167027)
                     /locus_tag="Dda3937_02027"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(166431..166436,166443..166445,
                     166452..166457,166464..166466,166473..166478,
                     166482..166487,166494..166499,166503..166508,
                     166515..166517,166524..166529,166536..166538,
                     166545..166550,166557..166562,166566..166571,
                     166578..166580,166587..166592,166599..166601,
                     166608..166613,166650..166655,166662..166667,
                     166671..166676,166683..166688,166695..166697,
                     166704..166709,166716..166718,166725..166727,
                     166737..166739,166758..166760,166767..166769,
                     166779..166781,166788..166793,166800..166802,
                     166809..166811,166818..166823,166830..166835,
                     166842..166844,166851..166856,166860..166862,
                     166872..166877,166881..166886,166893..166895,
                     166902..166907,166914..166919,166926..166928,
                     166935..166940,166947..166949,166956..166961,
                     166965..166970,166977..166979,166986..166991,
                     166998..167003))
                     /locus_tag="Dda3937_02027"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(166692..166793)
                     /locus_tag="Dda3937_02027"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(168379..170088)
                     /locus_tag="Dda3937_02028"
                     /db_xref="GeneID:9731535"
     CDS             complement(168379..170088)
                     /locus_tag="Dda3937_02028"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_003880923.1"
                     /db_xref="GI:307128907"
                     /db_xref="ASAP:ABF-0017674"
                     /db_xref="ERIC:ABF-0017674"
                     /db_xref="GeneID:9731535"
                     /translation="MEYTTLRTSMNALKKTKLGTMLSAGFALVIVIGLLVATFGRTQL
                     AGLGDDIDHLSTTTLTNMMLIQEAKTGFDTNSRLVRNIALSNDPERIAREKQLIDRQI
                     ARNTEVLKQLSERLDTPETRDQLNQLTLARPAYLKAFNNAVQLGISGQSEQREQAREL
                     ILNDMQTAQNGVFKALDNMLDFQKKITMNVVADSMQNARSDGTLMLALALVAAVLGAL
                     TAWLITRTVKGQLGGEPVYAAAVAQRISDGDLAFNVELRAGDDHSVLAAMNDMREKLG
                     QIVTQVRQSSESIATGASEIAAGSTDLSQRTEEQAASLQQTAASMEQMSQTIRQNGDT
                     VRTATKLAQSASSTAAKGGEAVNNIVRTMEDISVSSHKIGDIISVIDGIAFQTNILAL
                     NAAVEAARAGEQGRGFAVVAGEVRNLAQRSASAAKEIKELITASVEKVETGSTLVSEA
                     GSTIDELVKQARHVADLIGEIGVTTHEQESGISQINDAVNQLDQVTQQNASLVEESAS
                     AADSLSDQAARLVELMSIFNIQNSFNHQTTLLQTPGTGQKKPMPSKLVLANNASNSNW
                     EQF"
     misc_feature    complement(169495..170046)
                     /locus_tag="Dda3937_02028"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(168508..169248)
                     /locus_tag="Dda3937_02028"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(168568..169167)
                     /locus_tag="Dda3937_02028"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(168571..168576,168583..168585,
                     168592..168597,168604..168606,168613..168618,
                     168622..168627,168634..168639,168643..168648,
                     168655..168657,168664..168669,168676..168678,
                     168685..168690,168697..168702,168706..168711,
                     168718..168720,168727..168732,168739..168741,
                     168748..168753,168790..168795,168802..168807,
                     168811..168816,168823..168828,168835..168837,
                     168844..168849,168856..168858,168865..168867,
                     168877..168879,168898..168900,168907..168909,
                     168919..168921,168928..168933,168940..168942,
                     168949..168951,168958..168963,168970..168975,
                     168982..168984,168991..168996,169000..169002,
                     169012..169017,169021..169026,169033..169035,
                     169042..169047,169054..169059,169066..169068,
                     169075..169080,169087..169089,169096..169101,
                     169105..169110,169117..169119,169126..169131,
                     169138..169143))
                     /locus_tag="Dda3937_02028"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(168832..168933)
                     /locus_tag="Dda3937_02028"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            171109..172428
                     /gene="ugpB"
                     /locus_tag="Dda3937_02029"
                     /db_xref="GeneID:9731536"
     CDS             171109..172428
                     /gene="ugpB"
                     /locus_tag="Dda3937_02029"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="4.S.78 transport; substrate; glycerol-3-P"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="1.3.6 metabolism; energy metabolism, carbon;
                     aerobic respiration"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="1.6.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; phospholipid"
                     /codon_start=1
                     /transl_table=11
                     /product="substrate-binding protein of sn-glycerol
                     3-phosphate transport system"
                     /protein_id="YP_003880924.1"
                     /db_xref="GI:307128908"
                     /db_xref="ASAP:ABF-0017679"
                     /db_xref="ERIC:ABF-0017679"
                     /db_xref="GeneID:9731536"
                     /translation="MFQHAIRKTAAVVIMALAASAQAQAVTEIPFWHSMEGELGKTVN
                     SLADRFNQTHSDVKIVPVYKGNYEQSLAAGIAAFRSDNAPAILQVYEVGTATMMASKA
                     IKPVYQVFKDAGVPYDEKIFVPTVSGYYSDAKTGHLLSQPFNSSTPVLYYNKDAFKKA
                     GLDPEQPPKTWQQMAEYTAKLRASGMKCGYASGWQGWIQIENFSAWHGLPIATKNNGF
                     DGLDAVLEFNKPVQVKHIQMLEDMNKKGDFTYYGRKDEPTEKFYNGDCAMTTASSGSL
                     ANIRQYAKFNYGVAMMPYDADVKGAPQNAIIGGASLWVMNGKDAATYKGVAEFMQFLS
                     TPEIAAEWHQKTGYLPITTAAYELTKQQGFYDKNPGADIATRQMLNKEPLPFTKGLRL
                     GNMPQIRTIVDEELESVWTGKKTPQQALDAAVERGNALLRRFEQANK"
     misc_feature    171112..172425
                     /gene="ugpB"
                     /locus_tag="Dda3937_02029"
                     /note="glycerol-3-phosphate transporter periplasmic
                     binding protein; Provisional; Region: PRK10974"
                     /db_xref="CDD:182876"
     misc_feature    171187..172410
                     /gene="ugpB"
                     /locus_tag="Dda3937_02029"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     gene            172528..173415
                     /gene="ugpA"
                     /locus_tag="Dda3937_04431"
                     /gene_synonym="psiB; psiC"
                     /db_xref="GeneID:9731537"
     CDS             172528..173415
                     /gene="ugpA"
                     /locus_tag="Dda3937_04431"
                     /gene_synonym="psiB; psiC"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="7.3 location of gene products; inner membrane"
                     /function="6.1 cell structure; membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter"
                     /protein_id="YP_003880925.1"
                     /db_xref="GI:307128909"
                     /db_xref="ASAP:ABF-0046843"
                     /db_xref="ERIC:ABF-0046843"
                     /db_xref="GeneID:9731537"
                     /translation="MTASRPVFGRSLLPYLLVLPQLTITVIFFLWPAGQALWYSVQSV
                     DPFGLSSQFVGLDNFTNLFHDSYYLGSFYTTLLFSFLVAASGLIVSLFLAALVDYTLR
                     FSRLYQTLLILPYAVAPAVAAVLWMFLFNPGLGLITWLLHQWGYDWNHAQHSGQAMFL
                     VVLASVWKQISYNFLFFLAALQSIPRSLIEAAAIDGAGPVRRFFNLVLPLISPVSFFL
                     LVVNLTYAFFDTFPVIDAATGGGPVQATTTLIYKIYREGFAGLDLSSSAAQSVVLMLV
                     VTVLTVIQFRFVERKVNYQ"
     misc_feature    172753..173328
                     /gene="ugpA"
                     /locus_tag="Dda3937_04431"
                     /gene_synonym="psiB; psiC"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(172801..172806,172813..172818,172831..172833,
                     172861..172872,172903..172932,172939..172944,
                     172948..172950,173023..173028,173035..173037,
                     173041..173043,173050..173055,173059..173061,
                     173071..173076,173083..173085,173134..173136,
                     173176..173181,173188..173190,173209..173220,
                     173233..173238,173275..173280,173308..173313,
                     173320..173325)
                     /gene="ugpA"
                     /locus_tag="Dda3937_04431"
                     /gene_synonym="psiB; psiC"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(172906..172950,173209..173226)
                     /gene="ugpA"
                     /locus_tag="Dda3937_04431"
                     /gene_synonym="psiB; psiC"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(172948..172950,173008..173010,173233..173235,
                     173269..173271,173278..173280,173308..173310)
                     /gene="ugpA"
                     /locus_tag="Dda3937_04431"
                     /gene_synonym="psiB; psiC"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(173086..173124,173140..173145,173155..173157)
                     /gene="ugpA"
                     /locus_tag="Dda3937_04431"
                     /gene_synonym="psiB; psiC"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            173457..174305
                     /gene="ugpE"
                     /locus_tag="Dda3937_03043"
                     /db_xref="GeneID:9731538"
     CDS             173457..174305
                     /gene="ugpE"
                     /locus_tag="Dda3937_03043"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.78 transport; substrate; glycerol-3-P"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="1.3.6 metabolism; energy metabolism, carbon;
                     aerobic respiration"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="1.6.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; phospholipid"
                     /function="6.1 cell structure; membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter"
                     /protein_id="YP_003880926.1"
                     /db_xref="GI:307128910"
                     /db_xref="ASAP:ABF-0019159"
                     /db_xref="ERIC:ABF-0019159"
                     /db_xref="GeneID:9731538"
                     /translation="MIENRRGLDIFSHAMLVVAILAVLFPLYVAFIAATLSQEQMSQV
                     PMSLIPGGHLWENMTYIWRHGVGDNNSAPFGLMLFNSFVMALAITVGKISVSMLSAFA
                     IVYFRFPCRNLFFWMIFSTLMLPVEVRIFPTVEVISHLSMTNSYVGLTLPVMASATAT
                     FLFRQFFMTLPDELLEAARIDGAGPMRFFFDMVLPLSKTNLAALFVITFIYGWNQYLW
                     PLLIVNDPNLGTAVAGIQSMIATGDTATPWHQVMAAMLMTMLPPLLIVLLMQRWFVRG
                     LVDSEK"
     misc_feature    173469..174290
                     /gene="ugpE"
                     /locus_tag="Dda3937_03043"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    173688..174152
                     /gene="ugpE"
                     /locus_tag="Dda3937_03043"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(173736..173741,173748..173753,173766..173768,
                     173796..173807,173811..173840,173847..173852,
                     173856..173858,173913..173918,173922..173924,
                     173928..173930,173937..173942,173946..173948,
                     173958..173963,173970..173972,174021..174023,
                     174063..174068,174075..174077,174096..174107,
                     174114..174119)
                     /gene="ugpE"
                     /locus_tag="Dda3937_03043"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(173814..173858,174096..174113)
                     /gene="ugpE"
                     /locus_tag="Dda3937_03043"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(173856..173858,174114..174116,174150..174152)
                     /gene="ugpE"
                     /locus_tag="Dda3937_03043"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(173973..174011,174027..174032,174042..174044)
                     /gene="ugpE"
                     /locus_tag="Dda3937_03043"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            174312..175388
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /db_xref="GeneID:9731539"
     CDS             174312..175388
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="4.S.78 transport; substrate; glycerol-3-P"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="1.3.6 metabolism; energy metabolism, carbon;
                     aerobic respiration"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="1.6.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; phospholipid"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter ATP-binding
                     protein"
                     /protein_id="YP_003880927.1"
                     /db_xref="GI:307128911"
                     /db_xref="ASAP:ABF-0019160"
                     /db_xref="ERIC:ABF-0019160"
                     /db_xref="GeneID:9731539"
                     /translation="MACLKLQAVTKSYDGKTQVIQPIDLDVADGEFVVMVGPSGCGKS
                     TLLRMVAGLEQTTSGDIYIGDERVTDKEPKDRGIAMVFQNYALYPHMSVYDNMAYGLK
                     IRGFGKAQIRQRVEEAARILELQPLLHRKPRELSGGQRQRVAMGRAIVREPAVFLFDE
                     PLSNLDAKLRVQMRLELQQLHKRLKTTSLYVTHDQVEAMTLAHRVIVMNKGVAEQIGA
                     PAEIYRKPASLFVASFIGSPAMNLWAGQVSMDGSRVALSADFSLPLPVAKPEWQGRAV
                     TLGMRPEHILQSTADAGGVPLVVETLELLGADNLAHGKWAGQNIVVRLSHEHCPAVGE
                     TLWLTLPAASWHIFDSQSGLRMEA"
     misc_feature    174312..175382
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /note="glycerol-3-phosphate transporter ATP-binding
                     subunit; Provisional; Region: ugpC; PRK11650"
                     /db_xref="CDD:236947"
     misc_feature    174321..174962
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    174420..174443
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(174429..174434,174438..174446,174558..174560,
                     174786..174791,174888..174890)
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    174549..174560
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    174714..174743
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    174774..174791
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    174798..174809
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    174876..174896
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    175143..175355
                     /gene="ugpC"
                     /locus_tag="Dda3937_03044"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            175385..176134
                     /gene="ugpQ"
                     /locus_tag="Dda3937_03045"
                     /db_xref="GeneID:9731540"
     CDS             175385..176134
                     /gene="ugpQ"
                     /locus_tag="Dda3937_03045"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="YP_003880928.1"
                     /db_xref="GI:307128912"
                     /db_xref="ASAP:ABF-0019161"
                     /db_xref="ERIC:ABF-0019161"
                     /db_xref="GeneID:9731540"
                     /translation="MTPNWPYPAIVAHRGGGSLAPENTLAAIDVGAHHGHRMIEFDAK
                     LSQDGQIFLLHDDTLERTSNGWGVAGDLPWDKLVGLDVGSWYSRQFRGERLPLLSEVA
                     KRCAQYGMAANIEIKPTTGCEDQTGRVVALAARALWQNHPVAPLLSSFSVAALEAAQQ
                     AAPELPRGLLLDEWDDDWRALTERLGCVSIHLNHQLLDEARVRLLKDAGLRILVYTVN
                     QPDRARNLLLWGVDCICTDRIDLIGPQFNAS"
     misc_feature    175385..176128
                     /gene="ugpQ"
                     /locus_tag="Dda3937_03045"
                     /note="cytoplasmic glycerophosphodiester
                     phosphodiesterase; Provisional; Region: ugpQ; PRK09454"
                     /db_xref="CDD:236524"
     misc_feature    175412..176101
                     /gene="ugpQ"
                     /locus_tag="Dda3937_03045"
                     /note="Glycerophosphodiester phosphodiesterase domain in
                     Escherichia coli cytosolic glycerophosphodiester
                     phosphodiesterase UgpQ and similar proteins; Region:
                     GDPD_EcUgpQ_like; cd08562"
                     /db_xref="CDD:176505"
     misc_feature    order(175421..175423,175502..175504,175508..175510,
                     175547..175549,175727..175729,175826..175828,
                     176027..176029)
                     /gene="ugpQ"
                     /locus_tag="Dda3937_03045"
                     /note="putative active site [active]"
                     /db_xref="CDD:176505"
     misc_feature    order(175421..175423,175547..175549)
                     /gene="ugpQ"
                     /locus_tag="Dda3937_03045"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176505"
     misc_feature    order(175502..175504,175508..175510,175727..175729)
                     /gene="ugpQ"
                     /locus_tag="Dda3937_03045"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176505"
     gene            176340..177296
                     /locus_tag="Dda3937_03046"
                     /db_xref="GeneID:9731541"
     CDS             176340..177296
                     /locus_tag="Dda3937_03046"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="4.9.B transport; Transporters of Unknown
                     Classification;  uncharacterized transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_003880929.1"
                     /db_xref="GI:307128913"
                     /db_xref="ASAP:ABF-0019163"
                     /db_xref="ERIC:ABF-0019163"
                     /db_xref="GeneID:9731541"
                     /translation="MPTFILSLWHQIFLSLPLFVLIALGYALIRFGRWPSTVTDALTK
                     FVFSVALPAMLFRMMCDFSKRPAVDARLLIAFFGSCLIVFVLGRIVASRVFRLDGVSG
                     SVFSLSGIFSNNVMLGLPIATLMLGPQAIPSVALVLVFNGLILWTLVTVSVEWARNGS
                     LSMQGFTKTALGVLKNPLIIGILSGTFYSLTGLPLPDSIDKPIGMLSQIGVPLSLVAL
                     GMGLAEYRIRDGWQISVAICLIKLVVQPLVVWVLAVALGLPEMETRVVVLLGSMAVGV
                     NIYLMSRQFNVLGGPVAASLLMSTALAAVTTPLILTLMGVRV"
     misc_feature    176358..177284
                     /locus_tag="Dda3937_03046"
                     /note="Predicted permeases [General function prediction
                     only]; Region: COG0679"
                     /db_xref="CDD:223751"
     gene            complement(177370..177654)
                     /gene="yhhA"
                     /locus_tag="Dda3937_03047"
                     /db_xref="GeneID:9731542"
     CDS             complement(177370..177654)
                     /gene="yhhA"
                     /locus_tag="Dda3937_03047"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat containing protein"
                     /protein_id="YP_003880930.1"
                     /db_xref="GI:307128914"
                     /db_xref="ASAP:ABF-0019164"
                     /db_xref="ERIC:ABF-0019164"
                     /db_xref="GeneID:9731542"
                     /translation="MKIISPLMLLLSLPLLAQAATQQISPQQQQFENGISSQKRLLQD
                     MQQNQALQQQQLNSDIQQRSREQQRQLQQQLEQNRQRIQQSAPGNTNRTY"
     gene            177824..178288
                     /gene="yibK"
                     /locus_tag="Dda3937_03048"
                     /db_xref="GeneID:9731543"
     CDS             177824..178288
                     /gene="yibK"
                     /locus_tag="Dda3937_03048"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA methylase"
                     /protein_id="YP_003880931.1"
                     /db_xref="GI:307128915"
                     /db_xref="ASAP:ABF-0019165"
                     /db_xref="ERIC:ABF-0019165"
                     /db_xref="GeneID:9731543"
                     /translation="MFHIALYEPQIAPNTGNIIRLAANNGCSLHLIEPLGFDFEEKKL
                     RRAGLDYHDLASVSRHRNYQDFLQAVAGRRIFACTTKGSRPYDEPDYQPGDVLLFGSE
                     TAGLPDDIRNGFAPECRIRIPMEPNCRSLNLSNSVAIISYEAWRQNGFGGRR"
     misc_feature    177824..178279
                     /gene="yibK"
                     /locus_tag="Dda3937_03048"
                     /note="Predicted rRNA methylase (SpoU class) [Translation,
                     ribosomal structure and biogenesis]; Region: CspR;
                     COG0219"
                     /db_xref="CDD:223297"
     gene            178304..178933
                     /locus_tag="Dda3937_03049"
                     /db_xref="GeneID:9731544"
     CDS             178304..178933
                     /locus_tag="Dda3937_03049"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880932.1"
                     /db_xref="GI:307128916"
                     /db_xref="ASAP:ABF-0019166"
                     /db_xref="ERIC:ABF-0019166"
                     /db_xref="GeneID:9731544"
                     /translation="MINPSERPTGEHVMTRSIPASALRRTLIMGNSGSGKSWLAEQLA
                     ARLQAPAIDLDLINWEPGGYGKARERALVKAEARELAQAECWIMEGVYGWLMQEVVQQ
                     ATALIWLDIPVDECLNNIRQRGLRRGGDEAALAELLRWAGEYRERQSNSSFSGHQRVF
                     EQCAPEAPSQRMVVPQRMVVSQRMVVPQRIMLHSREDIERFMAGILSND"
     misc_feature    178379..178723
                     /locus_tag="Dda3937_03049"
                     /note="AAA domain; Region: AAA_33; pfam13671"
                     /db_xref="CDD:257977"
     misc_feature    178382..178687
                     /locus_tag="Dda3937_03049"
                     /note="AAA domain; Region: AAA_17; pfam13207"
                     /db_xref="CDD:257574"
     gene            complement(178969..179742)
                     /locus_tag="Dda3937_03050"
                     /db_xref="GeneID:9731545"
     CDS             complement(178969..179742)
                     /locus_tag="Dda3937_03050"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880933.1"
                     /db_xref="GI:307128917"
                     /db_xref="ASAP:ABF-0019167"
                     /db_xref="ERIC:ABF-0019167"
                     /db_xref="GeneID:9731545"
                     /translation="MGATAQILLVVRYTVVLTSLLCLSVTAHSATVNAARYHAFWLWA
                     AVQPQPVLSQADTLYLHQGEIARRGGKVEFLRQGIPVSALPVRHLWLSFRVSELRLGE
                     PELRRLLQLRQRWAAAGNRVDGIQIDFDAKSYHLSHYVAFLQMLRQRLPPDCRLSVTG
                     LLDWAKTGDVRQLNRLDGVVDELVVQTYQGRRTVENYAAYLPALMNLTLPFRLGLVQH
                     GKWDEQWQRRLAASPFYRGEVVFLLNPIPARRSPILQQR"
     misc_feature    complement(179008..179505)
                     /locus_tag="Dda3937_03050"
                     /note="Protein of unknown function (DUF3142); Region:
                     DUF3142; pfam11340"
                     /db_xref="CDD:256422"
     gene            complement(179712..181913)
                     /locus_tag="Dda3937_03051"
                     /db_xref="GeneID:9731546"
     CDS             complement(179712..181913)
                     /locus_tag="Dda3937_03051"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880934.1"
                     /db_xref="GI:307128918"
                     /db_xref="ASAP:ABF-0019168"
                     /db_xref="ERIC:ABF-0019168"
                     /db_xref="GeneID:9731546"
                     /translation="MKGLALLAGFIATLVQMPAYASGDGVCGFSDADCGMPALPYLLP
                     DNDTRTNLVLLQSSRNHIPLPIPQPEPDQTRSRVDPFTAYRVMGLAATEDNSASAKTD
                     TPADPSAPSDDKADEENTSLLQKATQLHFPDAELGKLRDLTPVDLDGRWVSNDLTTLE
                     SFFDLLLADKELNDAQRTQLALVRMRILSSEYGVSDANTDLAGVPDAGHAGELRRYLA
                     SAVAFYEGQLDQADKGFQQLLSASQPWVAETARYMLIRVSINQAMKDAQDEYNMFDPR
                     KMDKAAGKQAAQRVDEYLKQYPRGKYADSAEGLYRRAEWISGDTVALASHFSQVLASA
                     KSVDQLQAIGNEIDNKLLEDNQFVSSADTPILMLVQDIKRLRSPDGWMMLPALTQEEI
                     TRQQPLFEKAGMQEEFRYLQAAFQYYQQRDYAAVLKTLPMTTAEDITNVTAFSSQVLR
                     GLAMQRQKQWDDAEAHWRHLLMLKTTYTQQQFLQLMLAQTLVDSGQPGRVFTPESPVK
                     NLRFRSAILKVSADADLLHRQTGPQQTHEERAIALHTLLTKQLTHRDYAGFLKDSALL
                     KTIAPLKSTENMSWNEEDLTVFGWDGSDTEEGYECPTLQETVTTLNQNANDAHALNCL
                     GEFVLRTGNGVGFDWGESNMLNGLTDAASYYPGKEFNRLDNYMQVIADAKAPPEDKSY
                     ALYRAIYCYAPSGYNDCGSQDISKETRKAWFRQLKADFKGSQWARQLKYYW"
     misc_feature    complement(<180417..180596)
                     /locus_tag="Dda3937_03051"
                     /note="poly-beta-1,6 N-acetyl-D-glucosamine export porin
                     PgaA; Region: PGA_TPR_OMP; TIGR03939"
                     /db_xref="CDD:234406"
     gene            complement(182150..183523)
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /db_xref="GeneID:9731547"
     CDS             complement(182150..183523)
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="3.1.3.2 regulation; type of regulation;
                     posttranscriptional; covalent modification,
                     demodification, maturation"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /codon_start=1
                     /transl_table=11
                     /product="sensory histidine kinase in two-component
                     regulatory system with CpxR"
                     /protein_id="YP_003880935.1"
                     /db_xref="GI:307128919"
                     /db_xref="ASAP:ABF-0019169"
                     /db_xref="ERIC:ABF-0019169"
                     /db_xref="GeneID:9731547"
                     /translation="MINSLTARIFAIFWLTLALVLMLVLMLPKLDSRQLTPLLENEQR
                     QGLMLEQHIEAELASDPANDLLWWRRLFRVIEKWAPPGQRLLLVTSEGRVIGAQRNEM
                     QMVRNFIGQSDSADFPQKKKYGRLELLGPFSVRDGEDSYLMYMLRPASSPQSDFINLL
                     FDRPLLLLIVTMLTSSPLLLWLAWSLAKPARKLKNAADEVARGNLKQHPELESGPQEF
                     RATGSSFNQMVSALERMVTAQQRLLSDISHELRTPLTRLQLATALLRRRQGEGNELNR
                     IETETQRLDGMINDLLVLSRNQHKHELSREELQADELWNDVLDDARFEAEQMGKTLEV
                     LSPPGPWPLFGNPTALDSALENVVRNALRYSHSRIAVSFSVDAQGVTIVVGDDGPGVS
                     PEDREQIFRPFYRTDEARDRESGGTGLGLAIVETAISQHRGWAKADESPLGGLQLTLW
                     LPLYQRR"
     misc_feature    complement(182153..183523)
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /note="two-component sensor protein; Provisional; Region:
                     cpxA; PRK09470"
                     /db_xref="CDD:236532"
     misc_feature    complement(182822..182962)
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(182828..182833,182840..182845,
                     182849..182854,182861..182866,182870..182875,
                     182924..182926,182930..182935,182942..182947,
                     182951..182956))
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(182636..182812)
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(182651..182653,182663..182665,
                     182672..182674,182684..182686,182693..182695,
                     182744..182746,182753..182755,182765..182767,
                     182774..182776,182786..182788,182798..182800))
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(182780..182782)
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(182171..182476)
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(182183..182185,182189..182194,
                     182207..182209,182213..182215,182261..182272,
                     182351..182356,182360..182362,182366..182368,
                     182372..182374,182435..182437,182444..182446,
                     182456..182458))
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(182444..182446)
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(182264..182266,182270..182272,
                     182354..182356,182360..182362))
                     /gene="cpxA"
                     /locus_tag="Dda3937_03052"
                     /gene_synonym="ecfB; eup; ssd"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(183540..184238)
                     /gene="cpxR"
                     /locus_tag="Dda3937_03053"
                     /db_xref="GeneID:9731548"
     CDS             complement(183540..184238)
                     /gene="cpxR"
                     /locus_tag="Dda3937_03053"
                     /function="CpxR controls the expression of genes involved
                     in protein folding and degradation"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="CpxR is phosphorylated by the sensor histidine
                     kinase CpxA in response to envelope stress"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulatory protein cpxR"
                     /protein_id="YP_003880936.1"
                     /db_xref="GI:307128920"
                     /db_xref="ASAP:ABF-0019170"
                     /db_xref="ERIC:ABF-0019170"
                     /db_xref="GeneID:9731548"
                     /translation="MNKILLVDDDRELTSLLRELLEMEGFNVVVAHDGEQALSVLDDS
                     VDLLLLDIMMPKKNGIDTLKEVRQRYQTPVIMLTARGSELDRVLGLELGADDYLPKPF
                     NDRELVARIRAILRRSNWTDQQQAGEASAPTIEVDALRLNPGRQEASFDDEVLDLTGT
                     EFTLLYLLAQRLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERKDGLPWF
                     KTLRGRGYLMVSTA"
     misc_feature    complement(183543..184238)
                     /gene="cpxR"
                     /locus_tag="Dda3937_03053"
                     /note="DNA-binding transcriptional regulator CpxR;
                     Provisional; Region: PRK10955"
                     /db_xref="CDD:182864"
     misc_feature    complement(183894..184226)
                     /gene="cpxR"
                     /locus_tag="Dda3937_03053"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(183936..183941,183948..183950,
                     184005..184007,184062..184064,184212..184217))
                     /gene="cpxR"
                     /locus_tag="Dda3937_03053"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(184062..184070,184074..184079))
                     /gene="cpxR"
                     /locus_tag="Dda3937_03053"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(183933..183941)
                     /gene="cpxR"
                     /locus_tag="Dda3937_03053"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(183555..183839)
                     /gene="cpxR"
                     /locus_tag="Dda3937_03053"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(183564..183566,183579..183581,
                     183615..183620,183642..183644,183651..183653,
                     183705..183710,183765..183767))
                     /gene="cpxR"
                     /locus_tag="Dda3937_03053"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            184449..185009
                     /gene="cpxP"
                     /locus_tag="Dda3937_03054"
                     /db_xref="GeneID:9731549"
     CDS             184449..185009
                     /gene="cpxP"
                     /locus_tag="Dda3937_03054"
                     /function="CpxP periplasmic protein is a possible
                     chaperone which is involved in feedback inhibition of Cpx
                     signal transduction pathway"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880937.1"
                     /db_xref="GI:307128921"
                     /db_xref="ASAP:ABF-0019171"
                     /db_xref="ERIC:ABF-0019171"
                     /db_xref="GeneID:9731549"
                     /translation="MRGTIITLSFASLLMLVTGTVVATENSLPGENNLSSENKAPELG
                     NCYRDDSAMKREESQQGMFDGVKLTEHQRQQMRDLMRQVRHEQPVYDTNDVEIMHRLV
                     TAEKFDAPAVQAQVARMVQAQIARQVEIARVSNQMYNMLTPEQKSILDQKHEQAMQSV
                     RQQMSTSGSRSQNLELSRQGLDDSTE"
     misc_feature    184641..184919
                     /gene="cpxP"
                     /locus_tag="Dda3937_03054"
                     /note="CpxP component of the bacterial Cpx-two-component
                     system and related proteins; Region: CpxP_like; cd09916"
                     /db_xref="CDD:197366"
     misc_feature    order(184731..184733,184743..184745,184752..184757,
                     184767..184769,184773..184775,184785..184787,
                     184794..184796,184806..184808,184818..184820,
                     184830..184832,184839..184844,184851..184853,
                     184860..184862,184893..184898,184905..184907)
                     /gene="cpxP"
                     /locus_tag="Dda3937_03054"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:197366"
     gene            complement(185220..185459)
                     /locus_tag="Dda3937_03055"
                     /db_xref="GeneID:9731550"
     CDS             complement(185220..185459)
                     /locus_tag="Dda3937_03055"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880938.1"
                     /db_xref="GI:307128922"
                     /db_xref="ASAP:ABF-0019172"
                     /db_xref="ERIC:ABF-0019172"
                     /db_xref="GeneID:9731550"
                     /translation="MQGNFQDQTYTIRYISLPSEDWGKKTAFHQLTFINGDKEKYFIQ
                     NAIVETGEAIAQQNGTFSLEENKISNPITQKWHKN"
     gene            185989..187344
                     /locus_tag="Dda3937_03056"
                     /db_xref="GeneID:9731551"
     CDS             185989..187344
                     /locus_tag="Dda3937_03056"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="Tail fiber protein"
                     /protein_id="YP_003880939.1"
                     /db_xref="GI:307128923"
                     /db_xref="ASAP:ABF-0019175"
                     /db_xref="ERIC:ABF-0019175"
                     /db_xref="GeneID:9731551"
                     /translation="MYRQAWQYLFHTLAWVPLSLILMRHVMSTKYIALLTQVGAARLA
                     NAIALGKQLEITQMGVGDGGGMLPTPDTTQTKLINEKRRAPLNSLNIDPASANQIIAE
                     QVIPDHEGGFWLREIGLYDADDNLVAVANCPETYKPQMQEGSGRVQTVRMILAVGQTD
                     AVSLKIDPAVVLASRQYVDNMALAKAKNGEDIADKAQFIENLGVRSSFSGVIGMTRNA
                     TMNIPSASSSATFTADEIIVGTALGGNQYRIGLFKKTIDLTKNGVGGMDTGTVPDEGF
                     VGIYAIYNPATMASGLLTVNATSVKLPEIYNGTNMPDGYTASALLTVVPVKAGKFTVL
                     SVFGRQVHIPGVRVYSGLPNTSGVDIPVSKFIPLNTRTISGVLRQSSTGDGLLSITVS
                     SNLSPVSGQQMTNYVFANMEVSNNYADILIVDEGHIVAAASNATSGNATVIVVISKYA
                     I"
     misc_feature    186067..>187317
                     /locus_tag="Dda3937_03056"
                     /note="Phage-related tail fibre protein [General function
                     prediction only]; Region: COG5301"
                     /db_xref="CDD:227618"
     misc_feature    186067..186525
                     /locus_tag="Dda3937_03056"
                     /note="Phage tail-collar fibre protein; Region: DUF3751;
                     pfam12571"
                     /db_xref="CDD:257135"
     gene            187676..188968
                     /locus_tag="Dda3937_03057"
                     /db_xref="GeneID:9731552"
     CDS             187676..188968
                     /locus_tag="Dda3937_03057"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /codon_start=1
                     /transl_table=11
                     /product="Tail fiber protein"
                     /protein_id="YP_003880940.1"
                     /db_xref="GI:307128924"
                     /db_xref="ASAP:ABF-0019178"
                     /db_xref="ERIC:ABF-0019178"
                     /db_xref="GeneID:9731552"
                     /translation="MGIKYVTLLTRVGEVKLAASISTGKPLQIAQMGVGDGGGTLPTP
                     DATQTKLVNEKRRGAINSLTIDPNNTNQIIAEQVIPENEGGFWLREIGLYDVDGDLIA
                     VGNCPETYKPELKEGSGRVQTVRMILIVSHTDAVMMTFDPTVALASRQYVDDKTLSSL
                     AYTDTNVIEVKSYTDNLLAEHIAAADPHKQYAPIDSPVFVGNPTAPTPPFFDADTSIA
                     TTAFVQRALGNMKSAFGVRENKVLTSDAFGCFIESQIAGITITLPDASLCPGGVIEFN
                     NISNGTVTVSGAGVDILGPNNPSGSKTLKIQSGVNVKFLSTGPQWRAIGGVGIAGAGL
                     NGYQVLPSGIIIQWGVGKTLAAGVINQTFPIVYPNNFFSVVITENNSVGWNYTGVTVY
                     GQSNSTKEMLKGYGAFVRNGGSVEFSSDISYQFIAIGN"
     misc_feature    187688..188134
                     /locus_tag="Dda3937_03057"
                     /note="Phage tail-collar fibre protein; Region: DUF3751;
                     pfam12571"
                     /db_xref="CDD:257135"
     gene            188977..189354
                     /locus_tag="Dda3937_03058"
                     /db_xref="GeneID:9731553"
     CDS             188977..189354
                     /locus_tag="Dda3937_03058"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /codon_start=1
                     /transl_table=11
                     /product="tail fiber assembly protein"
                     /protein_id="YP_003880941.1"
                     /db_xref="GI:307128925"
                     /db_xref="ASAP:ABF-0019179"
                     /db_xref="ERIC:ABF-0019179"
                     /db_xref="GeneID:9731553"
                     /translation="MFYSKSNSGFYSKDVNGANIPDDAVEISDDYYQHLLNEQALGNT
                     IIFDELAKKPIAVTPAPVSETQLAEAARRQRDNLLIASDWTQVPDAPVDQQAWRSYRA
                     ILRQVPEQTGFPHNVEWPVSPGK"
     gene            189330..190790
                     /locus_tag="Dda3937_04432"
                     /db_xref="GeneID:9731554"
     CDS             189330..190790
                     /locus_tag="Dda3937_04432"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="Tail fiber protein"
                     /protein_id="YP_003880942.1"
                     /db_xref="GI:307128926"
                     /db_xref="ASAP:ABF-0046845"
                     /db_xref="ERIC:ABF-0046845"
                     /db_xref="GeneID:9731554"
                     /translation="MAGVAWKINKSALYSRSPLCFIFSRLYGGFIFNYMLCHGRHNAS
                     HTTRCYPLWIMLSETAIEWNALQILAAIFSGNYCNVSDTFRRHKGILVMAVKYMALLT
                     HVGATKLANAAALRKVLDITHIGVGDGGGNPTTPDPAQTTLVNEKRRAPLNYLSVDPA
                     NPNQIIAEQVIPENEGGFWLREIGLYDADGDLIAVANCPETYKPELKEGSGRVQTVRM
                     ILIVSHTDAVALKFDPAVALASRQYVDDKTLSSLAYTDTNVIEVKSYADKLLAEHIAA
                     TNPHKQYAPIVSPALTGIPTAPTAVAGTNTTQLATTAFVAGAIDLLSGKTDNNVKLKL
                     DINDIVGIPLPWPQATAPAGWLKCNGQAFDKNRYPRLAQVYPSGVLPDLRGEFIRGWD
                     DGRGVDTGRAILSAQTGSLIVGDIANNINMATLNNVGEAATKANVGWDTAELTSAKYP
                     SIRVNVVSGQTATDPYPYCGVARPRNLAFNYIVRAA"
     misc_feature    189606..190064
                     /locus_tag="Dda3937_04432"
                     /note="Phage tail-collar fibre protein; Region: DUF3751;
                     pfam12571"
                     /db_xref="CDD:257135"
     misc_feature    190350..190481
                     /locus_tag="Dda3937_04432"
                     /note="Phage Tail Collar Domain; Region: Collar;
                     pfam07484"
                     /db_xref="CDD:254225"
     gene            190787..191410
                     /locus_tag="Dda3937_04433"
                     /db_xref="GeneID:9731555"
     CDS             190787..191410
                     /locus_tag="Dda3937_04433"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="Tail fiber assembly protein"
                     /protein_id="YP_003880943.1"
                     /db_xref="GI:307128927"
                     /db_xref="ASAP:ABF-0046846"
                     /db_xref="ERIC:ABF-0046846"
                     /db_xref="GeneID:9731555"
                     /translation="MMTVPTQEACAMLTAEGLASRAGWLRVYHADTVTREYDGYSEEY
                     LMLGTGIPAHSYADGPSQSVAEGRTLRRSSDGLRWELIPDLRGRTVYDTQTRQPQVVS
                     ELGPLSTSLTLLPPANEFDCWNGVQWVTDIVAHQASLAQSARQERDTRRQVAHDRIRE
                     LTYAQELEMATEQEIRALKDWKIYLVQLSHIDPTHAPDIDWPIIPTN"
     misc_feature    191042..191401
                     /locus_tag="Dda3937_04433"
                     /note="Caudovirales tail fibre assembly protein; Region:
                     Caudo_TAP; pfam02413"
                     /db_xref="CDD:251279"
     gene            191655..193073
                     /locus_tag="Dda3937_04434"
                     /db_xref="GeneID:9731556"
     CDS             191655..193073
                     /locus_tag="Dda3937_04434"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="Tail fiber protein"
                     /protein_id="YP_003880944.1"
                     /db_xref="GI:307128928"
                     /db_xref="ASAP:ABF-0046847"
                     /db_xref="ERIC:ABF-0046847"
                     /db_xref="GeneID:9731556"
                     /translation="MILPCSCLTFFFKIMLMRESMGTKYFTLLTQMGEKKLAAAIAAG
                     KPLELVQMGVGDGNGVLPAPDSVQTRLVNERRRGAINSLTVDPDNASQMIAEQVIPEN
                     EGGFWLREIGLYDVDGDLIAVGNCPETYKPELKEGSGRVQTVRMILIVSRTDAVTLKF
                     DPTVALATRRYADTLLADHVAAMNPHKQYAPIESPVFTGNPAAPTPTAGDNSKKLATT
                     EFVAVGLSGKMDRNQNGADIQDPVQFVKNLGLESRFAGRILRIKKITSSQNYQWPDDV
                     SAIDVTICGAGGGGGAAAASAQNYHSAGSGGGAGGWARSFYRKGDIPALIYLEVGAGG
                     IGGVDATYEPGLGGVTKFGTLMTANGGSRGANGIAIAIGMSVLIGNGGGGNASGGNLV
                     AGFGGSGTPAMFFNSGYESGAGGDSVFSFGVPPIASNAPIGGFDGVDGAGGSGGYTVP
                     AGASAKGGNGGNGVIMIVEYSA"
     misc_feature    191727..192173
                     /locus_tag="Dda3937_04434"
                     /note="Phage tail-collar fibre protein; Region: DUF3751;
                     pfam12571"
                     /db_xref="CDD:257135"
     gene            193070..193465
                     /locus_tag="Dda3937_03863"
                     /db_xref="GeneID:9731557"
     CDS             193070..193465
                     /locus_tag="Dda3937_03863"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="tail fiber assembly protein"
                     /protein_id="YP_003880945.1"
                     /db_xref="GI:307128929"
                     /db_xref="ASAP:ABF-0020377"
                     /db_xref="ERIC:ABF-0020377"
                     /db_xref="GeneID:9731557"
                     /translation="MSKIYAVIENGVVINTVVWDSDVEADWKPQNGALIDISSERVGV
                     GYLYSDGVFTPPEKRRDEYIADATLRKTQLLSEAQKAIANWQTDLLLGIISDDDKNRL
                     ARWREYMKQIDAIDVQTAPAINWPIPPAP"
     misc_feature    <193202..193459
                     /locus_tag="Dda3937_03863"
                     /note="Caudovirales tail fibre assembly protein; Region:
                     Caudo_TAP; pfam02413"
                     /db_xref="CDD:251279"
     gene            complement(193462..193971)
                     /locus_tag="Dda3937_03864"
                     /db_xref="GeneID:9731558"
     CDS             complement(193462..193971)
                     /locus_tag="Dda3937_03864"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="MutT/nudix-family hydrolase"
                     /protein_id="YP_003880946.1"
                     /db_xref="GI:307128930"
                     /db_xref="ASAP:ABF-0020379"
                     /db_xref="ERIC:ABF-0020379"
                     /db_xref="GeneID:9731558"
                     /translation="MARKILTTRYTPGNLMKRRPASRLLILDPEQRVLLFLFHHTRDA
                     LAGERYWATPGGAVESGETFEQAAVRELWEETGIRRQDPGPSLAAQTFNMAMPNGDTV
                     IADERFFVIRVADSAIHTDAWTAHEREVMRDHHWWSRDELLATQDQVYPEQLVEMLWP
                     ATGKASTSS"
     misc_feature    complement(193507..193914)
                     /locus_tag="Dda3937_03864"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cl00447"
                     /db_xref="CDD:260427"
     misc_feature    complement(order(193744..193770,193798..193806))
                     /locus_tag="Dda3937_03864"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            194129..194599
                     /locus_tag="Dda3937_03865"
                     /db_xref="GeneID:9731559"
     CDS             194129..194599
                     /locus_tag="Dda3937_03865"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880947.1"
                     /db_xref="GI:307128931"
                     /db_xref="ASAP:ABF-0020380"
                     /db_xref="ERIC:ABF-0020380"
                     /db_xref="GeneID:9731559"
                     /translation="MNTIKSQRLARAWSQEQLAELSALSVRTIQRIENGERASLETLS
                     AIAAAFGVNVTALMEEGSEQAVSGESLAQRIEQARTQVGQESRFWRGLMLFVPVNALL
                     VAINLLVNPQTHWFLWPLLIWGGVLAIRAARVFWLRDRWSRWEQERLQKILRKP"
     misc_feature    194129..>194371
                     /locus_tag="Dda3937_03865"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    194129..194299
                     /locus_tag="Dda3937_03865"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(194141..194143,194153..194155,194228..194230)
                     /locus_tag="Dda3937_03865"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(194150..194152,194225..194227)
                     /locus_tag="Dda3937_03865"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(194171..194176,194207..194209,194216..194218,
                     194228..194233)
                     /locus_tag="Dda3937_03865"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    194348..194593
                     /locus_tag="Dda3937_03865"
                     /note="2TM domain; Region: 2TM; pfam13239"
                     /db_xref="CDD:257596"
     gene            194729..195631
                     /gene="fieF"
                     /locus_tag="Dda3937_03866"
                     /gene_synonym="cepA; yiiP"
                     /db_xref="GeneID:9731560"
     CDS             194729..195631
                     /gene="fieF"
                     /locus_tag="Dda3937_03866"
                     /gene_synonym="cepA; yiiP"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="4.2.A.4 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Cation Diffusion Facilitator (CDF) Family"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc transporter"
                     /protein_id="YP_003880948.1"
                     /db_xref="GI:307128932"
                     /db_xref="ASAP:ABF-0020381"
                     /db_xref="ERIC:ABF-0020381"
                     /db_xref="GeneID:9731560"
                     /translation="MNSHYARLVMTAAFLATATALSLFGMKVYAWWYTGSVSLLASLV
                     DSLVDIAASLVNLLVVRYSLQPADTEHTFGHGKAESLAALAQSMFISGSALFLLLTGA
                     QHLITPQPLQGPELGMWITIIALVATGLLVSFQRWVIRKTHSQAVRADMLHYQSDVLM
                     NGAILLSLALSWKGINWADAVFALGIGVYILGSALRMAYEAIQALLDRALPDEERQEI
                     INIVSSWPGVSGAHQLRTRRSGPTRFIQLHLEMADNLPLVESHQIADELEQALLKRFP
                     GSDVIIHQDPVSVVPQEQRGRWVL"
     misc_feature    194729..195622
                     /gene="fieF"
                     /locus_tag="Dda3937_03866"
                     /gene_synonym="cepA; yiiP"
                     /note="ferrous iron efflux protein F; Reviewed; Region:
                     fieF; PRK09509"
                     /db_xref="CDD:181919"
     gene            195878..196840
                     /gene="pfkA"
                     /locus_tag="Dda3937_03867"
                     /db_xref="GeneID:9731561"
     CDS             195878..196840
                     /gene="pfkA"
                     /locus_tag="Dda3937_03867"
                     /function="1.3.1 metabolism; energy metabolism, carbon;
                     glycolysis"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="YP_003880949.1"
                     /db_xref="GI:307128933"
                     /db_xref="ASAP:ABF-0020382"
                     /db_xref="ERIC:ABF-0020382"
                     /db_xref="GeneID:9731561"
                     /translation="MIKKIGVLTSGGDAPGMNAAIRGVVRAGLAENLDVYGIYDGYLG
                     LYEDRMVQLDRYSVSDVINRGGTFLGSARFPAFREEAVRQVCVENMKKRGLDALVVIG
                     GDGSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSS
                     HQRISIVEVMGRHCGDLTLAAAIAGGCEFIVLPEVDFKPEDLVEEIKAGIAKGKKHAI
                     VAITELVCDVDELARYIEQETERETRATVLGHIQRGGSPVAYDRILASRMGAYSIELL
                     QQGYGGRCVGIQNEKLVHHDIIDAIENMKRPFKGDWLNTAKKLF"
     misc_feature    195884..196834
                     /gene="pfkA"
                     /locus_tag="Dda3937_03867"
                     /note="Phosphofructokinase, a key regulatory enzyme in
                     glycolysis, catalyzes the phosphorylation of
                     fructose-6-phosphate to fructose-1,6-biphosphate. The
                     members belong to a subfamily of the PFKA family (cd00363)
                     and include bacterial ATP-dependent...; Region:
                     Bacterial_PFK; cd00763"
                     /db_xref="CDD:238388"
     misc_feature    order(195911..195913,196001..196003,196094..196096,
                     196187..196195,196199..196204,196253..196255,
                     196259..196261,196265..196267,196385..196393,
                     196544..196546,196625..196627,196634..196636)
                     /gene="pfkA"
                     /locus_tag="Dda3937_03867"
                     /note="active site"
                     /db_xref="CDD:238388"
     misc_feature    order(195911..195913,196001..196003,196094..196096,
                     196187..196195,196199..196204)
                     /gene="pfkA"
                     /locus_tag="Dda3937_03867"
                     /note="ADP/pyrophosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238388"
     misc_feature    order(195941..195943,195953..195955,196040..196042,
                     196055..196057,196064..196066,196283..196285,
                     196319..196321,196331..196333,196340..196342,
                     196424..196429,196433..196435,196517..196519,
                     196661..196666,196676..196678,196697..196699,
                     196742..196744,196829..196834)
                     /gene="pfkA"
                     /locus_tag="Dda3937_03867"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238388"
     misc_feature    order(195941..195943,195953..195955,196040..196045,
                     196052..196057,196340..196342,196433..196435,
                     196439..196441,196511..196513,196517..196525)
                     /gene="pfkA"
                     /locus_tag="Dda3937_03867"
                     /note="allosteric effector site; other site"
                     /db_xref="CDD:238388"
     misc_feature    order(196253..196255,196259..196261,196265..196267,
                     196364..196366,196385..196393,196544..196546,
                     196607..196609,196625..196627,196634..196636)
                     /gene="pfkA"
                     /locus_tag="Dda3937_03867"
                     /note="fructose-1,6-bisphosphate binding site; other site"
                     /db_xref="CDD:238388"
     gene            197176..198060
                     /locus_tag="Dda3937_03868"
                     /db_xref="GeneID:9731562"
     CDS             197176..198060
                     /locus_tag="Dda3937_03868"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="N-carbamoylputrescine amidase"
                     /protein_id="YP_003880950.1"
                     /db_xref="GI:307128934"
                     /db_xref="ASAP:ABF-0020386"
                     /db_xref="ERIC:ABF-0020386"
                     /db_xref="GeneID:9731562"
                     /translation="MTKVTVAATQMACTWDLPKNIENAERLVRQAHAQGAQIILIQEL
                     FAAPYFCIDQSPEHYALAQELATSPLIKHFSALAAELEVVLPLSLFERANNAYYNSLV
                     MIDADGSVLDVYRKTHIPNGPAYQEKQFFIPGDTGFKVWQTRYAKVGVGICWDQWFPE
                     TARCLALNGAELIFYPTAIGSEPAYPDIDSQPHWTRVQQGHAAANLVPVIASNRIGTE
                     ASKYIDGLEMTFYGSSFIADQTGALVAQANKTDEAVLVHEFDLDAIAAQRASWGLFRD
                     RRPDMYGVIGTSDGKTWR"
     misc_feature    197185..198036
                     /locus_tag="Dda3937_03868"
                     /note="N-carbamoylputrescine amidohydrolase (CPA) (class
                     11 nitrilases); Region: CPA; cd07573"
                     /db_xref="CDD:143597"
     misc_feature    order(197302..197304,197521..197523,197533..197535,
                     197554..197556,197632..197637,197641..197646,
                     197707..197709)
                     /locus_tag="Dda3937_03868"
                     /note="putative active site; other site"
                     /db_xref="CDD:143597"
     misc_feature    order(197302..197304,197521..197523,197632..197634)
                     /locus_tag="Dda3937_03868"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143597"
     misc_feature    order(197524..197535,197551..197553,197572..197580,
                     197635..197637,197641..197655,197662..197667,
                     197761..197766,197770..197778,197782..197787,
                     197869..197874,197998..198012)
                     /locus_tag="Dda3937_03868"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143597"
     gene            198061..199164
                     /locus_tag="Dda3937_03869"
                     /db_xref="GeneID:9731563"
     CDS             198061..199164
                     /locus_tag="Dda3937_03869"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="Agmatine deiminase"
                     /protein_id="YP_003880951.1"
                     /db_xref="GI:307128935"
                     /db_xref="ASAP:ABF-0020388"
                     /db_xref="ERIC:ABF-0020388"
                     /db_xref="GeneID:9731563"
                     /translation="MMSELTTPLQDGFSMPAEWAPHDAVWMLWPYRRDNWRSQGDAIP
                     AQRTFAAVAAAIAQTTPVIMGVPRDQMALAKSVMPAGVTLVEMESDDAWMRDTGPTVV
                     LNDAGERRGVDWQFNAWGGALGGLYEDWRRDEKVAAQVLAYHGDARYAAPLILEGGSI
                     HTDGEGTLLTTAECLLNPNRNPHLNKAQIEQLLRDYLGVSAFIWLEEGVYNDETDGHI
                     DNMCCFVRPGEVALHWTDDETDPQYARSQAAYQVLSQAKDAQGRSLKIWKLPAPGPLY
                     ATPEEAAGVTDGNAIERNAGSRLAGSYVNFLISNQQIIYPLLDERTDAEAHALLQQMF
                     PGYLVSGVPAREILLGGGNIHCITQQIPAAKTV"
     misc_feature    198076..199155
                     /locus_tag="Dda3937_03869"
                     /note="agmatine deiminase; Provisional; Region: PRK13551"
                     /db_xref="CDD:184135"
     gene            complement(199259..200698)
                     /gene="phoA"
                     /locus_tag="Dda3937_03870"
                     /db_xref="GeneID:9731564"
     CDS             complement(199259..200698)
                     /gene="phoA"
                     /locus_tag="Dda3937_03870"
                     /function="1.8.1 metabolism; metabolism of other
                     compounds; phosphorous metabolism"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="YP_003880952.1"
                     /db_xref="GI:307128936"
                     /db_xref="ASAP:ABF-0020389"
                     /db_xref="ERIC:ABF-0020389"
                     /db_xref="GeneID:9731564"
                     /translation="MTMTRKALIRKTLICKPLLSSLMMTLIAGSALAASADYHRQAQG
                     DITQPGGARRLSADQTEMLKASLNAKTAKNVILLIGDGMGDSEITAARNYALGAGGFF
                     KGIDALPLTGQYTHYSLDKKTRKPDYVTDSAASATAWSSGVKTYNGALGVDVDGKDHK
                     TLIEIAKAAGKATGNVSTAELEDATPAAMVSHVTSRKCYGPEKTSQQCPTNALENGGR
                     GSIAEQLLVTRADVTLGGGAATFKEIAKAGKYQGKSLKEQADALGYHLVTDLDGMNAI
                     TAASQSKPVLGLFADGNMPVRWQGPKASYHGNLDKPVVTCEPNAQRGAGVPTLAQMTD
                     KAIQLLSKNKNGFFLQVEGASIDKQDHAANPCGQFGETVDLDEAVQKALEFARRDGNT
                     LVIVTADHAHSSQIVENGSKAPGLTQALNTKDDAVMTISYGNSEEESQGHTGTQLRIA
                     AYGPHAANVVGLTDQTDLFYTMKNAMGLK"
     misc_feature    complement(199262..200599)
                     /gene="phoA"
                     /locus_tag="Dda3937_03870"
                     /note="Alkaline phosphatase [Inorganic ion transport and
                     metabolism]; Region: PhoA; COG1785"
                     /db_xref="CDD:224699"
     misc_feature    complement(199265..200500)
                     /gene="phoA"
                     /locus_tag="Dda3937_03870"
                     /note="Alkaline phosphatase homologues; alkaline
                     phosphatases are non-specific phosphomonoesterases that
                     catalyze the hydrolysis reaction via a phosphoseryl
                     intermediate to produce inorganic phosphate and the
                     corresponding alcohol, optimally at high pH; Region:
                     alkPPc; cd00016"
                     /db_xref="CDD:237983"
     misc_feature    complement(order(199289..199291,199298..199303,
                     199307..199318,199355..199357,199361..199372,
                     199376..199378,199397..199402,199415..199420,
                     199478..199486,199490..199492,200222..200224,
                     200237..200239,200267..200275,200312..200314,
                     200342..200344,200348..200350,200354..200356,
                     200360..200368,200372..200374,200381..200383,
                     200420..200425,200432..200434,200441..200446,
                     200492..200500))
                     /gene="phoA"
                     /locus_tag="Dda3937_03870"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:237983"
     misc_feature    complement(order(199373..199375,199499..199504,
                     199616..199618,199625..199630,199643..199645,
                     200111..200113,200144..200146,200150..200152,
                     200303..200308,200456..200458))
                     /gene="phoA"
                     /locus_tag="Dda3937_03870"
                     /note="active site"
                     /db_xref="CDD:237983"
     gene            complement(200851..201621)
                     /gene="tpiA"
                     /locus_tag="Dda3937_03871"
                     /db_xref="GeneID:9731565"
     CDS             complement(200851..201621)
                     /gene="tpiA"
                     /locus_tag="Dda3937_03871"
                     /function="1.3.1 metabolism; energy metabolism, carbon;
                     glycolysis"
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="YP_003880953.1"
                     /db_xref="GI:307128937"
                     /db_xref="ASAP:ABF-0020391"
                     /db_xref="ERIC:ABF-0020391"
                     /db_xref="GeneID:9731565"
                     /translation="MRHPLVMGNWKLNGSTSMVHELIAGLRNELSAVTGCGVAIAPPA
                     IYLDQAKHLLAGSRIALGAQNVDVNLAGAFTGETSAAMLKDIGAQYIIIGHSERRTYH
                     HESDEFIAKKFAVLKETGLIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAKAFE
                     NTVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANA
                     AELFTQPDIDGALVGGASLKADAFAVIVKAAAEAKSQA"
     misc_feature    complement(200881..201612)
                     /gene="tpiA"
                     /locus_tag="Dda3937_03871"
                     /note="Triosephosphate isomerase (TIM) is a glycolytic
                     enzyme that catalyzes the interconversion of
                     dihydroxyacetone phosphate and
                     D-glyceraldehyde-3-phosphate. The reaction is very
                     efficient and requires neither cofactors nor metal ions.
                     TIM, usually...; Region: TIM; cd00311"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(200920..200925,200929..200931,
                     200986..200988,201103..201105,201121..201123,
                     201337..201339,201589..201591,201595..201597))
                     /gene="tpiA"
                     /locus_tag="Dda3937_03871"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(201328..201333,201364..201369,
                     201376..201378,201430..201432,201469..201471,
                     201478..201480,201484..201492,201586..201588,
                     201595..201597))
                     /gene="tpiA"
                     /locus_tag="Dda3937_03871"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(201121..201123,201337..201339,
                     201589..201591))
                     /gene="tpiA"
                     /locus_tag="Dda3937_03871"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238190"
     gene            complement(201763..202341)
                     /gene="yiiQ"
                     /locus_tag="Dda3937_03872"
                     /db_xref="GeneID:9731566"
     CDS             complement(201763..202341)
                     /gene="yiiQ"
                     /locus_tag="Dda3937_03872"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880954.1"
                     /db_xref="GI:307128938"
                     /db_xref="ASAP:ABF-0020393"
                     /db_xref="ERIC:ABF-0020393"
                     /db_xref="GeneID:9731566"
                     /translation="MIVCCLSAGLLCTPFARSDGLFQQKPPTAAPYLLSGSPTFDMNI
                     IQFRTRYNLSNPSLPINEYRVIDTGDDSPNLTRAASRINDHLYSSTALEKGTGKIKTM
                     QITWLPKPKDTDQSGRRKQAIGYMAALVRTFMPSLTNEQSLKKIEMLLEKGKGQRFYQ
                     QTEGALRYVVADHGEKGLTFAVEPIKLALSDS"
     misc_feature    complement(201766..202266)
                     /gene="yiiQ"
                     /locus_tag="Dda3937_03872"
                     /note="Protein of unknown function (DUF1454); Region:
                     DUF1454; pfam07305"
                     /db_xref="CDD:148740"
     gene            202504..202929
                     /gene="yiiR"
                     /locus_tag="Dda3937_03873"
                     /db_xref="GeneID:9731567"
     CDS             202504..202929
                     /gene="yiiR"
                     /locus_tag="Dda3937_03873"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880955.1"
                     /db_xref="GI:307128939"
                     /db_xref="ASAP:ABF-0020395"
                     /db_xref="ERIC:ABF-0020395"
                     /db_xref="GeneID:9731567"
                     /translation="MTIQQWCFSFRGRVGRRDFWLGMAIVLALMVGLFMLAGTGWLET
                     QNAAFVLVVLMWPLAAILVKRLHDRNKSGWWALLLVVAWMLGNGNWAMLPPLGQWGLG
                     RFLPTLIAVMMLLDCGAFVGTSGANRFGPAAEPLRLRAS"
     misc_feature    202504..202896
                     /gene="yiiR"
                     /locus_tag="Dda3937_03873"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3152"
                     /db_xref="CDD:225694"
     gene            complement(202943..203689)
                     /gene="fpr"
                     /locus_tag="Dda3937_03874"
                     /gene_synonym="mvrA"
                     /db_xref="GeneID:9731568"
     CDS             complement(202943..203689)
                     /gene="fpr"
                     /locus_tag="Dda3937_03874"
                     /gene_synonym="mvrA"
                     /function="5.5.6 cell processes; adaptation to stress;
                     other (mechanical, nutritional, oxidative stress)"
                     /function="1.4.3 metabolism; energy production/transport;
                     electron carrier"
                     /function="1.7.1 metabolism; central intermediary
                     metabolism; unassigned reversible reactions"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-NADP reductase"
                     /protein_id="YP_003880956.1"
                     /db_xref="GI:307128940"
                     /db_xref="ASAP:ABF-0020396"
                     /db_xref="ERIC:ABF-0020396"
                     /db_xref="GeneID:9731568"
                     /translation="MAEWVTGKVIQVEHWTENLFSLRLEAPVAPFTAGQFAKLALELG
                     GERVQRAYSYVNAPSDTLLEFYLVNVPDGKLSPHLHRCQPGDEVLVTQEAAGFFVLGE
                     IPDCDTLWMLATGTAIGPYLSILQEGRGLERFKHIVLVHAARFARDLSFLPLMQQLEQ
                     RYDGKLRIQTVVSREEQPGSLTGRVPALIESGALEAAVGLSMDAATSHVMLCGNPQMV
                     RDTQQLLKDTRQMSKHLRRRPGHMTSEHYW"
     misc_feature    complement(202946..203689)
                     /gene="fpr"
                     /locus_tag="Dda3937_03874"
                     /gene_synonym="mvrA"
                     /note="ferredoxin-NADP reductase; Provisional; Region:
                     PRK10926"
                     /db_xref="CDD:182844"
     misc_feature    complement(202949..203668)
                     /gene="fpr"
                     /locus_tag="Dda3937_03874"
                     /gene_synonym="mvrA"
                     /note="Ferredoxin-NADP+ (oxido)reductase is an
                     FAD-containing enzyme that catalyzes the reversible
                     electron transfer between NADP(H) and electron carrier
                     proteins such as ferredoxin and flavodoxin. Isoforms of
                     these flavoproteins (i.e. having a non-covalently...;
                     Region: FNR1; cd06195"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(202949..202951,203342..203344,
                     203462..203467,203471..203473,203480..203482,
                     203486..203488,203492..203494,203531..203542,
                     203582..203584))
                     /gene="fpr"
                     /locus_tag="Dda3937_03874"
                     /gene_synonym="mvrA"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(203531..203536,203540..203542))
                     /gene="fpr"
                     /locus_tag="Dda3937_03874"
                     /gene_synonym="mvrA"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(203402..203404,203408..203410,
                     203435..203437,203453..203455,203462..203464,
                     203471..203473))
                     /gene="fpr"
                     /locus_tag="Dda3937_03874"
                     /gene_synonym="mvrA"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(203330..203332,203336..203347,
                     203357..203359))
                     /gene="fpr"
                     /locus_tag="Dda3937_03874"
                     /gene_synonym="mvrA"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99792"
     misc_feature    complement(order(203048..203053,203258..203266,
                     203339..203344))
                     /gene="fpr"
                     /locus_tag="Dda3937_03874"
                     /gene_synonym="mvrA"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99792"
     gene            complement(203799..204809)
                     /gene="glpX"
                     /locus_tag="Dda3937_03875"
                     /db_xref="GeneID:9731569"
     CDS             complement(203799..204809)
                     /gene="glpX"
                     /locus_tag="Dda3937_03875"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.7.8 metabolism; central intermediary
                     metabolism; gluconeogenesis"
                     /codon_start=1
                     /transl_table=11
                     /product="Fructose-1,6-bisphosphatase, GlpX type"
                     /protein_id="YP_003880957.1"
                     /db_xref="GI:307128941"
                     /db_xref="ASAP:ABF-0020397"
                     /db_xref="ERIC:ABF-0020397"
                     /db_xref="GeneID:9731569"
                     /translation="MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADNAAVQAMRIML
                     NQVDINGQIVIGEGEIDEAPMLYIGEQVGTGRGDAVDIAVDPIEGTRMTAMGQANALA
                     VLAVGEQGTFLHAPDMYMEKLIVGPQAKGAIDLDRPLEDNLKRVAERLGKPLSELTVI
                     TLAKPRHDRVIADMQRLGVKVFAIPDGDVAASILTCMPESEVDVLYGIGGAPEGVISA
                     AVIRALDGDMQGRLLARHQVKEDNAENRRLGEQELARCREMGIEAGKVLMLDDMARND
                     NVIFSATGITKGDLLDGISRRGNIATTETLLIRGKSRTIRRISSTHYLDRKDQALHAF
                     LL"
     misc_feature    complement(203844..204806)
                     /gene="glpX"
                     /locus_tag="Dda3937_03875"
                     /note="Bacterial fructose-1,6-bisphosphatase,
                     glpX-encoded. A dimeric enzyme dependent on Mg(2+).
                     glpX-encoded FPBase (FBPase class II) differs from other
                     members of the inositol-phosphatase superfamily by
                     permutation of secondary structure elements. The core...;
                     Region: FBPase_glpX; cd01516"
                     /db_xref="CDD:238774"
     misc_feature    complement(order(204171..204173,204246..204248,
                     204543..204557,204639..204644,204711..204713))
                     /gene="glpX"
                     /locus_tag="Dda3937_03875"
                     /note="putative active site [active]"
                     /db_xref="CDD:238774"
     gene            complement(204941..206452)
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /db_xref="GeneID:9731570"
     CDS             complement(204941..206452)
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="YP_003880958.1"
                     /db_xref="GI:307128942"
                     /db_xref="ASAP:ABF-0020398"
                     /db_xref="ERIC:ABF-0020398"
                     /db_xref="GeneID:9731570"
                     /translation="MNQEKKYIVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPKA
                     GWVEHDPMEIWASQSSTLVEALAKAGISSDEVAGIGITNQRETAVVWEKDTGKPIYNA
                     IVWQCRRSADICEKLKKDGLEEYIRANTGLVVDPYFSGTKVKWILDHVEGSRERARRG
                     ELLFGTIDTWLIWKMTQGRVHVTDYTNASRTMLFNIHKLDWDERMLEVLDIPRAMLPQ
                     VRPSSEIYGQTNIGGKGGTRIPIAGIAGDQQAALYGQLCVHPGMAKNTYGTGCFLLMN
                     TGTEAVRSRHGLLTTIACGPRGEVNYALEGAVFIGGASIQWLRDELKLIGDAMDSEYF
                     ATKVKDSNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHIIRATLESIAYQTRD
                     VLDAMQADADTRLQSLRVDGGAVANNFLMQFQSDILGTRVERPQVRESTALGAAFLAG
                     LATGFWNDLDEVKSKTAIEREFRPSIETVERNFRYRGWQKAVERARAWEEHDE"
     misc_feature    complement(204956..206443)
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="glycerol kinase; Provisional; Region: glpK;
                     PRK00047"
                     /db_xref="CDD:234594"
     misc_feature    complement(204974..206434)
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="Escherichia coli glycerol kinase-like proteins;
                     belongs to the FGGY family of carbohydrate kinases;
                     Region: FGGY_EcGK_like; cd07786"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(205085..205090,205094..205111,
                     205115..205120,205124..205132,205136..205138,
                     205364..205366,205370..205375,205379..205381,
                     205400..205402,205505..205507,205523..205528,
                     205532..205534,205538..205540,205547..205549,
                     205553..205555,205568..205588,205604..205606,
                     205610..205612,205637..205639,205646..205648,
                     205703..205708,205724..205729,205781..205792,
                     205856..205858,205862..205867,205883..205888,
                     205895..205900,206039..206044,206048..206050,
                     206054..206065,206072..206074,206108..206110,
                     206120..206122,206129..206131,206135..206140,
                     206198..206224,206318..206320,206366..206368,
                     206372..206374,206381..206386,206390..206392,
                     206396..206398,206405..206410,206417..206419,
                     206423..206425,206429..206434))
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="N- and C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(205202..205204,205211..205219,
                     205460..205462,205466..205471,205505..205510,
                     205514..205519,205637..205639,205646..205654,
                     205709..205714,206042..206044,206138..206140,
                     206195..206203,206396..206398,206405..206413,
                     206417..206419))
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="active site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(205202..205204,205211..205219,
                     205460..205462,205466..205471,205505..205510,
                     205514..205519,205646..205654,206396..206398,
                     206405..206413,206417..206419))
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(205712..205714,206408..206410,
                     206417..206419))
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(205712..205714,206417..206419))
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(205637..205639,205709..205714,
                     206042..206044,206138..206140,206195..206203,
                     206408..206410))
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="glycerol binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(205760..205765,205922..205924,
                     205931..205933,206162..206164,206261..206266,
                     206273..206275,206285..206290,206297..206299,
                     206348..206350))
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(205319..205321,205328..205330,
                     205340..205366,205403..205405,205418..205420,
                     205424..205426,205493..205495,205502..205507,
                     205514..205516,205523..205525,206135..206137,
                     206312..206314,206321..206323,206330..206332))
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(205739..205741,205745..205750))
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="FBP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(205004..205006,205010..205021,
                     205025..205027,205031..205033,205235..205237,
                     205241..205243))
                     /gene="glpK"
                     /locus_tag="Dda3937_03876"
                     /note="protein IIAGlc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198361"
     gene            complement(206480..207331)
                     /gene="glpF"
                     /locus_tag="Dda3937_03877"
                     /db_xref="GeneID:9731571"
     CDS             complement(206480..207331)
                     /gene="glpF"
                     /locus_tag="Dda3937_03877"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="4.S.77 transport; substrate; glycerol"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="4.1.A.8 transport; Channel-type Transporters;
                     alpha-type channels; The Major Intrinsic protein (MIP)
                     Family"
                     /function="6.1 cell structure; membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol uptake facilitator protein"
                     /protein_id="YP_003880959.1"
                     /db_xref="GI:307128943"
                     /db_xref="ASAP:ABF-0020399"
                     /db_xref="ERIC:ABF-0020399"
                     /db_xref="GeneID:9731571"
                     /translation="MSQSELSTLKGQCIAEFLGTGLLIFFGVGCVAALKLAGASLGLW
                     EISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFDGRKVLPYIVSQVAGAFCS
                     AALVYGLYHNLFDNIEQTHNMVRGSVESLDLAGIFSTYPNPHISVLQAFLVETVITAI
                     LMCLILALTDDGNGIPRGPLAPLLIGILIAIIGASMGPLTGFAMNPARDAGPKLFAYF
                     AGWGKIALTGGRDIPYILIPIFGPIVGACLGAFGYRSLIGRNLPCDVCATDTDTDTAA
                     SAQTRKV"
     misc_feature    complement(206570..207298)
                     /gene="glpF"
                     /locus_tag="Dda3937_03877"
                     /note="Major intrinsic protein (MIP) superfamily. Members
                     of the MIP superfamily function as membrane channels that
                     selectively transport water, small neutral molecules, and
                     ions out of and between cells. The channel proteins share
                     a common fold: the N-terminal...; Region: MIP; cd00333"
                     /db_xref="CDD:238204"
     misc_feature    complement(order(206708..206710,206717..206719,
                     206726..206731,207122..207130,207182..207184))
                     /gene="glpF"
                     /locus_tag="Dda3937_03877"
                     /note="amphipathic channel; other site"
                     /db_xref="CDD:238204"
     misc_feature    complement(order(206711..206719,207116..207124))
                     /gene="glpF"
                     /locus_tag="Dda3937_03877"
                     /note="Asn-Pro-Ala signature motifs; other site"
                     /db_xref="CDD:238204"
     gene            207507..207779
                     /locus_tag="Dda3937_03878"
                     /db_xref="GeneID:9731572"
     CDS             207507..207779
                     /locus_tag="Dda3937_03878"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880960.1"
                     /db_xref="GI:307128944"
                     /db_xref="ASAP:ABF-0020401"
                     /db_xref="ERIC:ABF-0020401"
                     /db_xref="GeneID:9731572"
                     /translation="MCVTRQENARIRVISEKMPLCPSGLVLTGVLNALTLVLFNSDPG
                     DFQSVLIAHERKSRQSRCFTGGVLDTPDPATYNLAGVYVGRASAGV"
     gene            207918..208160
                     /gene="yiiU"
                     /locus_tag="Dda3937_03879"
                     /db_xref="GeneID:9731573"
     CDS             207918..208160
                     /gene="yiiU"
                     /locus_tag="Dda3937_03879"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880961.1"
                     /db_xref="GI:307128945"
                     /db_xref="ASAP:ABF-0020402"
                     /db_xref="ERIC:ABF-0020402"
                     /db_xref="GeneID:9731573"
                     /translation="MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNTLSQEVESM
                     AGNRDALMRENEQLKQEQLVWQERLRALLGKMEDVQ"
     misc_feature    207918..208154
                     /gene="yiiU"
                     /locus_tag="Dda3937_03879"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3074"
                     /db_xref="CDD:225616"
     gene            complement(208226..208711)
                     /gene="rraA"
                     /locus_tag="Dda3937_03880"
                     /gene_synonym="menG"
                     /db_xref="GeneID:9731574"
     CDS             complement(208226..208711)
                     /gene="rraA"
                     /locus_tag="Dda3937_03880"
                     /gene_synonym="menG"
                     /function="1.5.3.11 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier;
                     menaquinone, ubiquinone"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease E (RNase E) inhibitor protein"
                     /protein_id="YP_003880962.1"
                     /db_xref="GI:307128946"
                     /db_xref="ASAP:ABF-0020403"
                     /db_xref="ERIC:ABF-0020403"
                     /db_xref="GeneID:9731574"
                     /translation="MKYDTSELCDIYHEEVNVVEPLFSNFGGRSSFGGKIITVKCFED
                     NGLLFDVLEENGSGRVLLVDGGGSVRRALVNAELARLATQNEWEGIVVYGAVRQVDDL
                     SELDIGIQAMAATPAGAASEGIGETDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDL
                     E"
     misc_feature    complement(208235..208711)
                     /gene="rraA"
                     /locus_tag="Dda3937_03880"
                     /gene_synonym="menG"
                     /note="ribonuclease activity regulator protein RraA;
                     Provisional; Region: PRK09372"
                     /db_xref="CDD:236487"
     gene            complement(208870..209778)
                     /gene="menA"
                     /locus_tag="Dda3937_03881"
                     /db_xref="GeneID:9731575"
     CDS             complement(208870..209778)
                     /gene="menA"
                     /locus_tag="Dda3937_03881"
                     /function="1.5.3.11 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier;
                     menaquinone, ubiquinone"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /protein_id="YP_003880963.1"
                     /db_xref="GI:307128947"
                     /db_xref="ASAP:ABF-0020405"
                     /db_xref="ERIC:ABF-0020405"
                     /db_xref="GeneID:9731575"
                     /translation="MTHSSKTQAWLDSLRPKTLPLAFASIVTGTVIACWHSNFKPGVA
                     LLTLITAGLLQILSNLANDYGDAVKGSDKEDRIGPLRGIQTGAISLPELRKALLITVT
                     LTAISGSALVALACEKPVDIVVFLALGLLAILAAITYTVGNKPYGYIGLGDISVLIFF
                     GWLSVAGSYYLQTGHFDSSVILPATACGLLAVAVLNINNLRDIDSDRENGKNTLAVRL
                     GAHKARRYHMVLLMTAPVCLALFAMLYLHTLAGWLFILALPLLVKQGRYVMRETTAFS
                     MRPMLEKTVKGALLTNLLFAVGVLLS"
     misc_feature    complement(208885..209748)
                     /gene="menA"
                     /locus_tag="Dda3937_03881"
                     /note="1,4-Dihydroxy-2-naphthoate octaprenyltransferase;
                     Region: PT_UbiA_UBIAD1; cd13962"
                     /db_xref="CDD:260125"
     misc_feature    complement(order(209161..209163,209173..209175,
                     209182..209187,209581..209583,209590..209595))
                     /gene="menA"
                     /locus_tag="Dda3937_03881"
                     /note="putative active site [active]"
                     /db_xref="CDD:260125"
     gene            complement(209945..211276)
                     /gene="hslU"
                     /locus_tag="Dda3937_03882"
                     /gene_synonym="clpY; htpI"
                     /db_xref="GeneID:9731576"
     CDS             complement(209945..211276)
                     /gene="hslU"
                     /locus_tag="Dda3937_03882"
                     /gene_synonym="clpY; htpI"
                     /function="5.5.2 cell processes; adaptation to stress;
                     temperature extremes"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="2.3.6 information transfer; protein related;
                     turnover, degradation"
                     /function="2.3.4 information transfer; protein related;
                     chaperoning, folding"
                     /function="3.1.3.4 regulation; type of regulation;
                     posttranscriptional; proteases, cleavage of compounds"
                     /function="5.1 cell processes; cell division"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone and ATPase of HslUV
                     protease"
                     /protein_id="YP_003880964.1"
                     /db_xref="GI:307128948"
                     /db_xref="ASAP:ABF-0020407"
                     /db_xref="ERIC:ABF-0020407"
                     /db_xref="GeneID:9731576"
                     /translation="MSEMTPREIVSELDSYIIGQHKAKRAVAIALRNRWRRMQLEESL
                     RHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRD
                     LTDVAIKMVRQQSMEKNRYRAEELAEERILDVLIPPAKNNWGQPEENHEPSAARQAFR
                     KKLREGSLDDKEIEIELAAAPVGVEIMAPPGMEEMTNQLQSMFQNLAGQKQKNRKIKI
                     REAFKLLVEEEAAKLVNPEELKQQAIEAVEQHGIVFIDEIDKICKRGDTSGPDVSREG
                     VQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVASPSDLIPELQGRLPIRVELQA
                     LTTEDFERILTEPSASLTRQYQALMETEGVNITFLPDGIRRIAEAAWQVNERTENIGA
                     RRLHTVLERLIEDVSYGASEMHGQTVTIDADYVRSHLDELVADEDLSRFIL"
     misc_feature    complement(209948..211276)
                     /gene="hslU"
                     /locus_tag="Dda3937_03882"
                     /gene_synonym="clpY; htpI"
                     /note="ATP-dependent protease ATP-binding subunit HslU;
                     Provisional; Region: hslU; PRK05201"
                     /db_xref="CDD:235364"
     misc_feature    complement(<210947..211225)
                     /gene="hslU"
                     /locus_tag="Dda3937_03882"
                     /gene_synonym="clpY; htpI"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(211085..211108)
                     /gene="hslU"
                     /locus_tag="Dda3937_03882"
                     /gene_synonym="clpY; htpI"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(211082..211105)
                     /gene="hslU"
                     /locus_tag="Dda3937_03882"
                     /gene_synonym="clpY; htpI"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(210278..>210604)
                     /gene="hslU"
                     /locus_tag="Dda3937_03882"
                     /gene_synonym="clpY; htpI"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(210506..210523)
                     /gene="hslU"
                     /locus_tag="Dda3937_03882"
                     /gene_synonym="clpY; htpI"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(210302..210304)
                     /gene="hslU"
                     /locus_tag="Dda3937_03882"
                     /gene_synonym="clpY; htpI"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(210008..210274)
                     /gene="hslU"
                     /locus_tag="Dda3937_03882"
                     /gene_synonym="clpY; htpI"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; smart01086"
                     /db_xref="CDD:198154"
     gene            complement(211286..211816)
                     /gene="hslV"
                     /locus_tag="Dda3937_03883"
                     /gene_synonym="htpO"
                     /db_xref="GeneID:9731577"
     CDS             complement(211286..211816)
                     /gene="hslV"
                     /locus_tag="Dda3937_03883"
                     /gene_synonym="htpO"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="2.3.6 information transfer; protein related;
                     turnover, degradation"
                     /function="2.3.4 information transfer; protein related;
                     chaperoning, folding"
                     /function="3.1.3.4 regulation; type of regulation;
                     posttranscriptional; proteases, cleavage of compounds"
                     /function="5.1 cell processes; cell division"
                     /codon_start=1
                     /transl_table=11
                     /product="HslUV protease peptidase subunit"
                     /protein_id="YP_003880965.1"
                     /db_xref="GI:307128949"
                     /db_xref="ASAP:ABF-0020408"
                     /db_xref="ERIC:ABF-0020408"
                     /db_xref="GeneID:9731577"
                     /translation="MTTIVSVRRNGQVVIGGDGQATLGNTVMKGNVRKVRRLYNDRVI
                     AGFAGGTADAFTLFELFERKLELHQGHLVKAAVELAKDWRTDRMLRRLEALLAVADEN
                     ASLIITGNGDVIQPENDLIAIGSGGPYAQAAARALLENTELSAREIVEKSLGIAGDIC
                     IYTNQFHTIEELASKA"
     misc_feature    complement(211301..211813)
                     /gene="hslV"
                     /locus_tag="Dda3937_03883"
                     /gene_synonym="htpO"
                     /note="Protease HslV and the ATPase/chaperone HslU are
                     part of an ATP-dependent proteolytic system that is the
                     prokaryotic homolog of the proteasome. HslV is a dimer of
                     hexamers (a dodecamer) that forms a central proteolytic
                     chamber with active sites on the...; Region:
                     protease_HslV; cd01913"
                     /db_xref="CDD:238894"
     misc_feature    complement(order(211442..211444,211715..211717,
                     211757..211759,211763..211765,211811..211813))
                     /gene="hslV"
                     /locus_tag="Dda3937_03883"
                     /gene_synonym="htpO"
                     /note="active site"
                     /db_xref="CDD:238894"
     misc_feature    complement(order(211334..211336,211340..211345,
                     211352..211354,211364..211366,211397..211399,
                     211421..211423,211430..211435,211472..211474,
                     211484..211486,211565..211567,211736..211744))
                     /gene="hslV"
                     /locus_tag="Dda3937_03883"
                     /gene_synonym="htpO"
                     /note="HslU subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238894"
     gene            complement(211902..212831)
                     /gene="ftsN"
                     /locus_tag="Dda3937_03884"
                     /gene_synonym="msgA"
                     /db_xref="GeneID:9731578"
     CDS             complement(211902..212831)
                     /gene="ftsN"
                     /locus_tag="Dda3937_03884"
                     /gene_synonym="msgA"
                     /function="5.1 cell processes; cell division"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="essential cell division protein"
                     /protein_id="YP_003880966.1"
                     /db_xref="GI:307128950"
                     /db_xref="ASAP:ABF-0020410"
                     /db_xref="ERIC:ABF-0020410"
                     /db_xref="GeneID:9731578"
                     /translation="MAQRDYVSRGRSGTRRKKTSSRKRGGSSGASKTMIALAVAVLVT
                     FAGGLYFIAHNKPDESPVLPHQGTKGNGLPPKPEERWRYIKELENRQIGVASPTEPSA
                     GGEIQSTGQLTNEQRQLLEQMQSDMKRQPTTLTEVPYNDQSQMPARSLAAPRPQTVVP
                     IVPNTSTVTPPPAPRTTTTVPANQHHTTQAATPPAQTAQKPVQAEPRKEAAKTETAAK
                     ETAKTDSKTENAKPEKEQRWMVQCGSFKTAEPAESVRAELAFAGVESRIASSGGWHRI
                     MLGPYNSRTVADKMAQKLKGMGQSNCIPLASGG"
     misc_feature    complement(211905..212732)
                     /gene="ftsN"
                     /locus_tag="Dda3937_03884"
                     /gene_synonym="msgA"
                     /note="cell division protein FtsN; Provisional; Region:
                     PRK12757"
                     /db_xref="CDD:237191"
     misc_feature    complement(211923..212132)
                     /gene="ftsN"
                     /locus_tag="Dda3937_03884"
                     /gene_synonym="msgA"
                     /note="Sporulation related domain; Region: SPOR;
                     pfam05036"
                     /db_xref="CDD:252961"
     gene            complement(212883..213953)
                     /gene="cytR"
                     /locus_tag="Dda3937_03885"
                     /db_xref="GeneID:9731579"
     CDS             complement(212883..213953)
                     /gene="cytR"
                     /locus_tag="Dda3937_03885"
                     /function="CytR controls the expression of genes involved
                     in nucleoside catabolism and nucleotide transport"
                     /function="In E. carotovora subsp. carotovora EC1, a CytR
                     homolog controls expression of polygalacturonase and
                     flagella secretion genes."
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.4 regulation; genetic unit regulated;
                     global"
                     /function="1.7.33 metabolism; central intermediary
                     metabolism; nucleotide and nucleoside conversions"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.3.2 regulation; genetic unit regulated;
                     regulon"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="CytR belongs to the LacI family of transcriptional
                     regulator;
                     CytR binds cytidine and adenosine as effector"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator CytR"
                     /protein_id="YP_003880967.1"
                     /db_xref="GI:307128951"
                     /db_xref="ASAP:ABF-0020411"
                     /db_xref="ERIC:ABF-0020411"
                     /db_xref="GeneID:9731579"
                     /translation="MEQKKFIPPATMKDVADQAGVSTATVSRALTNPEKVSATTRQKV
                     EQAALAVGYSAQNLARNLKRHESRTILALVPDICDPFFTEMLRGIEETAAERGYLVLI
                     GDCAHQRKTEKTFLDLITTRQIDGILLLGSQLPFDAGKDERRHLPPMVMANEFAPELD
                     MPTVHIDNLTAAFEAVSYLNQLGHRRIACIAGPEQIPISEYRLQGYIQALRRCGLVID
                     NQYIVRGDFSYDTGSRGLMRLMSHPTPPTAVFCHCDVMALGALTQARKMGLDVPRDLS
                     LVGFDDIAQASHCFPALTTVSQPRYDIGREAMLLLLAQLQQHKVQRGSRLISSQLIIR
                     DSTAAPPLRVTGFKNSGAGQIF"
     misc_feature    complement(213762..213917)
                     /gene="cytR"
                     /locus_tag="Dda3937_03885"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(213765..213770,213774..213779,
                     213786..213788,213795..213797,213834..213836,
                     213843..213848,213861..213863,213870..213875,
                     213879..213893,213915..213917))
                     /gene="cytR"
                     /locus_tag="Dda3937_03885"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(212931..213857)
                     /gene="cytR"
                     /locus_tag="Dda3937_03885"
                     /note="DNA-binding transcriptional regulator CytR;
                     Provisional; Region: PRK11041"
                     /db_xref="CDD:182923"
     misc_feature    complement(213768..213797)
                     /gene="cytR"
                     /locus_tag="Dda3937_03885"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(212946..213749)
                     /gene="cytR"
                     /locus_tag="Dda3937_03885"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     gene            complement(214389..216587)
                     /gene="priA"
                     /locus_tag="Dda3937_03886"
                     /gene_synonym="srgA"
                     /db_xref="GeneID:9731580"
     CDS             complement(214389..216587)
                     /gene="priA"
                     /locus_tag="Dda3937_03886"
                     /gene_synonym="srgA"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="primosome factor n'"
                     /protein_id="YP_003880968.1"
                     /db_xref="GI:307128952"
                     /db_xref="ASAP:ABF-0020412"
                     /db_xref="ERIC:ABF-0020412"
                     /db_xref="GeneID:9731580"
                     /translation="MPVVQVALPVPLTRTFDYRLPQGITPPVPGARVSVPFGNRKMIG
                     IVTALSAGSALPLEQLKPLHDVLDDAPLFQDSLWHILLWAAEYYHYPLGDVLFHALPI
                     LLRQGKPAHSAPLWQWFATEQGRATPVNALKRAPKQQQALAALLQGPLYRHQVAETEL
                     TEAALQALREKGLSELRALPQQVRDWRDDFSLTGERLRLNTEQATAVGAIRSEDDHFA
                     AWLLAGITGSGKTEVYLSVLENILAQGKQALVLVPEIGLTPQTIARFRDRFNAPVEAL
                     HSGLNDGERLSVWLRARQGEAAIVIGTRSALFTPFARLGLIVIDEEHDGSYKQQEGWR
                     YHARDLAVFRARQEDIPIVMGSATPALETLYNVQIGKYRQLRLSKRAGNARLAQQHLL
                     DLKGLPLTTGLSQPLISRIRHHLAADNQVILFLNRRGFAPVVLCHECGWIAECQRCDS
                     YYTLHQHQRMMRCHHCDSQRPIPQQCPQCGSTHLVPVGLGTEQLEQALPALFPEAPIT
                     RIDRDTTSRKGALEQQLAQVRQGGARILIGTQMLAKGHHFPDVTLVALLDVDSSLFSA
                     DFRATERFAQLYTQVSGRAGRAGKAGEVVLQTHHPEHPLLQTLLHQGYDAFASQTLKE
                     RQSVFLPPFTSHVLFRADDHDNQQASLFLQQLRNLLEASPLRDDSLWLMGPVPALQPK
                     RAGRFRWQLLLQHPSRATLQRLIRNSMPLIDTLPQTRKVKWVMDVDPTDN"
     misc_feature    complement(214395..216587)
                     /gene="priA"
                     /locus_tag="Dda3937_03886"
                     /gene_synonym="srgA"
                     /note="primosome assembly protein PriA; Validated; Region:
                     PRK05580"
                     /db_xref="CDD:235514"
     misc_feature    complement(215511..215927)
                     /gene="priA"
                     /locus_tag="Dda3937_03886"
                     /gene_synonym="srgA"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(215895..215909)
                     /gene="priA"
                     /locus_tag="Dda3937_03886"
                     /gene_synonym="srgA"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(215619..215630)
                     /gene="priA"
                     /locus_tag="Dda3937_03886"
                     /gene_synonym="srgA"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(214821..215114)
                     /gene="priA"
                     /locus_tag="Dda3937_03886"
                     /gene_synonym="srgA"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     gene            216863..217078
                     /gene="rpmE"
                     /locus_tag="Dda3937_04717"
                     /db_xref="GeneID:9731581"
     CDS             216863..217078
                     /gene="rpmE"
                     /locus_tag="Dda3937_04717"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31p"
                     /protein_id="YP_003880969.1"
                     /db_xref="GI:307128953"
                     /db_xref="ASAP:ABF-0174109"
                     /db_xref="ERIC:ABF-0174109"
                     /db_xref="GeneID:9731581"
                     /translation="MKEGIHPNYVEITATCSCGNVIKTRSTAAHDLNLDVCGACHPFF
                     TGKQRVVDTGGRVERFNKRFSVPGTKK"
     misc_feature    216863..217075
                     /gene="rpmE"
                     /locus_tag="Dda3937_04717"
                     /note="50S ribosomal protein L31; Reviewed; Region: rpmE;
                     PRK00019"
                     /db_xref="CDD:234576"
     gene            complement(217195..217512)
                     /gene="metJ"
                     /locus_tag="Dda3937_03887"
                     /db_xref="GeneID:9731582"
     CDS             complement(217195..217512)
                     /gene="metJ"
                     /locus_tag="Dda3937_03887"
                     /function="MetJ controls the expression of the genes
                     involved in methionine synthesis"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="1.5.1.9 metabolism; building block
                     biosynthesis; amino acids; methionine"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="MetJ belongs to the MetJ family of transcriptional
                     regulators;
                     S-adenosylmethionine is the corepressor of MetJ"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein transcriptional repressor,
                     S-adenosylmethionine-binding protein"
                     /protein_id="YP_003880970.1"
                     /db_xref="GI:307128954"
                     /db_xref="ASAP:ABF-0020414"
                     /db_xref="ERIC:ABF-0020414"
                     /db_xref="GeneID:9731582"
                     /translation="MAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRR
                     QVNNLRHATNSELLCEAFLHAFTGQPLPNDDDLRKERGDEIPDAAKAIMREMGIDPDT
                     WEY"
     misc_feature    complement(217201..217509)
                     /gene="metJ"
                     /locus_tag="Dda3937_03887"
                     /note="Met Repressor, MetJ.  MetJ is a bacterial
                     regulatory protein that uses S-adenosylmethionine (SAM) as
                     a corepressor to regulate the production of Methionine.
                     MetJ binds arrays of two to five adjacent copies of an
                     eight base-pair 'metbox'...; Region: Met_repressor_MetJ;
                     cd00490"
                     /db_xref="CDD:119402"
     misc_feature    complement(order(217300..217302,217315..217323,
                     217327..217332,217336..217341,217348..217350,
                     217393..217395,217402..217407,217411..217416,
                     217420..217455,217474..217476,217480..217485))
                     /gene="metJ"
                     /locus_tag="Dda3937_03887"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119402"
     misc_feature    complement(order(217348..217356,217390..217392,
                     217429..217431,217435..217449,217459..217461))
                     /gene="metJ"
                     /locus_tag="Dda3937_03887"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:119402"
     misc_feature    complement(order(217297..217302,217309..217311,
                     217315..217323,217327..217335,217342..217344,
                     217381..217386,217393..217395))
                     /gene="metJ"
                     /locus_tag="Dda3937_03887"
                     /note="corepressor binding sites; other site"
                     /db_xref="CDD:119402"
     gene            217701..218861
                     /gene="metB"
                     /locus_tag="Dda3937_03888"
                     /db_xref="GeneID:9731583"
     CDS             217701..218861
                     /gene="metB"
                     /locus_tag="Dda3937_03888"
                     /function="1.5.1.9 metabolism; building block
                     biosynthesis; amino acids; methionine"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="YP_003880971.1"
                     /db_xref="GI:307128955"
                     /db_xref="ASAP:ABF-0020415"
                     /db_xref="ERIC:ABF-0020415"
                     /db_xref="GeneID:9731583"
                     /translation="MTRKQATIAVRSGLNNDEQFGCVVPPIHLSSTYNFTGFNEPRAH
                     DYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAILLVCTVFLRPGDLLVAPHDCYG
                     GSYRLFDSLSKRGAYRVKFVDQGNAADLKAALAEKPKLVLVESPSNPLLRVVDIAAIC
                     QAAREAGAVSVVDNTFLSPALQNPLKLGADLVVHSCTKYLNGHSDVVAGAVIARDPEV
                     VTELAWWANNIGVTGAAFDSYLLLRGVRTLSPRMMIAQKNALQIVEYLRHQPLVKALY
                     HPSLPGNAGHEIARRQQSGFGAMLSFELDGDEDTLRRFLSTLELFTLAESLGGVESLI
                     SHAATMTHAGMAPQARAAAGISETLLRISVGIEDGDDLVADLDRAFQAAAKR"
     misc_feature    217761..218840
                     /gene="metB"
                     /locus_tag="Dda3937_03888"
                     /note="CGS_like: Cystathionine gamma-synthase is a PLP
                     dependent enzyme and catalyzes the committed step of
                     methionine biosynthesis. This pathway is unique to
                     microorganisms and plants, rendering the enzyme an
                     attractive target for the development of...; Region:
                     CGS_like; cd00614"
                     /db_xref="CDD:99738"
     misc_feature    order(217785..217796,217800..217805,217836..217838,
                     217842..217844,217920..217925,217929..217934,
                     218001..218003,218016..218018,218025..218027,
                     218289..218291,218313..218315,218319..218321,
                     218370..218372,218400..218402,218406..218411,
                     218646..218648)
                     /gene="metB"
                     /locus_tag="Dda3937_03888"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99738"
     misc_feature    order(217923..217931,218001..218003,218130..218132,
                     218217..218219,218283..218285,218289..218294,
                     218319..218321)
                     /gene="metB"
                     /locus_tag="Dda3937_03888"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99738"
     misc_feature    order(217923..217931,218001..218003,218217..218219,
                     218226..218228,218283..218285,218289..218294)
                     /gene="metB"
                     /locus_tag="Dda3937_03888"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99738"
     misc_feature    218292..218294
                     /gene="metB"
                     /locus_tag="Dda3937_03888"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99738"
     gene            218864..221299
                     /gene="metL"
                     /locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /db_xref="GeneID:9731584"
     CDS             218864..221299
                     /gene="metL"
                     /locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /function="1.5.1.9 metabolism; building block
                     biosynthesis; amino acids; methionine"
                     /function="1.5.1.21 metabolism; building block
                     biosynthesis; amino acids; homoserine"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aspartokinase/homoserine
                     dehydrogenase"
                     /protein_id="YP_003880972.1"
                     /db_xref="GI:307128956"
                     /db_xref="ASAP:ABF-0020416"
                     /db_xref="ERIC:ABF-0020416"
                     /db_xref="GeneID:9731584"
                     /translation="MSALGIAAAVKGRQLHKFGGSSLADVKCYQRVAGIMADYSQAGD
                     LMVVSAAGSTTNQLISWLNLSQSDRISAHQVQQSLRRYQSELISGLLPAETAAPLINE
                     FIRDLERLAALLDGKLTEAAYAEVVGHGEIWSARLMAAVLNQKNLPAAWLDARTFLRA
                     ERAAQPQVDEGRSWPLLQQLLTQNAGQRLVITGFISSNDAGETVLLGRNGSDYSATQI
                     GALAGVERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHARTLQP
                     VSGSDIDLQLRCSYQPEQGSTRIERVLASGTGAKIVTSHDDVCLIEIGVPAEHDFART
                     HKDVEQLLQKSQIRPLALGVHQDRNLLQLCYTSEVVHSAWQVLEQAALPVSLHLREGL
                     ALVALVGAGVCRNPLHSHRFYQQLRDQPIEFVWQAEDDISLVAVLRVGPTEHLVRGLH
                     HSLFRAEKRIGLVLFGKGNIGSRWLELFAREQSLISARTGFEFTLAGVVDSSRSLLDY
                     EGLDASRVLAFFGDEAQERDDDELFLWMRAHPYDDLVVLDVTASQSVADLYLDFASHG
                     FHVISANKLAGASGGDNYRQIRDAFAKTGRHWLYNATVGAGLPVNYAVRDLRESGDSI
                     LAISGIFSGTLSWLFLQFDGTVPFTELVDQAWQQGLTEPDPRVDLSGQDVMRKLVILA
                     REAGYEIEPNQVRVESLVPAGCENGSVDQFFEDGEPLNQQMLQRLEAANEMGLVLRYV
                     ARFDVNGKARVGVEAVRADHPLAALLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAG
                     AIQSDLNRLAQLL"
     misc_feature    218867..221296
                     /gene="metL"
                     /locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /note="bifunctional aspartate kinase II/homoserine
                     dehydrogenase II; Provisional; Region: metL; PRK09466"
                     /db_xref="CDD:236530"
     misc_feature    218903..219763
                     /gene="metL"
                     /locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /note="AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK),
                     AK-HSDH; this CD includes the N-terminal catalytic domain
                     of aspartokinase (AK) of the bifunctional enzyme AK -
                     homoserine dehydrogenase (HSDH). These aspartokinases are
                     found in bacteria (E. coli...; Region: AAK_AK-HSDH;
                     cd04257"
                     /db_xref="CDD:239790"
     misc_feature    order(218912..218914,219026..219028,219254..219256,
                     219497..219499,219632..219634,219671..219673)
                     /gene="metL"
                     /locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239790"
     misc_feature    order(218912..218914,218918..218926,219557..219562,
                     219569..219574)
                     /gene="metL"
                     /locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /note="putative nucleotide binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239790"
     misc_feature    order(219008..219013,219026..219028,219254..219256)
                     /gene="metL"
                     /locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /note="putative aspartate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239790"
     misc_feature    220040..220225
                     /gene="metL"
                     /locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /note="ACT domains C-terminal to the catalytic domain of
                     aspartokinase (AK; 4-L-aspartate-4-phosphotransferase);
                     Region: ACT_AK-like_2; cd04892"
                     /db_xref="CDD:153164"
     misc_feature    220259..220666
                     /gene="metL"
                     /locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /note="Homoserine dehydrogenase, NAD binding domain;
                     Region: NAD_binding_3; pfam03447"
                     /db_xref="CDD:251960"
     misc_feature    220688..221275
                     /gene="metL"
                     /locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /note="Homoserine dehydrogenase; Region: Homoserine_dh;
                     pfam00742"
                     /db_xref="CDD:250099"
     gene            221642..222538
                     /gene="metF"
                     /locus_tag="Dda3937_03890"
                     /db_xref="GeneID:9731585"
     CDS             221642..222538
                     /gene="metF"
                     /locus_tag="Dda3937_03890"
                     /function="1.7.17 metabolism; central intermediary
                     metabolism; formyl-tetrahydrofolate biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="YP_003880973.1"
                     /db_xref="GI:307128957"
                     /db_xref="ASAP:ABF-0020418"
                     /db_xref="ERIC:ABF-0020418"
                     /db_xref="GeneID:9731585"
                     /translation="MSFFHANHQEALNQNLAELQGRINVSFEFFPPRTSEMEETLWNS
                     IDRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASRDELKAI
                     AQDYWQSGIRHIVALRGDLPPGSGKPEMYASDLVTLLKEVGDFDISVAAYPEVHPEAK
                     SAQADLINLKRKIDAGASRAITQFFFDVESYLRFRDRCVTTGIDVEIVPGILPVSNFK
                     QLQRFATMTNVRVPNWMTAMFEGLDNDPETRKMVGASIAMDMVKILSREGVKDFHFYT
                     LNRSELSYAICHTLGVRPVTAA"
     misc_feature    221714..222511
                     /gene="metF"
                     /locus_tag="Dda3937_03890"
                     /note="Methylenetetrahydrofolate reductase (MTHFR).
                     5,10-Methylenetetrahydrofolate is reduced to
                     5-methyltetrahydrofolate by methylenetetrahydrofolate
                     reductase, a cytoplasmic, NAD(P)-dependent enzyme.
                     5-methyltetrahydrofolate is utilized by methionine
                     synthase...; Region: MTHFR; cd00537"
                     /db_xref="CDD:238299"
     misc_feature    order(221819..221821,221903..221905,221990..221998,
                     222032..222037,222089..222091,222095..222097,
                     222107..222109,222113..222115,222134..222136,
                     222143..222145,222152..222157,222182..222184,
                     222188..222190,222464..222466)
                     /gene="metF"
                     /locus_tag="Dda3937_03890"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:238299"
     gene            complement(222718..223449)
                     /locus_tag="Dda3937_03891"
                     /db_xref="GeneID:9731586"
     CDS             complement(222718..223449)
                     /locus_tag="Dda3937_03891"
                     /function="1.6.15.2 metabolism; macromolecules (cellular
                     constituent) biosynthesis; large molecule carriers;
                     thioredoxin, glutaredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="Peroxiredoxin family protein/glutaredoxin"
                     /protein_id="YP_003880974.1"
                     /db_xref="GI:307128958"
                     /db_xref="ASAP:ABF-0020419"
                     /db_xref="ERIC:ABF-0020419"
                     /db_xref="GeneID:9731586"
                     /translation="MFVSQEGKKIPSVTFHTRQGDQWVDVTTAELFNNKTVVVFSLPG
                     AFTPTCSSSHLPRYNELAAVFKQFGVDAVLCVSVNDTFVMNAWKADQDAENITFIPDG
                     NGEFTRAMNMLVEKAELGFGPRSWRYSMLVRHGVVAKMFVEPNKPGDPFEVSDADTML
                     KYLAPHYKVQESVSLFTKPGCPFCAKAKQLLQDRGIQYEEIMLGKDATTVSLRAMTGR
                     STVPQVFMGGRHIGGSEELETVLTT"
     misc_feature    complement(222967..223434)
                     /locus_tag="Dda3937_03891"
                     /note="Peroxiredoxin (PRX) family, PRX5-like subfamily;
                     members are similar to the human protein, PRX5, a
                     homodimeric TRX peroxidase, widely expressed in tissues
                     and found cellularly in mitochondria, peroxisomes and the
                     cytosol. The cellular location of PRX5...; Region:
                     PRX5_like; cd03013"
                     /db_xref="CDD:239311"
     misc_feature    complement(222904..223431)
                     /locus_tag="Dda3937_03891"
                     /note="Peroxiredoxin [Posttranslational modification,
                     protein turnover, chaperones]; Region: AhpC; COG0450"
                     /db_xref="CDD:223527"
     misc_feature    complement(order(223069..223071,223300..223302,
                     223309..223311))
                     /locus_tag="Dda3937_03891"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:239311"
     misc_feature    complement(order(223078..223080,223141..223146,
                     223204..223206,223210..223212,223306..223308))
                     /locus_tag="Dda3937_03891"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239311"
     misc_feature    complement(222727..222960)
                     /locus_tag="Dda3937_03891"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            223626..224543
                     /gene="oxyR"
                     /locus_tag="Dda3937_03892"
                     /gene_synonym="momR; mor"
                     /db_xref="GeneID:9731587"
     CDS             223626..224543
                     /gene="oxyR"
                     /locus_tag="Dda3937_03892"
                     /gene_synonym="momR; mor"
                     /function="OxyR activates the expression of a regulon of
                     hydrogen peroxide-inducible genes such as katG, gor, ahpC,
                     ahpF, oxyS (a regulatory RNA), dps, fur and grxA."
                     /function="OxyR activates the expression of a regulon of
                     hydrogen peroxide-inducible genes such as katG, gor, ahpC,
                     ahpF, dps, fur and grxA."
                     /function="An EC16 oxyR mutant is reduced in catalase and
                     glutathione reductase activity and is unable to form
                     colonies on agar plates unless exogenous catalase is
                     added. However, it is not reduced in virulence, suggesting
                     that hydrogen peroxide is not important for"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="3.3.2 regulation; genetic unit regulated;
                     regulon"
                     /function="5.5.6 cell processes; adaptation to stress;
                     other (mechanical, nutritional, oxidative stress)"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /note="OxyR belongs to the LysR family of transcriptional
                     regulators;
                     OxyR is inactivated by reduction of its essential
                     disulfide bond (Cys 199-Cys 208);
                     while other genes regulated by OxyR are present in
                     ECH3937, the gene for the regulatory RNA OxyS is not
                     detected"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional dual regulator"
                     /protein_id="YP_003880975.1"
                     /db_xref="GI:307128959"
                     /db_xref="ASAP:ABF-0020420"
                     /db_xref="ERIC:ABF-0020420"
                     /db_xref="GeneID:9731587"
                     /translation="MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELG
                     VMLLERTSRKVLFTQAGLLLVEQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVG
                     PYLLPQIIPMLHRTFPKLEMYLHEAQTHQLLAQLDSGKLDCAILAMVKESEAFIEVPL
                     FDEPMKLAIYQDHPWANRERVAMSDLSGEKLLMLEDGHCLRDQAMGFCFQAGADEDTH
                     FRATSLETLRNMVAAGSGITLLPSLAVPPERVRDGVCYLPCYKPEPKRTIALVYRPGS
                     PLRGRYEQLADSVREHMQLHMEQLSKQSA"
     misc_feature    223626..224540
                     /gene="oxyR"
                     /locus_tag="Dda3937_03892"
                     /gene_synonym="momR; mor"
                     /note="DNA-binding transcriptional regulator OxyR;
                     Provisional; Region: PRK11151"
                     /db_xref="CDD:182999"
     misc_feature    223632..223808
                     /gene="oxyR"
                     /locus_tag="Dda3937_03892"
                     /gene_synonym="momR; mor"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    223896..224492
                     /gene="oxyR"
                     /locus_tag="Dda3937_03892"
                     /gene_synonym="momR; mor"
                     /note="The C-terminal substrate-binding domain of the
                     LysR-type transcriptional regulator OxyR, a member of the
                     type 2 periplasmic binding fold protein superfamily;
                     Region: PBP2_OxyR; cd08411"
                     /db_xref="CDD:176103"
     misc_feature    order(223932..223934,223941..223946,223953..223955,
                     223965..223967,223989..224003,224280..224282,
                     224289..224294,224301..224303,224310..224315,
                     224319..224324)
                     /gene="oxyR"
                     /locus_tag="Dda3937_03892"
                     /gene_synonym="momR; mor"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176103"
     gene            complement(224627..226033)
                     /gene="sthA"
                     /locus_tag="Dda3937_03893"
                     /gene_synonym="udhA"
                     /db_xref="GeneID:9731588"
     CDS             complement(224627..226033)
                     /gene="sthA"
                     /locus_tag="Dda3937_03893"
                     /gene_synonym="udhA"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide transhydrogenase"
                     /protein_id="YP_003880976.1"
                     /db_xref="GI:307128960"
                     /db_xref="ASAP:ABF-0020421"
                     /db_xref="ERIC:ABF-0020421"
                     /db_xref="GeneID:9731588"
                     /translation="MSIQQQYDYDAIVIGSGPGGEGAAMGLAKQGAKIAVIERHYNVG
                     GGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARVISSSFSDILRHADSVIGQQTRM
                     RQGFYERNHCELFSGEARFIDAHTIAVYYPDDTHDTLTAANIIIATGSRPYHPAGVDF
                     HHPRIYDSDSILDLDYEPKHVIIYGAGVIGCEYASIFRGLNVKVDLINTRDRLLAFLD
                     QEMSDALSYHFWNSGVVIRHNEEFERIEGLDDGVIIHLKSGKKMKADCLLYANGRTGN
                     TETLGLENVGLETDSRGQLKVNSMYQTAQAHIYAVGDVIGYPSLASAAYDQGRIAAQA
                     ITKGDATAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVG
                     MNVGSLKILFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYP
                     TMAEAYRVAALNGLNRLF"
     misc_feature    complement(224630..226024)
                     /gene="sthA"
                     /locus_tag="Dda3937_03893"
                     /gene_synonym="udhA"
                     /note="soluble pyridine nucleotide transhydrogenase;
                     Provisional; Region: PRK05249"
                     /db_xref="CDD:235373"
     misc_feature    complement(<225881..226006)
                     /gene="sthA"
                     /locus_tag="Dda3937_03893"
                     /gene_synonym="udhA"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(225257..225496)
                     /gene="sthA"
                     /locus_tag="Dda3937_03893"
                     /gene_synonym="udhA"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    complement(224654..224992)
                     /gene="sthA"
                     /locus_tag="Dda3937_03893"
                     /gene_synonym="udhA"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            226234..226872
                     /gene="fabR"
                     /locus_tag="Dda3937_03894"
                     /gene_synonym="yijC"
                     /db_xref="GeneID:9731589"
     CDS             226234..226872
                     /gene="fabR"
                     /locus_tag="Dda3937_03894"
                     /gene_synonym="yijC"
                     /function="FabR regulates fabA and fabB genes involved in
                     unsaturated fatty acid biosynthesis"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /note="FabR belongs to the TetR family of transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator FabR"
                     /protein_id="YP_003880977.1"
                     /db_xref="GI:307128961"
                     /db_xref="ASAP:ABF-0020422"
                     /db_xref="ERIC:ABF-0020422"
                     /db_xref="GeneID:9731589"
                     /translation="MGVRAQQKERTRRSLVEAAFSQLSAERSFASLSLREVAREAGIA
                     PTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIVKSGGSVIRTSVSTFMEFIGN
                     NPNAFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLEVENHIPRSFAEAQAEAMVI
                     IVFSAGAEALDVDIEQRRQLEERLVLQLRMIAKGAYYWYRKEQGKGFVYPEG"
     misc_feature    226234..226836
                     /gene="fabR"
                     /locus_tag="Dda3937_03894"
                     /gene_synonym="yijC"
                     /note="DNA-binding transcriptional repressor FabR;
                     Provisional; Region: PRK11202"
                     /db_xref="CDD:236881"
     misc_feature    226276..226407
                     /gene="fabR"
                     /locus_tag="Dda3937_03894"
                     /gene_synonym="yijC"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            226853..227245
                     /locus_tag="Dda3937_04435"
                     /db_xref="GeneID:9731590"
     CDS             226853..227245
                     /locus_tag="Dda3937_04435"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880978.1"
                     /db_xref="GI:307128962"
                     /db_xref="ASAP:ABF-0046849"
                     /db_xref="ERIC:ABF-0046849"
                     /db_xref="GeneID:9731590"
                     /translation="MFTLRDNQRKSHDRADKFREKHVGADAGGRFVREWFLCRRVQFY
                     RAIFHLSADCASSVGVLPASALHAPCHAKGHAAAGGRLFPVRSATLQRDCTRRVPANR
                     LQFRAVNPVRGAGAMAGGEAADSQARQW"
     gene            226887..227261
                     /gene="yijD"
                     /locus_tag="Dda3937_03895"
                     /db_xref="GeneID:9731591"
     CDS             226887..227261
                     /gene="yijD"
                     /locus_tag="Dda3937_03895"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880979.1"
                     /db_xref="GI:307128963"
                     /db_xref="ASAP:ABF-0020423"
                     /db_xref="ERIC:ABF-0020423"
                     /db_xref="GeneID:9731591"
                     /translation="MTEQINSEKSTLVLTLVAGLSANGSFVAVFSSIVPFSIFPLIAL
                     VLSVYCLHQRYMHHAMPKGTPLLAAGCFLFGLLLYSAIVRAEYPQIGSNFVPSILCVV
                     LALWLVVKLRTRKPGSGEINTP"
     misc_feature    226887..227231
                     /gene="yijD"
                     /locus_tag="Dda3937_03895"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11056"
                     /db_xref="CDD:236832"
     gene            complement(227274..228377)
                     /gene="trmA"
                     /locus_tag="Dda3937_03896"
                     /gene_synonym="rT"
                     /db_xref="GeneID:9731592"
     CDS             complement(227274..228377)
                     /gene="trmA"
                     /locus_tag="Dda3937_03896"
                     /gene_synonym="rT"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (uracil-5-)-methyltransferase"
                     /protein_id="YP_003880980.1"
                     /db_xref="GI:307128964"
                     /db_xref="ASAP:ABF-0020424"
                     /db_xref="ERIC:ABF-0020424"
                     /db_xref="GeneID:9731592"
                     /translation="MTPEILPIDQYDAQLEEKTGRLGAMMAPFDAPAPTVFRSPVSHY
                     RMRAEFRIWHDGDDLYHIIFDQQTKQRIRVDRFPAASELINRLMPALISALRAEPVLR
                     RKLFQIDYLSTLSGEIVVSLLYHKALDDEWQQCARLLRDQLHAQGFALQLIGRATKTK
                     ICLDRDYVDECLPVAGRQMIYRQVENSFTQPNAMMNIQMLEWALSATQGSTGDLLELY
                     CGNGNFSLALARNFERVLATEIAKPSVAAAQYNIAANQIDNVQIIRMAAEEFTQAMNG
                     VRQFNRLQGIDLAGYRCETIFVDPPRSGLDDDTVKLVQAYPRILYISCNPETLCANLE
                     TLSQTHRISQLALFDQFPYTHHMECGVLLEKRQ"
     misc_feature    complement(227280..228377)
                     /gene="trmA"
                     /locus_tag="Dda3937_03896"
                     /gene_synonym="rT"
                     /note="tRNA (uracil-5-)-methyltransferase; Validated;
                     Region: PRK05031"
                     /db_xref="CDD:235332"
     misc_feature    complement(227418..227741)
                     /gene="trmA"
                     /locus_tag="Dda3937_03896"
                     /gene_synonym="rT"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(227481..227483,227577..227585,
                     227658..227663,227709..227729))
                     /gene="trmA"
                     /locus_tag="Dda3937_03896"
                     /gene_synonym="rT"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            228786..230657
                     /gene="btuB"
                     /locus_tag="Dda3937_03897"
                     /gene_synonym="bfe; cer"
                     /db_xref="GeneID:9731593"
     CDS             228786..230657
                     /gene="btuB"
                     /locus_tag="Dda3937_03897"
                     /gene_synonym="bfe; cer"
                     /function="6.1 cell structure; membrane"
                     /function="4.1.B transport; Channel-type Transporters;
                     Beta barrel porins (The Outer Membrane Porin (OMP)
                     Functional Superfamily)"
                     /function="7.4 location of gene products; outer membrane"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /function="4.S.187 transport; substrate; vitamin B12"
                     /codon_start=1
                     /transl_table=11
                     /product="vitamin B12/cobalamin outer membrane
                     transporter"
                     /protein_id="YP_003880981.1"
                     /db_xref="GI:307128965"
                     /db_xref="ASAP:ABF-0020427"
                     /db_xref="ERIC:ABF-0020427"
                     /db_xref="GeneID:9731593"
                     /translation="MFTKKTTMLAAMVATAFSGWAQGSDNTQQNSNDAMVVTANRFPQ
                     PISSVLAPTTVVTRDDIDRWQSKSLTDVMRRLPGVDIGQNGGRGQLASVFIRGTESRH
                     ILVLIDGIRMASPGVTGTTDFSQIPMSIIQRIEYIRGARSAVYGSEAIGGVINIITTR
                     TQDGGVLNAGYGSHAYQQYDGSIKQHIGENTAVSLAGGYEGTHGFNVYPGSTIAGDDQ
                     KSGYRSKTFWGMVEHQFTPQLNGFVRNYGYDNLTDYNKIYSDSSSNRRYLSSRSYDTG
                     LQFQQGIYAGQLVASYQTYDDQNYDDAVGRYSNSVTRINQRSLQWGNVFSVGQGSIST
                     GVDWRDERAAAGGASAISESQSRTNTGLYLTTQQRIGQFTLEGAIRGDDNQQYGRHGT
                     WQTAAGWEFIDGYRLTGSYGTAFKAPTFSQIYNTDYNVGNISLKPEESKQWEFGVEGI
                     SGPVNWRASTYRNDINNLIEYDGTSNPASPTYFNVAKAVIKGVEFTASYDTGPVTHHA
                     TLEYLDARNAETQAVLERRAHKKAKYSIDTTVADVDWSLAWIYQGARADKKYNEFPSD
                     PVKLGGYSTWDLSAAYPVTSHLTVRARIANLFDKNYETVYGYRTAGREYYLTGSYSF"
     misc_feature    228795..230654
                     /gene="btuB"
                     /locus_tag="Dda3937_03897"
                     /gene_synonym="bfe; cer"
                     /note="vitamin B12/cobalamin outer membrane transporter;
                     Provisional; Region: btuB; PRK10641"
                     /db_xref="CDD:236730"
     misc_feature    228939..230654
                     /gene="btuB"
                     /locus_tag="Dda3937_03897"
                     /gene_synonym="bfe; cer"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(228939..228968,228996..229025,229062..229079,
                     229098..229121,229167..229199,229233..229259)
                     /gene="btuB"
                     /locus_tag="Dda3937_03897"
                     /gene_synonym="bfe; cer"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    229719..229721
                     /gene="btuB"
                     /locus_tag="Dda3937_03897"
                     /gene_synonym="bfe; cer"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            230602..231474
                     /gene="murI"
                     /locus_tag="Dda3937_03898"
                     /gene_synonym="dga; glr; mbrC"
                     /db_xref="GeneID:9731594"
     CDS             230602..231474
                     /gene="murI"
                     /locus_tag="Dda3937_03898"
                     /gene_synonym="dga; glr; mbrC"
                     /function="1.5.1.1 metabolism; building block
                     biosynthesis; amino acids; glutamate"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="YP_003880982.1"
                     /db_xref="GI:307128966"
                     /db_xref="ASAP:ABF-0020428"
                     /db_xref="ERIC:ABF-0020428"
                     /db_xref="GeneID:9731594"
                     /translation="MATELQGENTISPEAIVSDLPARPTVLVFDSGVGGLSVYDEVRK
                     LLPDLHYIYTFDNEAFPYGEKPEQFIIERVVSIVDAVEKQHPLSLVIIACNTASTISL
                     PALRARFNFPVVGVVPAVKPAAKLTRNGVVGLLATRATVQRPYTHELISRFANDCQIL
                     LLGSAELVEWGEAKLQGETVPEEVLRKILKPWLKLPEPPDTVVLGCTHFPLLSEELQQ
                     VLPDGTRLVDSGTAIARRTAWLIEHLDNPKLSTERNLAYCLSITPKVAALSPVLRRYG
                     FSALERLTLLPADE"
     misc_feature    230662..231450
                     /gene="murI"
                     /locus_tag="Dda3937_03898"
                     /gene_synonym="dga; glr; mbrC"
                     /note="glutamate racemase; Provisional; Region: PRK00865"
                     /db_xref="CDD:234851"
     gene            231820..233361
                     /locus_tag="Dda3937_04663"
                     /db_xref="GeneID:9731595"
     rRNA            231820..233361
                     /locus_tag="Dda3937_04663"
                     /product="16S ribosomal RNA"
                     /function="2.2.6 information transfer; RNA related; rRNA,
                     stable RNA"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /db_xref="ASAP:ABF-0047231"
                     /db_xref="ERIC:ABF-0047231"
                     /db_xref="GeneID:9731595"
     gene            233448..233523
                     /locus_tag="Dda3937_04672"
                     /db_xref="GeneID:9731596"
     tRNA            233448..233523
                     /locus_tag="Dda3937_04672"
                     /product="tRNA-Glu"
                     /note="anticodon TTC, Cove score 59.80"
                     /db_xref="ASAP:ABF-0047291"
                     /db_xref="ERIC:ABF-0047291"
                     /db_xref="GeneID:9731596"
     gene            233718..236625
                     /locus_tag="Dda3937_04664"
                     /db_xref="GeneID:9731597"
     rRNA            233718..236625
                     /locus_tag="Dda3937_04664"
                     /product="23S ribosomal RNA"
                     /function="2.2.6 information transfer; RNA related; rRNA,
                     stable RNA"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /db_xref="ASAP:ABF-0047232"
                     /db_xref="ERIC:ABF-0047232"
                     /db_xref="GeneID:9731597"
     gene            236732..236851
                     /locus_tag="Dda3937_04226"
                     /db_xref="GeneID:9731598"
     rRNA            236732..236851
                     /locus_tag="Dda3937_04226"
                     /product="5S ribosomal RNA"
                     /function="2.2.6 information transfer; RNA related; rRNA,
                     stable RNA"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /db_xref="ASAP:ABF-0020887"
                     /db_xref="ERIC:ABF-0020887"
                     /db_xref="GeneID:9731598"
     gene            237119..238156
                     /gene="murB"
                     /locus_tag="Dda3937_04216"
                     /db_xref="GeneID:9731599"
     CDS             237119..238156
                     /gene="murB"
                     /locus_tag="Dda3937_04216"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase,
                     FAD-binding protein"
                     /protein_id="YP_003880983.1"
                     /db_xref="GI:307128967"
                     /db_xref="ASAP:ABF-0020874"
                     /db_xref="ERIC:ABF-0020874"
                     /db_xref="GeneID:9731599"
                     /translation="MTNSVTSLKSFNSFSLPVFATEVATIADSSALLSAWQRAHQGKL
                     PVLILGGGSNVLFLDDFHGIILINRLKGIEIKENASEWMLHVGAGENWHYLVEYTLER
                     QIAGLENLALIPGCVGSAPIQNIGAYGVELKKVCAYVDMLNLRTGETVRLSAEECQFG
                     YRDSVFKHEYQDGFAIIAVGLHLSKEWKPVLEYGDLTRLDHTVVTAKQIFDAVCQMRR
                     SKLPDPEVMGNAGSFFKNPVIPAAMAEHILASYPNVPHYPQPNGEVKLAAGWLIDQCG
                     LKGYQIGQAAVHDKQALVLVNKGEATSRDVVNLARYVRNQVAEKFEVWLEPEVRFISA
                     QGEVNALEVLA"
     misc_feature    237119..238114
                     /gene="murB"
                     /locus_tag="Dda3937_04216"
                     /note="UDP-N-acetylenolpyruvoylglucosamine reductase;
                     Provisional; Region: murB; PRK00046"
                     /db_xref="CDD:234593"
     misc_feature    237185..237577
                     /gene="murB"
                     /locus_tag="Dda3937_04216"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    237737..238117
                     /gene="murB"
                     /locus_tag="Dda3937_04216"
                     /note="UDP-N-acetylenolpyruvoylglucosamine reductase,
                     C-terminal domain; Region: MurB_C; pfam02873"
                     /db_xref="CDD:251582"
     gene            238153..239112
                     /gene="birA"
                     /locus_tag="Dda3937_04217"
                     /gene_synonym="bioR; dhbB"
                     /db_xref="GeneID:9731600"
     CDS             238153..239112
                     /gene="birA"
                     /locus_tag="Dda3937_04217"
                     /gene_synonym="bioR; dhbB"
                     /function="BirA controls the expression of genes involved
                     in biotin biosynthesis"
                     /function="1.5.3.1 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; biotin"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="the corepressor for BirA is biotinyl-5'-AMP;
                     BirA is a bifunctional protein with both repressor
                     activity and biotin-holoenzyme synthetase activity"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional biotin-[acetylCoA carboxylase]
                     holoenzyme synthetase/DNA-binding protein transcriptional
                     repressor, bio-5'-AMP-binding protein"
                     /protein_id="YP_003880984.1"
                     /db_xref="GI:307128968"
                     /db_xref="ASAP:ABF-0020875"
                     /db_xref="ERIC:ABF-0020875"
                     /db_xref="GeneID:9731600"
                     /translation="MKDYTVPLKLISILSDGEFYSGEYLGELMGMSRAAINKHIQTIR
                     EWGLDVFTVTGKGYALSAPIQLLDADKIRSHIQSGNIAVLPVIDSTNQYLLDRLDSVS
                     SGDACIAEYQNAGRGRRGRTWFSPFGSNLYLSLYWRLEQGPAAAVGVSLVIGIVMAEV
                     LHHLGADGVRVKWPNDLYLNDKKLAGILVELNGRTGDAAHLVIGAGINLRMNSSGSDV
                     INQGWINLQEAGIDIDRNMLAVKLITELRTALVIYEQQGLAPFISRWNDLDNFYNRAV
                     KLIVGNREITGIDKGIDSQGALLLEQDGGIQSYIGGEISLRGW"
     misc_feature    238153..238374
                     /gene="birA"
                     /locus_tag="Dda3937_04217"
                     /gene_synonym="bioR; dhbB"
                     /note="Biotin operon repressor [Transcription]; Region:
                     BirA; COG1654"
                     /db_xref="CDD:224568"
     misc_feature    238156..239109
                     /gene="birA"
                     /locus_tag="Dda3937_04217"
                     /gene_synonym="bioR; dhbB"
                     /note="bifunctional biotin--[acetyl-CoA-carboxylase]
                     synthetase/biotin operon repressor; Provisional; Region:
                     PRK11886"
                     /db_xref="CDD:237010"
     misc_feature    238399..238776
                     /gene="birA"
                     /locus_tag="Dda3937_04217"
                     /gene_synonym="bioR; dhbB"
                     /note="Biotin/lipoate A/B protein ligase family; Region:
                     BPL_LplA_LipB; pfam03099"
                     /db_xref="CDD:251729"
     misc_feature    238969..239103
                     /gene="birA"
                     /locus_tag="Dda3937_04217"
                     /gene_synonym="bioR; dhbB"
                     /note="Biotin protein ligase C terminal domain; Region:
                     BPL_C; pfam02237"
                     /db_xref="CDD:251174"
     gene            complement(239136..240086)
                     /gene="coaA"
                     /locus_tag="Dda3937_04218"
                     /gene_synonym="panK; rts"
                     /db_xref="GeneID:9731601"
     CDS             complement(239136..240086)
                     /gene="coaA"
                     /locus_tag="Dda3937_04218"
                     /gene_synonym="panK; rts"
                     /function="1.5.3.5 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; Coenzyme
                     A"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="YP_003880985.1"
                     /db_xref="GI:307128969"
                     /db_xref="ASAP:ABF-0020876"
                     /db_xref="ERIC:ABF-0020876"
                     /db_xref="GeneID:9731601"
                     /translation="MTNKAQSFATPYLQFDRQQWAHLRDSVPLTLTEDEIIKLKGINE
                     DLSLDEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQKIPYIIGIAGSVAVGKS
                     TTARVLQALLSRWPEHRKVELITTDGFLHPNKVLQQRNLMKKKGFPQSYDMHSLVKFV
                     SEIKSGVPWVTAPTYSHLTYDIVPDCNKVIEQPDILILEGLNVLQSGMDYPHDPHRVF
                     VSDFVDFSIYVDAPEELLKSWYINRFLKFRQGAFTNPDSYFHNYAKLAEVEAVNIASQ
                     LWNEINGLNLKQNILPTRGRASLIMTKSANHAVECVRLRK"
     misc_feature    complement(239145..239819)
                     /gene="coaA"
                     /locus_tag="Dda3937_04218"
                     /gene_synonym="panK; rts"
                     /note="Pantothenate kinase (PanK) catalyzes the
                     phosphorylation of pantothenic acid to form
                     4'-phosphopantothenic, which is the first of five steps in
                     coenzyme A (CoA) biosynthetic pathway. The reaction
                     carried out by this enzyme is a key regulatory point...;
                     Region: PanK; cd02025"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(239166..239168,239178..239180,
                     239358..239360,239370..239372,239775..239786,
                     239793..239795))
                     /gene="coaA"
                     /locus_tag="Dda3937_04218"
                     /gene_synonym="panK; rts"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(239166..239168,239346..239348,
                     239358..239360,239556..239558,239769..239771,
                     239781..239786))
                     /gene="coaA"
                     /locus_tag="Dda3937_04218"
                     /gene_synonym="panK; rts"
                     /note="CoA-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(239490..239492,239781..239783))
                     /gene="coaA"
                     /locus_tag="Dda3937_04218"
                     /gene_synonym="panK; rts"
                     /note="Mg2+-binding site [ion binding]; other site"
                     /db_xref="CDD:238983"
     gene            complement(240302..240643)
                     /locus_tag="Dda3937_04219"
                     /db_xref="GeneID:9731602"
     CDS             complement(240302..240643)
                     /locus_tag="Dda3937_04219"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="histone acetyltransferase HPA2-like
                     acetyltransferase"
                     /protein_id="YP_003880986.1"
                     /db_xref="GI:307128970"
                     /db_xref="ASAP:ABF-0020877"
                     /db_xref="ERIC:ABF-0020877"
                     /db_xref="GeneID:9731602"
                     /translation="MIGSIQLELCQKSNGQNRAEVQKLLVHSSMRRQGIGKRLLSTLE
                     QAALQHRRGLIYLDTQAGSPAEHFYRAQGYRYLGELPDYASSPDGYYYPTAIYYKRLF
                     AVNRVERALAS"
     misc_feature    complement(240470..240640)
                     /locus_tag="Dda3937_04219"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(240533..240538,240566..240574))
                     /locus_tag="Dda3937_04219"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(240943..241221)
                     /locus_tag="Dda3937_04436"
                     /db_xref="GeneID:9731603"
     CDS             complement(240943..241221)
                     /locus_tag="Dda3937_04436"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880987.1"
                     /db_xref="GI:307128971"
                     /db_xref="ASAP:ABF-0046854"
                     /db_xref="ERIC:ABF-0046854"
                     /db_xref="GeneID:9731603"
                     /translation="MLRILGRGASLCNKKIAQNALSLRFCTNSDAVSHYYQSFVQISV
                     RQHVKSALRVRFSGIQTSMICRRHRHISCTKKVIMLPFVAVLSMRFGI"
     gene            241227..241302
                     /locus_tag="Dda3937_04227"
                     /db_xref="GeneID:9731604"
     tRNA            241227..241302
                     /locus_tag="Dda3937_04227"
                     /product="tRNA-Thr"
                     /note="anticodon TGT, Cove score 93.40"
                     /db_xref="ASAP:ABF-0020888"
                     /db_xref="ERIC:ABF-0020888"
                     /db_xref="GeneID:9731604"
     gene            241320..241404
                     /locus_tag="Dda3937_04228"
                     /db_xref="GeneID:9731605"
     tRNA            241320..241404
                     /locus_tag="Dda3937_04228"
                     /product="tRNA-Tyr"
                     /note="anticodon GTA, Cove score 67.63"
                     /db_xref="ASAP:ABF-0020889"
                     /db_xref="ERIC:ABF-0020889"
                     /db_xref="GeneID:9731605"
     gene            241708..241782
                     /locus_tag="Dda3937_04229"
                     /db_xref="GeneID:9731606"
     tRNA            241708..241782
                     /locus_tag="Dda3937_04229"
                     /product="tRNA-Gly"
                     /note="anticodon TCC, Cove score 63.22"
                     /db_xref="ASAP:ABF-0020890"
                     /db_xref="ERIC:ABF-0020890"
                     /db_xref="GeneID:9731606"
     gene            241792..241867
                     /locus_tag="Dda3937_04230"
                     /db_xref="GeneID:9731607"
     tRNA            241792..241867
                     /locus_tag="Dda3937_04230"
                     /product="tRNA-Thr"
                     /note="anticodon GGT, Cove score 94.75"
                     /db_xref="ASAP:ABF-0020891"
                     /db_xref="ERIC:ABF-0020891"
                     /db_xref="GeneID:9731607"
     gene            241974..243158
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /db_xref="GeneID:9731608"
     CDS             241974..243158
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="5.5.1 cell processes; adaptation to stress;
                     osmotic pressure"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="this is tufB, not tufA; based on genome context in
                     comparison to E. coli"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor Tu"
                     /protein_id="YP_003880988.1"
                     /db_xref="GI:307128972"
                     /db_xref="ASAP:ABF-0014890"
                     /db_xref="ERIC:ABF-0014890"
                     /db_xref="GeneID:9731608"
                     /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGQA
                     RAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQ
                     YDFPGDDTPVIRGSALKALEGEAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDV
                     FSISGRGTVVTGRVERGIVKVGEEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVG
                     VLLRGTKRDEVERGQVLAKPGSIKPHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNIKMVVNLIAPIAMDDGLRFAIREGGRTVGAGVVAKV
                     IA"
     misc_feature    241974..243155
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="elongation factor Tu; Reviewed; Region: PRK00049"
                     /db_xref="CDD:234596"
     misc_feature    242004..242582
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="Elongation Factor Tu (EF-Tu) GTP-binding proteins;
                     Region: EF_Tu; cd01884"
                     /db_xref="CDD:206671"
     misc_feature    242028..242051
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="G1 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    order(242031..242033,242037..242039,242049..242054,
                     242061..242063,242070..242075,242085..242087,
                     242169..242174,242226..242231,242298..242303,
                     242307..242318,242325..242327,242418..242420,
                     242430..242432,242508..242513)
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="GEF interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    order(242037..242054,242112..242114,242379..242384,
                     242388..242390,242493..242501)
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    242139..242171
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206671"
     misc_feature    242157..242159
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="G2 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    242214..242225
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="G3 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    242220..242276
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206671"
     misc_feature    242379..242390
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="G4 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    242493..242501
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="G5 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    242604..242864
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="EFTU_II: Elongation factor Tu domain II. Elongation
                     factors Tu (EF-Tu) are three-domain GTPases with an
                     essential function in the elongation phase of mRNA
                     translation. The GTPase center of EF-Tu is in the
                     N-terminal domain (domain I), also known as the...;
                     Region: EFTU_II; cd03697"
                     /db_xref="CDD:239668"
     misc_feature    242871..243140
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="Domain III of elongation factor (EF) Tu. Ef-Tu
                     consists of three structural domains, designated I, II and
                     III. Domain III adopts a beta barrel structure. Domain III
                     is involved in binding to both charged tRNA and binding to
                     elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707"
                     /db_xref="CDD:239678"
     misc_feature    order(242907..242909,242913..242921,242973..242975,
                     243093..243101,243129..243131)
                     /gene="tufB"
                     /locus_tag="Dda3937_00214"
                     /note="Antibiotic Binding Site [chemical binding]; other
                     site"
                     /db_xref="CDD:239678"
     gene            243393..243776
                     /gene="secE"
                     /locus_tag="Dda3937_00215"
                     /gene_synonym="prlG"
                     /db_xref="GeneID:9731609"
     CDS             243393..243776
                     /gene="secE"
                     /locus_tag="Dda3937_00215"
                     /gene_synonym="prlG"
                     /function="2.3.5 information transfer; protein related;
                     export, signal peptide cleavage"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.3.A.5 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The Type II (General) Secretory Pathway
                     (IISP) Family"
                     /function="6.1 cell structure; membrane"
                     /function="4.S.160 transport; substrate; protein"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase membrane subunit"
                     /protein_id="YP_003880989.1"
                     /db_xref="GI:307128973"
                     /db_xref="ASAP:ABF-0014892"
                     /db_xref="ERIC:ABF-0014892"
                     /db_xref="GeneID:9731609"
                     /translation="MSANTEAQESGRGLEALKWLVVAVLLIAAIVGNYYYREFSLPLR
                     ALAVVVLIAAAGGVALLTTKGKATVLFAREARTEVRKVIWPTRQETLHTTLIVAAVTA
                     VMSLILWGLDGILVRLVSFITGLRF"
     misc_feature    243489..243764
                     /gene="secE"
                     /locus_tag="Dda3937_00215"
                     /gene_synonym="prlG"
                     /note="preprotein translocase subunit SecE; Reviewed;
                     Region: secE; PRK05740"
                     /db_xref="CDD:235587"
     gene            243778..244323
                     /gene="nusG"
                     /locus_tag="Dda3937_00216"
                     /db_xref="GeneID:9731610"
     CDS             243778..244323
                     /gene="nusG"
                     /locus_tag="Dda3937_00216"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor"
                     /protein_id="YP_003880990.1"
                     /db_xref="GI:307128974"
                     /db_xref="ASAP:ABF-0014893"
                     /db_xref="ERIC:ABF-0014893"
                     /db_xref="GeneID:9731610"
                     /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHSMEDHFGEVMV
                     PTEEVVEIRGGQRRKSERKFFPGYVLVQMVMDDASWHLVRSVPRVMGFIGGTSDRPAP
                     ISDKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKV
                     SVSIFGRATPVELDFGQVEKG"
     misc_feature    243781..244317
                     /gene="nusG"
                     /locus_tag="Dda3937_00216"
                     /note="transcription antitermination protein NusG;
                     Validated; Region: nusG; PRK05609"
                     /db_xref="CDD:180161"
     misc_feature    243799..244122
                     /gene="nusG"
                     /locus_tag="Dda3937_00216"
                     /note="Bacterial N-Utilization Substance G (NusG)
                     N-terminal (NGN) domain, subgroup 1; Region: NGN_Bact_1;
                     cd09891"
                     /db_xref="CDD:193580"
     misc_feature    order(243808..243810,243910..243912,243970..243972,
                     243979..243981,243985..243987,244084..244086,
                     244108..244110)
                     /gene="nusG"
                     /locus_tag="Dda3937_00216"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193580"
     misc_feature    244150..244317
                     /gene="nusG"
                     /locus_tag="Dda3937_00216"
                     /note="NusG contains an NGN domain at its N-terminus and
                     KOW motif at its C-terminus; Region: KOW_NusG; cd06091"
                     /db_xref="CDD:240515"
     misc_feature    order(244186..244200,244207..244209,244243..244245,
                     244270..244278,244282..244293,244303..244308)
                     /gene="nusG"
                     /locus_tag="Dda3937_00216"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     misc_feature    244186..244197
                     /gene="nusG"
                     /locus_tag="Dda3937_00216"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     gene            244472..244900
                     /gene="rplK"
                     /locus_tag="Dda3937_00217"
                     /gene_synonym="relC"
                     /db_xref="GeneID:9731611"
     CDS             244472..244900
                     /gene="rplK"
                     /locus_tag="Dda3937_00217"
                     /gene_synonym="relC"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="YP_003880991.1"
                     /db_xref="GI:307128975"
                     /db_xref="ASAP:ABF-0014894"
                     /db_xref="ERIC:ABF-0014894"
                     /db_xref="GeneID:9731611"
                     /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNA
                     KTESLEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVT
                     HAQVLEIAQTKAADMTGADVEAMARSIAGTARSMGLVVED"
     misc_feature    244472..244897
                     /gene="rplK"
                     /locus_tag="Dda3937_00217"
                     /gene_synonym="relC"
                     /note="50S ribosomal protein L11; Validated; Region: rplK;
                     PRK00140"
                     /db_xref="CDD:234661"
     misc_feature    244496..244891
                     /gene="rplK"
                     /locus_tag="Dda3937_00217"
                     /gene_synonym="relC"
                     /note="Ribosomal protein L11. Ribosomal protein L11,
                     together with proteins L10 and L7/L12, and 23S rRNA, form
                     the L7/L12 stalk on the surface of the large subunit of
                     the ribosome. The homologous eukaryotic cytoplasmic
                     protein is also called 60S ribosomal...; Region:
                     Ribosomal_L11; cd00349"
                     /db_xref="CDD:100101"
     misc_feature    order(244499..244501,244559..244561,244694..244702,
                     244712..244714,244733..244735,244808..244810,
                     244823..244831,244841..244843,244850..244855,
                     244862..244867,244871..244879)
                     /gene="rplK"
                     /locus_tag="Dda3937_00217"
                     /gene_synonym="relC"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100101"
     misc_feature    order(244499..244501,244643..244645,244649..244660,
                     244670..244672,244676..244681,244811..244816,
                     244823..244828)
                     /gene="rplK"
                     /locus_tag="Dda3937_00217"
                     /gene_synonym="relC"
                     /note="L7/L12 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(244547..244549,244559..244561)
                     /gene="rplK"
                     /locus_tag="Dda3937_00217"
                     /gene_synonym="relC"
                     /note="putative thiostrepton binding site; other site"
                     /db_xref="CDD:100101"
     misc_feature    order(244751..244753,244760..244762)
                     /gene="rplK"
                     /locus_tag="Dda3937_00217"
                     /gene_synonym="relC"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     gene            244904..245608
                     /gene="rplA"
                     /locus_tag="Dda3937_00218"
                     /db_xref="GeneID:9731612"
     CDS             244904..245608
                     /gene="rplA"
                     /locus_tag="Dda3937_00218"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="3.1.3.1 regulation; type of regulation;
                     posttranscriptional; translation attenuation and
                     efficiency"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="YP_003880992.1"
                     /db_xref="GI:307128976"
                     /db_xref="ASAP:ABF-0014896"
                     /db_xref="ERIC:ABF-0014896"
                     /db_xref="GeneID:9731612"
                     /translation="MAKLTKRMRVIREKVDVTKQYDVNEAVALLKELATAKFVESVDV
                     AVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLAD
                     QIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQ
                     IRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPAQAKGVYIKKISLSTTM
                     GAGVAIDQSGLNAVAN"
     misc_feature    244970..245575
                     /gene="rplA"
                     /locus_tag="Dda3937_00218"
                     /note="Ribosomal protein L1.  The L1 protein, located near
                     the E-site of the ribosome, forms part of the L1 stalk
                     along with 23S rRNA.  In bacteria and archaea, L1
                     functions both as a ribosomal protein that binds rRNA, and
                     as a translation repressor that binds...; Region:
                     Ribosomal_L1; cd00403"
                     /db_xref="CDD:238235"
     misc_feature    order(245009..245017,245024..245026,245030..245032,
                     245036..245038,245042..245044,245405..245407,
                     245411..245413,245417..245419,245555..245560,
                     245564..245566)
                     /gene="rplA"
                     /locus_tag="Dda3937_00218"
                     /note="mRNA/rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238235"
     gene            245953..246450
                     /gene="rplJ"
                     /locus_tag="Dda3937_00219"
                     /gene_synonym="strA"
                     /db_xref="GeneID:9731613"
     CDS             245953..246450
                     /gene="rplJ"
                     /locus_tag="Dda3937_00219"
                     /gene_synonym="strA"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="YP_003880993.1"
                     /db_xref="GI:307128977"
                     /db_xref="ASAP:ABF-0014898"
                     /db_xref="ERIC:ABF-0014898"
                     /db_xref="GeneID:9731613"
                     /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKA
                     GREAGVYMRVVRNTLLRRVVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKA
                     NAKFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRD
                     QKEAA"
     misc_feature    245962..246435
                     /gene="rplJ"
                     /locus_tag="Dda3937_00219"
                     /gene_synonym="strA"
                     /note="Ribosomal protein L10 family, L10 subfamily;
                     composed of bacterial 50S ribosomal protein and eukaryotic
                     mitochondrial 39S ribosomal protein, L10. L10 occupies the
                     L7/L12 stalk of the ribosome. The N-terminal domain (NTD)
                     of L10 interacts with L11 protein...; Region:
                     Ribosomal_L10; cd05797"
                     /db_xref="CDD:240223"
     misc_feature    order(245974..245979,245986..245988,246118..246129,
                     246136..246138)
                     /gene="rplJ"
                     /locus_tag="Dda3937_00219"
                     /gene_synonym="strA"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240223"
     misc_feature    order(246220..246222,246289..246291,246298..246300,
                     246346..246348,246355..246360,246367..246372,
                     246376..246384,246388..246396,246400..246408,
                     246415..246420,246424..246429,246433..246435)
                     /gene="rplJ"
                     /locus_tag="Dda3937_00219"
                     /gene_synonym="strA"
                     /note="Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240223"
     gene            246517..246885
                     /gene="rplL"
                     /locus_tag="Dda3937_04437"
                     /db_xref="GeneID:9731614"
     CDS             246517..246885
                     /gene="rplL"
                     /locus_tag="Dda3937_04437"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="YP_003880994.1"
                     /db_xref="GI:307128978"
                     /db_xref="ASAP:ABF-0046855"
                     /db_xref="ERIC:ABF-0046855"
                     /db_xref="GeneID:9731614"
                     /translation="MSITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVASA
                     GPAEAAEEKTEFDVILKAVGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEAVSK
                     DDAEALKKSLEEAGAEVEVK"
     misc_feature    246523..246879
                     /gene="rplL"
                     /locus_tag="Dda3937_04437"
                     /note="Ribosomal protein L7/L12. Ribosomal protein L7/L12
                     refers to the large ribosomal subunit proteins L7 and L12,
                     which are identical except that L7 is acetylated at the N
                     terminus. It is a component of the L7/L12 stalk, which is
                     located at the surface of...; Region: Ribosomal_L7_L12;
                     cd00387"
                     /db_xref="CDD:100102"
     misc_feature    order(246523..246525,246562..246570,246577..246582,
                     246589..246591,246598..246600,246643..246645,
                     246676..246681,246742..246744,246748..246753,
                     246757..246759,246763..246768,246808..246813,
                     246817..246819,246826..246828)
                     /gene="rplL"
                     /locus_tag="Dda3937_04437"
                     /note="core dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100102"
     misc_feature    order(246532..246534,246541..246543,246553..246555,
                     246592..246594,246607..246609)
                     /gene="rplL"
                     /locus_tag="Dda3937_04437"
                     /note="peripheral dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100102"
     misc_feature    order(246574..246576,246583..246588,246598..246600,
                     246607..246609)
                     /gene="rplL"
                     /locus_tag="Dda3937_04437"
                     /note="L10 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(246715..246720,246727..246732,246739..246741,
                     246760..246765,246772..246774)
                     /gene="rplL"
                     /locus_tag="Dda3937_04437"
                     /note="L11 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(246718..246720,246730..246732,246739..246741,
                     246760..246765,246772..246774)
                     /gene="rplL"
                     /locus_tag="Dda3937_04437"
                     /note="putative EF-Tu interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(246718..246720,246727..246732,246739..246741)
                     /gene="rplL"
                     /locus_tag="Dda3937_04437"
                     /note="putative EF-G interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     gene            247206..251234
                     /gene="rpoB"
                     /locus_tag="Dda3937_00220"
                     /gene_synonym="ftsR; groN; mbrD; nitB; rif; ron; sdgB;
                     stl; stv; tabD"
                     /db_xref="GeneID:9731615"
     CDS             247206..251234
                     /gene="rpoB"
                     /locus_tag="Dda3937_00220"
                     /gene_synonym="ftsR; groN; mbrD; nitB; rif; ron; sdgB;
                     stl; stv; tabD"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase subunit beta"
                     /protein_id="YP_003880995.1"
                     /db_xref="GI:307128979"
                     /db_xref="ASAP:ABF-0014902"
                     /db_xref="ERIC:ABF-0014902"
                     /db_xref="GeneID:9731615"
                     /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPE
                     GQYGLEAAFRSVFPISSYSGNSELQYVSYRLGEPVFDVQECQIRGVTFSAPLRVKLRL
                     VIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSD
                     KGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALSYSTE
                     EILDLFFDKVVYEIHNNKLQMELVPERLRGETASFDIEADGKVYVEKGRRITARHIRQ
                     LEKDGIERIEVPVEYIAGKVLAKDYVDESTGEVIAMANMELSLDLLAKLSQAGHKRLD
                     TLFTNDLDHGPYMSETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAETLFENLFFSE
                     DRYDLSAVGRMKFNRSLLREEIEGSGILSKADIIDVMKKLIDIRNGKGEVDDIDHLGN
                     RRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGS
                     SQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEG
                     PNIGLINSLSVYAQTNEYGFLETPYRRVRDGVVTDEIHYLSAIEEGNYVIAQANTNLD
                     DEGHFIEELVTCRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMG
                     ANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKRGGTVQYVDASRIVIKVNEDE
                     MYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERGDVLADGPSTDLGELALGQ
                     NMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPN
                     VGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
                     DSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLF
                     ARIHYVLVAGGVEADKLDKLPRERWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLE
                     AKRRKITQGDDLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYD
                     ENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQ
                     RAYDLGNDVRQKVDLNTFSDEEVLRLAENLKKGMPIATPVFDGAKENEIKELLKLGDL
                     PTSGQIRLFDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGK
                     AQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMP
                     ESFNVLLKEIRSLGINIELEEE"
     misc_feature    247206..251231
                     /gene="rpoB"
                     /locus_tag="Dda3937_00220"
                     /gene_synonym="ftsR; groN; mbrD; nitB; rif; ron; sdgB;
                     stl; stv; tabD"
                     /note="DNA-directed RNA polymerase subunit beta; Reviewed;
                     Region: rpoB; PRK00405"
                     /db_xref="CDD:234749"
     misc_feature    247284..251225
                     /gene="rpoB"
                     /locus_tag="Dda3937_00220"
                     /gene_synonym="ftsR; groN; mbrD; nitB; rif; ron; sdgB;
                     stl; stv; tabD"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cd00653"
                     /db_xref="CDD:238353"
     misc_feature    order(247467..247469,249690..249692,249801..249803,
                     249807..249809,249819..249827,249831..249833)
                     /gene="rpoB"
                     /locus_tag="Dda3937_00220"
                     /gene_synonym="ftsR; groN; mbrD; nitB; rif; ron; sdgB;
                     stl; stv; tabD"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(248841..248843,248847..248855,248859..248861,
                     248868..248870,248883..248885,249165..249167,
                     249219..249227,249231..249233,249615..249626,
                     249633..249635,249639..249647,250422..250424,
                     250428..250430,250434..250436,250500..250502,
                     250506..250508,250515..250517,250524..250526,
                     250539..250541,250551..250553,250764..250766,
                     250845..250847,250869..250877,250881..250883,
                     250920..250922,250929..250937,250941..250946,
                     251007..251015,251025..251027,251031..251036,
                     251040..251042,251046..251063,251067..251084,
                     251094..251096,251163..251165,251175..251177,
                     251181..251183,251187..251192,251196..251198,
                     251202..251213,251217..251219,251223..251225)
                     /gene="rpoB"
                     /locus_tag="Dda3937_00220"
                     /gene_synonym="ftsR; groN; mbrD; nitB; rif; ron; sdgB;
                     stl; stv; tabD"
                     /note="RPB1 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    248976..249173
                     /gene="rpoB"
                     /locus_tag="Dda3937_00220"
                     /gene_synonym="ftsR; groN; mbrD; nitB; rif; ron; sdgB;
                     stl; stv; tabD"
                     /note="RNA polymerase beta subunit external 1 domain;
                     Region: RNA_pol_Rpb2_45; pfam10385"
                     /db_xref="CDD:255954"
     misc_feature    order(249291..249296,249600..249602,249606..249608,
                     249669..249671,249678..249680,250449..250451,
                     250488..250490,250569..250571,250734..250736,
                     250740..250742,250833..250835,250884..250886)
                     /gene="rpoB"
                     /locus_tag="Dda3937_00220"
                     /gene_synonym="ftsR; groN; mbrD; nitB; rif; ron; sdgB;
                     stl; stv; tabD"
                     /note="RPB10 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(249633..249635,249675..249677,250446..250448,
                     250851..250853)
                     /gene="rpoB"
                     /locus_tag="Dda3937_00220"
                     /gene_synonym="ftsR; groN; mbrD; nitB; rif; ron; sdgB;
                     stl; stv; tabD"
                     /note="RPB11 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(249675..249680,249690..249692,250368..250370,
                     250374..250376,250449..250457,250464..250466,
                     250470..250475,250848..250871,250875..250877)
                     /gene="rpoB"
                     /locus_tag="Dda3937_00220"
                     /gene_synonym="ftsR; groN; mbrD; nitB; rif; ron; sdgB;
                     stl; stv; tabD"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            251342..255565
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /db_xref="GeneID:9731616"
     CDS             251342..255565
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase, beta prime subunit"
                     /protein_id="YP_003880996.1"
                     /db_xref="GI:307128980"
                     /db_xref="ASAP:ABF-0014903"
                     /db_xref="ERIC:ABF-0014903"
                     /db_xref="GeneID:9731616"
                     /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERM
                     GHIELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQIL
                     TEEQYLDALEEFGDEFDAKMGAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLT
                     KRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLAT
                     TIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTRDCVNAKGEGMVLTGPKEAERIYRAGLASLHARVKVRITEHQKNAQGEWTQK
                     ISLIDTTVGRAILWMIVPKGLPYSIVNQALGKKAISKMLNTCYRVLGLKPTVIFADQI
                     MYTGFAYAARSGSSVGIDDMVIPAKKVEIISEAEAEVAEIQEQFQSGLVTAGERYNKV
                     IDIWAAANERVAKAMMENLSTETVINRNGEEEKQVSFNSIFMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRERVLGRVTAEDVLKPGTADI
                     LVPRNTLLNEKWCDLLEENSVDAVKVRSVVGCETDFGVCAKCYGRDLARGHIINKGEA
                     IGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSLKLTNAKFVKNVAGK
                     LVITSRNTELKLIDEFGRTKESYKVPYGAVMGKGDGSEVNGGDTVANWDPHTMPVITE
                     VGGSIRFTDMIDGQTITRQTDELTGLSSIVVLDSAERTGGGKDLRPALKIVDANGDDV
                     LIPGTDMPAQYFLPGKAIVQLEDGSQIGAGDTLARIPQESGGTKDITGGLPRVADLFE
                     ARRPKEPAILAEISGVVSFGKETKGKRRLVITPVDGSEPYEEMIPKWRQLNVFEGERV
                     ERGDVISDGPESPHDILRLRGVHAVTRYIVNEVQEVYRLQGVKINDKHIEVIVRQMLR
                     KGTIVNPGSSEFLEGEQVEMSRIKIANRQLETDGKITATYSRDLLGITKASLATESFI
                     SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRQAGEV
                     PAVAQVSADEASANLAELLNAGFGSSDDE"
     misc_feature    251384..253780
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="Largest subunit (beta') of bacterial DNA-dependent
                     RNA polymerase (RNAP), N-terminal domain; Region:
                     RNAP_beta'_N; cd01609"
                     /db_xref="CDD:259845"
     misc_feature    order(251384..251410,251414..251416,251426..251428,
                     251435..251446,251480..251482,251486..251488,
                     251537..251539,251570..251572,251627..251632,
                     251636..251647,251678..251680,251684..251686,
                     252056..252058,252068..252070,252074..252076,
                     252083..252088,252092..252094,252098..252100,
                     252107..252112,252260..252262,252320..252322,
                     252329..252334,252350..252412,252416..252418,
                     252452..252457,252464..252469,252476..252481,
                     252485..252490,252533..252535,252611..252613,
                     252623..252625,252632..252637,252641..252646,
                     252674..252679,252692..252694,252719..252727,
                     252734..252736,252746..252769,252776..252778,
                     252788..252793,252806..252808,252848..252856,
                     252863..252865,252875..252877,252890..252892,
                     253226..253231,253235..253270,253496..253498,
                     253514..253516,253532..253534,253547..253549,
                     253556..253561,253571..253573,253586..253591,
                     253610..253612,253628..253651,253655..253660,
                     253667..253672,253676..253684,253688..253696,
                     253700..253705,253733..253735,253742..253744)
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="beta and beta' interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259845"
     misc_feature    251387..255487
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="DNA-directed RNA polymerase subunit beta';
                     Provisional; Region: PRK00566"
                     /db_xref="CDD:234794"
     misc_feature    order(251465..251473,251477..251479,251534..251536,
                     251540..251542,251570..251572,251576..251578,
                     251624..251626,251759..251764,252092..252097,
                     252104..252106,252116..252133,252140..252142,
                     252149..252151,252161..252166,252173..252175,
                     252179..252190,252200..252226,252230..252235,
                     252242..252244,252275..252277,252305..252307,
                     252314..252316,252341..252346,252530..252532,
                     252536..252541)
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="beta' and sigma factor interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(251549..251551,251555..251557,251594..251596,
                     251603..251605)
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="Zn-binding [ion binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    order(251702..251704,252272..252274,252341..252343,
                     252356..252358,252377..252379,252395..252397,
                     252614..252622,252719..252721,252725..252727,
                     252731..252733,253709..253714,253721..253726)
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="active site region [active]"
                     /db_xref="CDD:259845"
     misc_feature    order(252719..252721,252725..252727,252731..252733)
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="catalytic site [active]"
                     /db_xref="CDD:259845"
     misc_feature    254060..255430
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="Largest subunit (beta') of Bacterial DNA-dependent
                     RNA polymerase (RNAP), C-terminal domain; Region:
                     RNAP_beta'_C; cd02655"
                     /db_xref="CDD:132721"
     misc_feature    order(254060..254062,254069..254074,254078..254080,
                     255422..255424)
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="Rpb1 (beta') - Rpb6 (omega) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(254090..254092,254102..254104,255362..255364,
                     255380..255382,255398..255400,255407..255412,
                     255422..255424)
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="Rpb1 (beta') - Rpb2 (beta) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(254135..254158,254246..254248)
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="G-loop; other site"
                     /db_xref="CDD:132721"
     misc_feature    order(254783..254785,255272..255274,255317..255322)
                     /gene="rpoC"
                     /locus_tag="Dda3937_00221"
                     /gene_synonym="tabD"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:132721"
     gene            255743..256000
                     /locus_tag="Dda3937_04438"
                     /db_xref="GeneID:9731617"
     CDS             255743..256000
                     /locus_tag="Dda3937_04438"
                     /function="0 unknown function"
                     /note="protein consists of two half repeats and two full
                     repeats of GDVKKRFQRFMIRFALMAKLTRWAVA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880997.1"
                     /db_xref="GI:307128981"
                     /db_xref="ASAP:ABF-0046856"
                     /db_xref="ERIC:ABF-0046856"
                     /db_xref="GeneID:9731617"
                     /translation="MIRSALMAKLTRWAVAGDVKKRFQRFMIRFALMAKLTRWAVAGD
                     VKKRFQRFMIRSALMAELTRWAVAGDVKKRFQRFFSGGEKT"
     gene            255981..257141
                     /locus_tag="Dda3937_00222"
                     /db_xref="GeneID:9731618"
     CDS             255981..257141
                     /locus_tag="Dda3937_00222"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880998.1"
                     /db_xref="GI:307128982"
                     /db_xref="ASAP:ABF-0014904"
                     /db_xref="ERIC:ABF-0014904"
                     /db_xref="GeneID:9731618"
                     /translation="MAGKRHNCAITSAWKFHKECPMRFTTTLSGIILVLLSGSAFSAG
                     EMPSGYPTPVQKVFRHWQITCNNLNDCDIRNNDPYLRVTLKREAGAQGKISLDFDLAD
                     KRQALYLDGVRFPLSQPAWQTDEEEGAFYVHTDQLDVIQQFVMAAKNAKRLSLSEHGG
                     SQGNNQEESISLNGLNAALLLADERQGRLNNLSALLQVGNGEVAQVPPVPVGQEINPA
                     YTQPPPLTNAKILINGVISAKKNLLEEEDCGLSKEARQLSEAEPLTNELALVMLNCGM
                     GAYQSSSMLFVTPRNNPQAAQLLELPRPIRPADSREEKIRWFTEADYDPESGMLYHSA
                     KGRGIADCGESAQWVFDGKTFQLVAYNYQPECNGGQPGDWPSVWAMPGYPTE"
     misc_feature    256119..257114
                     /locus_tag="Dda3937_00222"
                     /note="Protein of unknown function (DUF1176); Region:
                     DUF1176; pfam06674"
                     /db_xref="CDD:253852"
     gene            257111..257332
                     /locus_tag="Dda3937_00223"
                     /db_xref="GeneID:9731619"
     CDS             257111..257332
                     /locus_tag="Dda3937_00223"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003880999.1"
                     /db_xref="GI:307128983"
                     /db_xref="ASAP:ABF-0014905"
                     /db_xref="ERIC:ABF-0014905"
                     /db_xref="GeneID:9731619"
                     /translation="MGDAGLPDRVARHDVDSRRGFLSVHAGWEAAAPMASFGSGCISP
                     RTVTTARPPGDGQFGDVRGGTHAIVSSLY"
     gene            complement(257816..258037)
                     /locus_tag="Dda3937_04439"
                     /db_xref="GeneID:9731620"
     CDS             complement(257816..258037)
                     /locus_tag="Dda3937_04439"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881000.1"
                     /db_xref="GI:307128984"
                     /db_xref="ASAP:ABF-0046857"
                     /db_xref="ERIC:ABF-0046857"
                     /db_xref="GeneID:9731620"
                     /translation="MILSSLHLRRIIMTTRPPRHTVLPTHASILRHLCRQLLHWHWQR
                     KTRHILTQLDDDRLQDIGLKREDIQRLYR"
     misc_feature    complement(257828..257980)
                     /locus_tag="Dda3937_04439"
                     /note="Domain of unknown function (DUF1127); Region:
                     DUF1127; cl02276"
                     /db_xref="CDD:261233"
     gene            258160..259596
                     /gene="yjiR"
                     /locus_tag="Dda3937_00224"
                     /db_xref="GeneID:9731621"
     CDS             258160..259596
                     /gene="yjiR"
                     /locus_tag="Dda3937_00224"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /codon_start=1
                     /transl_table=11
                     /product="regulator"
                     /protein_id="YP_003881001.1"
                     /db_xref="GI:307128985"
                     /db_xref="ASAP:ABF-0014909"
                     /db_xref="ERIC:ABF-0014909"
                     /db_xref="GeneID:9731621"
                     /translation="MTRYQHLATLLAQRIEQGLYRGGERLPSVRMLSQEHGVSISTVQ
                     QAYYLLEQQQLIVPLPRSGYFVRSRKAEPPIPAMSKPVQRPVEVKKWSAVLELVNARL
                     DPGVISLGSSSPDLTQSTLKPLWKQLQRIGQKQMAASFVYDNLAGVPLLREQIARLMV
                     DSGCQLSADDIVVTTGCTEALAVAVRAVAHPGDIIAVESPVFHGILQILCGLDIKVIE
                     IPTDFTTGINLEALELALDQWPIKAVITVPHCNNPLGFIMPMQRKRALLTLAQRYDIA
                     IIEDDVYGELAYEYPRPVTLKSMDIDGRVLLCSSFSKTLAPGLRVGWVVPGRYLDRAL
                     HMKYTSTGSSTVCTQLAVAEFIQQGHYQPHVRRMRGIYQRNLEMFTCWVRRYFPETIC
                     VSRPKGGFVLWVEMPESFDGVQLRQQLRENKIHIAEGSLFSASGKYRHGLRMSCAMPM
                     TPEIEQVVATIGAAVERALAAGMHETTA"
     misc_feature    258160..259572
                     /gene="yjiR"
                     /locus_tag="Dda3937_00224"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    258163..258360
                     /gene="yjiR"
                     /locus_tag="Dda3937_00224"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(258163..258165,258169..258171,258238..258240,
                     258244..258249,258271..258285,258289..258294,
                     258301..258303,258331..258336,258340..258351)
                     /gene="yjiR"
                     /locus_tag="Dda3937_00224"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    258478..259548
                     /gene="yjiR"
                     /locus_tag="Dda3937_00224"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(258685..258693,258763..258765,258913..258915,
                     259006..259008,259087..259089,259093..259098,
                     259117..259119)
                     /gene="yjiR"
                     /locus_tag="Dda3937_00224"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(258694..258696,258793..258795,258985..258987,
                     259111..259119,259201..259203,259210..259212)
                     /gene="yjiR"
                     /locus_tag="Dda3937_00224"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    259096..259098
                     /gene="yjiR"
                     /locus_tag="Dda3937_00224"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(259697..260464)
                     /locus_tag="Dda3937_00225"
                     /db_xref="GeneID:9731622"
     CDS             complement(259697..260464)
                     /locus_tag="Dda3937_00225"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, molybdopterin-binding protein"
                     /protein_id="YP_003881002.1"
                     /db_xref="GI:307128986"
                     /db_xref="ASAP:ABF-0014910"
                     /db_xref="ERIC:ABF-0014910"
                     /db_xref="GeneID:9731622"
                     /translation="MSDKSPRRAPLLLEPDQKKRLVNLERRLMLRSGLTLGAVAMLTG
                     CNMQDGDSVDKVLWAMSRWNDRVQAWLFNGQRLAPSYRRDQITQPFPFNAYYPEYNVP
                     EIYLDSYRLEVAGKVEKKGVWTLEQLRQLPQETQITRLICIEGWSAVGQWRGIPLRHF
                     LQHIGADLTARYVGFKCADRYYSSIDMATALHPQTILALEFGDQALPADYGYPLRLRV
                     PTKLGFKNAKHVAALFVSDTNPGGYWEDQGYNWFSGI"
     misc_feature    complement(259700..260395)
                     /locus_tag="Dda3937_00225"
                     /note="Sulfite oxidase and related enzymes [General
                     function prediction only]; Region: COG2041"
                     /db_xref="CDD:224952"
     misc_feature    complement(259706..260236)
                     /locus_tag="Dda3937_00225"
                     /note="Sulfite oxidase (SO) family, molybdopterin binding
                     domain. This molybdopterin cofactor (Moco) binding domain
                     is found in a variety of oxidoreductases, main members of
                     this family are nitrate reductase (NR) and sulfite oxidase
                     (SO). SO catalyzes the...; Region: SO_family_Moco;
                     cl00199"
                     /db_xref="CDD:260254"
     misc_feature    complement(order(259778..259783,259787..259789,
                     259796..259798,259820..259822,259835..259837,
                     259922..259924,260039..260041,260168..260170,
                     260177..260179,260183..260185))
                     /locus_tag="Dda3937_00225"
                     /note="Moco binding site; other site"
                     /db_xref="CDD:238198"
     misc_feature    complement(260039..260041)
                     /locus_tag="Dda3937_00225"
                     /note="metal coordination site [ion binding]; other site"
                     /db_xref="CDD:238198"
     gene            complement(260457..261059)
                     /locus_tag="Dda3937_00226"
                     /db_xref="GeneID:9731623"
     CDS             complement(260457..261059)
                     /locus_tag="Dda3937_00226"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="1.6.15.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; large molecule carriers;
                     cytochromes"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiosulfate reductase cytochrome B subunit
                     (membrane anchoring protein)"
                     /protein_id="YP_003881003.1"
                     /db_xref="GI:307128987"
                     /db_xref="ASAP:ABF-0014911"
                     /db_xref="ERIC:ABF-0014911"
                     /db_xref="GeneID:9731623"
                     /translation="MPTSRRPVHPWPVRLTHWLNLLAMIGMFMSGWEIYNASPLFDFH
                     FPHAMTLGGWLGGAISWHLAVMWLLVGNGLLYVLWSLCSGHWRQRWLPLTPASLWRDI
                     RLALTFRLRHESYQYNAIQKLMYFGVITLGVLLVLSGLAIWKPVQLQGLVTVLGGFAI
                     ARYVHFFAMAGIGLFVVIHVLMVLIVPRTLWAMLTGGKHE"
     misc_feature    complement(260508..261038)
                     /locus_tag="Dda3937_00226"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cl00859"
                     /db_xref="CDD:260663"
     gene            complement(261086..261709)
                     /locus_tag="Dda3937_00227"
                     /db_xref="GeneID:9731624"
     CDS             complement(261086..261709)
                     /locus_tag="Dda3937_00227"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881004.1"
                     /db_xref="GI:307128988"
                     /db_xref="ASAP:ABF-0014912"
                     /db_xref="ERIC:ABF-0014912"
                     /db_xref="GeneID:9731624"
                     /translation="MIRHRLTGLLFSSLLLCSQWSFAADAPAKPQPPVRGTISAISNT
                     QLQLTDRKGQKIDVKLTDQTRVMSVAQANPDTIKPDSFIGTAAIPQPDGTLKALEVHV
                     FDASLRGAGEGFRPWESADGKSGTMTNGTVGKLVNSNGRTLTVTYNGGQKTVVVPDDV
                     PIVSISPGDRSLLKPGAHIVLFSKLDEQGERVAVAISAGKDGTVPPM"
     gene            261875..262546
                     /locus_tag="Dda3937_00228"
                     /db_xref="GeneID:9731625"
     CDS             261875..262546
                     /locus_tag="Dda3937_00228"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding heavy metal response regulator"
                     /protein_id="YP_003881005.1"
                     /db_xref="GI:307128989"
                     /db_xref="ASAP:ABF-0014914"
                     /db_xref="ERIC:ABF-0014914"
                     /db_xref="GeneID:9731625"
                     /translation="MRILVIEDDAGTGDYLKKGLTEAGYAVDLARNGTDGLFNALEHG
                     YDAIILDVMLPGLNGWQIIEMLRKKSDVPVLFLTARDQLHDRIHGLELGADDYLIKPF
                     SFTELVLRMRTLLRRGAVREADHYVVADLQLDVLRRKATRQDTAIPLTNKEFMLLHLL
                     VRREGEVLSRTLIASQVWDMNFDSDTNVVDVAVKRLRAKIDKPFDVKLIHTVRGIGYV
                     CEPRS"
     misc_feature    261881..262528
                     /locus_tag="Dda3937_00228"
                     /note="heavy metal response regulator; Region:
                     cztR_silR_copR; TIGR01387"
                     /db_xref="CDD:130454"
     misc_feature    261884..262219
                     /locus_tag="Dda3937_00228"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(261893..261898,262025..262027,262049..262051,
                     262106..262108,262163..262165,262172..262177)
                     /locus_tag="Dda3937_00228"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    262025..262027
                     /locus_tag="Dda3937_00228"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(262034..262039,262043..262051)
                     /locus_tag="Dda3937_00228"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    262172..262180
                     /locus_tag="Dda3937_00228"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    262250..262528
                     /locus_tag="Dda3937_00228"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(262322..262324,262379..262384,262436..262438,
                     262445..262447,262469..262474,262505..262507,
                     262520..262522)
                     /locus_tag="Dda3937_00228"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            262528..264006
                     /locus_tag="Dda3937_00229"
                     /db_xref="GeneID:9731626"
     CDS             262528..264006
                     /locus_tag="Dda3937_00229"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /function="3.1.3.2 regulation; type of regulation;
                     posttranscriptional; covalent modification,
                     demodification, maturation"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein"
                     /protein_id="YP_003881006.1"
                     /db_xref="GI:307128990"
                     /db_xref="ASAP:ABF-0014915"
                     /db_xref="ERIC:ABF-0014915"
                     /db_xref="GeneID:9731626"
                     /translation="MRAAFMKLWLQRWRASSLTLRCSLLFALTTALVVSSVGGYLYGV
                     LSQEMYRRSDVQVTGRVEYYRRLLGRNFTLPMLTANTGMFENMLGSEQDVLLFSLPGQ
                     KPLISVNPARIVLPDIAPIAVDMPLQTDAVHGSLTEQGVPLRAIAAQVRLNDGQMLQI
                     TAAHVMFSEQKMLEHYLWRVMGAVAIAFVLIGGLGYLALRRGLLPLWRMTAQASAIAP
                     NTLSTRISDADAPQEMRQLIRAFNAMLDRLNEGYLRLTQFSADLAHEIRTPIGALMGH
                     CQVALYQPRSVEEYETLLSDNIAELERMSRMVENILFLARASHEQPVLSRVSVEVATE
                     LHRVADYFEMLAEERGIELLCEGHARLAVDALLFQRALSNLVANAVRYAKADSPVRLS
                     VAVFTEQVVVEVVNLGPVLPPSQLEQLFDRFYRADATRSASSDSSGLGLSIVRAIMTL
                     HGGEVIARCDPLDETIGRITFRLIFPASRDDHTLLAKSPLSR"
     misc_feature    262576..263955
                     /locus_tag="Dda3937_00229"
                     /note="heavy metal sensor kinase; Region: cztS_silS_copS;
                     TIGR01386"
                     /db_xref="CDD:233391"
     misc_feature    263134..263277
                     /locus_tag="Dda3937_00229"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(263134..263136,263143..263148,263152..263157,
                     263164..263169,263173..263175,263224..263229,
                     263233..263238,263245..263250,263254..263259,
                     263266..263271)
                     /locus_tag="Dda3937_00229"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    263287..263475
                     /locus_tag="Dda3937_00229"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(263299..263301,263311..263313,263323..263325,
                     263332..263334,263344..263346,263353..263355,
                     263404..263406,263416..263418,263425..263427,
                     263437..263439,263446..263448,263458..263460)
                     /locus_tag="Dda3937_00229"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    263317..263319
                     /locus_tag="Dda3937_00229"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    263629..263946
                     /locus_tag="Dda3937_00229"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(263647..263649,263659..263661,263668..263670,
                     263737..263739,263743..263745,263749..263751,
                     263755..263760,263896..263898,263902..263904,
                     263917..263922,263932..263934)
                     /locus_tag="Dda3937_00229"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    263659..263661
                     /locus_tag="Dda3937_00229"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(263749..263751,263755..263757)
                     /locus_tag="Dda3937_00229"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(264020..265273)
                     /gene="thiH"
                     /locus_tag="Dda3937_00230"
                     /gene_synonym="thiA"
                     /db_xref="GeneID:9731627"
     CDS             complement(264020..265273)
                     /gene="thiH"
                     /locus_tag="Dda3937_00230"
                     /gene_synonym="thiA"
                     /function="1.5.3.8 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; thiamin"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin biosynthesis ThiGH complex subunit"
                     /protein_id="YP_003881007.1"
                     /db_xref="GI:307128991"
                     /db_xref="ASAP:ABF-0014916"
                     /db_xref="ERIC:ABF-0014916"
                     /db_xref="GeneID:9731627"
                     /translation="MDSQLIDSQSIDNQTIDGQTIDRQTMDSQTMDSQTIDGKHQPPS
                     FERHWQQLEWHDLTLRINSKTDADVERALCADRLTREDMMALLSPAAGRWLEPLAQRA
                     QQLTRQRFGNTVSFYVPLYLSNLCANDCTYCGFSMSNHLKRKTLDEQEILRECEAIKA
                     LGFDHLLLVTGEHQRKVGMDYFRQMLPLIRPQFSSLMMEVQPLSQAEYAELKTLGLDG
                     VMVYQETYHPATYARHHLRGHKQDFAWRLATPDRLGRAGIDKIGLGALIGLSDSWRTD
                     CYMVAEHLLYLQQTYWQSRYSVSFPRLRPCAGGIEPASLMDEAQLMQVICAFRLLAPD
                     VELSLSTRESPFFRDHMIPIAINNVSAFSKTQPGGYADDHPELEQFTPHDNRRPQAVA
                     DALTRAGLQPVWKDWDGYLGRPVTG"
     misc_feature    complement(264032..265144)
                     /gene="thiH"
                     /locus_tag="Dda3937_00230"
                     /gene_synonym="thiA"
                     /note="thiamine biosynthesis protein ThiH; Reviewed;
                     Region: thiH; PRK09240"
                     /db_xref="CDD:236425"
     misc_feature    complement(264293..264916)
                     /gene="thiH"
                     /locus_tag="Dda3937_00230"
                     /gene_synonym="thiA"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(264365..264370,264476..264478,
                     264608..264610,264671..264679,264758..264763,
                     264767..264769,264872..264880,264884..264886,
                     264890..264892,264896..264898))
                     /gene="thiH"
                     /locus_tag="Dda3937_00230"
                     /gene_synonym="thiA"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(264068..264385)
                     /gene="thiH"
                     /locus_tag="Dda3937_00230"
                     /gene_synonym="thiA"
                     /note="Biotin and Thiamin Synthesis associated domain;
                     Region: BATS; pfam06968"
                     /db_xref="CDD:253996"
     gene            complement(265273..266052)
                     /gene="thiG"
                     /locus_tag="Dda3937_00231"
                     /gene_synonym="thiA"
                     /db_xref="GeneID:9731628"
     CDS             complement(265273..266052)
                     /gene="thiG"
                     /locus_tag="Dda3937_00231"
                     /gene_synonym="thiA"
                     /function="1.5.3.8 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; thiamin"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin biosynthesis ThiGH complex subunit"
                     /protein_id="YP_003881008.1"
                     /db_xref="GI:307128992"
                     /db_xref="ASAP:ABF-0014917"
                     /db_xref="ERIC:ABF-0014917"
                     /db_xref="GeneID:9731628"
                     /translation="MLKIADITFTSRLLTGTGKFSSAKLMQDALHASGSQLVTLAMKR
                     VDLKSGSDAILAPLRELGVHLLPNTSGAKTAEEAVFAARLAREALGTHWVKLEIHPDM
                     KYLLPDPVETLKAAEQLVKDGFVVLPYCGADPVLCKRLEDAGCAAVMPLGAPIGSNQG
                     LQTRDFLRIIIEQARVPVVVDAGIGAPSHAAEAIELGADAVLVNTAIAVARDPVQMAH
                     AFRLAVDAGAIARQAGLGNRQRIASATSPLTGFLQHTEVAS"
     misc_feature    complement(265309..266049)
                     /gene="thiG"
                     /locus_tag="Dda3937_00231"
                     /gene_synonym="thiA"
                     /note="Thiazole synthase (ThiG) is the tetrameric enzyme
                     that is involved in the formation of the thiazole moiety
                     of thiamin pyrophosphate, an essential ubiquitous cofactor
                     that plays an important role in carbohydrate and amino
                     acid metabolism. ThiG catalyzes...; Region: ThiG; cd04728"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(265885..265887,265894..265896,
                     265930..265932))
                     /gene="thiG"
                     /locus_tag="Dda3937_00231"
                     /gene_synonym="thiA"
                     /note="ThiS interaction site; other site"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(265510..265512,265762..265764,
                     265768..265770))
                     /gene="thiG"
                     /locus_tag="Dda3937_00231"
                     /gene_synonym="thiA"
                     /note="putative active site [active]"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(265312..265314,265318..265326,
                     265330..265332,265336..265341,265345..265359,
                     265363..265368,265375..265377,265396..265398,
                     265405..265410,265417..265425,265438..265440,
                     265465..265470,265477..265479,265489..265497,
                     265537..265539,265549..265551,265567..265569,
                     265576..265584,265636..265641,265648..265656,
                     265660..265662,265729..265737,265744..265746,
                     265753..265755))
                     /gene="thiG"
                     /locus_tag="Dda3937_00231"
                     /gene_synonym="thiA"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240079"
     gene            complement(266054..266254)
                     /gene="thiS"
                     /locus_tag="Dda3937_00232"
                     /db_xref="GeneID:9731629"
     CDS             complement(266054..266254)
                     /gene="thiS"
                     /locus_tag="Dda3937_00232"
                     /function="1.5.3.8 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; thiamin"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin biosynthesis protein, sulfur donor"
                     /protein_id="YP_003881009.1"
                     /db_xref="GI:307128993"
                     /db_xref="ASAP:ABF-0014919"
                     /db_xref="ERIC:ABF-0014919"
                     /db_xref="GeneID:9731629"
                     /translation="MKIRLNDDVIELQDGLTVAQLLGQLERLQPGTALAINQTIIPRD
                     VWTQHALRDGDDILLFQAIAGG"
     misc_feature    complement(266057..266251)
                     /gene="thiS"
                     /locus_tag="Dda3937_00232"
                     /note="ThiaminS ubiquitin-like sulfur carrier protein;
                     Region: ThiS; cd00565"
                     /db_xref="CDD:176353"
     misc_feature    complement(order(266075..266083,266135..266137))
                     /gene="thiS"
                     /locus_tag="Dda3937_00232"
                     /note="thiS-thiF/thiG interaction site; other site"
                     /db_xref="CDD:176353"
     gene            complement(266251..267000)
                     /gene="thiF"
                     /locus_tag="Dda3937_00233"
                     /gene_synonym="thiA"
                     /db_xref="GeneID:9731630"
     CDS             complement(266251..267000)
                     /gene="thiF"
                     /locus_tag="Dda3937_00233"
                     /gene_synonym="thiA"
                     /function="1.5.3.8 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; thiamin"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin (thiazole moiety) biosynthesis protein"
                     /protein_id="YP_003881010.1"
                     /db_xref="GI:307128994"
                     /db_xref="ASAP:ABF-0014920"
                     /db_xref="ERIC:ABF-0014920"
                     /db_xref="GeneID:9731630"
                     /translation="MLDDQAFMRYSRQLLLEDIGQEGQQKLAAARVLLVGMGGLGSPA
                     ALYLAAAGVGTLLLADHDTLHISNLQRQILYRNADLSHPKAVLARHALEAVNPLVKTV
                     ALTTRLEGQPLEKAVAQADLVLDCCDNMTTRHAVNAACVAAQKPLISASAVGFSGQLL
                     VLTPPYTHGCYACLYPDASEPQRNCRTAGVLGPVVGVMGTLQALEAIKLLCGLPSPLD
                     GKLRLFDARQHQWSTLQLTRSPACPVCGGLA"
     misc_feature    complement(266275..267000)
                     /gene="thiF"
                     /locus_tag="Dda3937_00233"
                     /gene_synonym="thiA"
                     /note="molybdopterin biosynthesis protein MoeB;
                     Provisional; Region: PRK05690"
                     /db_xref="CDD:180204"
     misc_feature    complement(266293..266976)
                     /gene="thiF"
                     /locus_tag="Dda3937_00233"
                     /gene_synonym="thiA"
                     /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved
                     in molybdopterin and thiamine biosynthesis family. The
                     common reaction mechanism catalyzed by MoeB and ThiF, like
                     other E1 enzymes, begins with a nucleophilic attack of the
                     C-terminal carboxylate of MoaD...; Region:
                     ThiF_MoeB_HesA_family; cd00757"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(266605..266607,266623..266625,
                     266749..266751,266788..266790,266815..266817,
                     266821..266823,266881..266883,266887..266889,
                     266893..266895))
                     /gene="thiF"
                     /locus_tag="Dda3937_00233"
                     /gene_synonym="thiA"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(266296..266301,266305..266307,
                     266326..266328,266338..266340,266527..266529,
                     266533..266535,266545..266550,266602..266604,
                     266614..266622,266881..266883))
                     /gene="thiF"
                     /locus_tag="Dda3937_00233"
                     /gene_synonym="thiA"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238386"
     gene            complement(267002..267637)
                     /gene="thiE"
                     /locus_tag="Dda3937_00234"
                     /gene_synonym="thiA"
                     /db_xref="GeneID:9731631"
     CDS             complement(267002..267637)
                     /gene="thiE"
                     /locus_tag="Dda3937_00234"
                     /gene_synonym="thiA"
                     /function="1.5.3.8 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; thiamin"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin phosphate synthase"
                     /protein_id="YP_003881011.1"
                     /db_xref="GI:307128995"
                     /db_xref="ASAP:ABF-0014921"
                     /db_xref="ERIC:ABF-0014921"
                     /db_xref="GeneID:9731631"
                     /translation="MNGAFPATDARLGLYPVVDSVEWIERLLGAGVHTIQLRIKDQPA
                     DQAEPDIIRSIALGRRYQARLFINDYWQLAVKHQAYGVHLGQEDLDTADLDAIRAAGL
                     RLGVSTHDDAELARAVAIKPSYIALGHIFPTQTKAMPSAPQGLVELARHIRALDGRFP
                     TVAIGGISIDRVPAVLETGVGSIAVVSAITQAADWRAATATLLRLTEGREA"
     misc_feature    complement(267026..267598)
                     /gene="thiE"
                     /locus_tag="Dda3937_00234"
                     /gene_synonym="thiA"
                     /note="Thiamine monophosphate synthase (TMP
                     synthase)/TenI. TMP synthase catalyzes an important step
                     in the thiamine biosynthesis pathway, the substitution of
                     the pyrophosphate of 2-methyl-4-amino-5-
                     hydroxymethylpyrimidine pyrophosphate by 4-methyl-5-;
                     Region: TMP_TenI; cd00564"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(267077..267088,267140..267142,
                     267152..267154,267233..267235,267239..267241,
                     267260..267262,267266..267268,267317..267319,
                     267389..267391,267524..267526,267530..267532,
                     267587..267589,267593..267595))
                     /gene="thiE"
                     /locus_tag="Dda3937_00234"
                     /gene_synonym="thiA"
                     /note="thiamine phosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(267077..267082,267140..267142,
                     267230..267235,267239..267241,267317..267319,
                     267374..267376,267431..267436,267518..267520,
                     267524..267526,267530..267532))
                     /gene="thiE"
                     /locus_tag="Dda3937_00234"
                     /gene_synonym="thiA"
                     /note="active site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(267230..267232,267317..267319,
                     267374..267376,267383..267385,267431..267436,
                     267518..267520,267524..267526))
                     /gene="thiE"
                     /locus_tag="Dda3937_00234"
                     /gene_synonym="thiA"
                     /note="pyrophosphate binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238317"
     gene            complement(267637..269604)
                     /gene="thiC"
                     /locus_tag="Dda3937_00235"
                     /db_xref="GeneID:9731632"
     CDS             complement(267637..269604)
                     /gene="thiC"
                     /locus_tag="Dda3937_00235"
                     /function="1.5.3.8 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; thiamin"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin (pyrimidine moiety) biosynthesis
                     protein"
                     /protein_id="YP_003881012.1"
                     /db_xref="GI:307128996"
                     /db_xref="ASAP:ABF-0014922"
                     /db_xref="ERIC:ABF-0014922"
                     /db_xref="GeneID:9731632"
                     /translation="MSTEPTQSTEQNVSGEKKSSGRREQRAAAQQFIDTLRGSTFPNS
                     QRIYLTGSQPDIRVPMREIQLSPTLLGGSRDNPRYEANEAVPVYDTAGPYGDPAITPD
                     VHRGLGKLRADWITGRDDTEALPKASSGFTQQRLADIGLDHLRFEHLPQPKRAKAGRR
                     VTQLHYARQGIITPEMEFIAIRENMGRERVRGEVLRQQHPGHSFGALLPDNITPEFVR
                     QEVAAGRAIIPANINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWATRW
                     GADTVMDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGIAENLTWELFRDTLL
                     EQAEQGVDYFTIHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFRD
                     ICDICSAYDVALSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPG
                     HVPMQMIRRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLC
                     YVTPKEHLGLPNKNDVKQGLIAYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQ
                     FNLALDPETARAYHDETLPQESGKVAHFCSMCGPKFCSMKITQEVRDYAARQGAQAQP
                     VDVGMAQMSAEFRARGSELYHTATSLPQEER"
     misc_feature    complement(267664..269538)
                     /gene="thiC"
                     /locus_tag="Dda3937_00235"
                     /note="thiamine biosynthesis protein ThiC; Provisional;
                     Region: PRK09284"
                     /db_xref="CDD:236451"
     misc_feature    complement(269236..269484)
                     /gene="thiC"
                     /locus_tag="Dda3937_00235"
                     /note="ThiC-associated domain; Region: ThiC-associated;
                     pfam13667"
                     /db_xref="CDD:257973"
     misc_feature    complement(267769..269121)
                     /gene="thiC"
                     /locus_tag="Dda3937_00235"
                     /note="ThiC family; Region: ThiC; pfam01964"
                     /db_xref="CDD:250998"
     gene            complement(269940..270389)
                     /gene="rsd"
                     /locus_tag="Dda3937_00236"
                     /gene_synonym="yjaE"
                     /db_xref="GeneID:9731633"
     CDS             complement(269940..270389)
                     /gene="rsd"
                     /locus_tag="Dda3937_00236"
                     /gene_synonym="yjaE"
                     /function="3.1.2.1 regulation; type of regulation;
                     transcriptional level; sigma factors, anti-sigmafactors"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.3.3 regulation; genetic unit regulated;
                     stimulon"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="Rsd sequesters sigma70 and is responsible for
                     replacement of the RNA polymerase sigma subunit from
                     sigma70 to sigmaS during the transition from exponential
                     growth to the stationary phase"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma D"
                     /protein_id="YP_003881013.1"
                     /db_xref="GI:307128997"
                     /db_xref="ASAP:ABF-0014923"
                     /db_xref="ERIC:ABF-0014923"
                     /db_xref="GeneID:9731633"
                     /translation="MLKQLQRLTENVGGNYALIDQWLLARKHLLLAYYHLLSIQTGKI
                     PEARTLDEFCHHLVDYLSVGHFHVYERMLQENIMRNDRKLTQASHFDVALRSNTQQIM
                     DIYDSHLAFFIDPVDSQEFRQTLSGVGEALAMRFTLEDSLIRLMFDH"
     misc_feature    complement(269943..270389)
                     /gene="rsd"
                     /locus_tag="Dda3937_00236"
                     /gene_synonym="yjaE"
                     /note="Regulator of RNA polymerase sigma(70) subunit,
                     Rsd/AlgQ; Region: Rsd_AlgQ; cl11478"
                     /db_xref="CDD:264391"
     gene            270493..271266
                     /gene="nudC"
                     /locus_tag="Dda3937_00237"
                     /gene_synonym="yjaD"
                     /db_xref="GeneID:9731634"
     CDS             270493..271266
                     /gene="nudC"
                     /locus_tag="Dda3937_00237"
                     /gene_synonym="yjaD"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH pyrophosphatase"
                     /protein_id="YP_003881014.1"
                     /db_xref="GI:307128998"
                     /db_xref="ASAP:ABF-0014924"
                     /db_xref="ERIC:ABF-0014924"
                     /db_xref="GeneID:9731634"
                     /translation="MEVTLKGEESGWWVVYHHHQIWLPQGELPQGTAAQWQLQRQSAR
                     QVGEWQGEPVWLVLQDKTSDMGSVRQLLGQDAGLFQLAGRAVQLAEFYRSHRFCGYCG
                     HEMSASTTELACLCLHCKERYYPQIAPCVIVAIRRHDKILLAQHLRHKGNMYTTLAGF
                     VEVGETLEQAVAREVMEESNIRVRNLRYVSSQPWPFPHSLMMAFMADYDGGEVKPDPS
                     ELRDADWFRYDRLPELPPPGTVARRLIEDTVVLCREADC"
     misc_feature    270493..271248
                     /gene="nudC"
                     /locus_tag="Dda3937_00237"
                     /gene_synonym="yjaD"
                     /note="NADH pyrophosphatase; Reviewed; Region: nudC;
                     PRK00241"
                     /db_xref="CDD:234699"
     misc_feature    270520..270765
                     /gene="nudC"
                     /locus_tag="Dda3937_00237"
                     /gene_synonym="yjaD"
                     /note="NADH pyrophosphatase-like rudimentary NUDIX domain;
                     Region: NUDIX-like; pfam09296"
                     /db_xref="CDD:255270"
     misc_feature    270769..270864
                     /gene="nudC"
                     /locus_tag="Dda3937_00237"
                     /gene_synonym="yjaD"
                     /note="NADH pyrophosphatase zinc ribbon domain; Region:
                     zf-NADH-PPase; pfam09297"
                     /db_xref="CDD:255271"
     misc_feature    270877..271239
                     /gene="nudC"
                     /locus_tag="Dda3937_00237"
                     /gene_synonym="yjaD"
                     /note="NADH pyrophosphatase, a member of the Nudix
                     hydrolase superfamily, catalyzes the cleavage of NADH into
                     reduced nicotinamide mononucleotide (NMNH) and AMP. Like
                     other members of the Nudix family, it requires a divalent
                     cation, such as Mg2+ or Mn2+, for...; Region:
                     NADH_pyrophosphatase; cd03429"
                     /db_xref="CDD:239521"
     misc_feature    order(270880..270882,270964..270972,271072..271074,
                     271081..271083,271087..271089,271093..271095)
                     /gene="nudC"
                     /locus_tag="Dda3937_00237"
                     /gene_synonym="yjaD"
                     /note="putative NADH binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239521"
     misc_feature    order(270967..270972,270976..270978,271012..271014,
                     271021..271026,271072..271074,271081..271083,
                     271087..271089,271093..271095)
                     /gene="nudC"
                     /locus_tag="Dda3937_00237"
                     /gene_synonym="yjaD"
                     /note="putative active site [active]"
                     /db_xref="CDD:239521"
     misc_feature    270967..271035
                     /gene="nudC"
                     /locus_tag="Dda3937_00237"
                     /gene_synonym="yjaD"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239521"
     misc_feature    order(271012..271014,271021..271026,271147..271149)
                     /gene="nudC"
                     /locus_tag="Dda3937_00237"
                     /gene_synonym="yjaD"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239521"
     gene            271322..272395
                     /gene="hemE"
                     /locus_tag="Dda3937_00238"
                     /db_xref="GeneID:9731635"
     CDS             271322..272395
                     /gene="hemE"
                     /locus_tag="Dda3937_00238"
                     /function="1.5.3.12 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; heme,
                     porphyrine"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="YP_003881015.1"
                     /db_xref="GI:307128999"
                     /db_xref="ASAP:ABF-0014926"
                     /db_xref="ERIC:ABF-0014926"
                     /db_xref="GeneID:9731635"
                     /translation="MTDLKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYRATRSQAG
                     DFMSLCKNAELACEVTLQPLRRYNLDAAILFSDILTVPDAMGLGLYFEAGEGPRFTSP
                     VTCHADVEKLPVPDPEQELGYVMNAVRTIRRNLAGAVPLIGFSGSPWTLATYMVEGGS
                     SKAFTVIKKMMFAEPRTLHLLLDKLADSVTLYLNAQIRAGAQAVMIFDTWGGALSGAD
                     YREFSLHYMHKIVDGLLRENDGRRVPVTLFTKGGGQWLEAMADTGCDALGLDWTTDIA
                     DARRRVGDRVALQGNMDPSMLYAPPARIEQEVATILAGFGAGNGHVFNLGHGIHQDVP
                     PEHAGAFVEAVHRLSAPYHQDLA"
     misc_feature    271349..272362
                     /gene="hemE"
                     /locus_tag="Dda3937_00238"
                     /note="Uroporphyrinogen decarboxylase (URO-D) is a dimeric
                     cytosolic enzyme that decarboxylates the four acetate side
                     chains of uroporphyrinogen III (uro-III) to create
                     coproporphyrinogen III, without requiring any prosthetic
                     groups or cofactors. This reaction...; Region: URO-D;
                     cd00717"
                     /db_xref="CDD:238368"
     misc_feature    order(271397..271414,271427..271429,271439..271441,
                     271457..271459,271538..271558,271592..271594,
                     271607..271609,271751..271753,271781..271783,
                     271799..271801,271940..271942,271946..271951,
                     272063..272065,272300..272302)
                     /gene="hemE"
                     /locus_tag="Dda3937_00238"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238368"
     misc_feature    order(271400..271402,271412..271414,271550..271552,
                     271781..271783,271946..271948,272300..272302)
                     /gene="hemE"
                     /locus_tag="Dda3937_00238"
                     /note="active site"
                     /db_xref="CDD:238368"
     gene            272395..273069
                     /gene="nfi"
                     /locus_tag="Dda3937_00239"
                     /db_xref="GeneID:9731636"
     CDS             272395..273069
                     /gene="nfi"
                     /locus_tag="Dda3937_00239"
                     /function="1.2.2 metabolism; macromolecule degradation;
                     DNA"
                     /function="2.1.5 information transfer; DNA related; DNA
                     degradation"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="YP_003881016.1"
                     /db_xref="GI:307129000"
                     /db_xref="ASAP:ABF-0014928"
                     /db_xref="ERIC:ABF-0014928"
                     /db_xref="GeneID:9731636"
                     /translation="MDMQALREEQRDKAVQVIRHDDVPFEQPTLIAGADVGFEQDGAV
                     TRAALAVLTYPSLQLVEYQIARIPTIMPYIPGFLSFREYPALLAAWEQLQHRPDLLFV
                     DGHGVSHPRRLGVASHFGLLVNVPTIGVAKRRLCGQFAPLEDAVGSRQPLLDKDEQIG
                     WVWRSKARCNPLFVSTGHRIGVDSALQWVMRCMNGYRLPEPTRWADAVASNRPAFQRW
                     QRQAGL"
     misc_feature    272404..273012
                     /gene="nfi"
                     /locus_tag="Dda3937_00239"
                     /note="Endonuclease_V, a DNA repair enzyme that initiates
                     repair of nitrosative deaminated purine bases; Region:
                     Endonuclease_V; cd06559"
                     /db_xref="CDD:143472"
     misc_feature    order(272497..272499,272503..272508,272611..272613,
                     272617..272628,272701..272709,272719..272721,
                     272734..272739,272785..272799,273010..273012)
                     /gene="nfi"
                     /locus_tag="Dda3937_00239"
                     /note="Active_site [active]"
                     /db_xref="CDD:143472"
     gene            273161..273751
                     /gene="yjaG"
                     /locus_tag="Dda3937_00240"
                     /db_xref="GeneID:9731637"
     CDS             273161..273751
                     /gene="yjaG"
                     /locus_tag="Dda3937_00240"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881017.1"
                     /db_xref="GI:307129001"
                     /db_xref="ASAP:ABF-0014929"
                     /db_xref="ERIC:ABF-0014929"
                     /db_xref="GeneID:9731637"
                     /translation="MLRNPIHLRLEKLTSWQHVTFMACLCERMYPNYHEFCQQTGFGD
                     AQLYRRMLDLVWETLVVKDAKVNFDSQLEKLEDAIPAADDYDIYGVYPAIDACVALSE
                     LLHSRLSGETLEHAITISEMSIRTVAMLEMTQAGREMTDEELKVVPAVEEEWDIQWEI
                     FRLLADCEERDVELIKGLRADLRESGISNIGINLYQ"
     misc_feature    273161..273742
                     /gene="yjaG"
                     /locus_tag="Dda3937_00240"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3068"
                     /db_xref="CDD:225610"
     gene            273939..274211
                     /gene="hupA"
                     /locus_tag="Dda3937_00241"
                     /db_xref="GeneID:9731638"
     CDS             273939..274211
                     /gene="hupA"
                     /locus_tag="Dda3937_00241"
                     /function="3.1.1.1 regulation; type of regulation; DNA
                     structure level; DNA bending, supercoiling, inversion"
                     /function="2.3.7 information transfer; protein related;
                     nucleoproteins, basic proteins"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="3.1.3.1 regulation; type of regulation;
                     posttranscriptional; translation attenuation and
                     efficiency"
                     /codon_start=1
                     /transl_table=11
                     /product="HU, DNA-binding transcriptional regulator
                     subunit alpha"
                     /protein_id="YP_003881018.1"
                     /db_xref="GI:307129002"
                     /db_xref="ASAP:ABF-0014930"
                     /db_xref="ERIC:ABF-0014930"
                     /db_xref="GeneID:9731638"
                     /translation="MNKTQLIDVIADKADLSKTQAKAALEATLAAITESLKEGDAVQL
                     VGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
     misc_feature    273942..274199
                     /gene="hupA"
                     /locus_tag="Dda3937_00241"
                     /note="histone-like DNA-binding protein HU; Region: HU;
                     cd13831"
                     /db_xref="CDD:259853"
     misc_feature    order(273954..273956,273963..273968,273975..273977,
                     274002..274013,274017..274025,274029..274037,
                     274041..274046,274056..274070,274077..274079,
                     274161..274169,274173..274175,274179..274181,
                     274191..274196)
                     /gene="hupA"
                     /locus_tag="Dda3937_00241"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259853"
     misc_feature    order(274095..274097,274101..274106,274110..274112,
                     274116..274127,274140..274145,274149..274151)
                     /gene="hupA"
                     /locus_tag="Dda3937_00241"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259853"
     gene            274216..274926
                     /gene="yjaH"
                     /locus_tag="Dda3937_00242"
                     /db_xref="GeneID:9731639"
     CDS             274216..274926
                     /gene="yjaH"
                     /locus_tag="Dda3937_00242"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881019.1"
                     /db_xref="GI:307129003"
                     /db_xref="ASAP:ABF-0014931"
                     /db_xref="ERIC:ABF-0014931"
                     /db_xref="GeneID:9731639"
                     /translation="MLIQGLSRGAISPLLLFFRRHIRFAAPALVCWLSACSSSTPSPA
                     VYASGYLADSGVVRLWRKDDAPQHLTTLVTALSPLQGQDARITRYRFQQGVLREVQQT
                     YSASAREEVRLRFDQAGTVSYMQRQLPDRRESLSEDEIALFQFDARRLLELSDSLRAG
                     KVSLMQGRWNAGQVITCDGQTVRPDLDRASLAWIAQRAERATGPLSVAWLVSPEGTQL
                     LQVAEADFCRWVPTVEAW"
     misc_feature    274354..274911
                     /gene="yjaH"
                     /locus_tag="Dda3937_00242"
                     /note="Protein of unknown function (DUF1481); Region:
                     DUF1481; pfam07356"
                     /db_xref="CDD:148775"
     gene            complement(275011..276300)
                     /gene="purD"
                     /locus_tag="Dda3937_00243"
                     /gene_synonym="adtha"
                     /db_xref="GeneID:9731640"
     CDS             complement(275011..276300)
                     /gene="purD"
                     /locus_tag="Dda3937_00243"
                     /gene_synonym="adtha"
                     /function="1.5.2.1 metabolism; building block
                     biosynthesis; nucleotide; purine biosynthesis"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycinamide synthetase
                     phosphoribosylamine-glycine ligase"
                     /protein_id="YP_003881020.1"
                     /db_xref="GI:307129004"
                     /db_xref="ASAP:ABF-0014932"
                     /db_xref="ERIC:ABF-0014932"
                     /db_xref="GeneID:9731640"
                     /translation="MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEPALE
                     NVNIAATDIPALLDFARQNTIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLE
                     GSKAFTKDFLARQHIPTAEYQNFTEIEPALAYIRRKGAPIVIKADGLAAGKGVIVAMT
                     LEEAENAATDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGEHVLPMATSQDHKRV
                     GDKDTGPNTGGMGAYSPAPVVTDEVHQRVMDQIIWPTVRGMAAEGNVYTGFLYAGLMI
                     SADGQPKVIEFNCRFGDPETQPIMLRLKSDLVELCLAACDGKLDEKTSDWDARPSLGV
                     VLAAGGYPADYRNGDVISGLPTQDATDGKVFHAGTRLNGDDVVTNGGRVLCVTALGHS
                     VAEAQQRAYELAKPISWEGSFCRSDIGYRAIAREQKI"
     misc_feature    complement(275026..276300)
                     /gene="purD"
                     /locus_tag="Dda3937_00243"
                     /gene_synonym="adtha"
                     /note="phosphoribosylamine--glycine ligase; Provisional;
                     Region: PRK00885"
                     /db_xref="CDD:234856"
     misc_feature    complement(275995..276297)
                     /gene="purD"
                     /locus_tag="Dda3937_00243"
                     /gene_synonym="adtha"
                     /note="Phosphoribosylglycinamide synthetase, N domain;
                     Region: GARS_N; pfam02844"
                     /db_xref="CDD:251569"
     misc_feature    complement(275413..275994)
                     /gene="purD"
                     /locus_tag="Dda3937_00243"
                     /gene_synonym="adtha"
                     /note="Phosphoribosylglycinamide synthetase, ATP-grasp (A)
                     domain; Region: GARS_A; pfam01071"
                     /db_xref="CDD:250341"
     misc_feature    complement(275032..275313)
                     /gene="purD"
                     /locus_tag="Dda3937_00243"
                     /gene_synonym="adtha"
                     /note="Phosphoribosylglycinamide synthetase, C domain;
                     Region: GARS_C; pfam02843"
                     /db_xref="CDD:251568"
     gene            complement(276316..277905)
                     /gene="purH"
                     /locus_tag="Dda3937_00244"
                     /db_xref="GeneID:9731641"
     CDS             complement(276316..277905)
                     /gene="purH"
                     /locus_tag="Dda3937_00244"
                     /function="1.5.2.1 metabolism; building block
                     biosynthesis; nucleotide; purine biosynthesis"
                     /function="1.7.33 metabolism; central intermediary
                     metabolism; nucleotide and nucleoside conversions"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /protein_id="YP_003881021.1"
                     /db_xref="GI:307129005"
                     /db_xref="ASAP:ABF-0014933"
                     /db_xref="ERIC:ABF-0014933"
                     /db_xref="GeneID:9731641"
                     /translation="MQQRRPIRRALLSVSDKAGIVEFAQALSQRGIDLLSTGGTARLL
                     ADAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDAIMTQHNIQPIDMVV
                     VNLYPFAQTVAKADCTLEDAVENIDIGGPTMVRSAAKNHNDVAIVVKSSDYTAIITEM
                     DANEGSLTYETRFDLAIKAFEHTAAYDSMIANYFGSKVPAYHGDTTQPSGHFPRTLNL
                     NFIKKQDMRYGENSHQQAAFYIEEKVAEASVATAQQLQGKALSYNNIADTDAALECVK
                     EFVEPACVIVKHANPCGVAIGDSILDAYERAYKTDPTSAFGGIIAFNRELDEATAQAI
                     ISRQFVEVIIAPSASEAALKVTAAKQNVRVLTCGQWQQRVSGLDFKRVNGGLLVQDRD
                     LGMVEAAQLRVVTERQPTEAELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSR
                     VYSAKIAGIKAGDEGLEVKGSVMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEV
                     IAAANEHGIAMLFTDMRHFRH"
     misc_feature    complement(276319..277896)
                     /gene="purH"
                     /locus_tag="Dda3937_00244"
                     /note="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase; Provisional; Region:
                     purH; PRK00881"
                     /db_xref="CDD:234854"
     misc_feature    complement(277324..277884)
                     /gene="purH"
                     /locus_tag="Dda3937_00244"
                     /note="Inosine monophosphate cyclohydrolase domain. This
                     is the N-terminal domain in the purine biosynthesis
                     pathway protein ATIC (purH). The bifunctional ATIC protein
                     contains a C-terminal  ATIC formylase domain that
                     formylates...; Region: IMPCH; cd01421"
                     /db_xref="CDD:238709"
     misc_feature    complement(order(277525..277527,277594..277596,
                     277696..277701,277786..277788,277795..277797,
                     277855..277857,277861..277863))
                     /gene="purH"
                     /locus_tag="Dda3937_00244"
                     /note="purine monophosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    complement(order(277324..277326,277333..277338,
                     277342..277350,277372..277380,277387..277389,
                     277489..277491,277498..277503,277513..277515,
                     277522..277530,277666..277668,277675..277680,
                     277687..277695,277702..277707,277714..277719,
                     277726..277728))
                     /gene="purH"
                     /locus_tag="Dda3937_00244"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238709"
     misc_feature    complement(order(277525..277527,277699..277701))
                     /gene="purH"
                     /locus_tag="Dda3937_00244"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:238709"
     misc_feature    complement(276523..277497)
                     /gene="purH"
                     /locus_tag="Dda3937_00244"
                     /note="AICARFT/IMPCHase bienzyme; Region: AICARFT_IMPCHas;
                     smart00798"
                     /db_xref="CDD:214822"
     gene            278066..278443
                     /locus_tag="Dda3937_04440"
                     /db_xref="GeneID:9731642"
     CDS             278066..278443
                     /locus_tag="Dda3937_04440"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881022.1"
                     /db_xref="GI:307129006"
                     /db_xref="ASAP:ABF-0046858"
                     /db_xref="ERIC:ABF-0046858"
                     /db_xref="GeneID:9731642"
                     /translation="MMLAKFQKMPRLWITLCKIRYKRRFCCGMQRTRDLIKNTGCGLR
                     GTPYNAHPLTRQQRKRGAVSGGKNEKKVVDSAGGKRSIRHLATAGCKPVAPLFNNQSD
                     NLCGHSQDTSLKNYVKVLKSDNS"
     gene            278505..280046
                     /locus_tag="Dda3937_04665"
                     /db_xref="GeneID:9731643"
     rRNA            278505..280046
                     /locus_tag="Dda3937_04665"
                     /product="16S ribosomal RNA"
                     /function="2.2.6 information transfer; RNA related; rRNA,
                     stable RNA"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /db_xref="ASAP:ABF-0047234"
                     /db_xref="ERIC:ABF-0047234"
                     /db_xref="GeneID:9731643"
     gene            280117..280193
                     /locus_tag="Dda3937_04247"
                     /db_xref="GeneID:9731644"
     tRNA            280117..280193
                     /locus_tag="Dda3937_04247"
                     /product="tRNA-Ile"
                     /note="anticodon GAT, Cove score 88.37"
                     /db_xref="ASAP:ABF-0020908"
                     /db_xref="ERIC:ABF-0020908"
                     /db_xref="GeneID:9731644"
     gene            280298..280373
                     /locus_tag="Dda3937_04248"
                     /db_xref="GeneID:9731645"
     tRNA            280298..280373
                     /locus_tag="Dda3937_04248"
                     /product="tRNA-Ala"
                     /note="anticodon TGC, Cove score 88.77"
                     /db_xref="ASAP:ABF-0020909"
                     /db_xref="ERIC:ABF-0020909"
                     /db_xref="GeneID:9731645"
     gene            280542..283449
                     /locus_tag="Dda3937_04222"
                     /db_xref="GeneID:9731646"
     rRNA            280542..283449
                     /locus_tag="Dda3937_04222"
                     /product="23S ribosomal RNA"
                     /function="2.2.6 information transfer; RNA related; rRNA,
                     stable RNA"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /db_xref="ASAP:ABF-0020880"
                     /db_xref="ERIC:ABF-0020880"
                     /db_xref="GeneID:9731646"
     gene            283556..283675
                     /locus_tag="Dda3937_04223"
                     /db_xref="GeneID:9731647"
     rRNA            283556..283675
                     /locus_tag="Dda3937_04223"
                     /product="5S ribosomal RNA"
                     /function="2.2.6 information transfer; RNA related; rRNA,
                     stable RNA"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /db_xref="ASAP:ABF-0020881"
                     /db_xref="ERIC:ABF-0020881"
                     /db_xref="GeneID:9731647"
     gene            complement(283931..284167)
                     /locus_tag="Dda3937_04441"
                     /db_xref="GeneID:9731648"
     CDS             complement(283931..284167)
                     /locus_tag="Dda3937_04441"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobB"
                     /protein_id="YP_003881023.1"
                     /db_xref="GI:307129007"
                     /db_xref="ASAP:ABF-0046863"
                     /db_xref="ERIC:ABF-0046863"
                     /db_xref="GeneID:9731648"
                     /translation="MHWDQHAKDFKHEPVDKILLYRHGPGGDIAALIDADTLAVATDT
                     ALTLALPCLDLNQPAQIAVFIRDWLRRRTGAAGD"
     misc_feature    complement(283955..>284140)
                     /locus_tag="Dda3937_04441"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            complement(284244..285005)
                     /gene="yhdZ"
                     /locus_tag="Dda3937_01575"
                     /gene_synonym="aapP"
                     /db_xref="GeneID:9731649"
     CDS             complement(284244..285005)
                     /gene="yhdZ"
                     /locus_tag="Dda3937_01575"
                     /gene_synonym="aapP"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="4.S.12 transport; substrate; amino acid"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881024.1"
                     /db_xref="GI:307129008"
                     /db_xref="ASAP:ABF-0017006"
                     /db_xref="ERIC:ABF-0017006"
                     /db_xref="GeneID:9731649"
                     /translation="MNQDTLTSSSDYMITLENVNKWYGQFHVLKNINLQVKQGERIVL
                     CGPSGSGKSTTIRCINHLEEHQQGRIVVDGIELNHDSRNIEKIRTEVGMVFQHFNLFP
                     HLTVLQNCTLAPSWVRNMPKKEAEELAMHYLERVRIAAHAHKYPGQLSGGQQQRVAIA
                     RSLCMKPKIMLFDEPTSALDPEMVKEVLDTMLGLAEDGMTMLCVTHEMGFARTVANRV
                     IFMDQGEIVEQAPPDIFFSRPRSERTQTFLAQILH"
     misc_feature    complement(284250..284969)
                     /gene="yhdZ"
                     /locus_tag="Dda3937_01575"
                     /gene_synonym="aapP"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    complement(284328..284966)
                     /gene="yhdZ"
                     /locus_tag="Dda3937_01575"
                     /gene_synonym="aapP"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    complement(284847..284870)
                     /gene="yhdZ"
                     /locus_tag="Dda3937_01575"
                     /gene_synonym="aapP"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(order(284388..284390,284484..284489,
                     284718..284720,284844..284852,284856..284861))
                     /gene="yhdZ"
                     /locus_tag="Dda3937_01575"
                     /gene_synonym="aapP"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(284718..284729)
                     /gene="yhdZ"
                     /locus_tag="Dda3937_01575"
                     /gene_synonym="aapP"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(284532..284561)
                     /gene="yhdZ"
                     /locus_tag="Dda3937_01575"
                     /gene_synonym="aapP"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(284484..284501)
                     /gene="yhdZ"
                     /locus_tag="Dda3937_01575"
                     /gene_synonym="aapP"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(284466..284477)
                     /gene="yhdZ"
                     /locus_tag="Dda3937_01575"
                     /gene_synonym="aapP"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(284382..284402)
                     /gene="yhdZ"
                     /locus_tag="Dda3937_01575"
                     /gene_synonym="aapP"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            complement(285014..286108)
                     /gene="yhdY"
                     /locus_tag="Dda3937_01576"
                     /gene_synonym="aapM"
                     /db_xref="GeneID:9731650"
     CDS             complement(285014..286108)
                     /gene="yhdY"
                     /locus_tag="Dda3937_01576"
                     /gene_synonym="aapM"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.12 transport; substrate; amino acid"
                     /codon_start=1
                     /transl_table=11
                     /product="amino-acid ABC transporter membrane protein"
                     /protein_id="YP_003881025.1"
                     /db_xref="GI:307129009"
                     /db_xref="ASAP:ABF-0017007"
                     /db_xref="ERIC:ABF-0017007"
                     /db_xref="GeneID:9731650"
                     /translation="MTMITHTPSNPTPINRAIVWARRNLFSSITNSVLTLACLWLLWT
                     LIPPLLNWAILKANWIGSTRADCTSDGACWVFIHARFEQFMYGLYPREELWRINFALV
                     LALISILPMFWRNLPHRGRYIAVWCVIYPLIAWWLLFGGFGGLTRVETRQWGGLTLTI
                     IIAAIGIAGALPLGILLALGRRSNMPVLRALCVIFIEFWRGVPLITVLFMSSVMLPLF
                     LTEGTNIDKLLRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAQSLALGYWRMQGLV
                     ILPQALKMVIPGLVNTIIALFKDTSLVIIIGLFDLFSSIQQATVDPAWLGMSTEGYVF
                     AAILYWIFCFSMSRYSQHLEKRFDTGRKSH"
     misc_feature    complement(285026..285706)
                     /gene="yhdY"
                     /locus_tag="Dda3937_01576"
                     /gene_synonym="aapM"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    complement(285068..285598)
                     /gene="yhdY"
                     /locus_tag="Dda3937_01576"
                     /gene_synonym="aapM"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(285068..285070,285077..285082,
                     285089..285094,285098..285103,285110..285115,
                     285152..285157,285194..285199,285206..285217,
                     285236..285238,285245..285250,285290..285292,
                     285341..285343,285350..285355,285365..285367,
                     285371..285376,285383..285385,285389..285391,
                     285395..285400,285473..285475,285479..285484,
                     285491..285520,285524..285535,285563..285565,
                     285578..285583,285590..285595))
                     /gene="yhdY"
                     /locus_tag="Dda3937_01576"
                     /gene_synonym="aapM"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(285200..285217,285473..285517))
                     /gene="yhdY"
                     /locus_tag="Dda3937_01576"
                     /gene_synonym="aapM"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(285113..285115,285152..285154,
                     285161..285163,285197..285199,285413..285415,
                     285473..285475))
                     /gene="yhdY"
                     /locus_tag="Dda3937_01576"
                     /gene_synonym="aapM"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(285269..285271,285281..285286,
                     285302..285340))
                     /gene="yhdY"
                     /locus_tag="Dda3937_01576"
                     /gene_synonym="aapM"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(286118..287296)
                     /gene="yhdX"
                     /locus_tag="Dda3937_01577"
                     /gene_synonym="aapQ"
                     /db_xref="GeneID:9731651"
     CDS             complement(286118..287296)
                     /gene="yhdX"
                     /locus_tag="Dda3937_01577"
                     /gene_synonym="aapQ"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.12 transport; substrate; amino acid"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /codon_start=1
                     /transl_table=11
                     /product="transport system permease"
                     /protein_id="YP_003881026.1"
                     /db_xref="GI:307129010"
                     /db_xref="ASAP:ABF-0017008"
                     /db_xref="ERIC:ABF-0017008"
                     /db_xref="GeneID:9731651"
                     /translation="MLQRPTVKGDLSLTNPAVRAWLYQILAVVIVVVTVGYLLHNTVT
                     NLAQRGITSGFAFLNNSADFGIVQHLIDYEQGDTYARVFVVGLLNTLLVSAICIVCAS
                     LLGFIVGLARLSDNWLLRKLSTIYIETFRNIPPLLQIFFWYFAVLRNLPGPRQAVNAL
                     DTFFLSNRGLYIPAAEFGPGALPSILALIIALVVGAMIFRRNKRYHALTGQQRRSWPI
                     PLAVLVVLLGLSHLIFGRALHWDFPVLKGFNFSGGMVLIPELAALALALSVYTSSFIA
                     EIIRSGIQSVSYGQHEAALSLGLPKPVTLRKVILPQALRVIIPPLTSQYLNVVKNSSL
                     AAAIGYPDMVSLFAGTVLNQTGQAIETIAITMSVYLIISLLISLLMNIYNRKIALIER
                     "
     misc_feature    complement(286121..287287)
                     /gene="yhdX"
                     /locus_tag="Dda3937_01577"
                     /gene_synonym="aapQ"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     BatB; COG4597"
                     /db_xref="CDD:226960"
     misc_feature    complement(<286862..287050)
                     /gene="yhdX"
                     /locus_tag="Dda3937_01577"
                     /gene_synonym="aapQ"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cl00427"
                     /db_xref="CDD:260417"
     misc_feature    complement(286193..>286495)
                     /gene="yhdX"
                     /locus_tag="Dda3937_01577"
                     /gene_synonym="aapQ"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(286193..286195,286199..286204,
                     286211..286216,286244..286249,286286..286291,
                     286298..286309,286328..286330,286337..286342,
                     286382..286384,286433..286435,286442..286447,
                     286457..286459,286463..286468,286475..286477,
                     286481..286483,286487..286492))
                     /gene="yhdX"
                     /locus_tag="Dda3937_01577"
                     /gene_synonym="aapQ"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(286361..286363,286373..286378,
                     286394..286432))
                     /gene="yhdX"
                     /locus_tag="Dda3937_01577"
                     /gene_synonym="aapQ"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(286214..286216,286244..286246,
                     286253..286255,286289..286291))
                     /gene="yhdX"
                     /locus_tag="Dda3937_01577"
                     /gene_synonym="aapQ"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     gene            complement(287369..288394)
                     /gene="yhdW"
                     /locus_tag="Dda3937_01578"
                     /gene_synonym="aapJ"
                     /db_xref="GeneID:9731652"
     CDS             complement(287369..288394)
                     /gene="yhdW"
                     /locus_tag="Dda3937_01578"
                     /gene_synonym="aapJ"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="4.S.12 transport; substrate; amino acid"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter periplasmic amino
                     acid-binding protein"
                     /protein_id="YP_003881027.1"
                     /db_xref="GI:307129011"
                     /db_xref="ASAP:ABF-0017010"
                     /db_xref="ERIC:ABF-0017010"
                     /db_xref="GeneID:9731652"
                     /translation="MKKVIMSTLVASASLFAFINQAHAGATLDAIQKKGFVQCGISDG
                     LPGFSYADANGKYSGIDVDVCRGVAAAIFGDANKVKFTPLTAKERFTALQSGEVDLLS
                     RNTTWTSSRDGGMGLLFTGVTYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELN
                     VADYFKTHNMKYTPVTFDRSDESAKALDSGRCDTLASDQSQLYALRIKLGKPADFVVL
                     PEVISKEPLGPVVRRGDEDWYAIVRWTLFAMLNAEEMGITSQNVDQMAAKPTTPDMSH
                     LLGKEGNYGKDLKLPADWAYKIVKQVGNYGEVFERNVGQGSELKIKRGLNELWNKGGI
                     QYAPAIR"
     misc_feature    complement(287633..288286)
                     /gene="yhdW"
                     /locus_tag="Dda3937_01578"
                     /gene_synonym="aapJ"
                     /note="Bacterial periplasmic substrate-binding proteins;
                     Region: PBPb; smart00062"
                     /db_xref="CDD:214497"
     misc_feature    complement(287648..288286)
                     /gene="yhdW"
                     /locus_tag="Dda3937_01578"
                     /gene_synonym="aapJ"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(287801..287803,287927..287929,
                     288062..288064,288137..288139,288260..288262))
                     /gene="yhdW"
                     /locus_tag="Dda3937_01578"
                     /gene_synonym="aapJ"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(287822..287824,287840..287842,
                     287852..287854))
                     /gene="yhdW"
                     /locus_tag="Dda3937_01578"
                     /gene_synonym="aapJ"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(287705..287722)
                     /gene="yhdW"
                     /locus_tag="Dda3937_01578"
                     /gene_synonym="aapJ"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(288691..289470)
                     /locus_tag="Dda3937_01579"
                     /db_xref="GeneID:9731653"
     CDS             complement(288691..289470)
                     /locus_tag="Dda3937_01579"
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthase"
                     /protein_id="YP_003881028.1"
                     /db_xref="GI:307129012"
                     /db_xref="ASAP:ABF-0017011"
                     /db_xref="ERIC:ABF-0017011"
                     /db_xref="GeneID:9731653"
                     /translation="MPPLTIKPTTSTLPPICRSLLFYQPENVMKQIVRIALIGDYTPT
                     VTAHQAIPPALDLAARQLDLTTQYQWIDSELLSPASQLDAFDAVWCVPASPYRHDDNI
                     LQAIRFARETHIPFLGTCGGCQYALLEYARHVLSWHDANNAEVTQEGRAVISPLQCEM
                     VEKQGDIRLSPDSRIGRAYGRDAIAEGYRCRYGINEAFRDAFTTAGVRVSGVDDNGDI
                     RAVELTDHPFFVGTLFQPERAALKQIAPPLAIALLEAASVR"
     misc_feature    complement(288700..289374)
                     /locus_tag="Dda3937_01579"
                     /note="hypothetical protein; Validated; Region: PRK06186"
                     /db_xref="CDD:180452"
     misc_feature    complement(288712..289374)
                     /locus_tag="Dda3937_01579"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain; Region: GAT_1; cl00020"
                     /db_xref="CDD:260141"
     misc_feature    complement(289111..289113)
                     /locus_tag="Dda3937_01579"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153222"
     gene            complement(289501..290166)
                     /gene="yecS"
                     /locus_tag="Dda3937_01580"
                     /db_xref="GeneID:9731654"
     CDS             complement(289501..290166)
                     /gene="yecS"
                     /locus_tag="Dda3937_01580"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.12 transport; substrate; amino acid"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter membrane protein"
                     /protein_id="YP_003881029.1"
                     /db_xref="GI:307129013"
                     /db_xref="ASAP:ABF-0017012"
                     /db_xref="ERIC:ABF-0017012"
                     /db_xref="GeneID:9731654"
                     /translation="MPSWLQLMADSFWSLLSAGLTFTVPLAILSFVLGLMIGVLVALL
                     RLYGPTPLKKICDFYVWMIRGTPLLVQLFLIFYGLPNAGITLDAFPAALIGFSLNVGA
                     YSSEIVRGAILSVPKGQWNAAYSLGMSGAQAIRWVIVPQSVFVSLPPLANTFISLVKD
                     TSLAAVITVPEMFLAAQRIVSVTYEPLILYIEAALIYLLFSTVLSKLQTRLEKYYQRH
                     IVH"
     misc_feature    complement(289513..290166)
                     /gene="yecS"
                     /locus_tag="Dda3937_01580"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    complement(289552..290109)
                     /gene="yecS"
                     /locus_tag="Dda3937_01580"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(289552..289554,289561..289566,
                     289573..289578,289582..289587,289594..289599,
                     289627..289632,289669..289674,289681..289692,
                     289711..289713,289720..289725,289765..289767,
                     289816..289818,289825..289830,289840..289842,
                     289846..289851,289858..289860,289864..289866,
                     289870..289875,289939..289941,289945..289950,
                     289957..289986,289990..290001,290029..290031,
                     290044..290049,290056..290061))
                     /gene="yecS"
                     /locus_tag="Dda3937_01580"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(289675..289692,289939..289983))
                     /gene="yecS"
                     /locus_tag="Dda3937_01580"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(289597..289599,289627..289629,
                     289636..289638,289672..289674,289888..289890,
                     289939..289941))
                     /gene="yecS"
                     /locus_tag="Dda3937_01580"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(289744..289746,289756..289761,
                     289777..289815))
                     /gene="yecS"
                     /locus_tag="Dda3937_01580"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(290192..290965)
                     /gene="fliY"
                     /locus_tag="Dda3937_01581"
                     /db_xref="GeneID:9731655"
     CDS             complement(290192..290965)
                     /gene="fliY"
                     /locus_tag="Dda3937_01581"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="4.S.12 transport; substrate; amino acid"
                     /codon_start=1
                     /transl_table=11
                     /product="cystine ABC transporter periplasmic-binding
                     component"
                     /protein_id="YP_003881030.1"
                     /db_xref="GI:307129014"
                     /db_xref="ASAP:ABF-0017013"
                     /db_xref="ERIC:ABF-0017013"
                     /db_xref="GeneID:9731655"
                     /translation="MMKKSRLALLTGALLVTSALAQAQDDLSAIKAAGVIKFGTEGTY
                     APYTYHDASGKLVGFDVDVGRAVAEKLGVKAEFVEGRWDGLIAGVDAKRYDAVINQVG
                     VTKERRAKYDFTKPYIDAKSVLIVRGDNTGIKSFNDLKGHKSAQSLTSNYSKLATSYG
                     AEIVPTDGFNQSLELVLSGRAEATLNDNLSFLDFKKHKPDANVKVVATAESGDPSAIL
                     VRKNQPQLVDALNNALDQIKADGTYKTISVRYFGQDVSK"
     misc_feature    complement(290213..290860)
                     /gene="fliY"
                     /locus_tag="Dda3937_01581"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(290213..290860)
                     /gene="fliY"
                     /locus_tag="Dda3937_01581"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(order(290405..290407,290513..290515,
                     290645..290647,290720..290722,290834..290836))
                     /gene="fliY"
                     /locus_tag="Dda3937_01581"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(290426..290428,290444..290446,
                     290456..290458))
                     /gene="fliY"
                     /locus_tag="Dda3937_01581"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(290318..290320,290321..290329))
                     /gene="fliY"
                     /locus_tag="Dda3937_01581"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            291208..292350
                     /locus_tag="Dda3937_01582"
                     /db_xref="GeneID:9731656"
     CDS             291208..292350
                     /locus_tag="Dda3937_01582"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/Exonuclease/phosphatase family
                     protein"
                     /protein_id="YP_003881031.1"
                     /db_xref="GI:307129015"
                     /db_xref="ASAP:ABF-0017015"
                     /db_xref="ERIC:ABF-0017015"
                     /db_xref="GeneID:9731656"
                     /translation="MKLRLASYNVENLFHRTAILNLPDPQQSSELLEKVRQLQTLLDA
                     DKYDDALKDRVFTLTSNLQPYVDLRVDGGSLGSWKNEAGKTGFRINKSCQGRGDWLGE
                     LVFRAEAFGDQQRKNTGLVIKALNADILCAVEVENMAVLRDFNQQILADRAFAQYVMI
                     DSPNDPRGIDVACLTRHRITQLRTHIFDVSESFKPLFSRDCLEVTIDVGLPQPVHVLC
                     NHFKSQNGRNDDERERAAKRRRAQAERVAEIVRGYNLQQEYVVVMGDLNEDVANPWHS
                     LAPLFSVPDLHPAIDPSLPETARYTYYFSGGKAGERLNQLDYIFISTPLHQAKVTCGI
                     ERRGIYNIDKITAKEGAEPVTPFPTVTSWDTAASDHAAVWVELDIR"
     misc_feature    291550..292347
                     /locus_tag="Dda3937_01582"
                     /note="Exonuclease-Endonuclease-Phosphatase (EEP) domain
                     superfamily; Region: EEP; cl00490"
                     /db_xref="CDD:260458"
     misc_feature    order(291607..291609,291865..291867,292000..292002,
                     292006..292008,292156..292158,292312..292317)
                     /locus_tag="Dda3937_01582"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197306"
     misc_feature    order(291607..291609,292312..292314)
                     /locus_tag="Dda3937_01582"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197306"
     misc_feature    order(291865..291867,292006..292008,292315..292317)
                     /locus_tag="Dda3937_01582"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197306"
     gene            292553..293398
                     /locus_tag="Dda3937_01583"
                     /db_xref="GeneID:9731657"
     CDS             292553..293398
                     /locus_tag="Dda3937_01583"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain oxidoreductase"
                     /protein_id="YP_003881032.1"
                     /db_xref="GI:307129016"
                     /db_xref="ASAP:ABF-0017016"
                     /db_xref="ERIC:ABF-0017016"
                     /db_xref="GeneID:9731657"
                     /translation="MMSQRIWLITGVSTGFGRELTQQLLAKGDRVVGTVRNLASVQPL
                     MDQWPETFHPEILDVTDTDAIAGVVERTFKRFGRIDVAISNAGYGLFGAAEELSDRQI
                     EQMIATNLLGSIQFIRGVIPIMRQQGGGRIIQISSYGGQVAFPGNSLYHATKWGIEGF
                     VESVAQEVAPFGIGMTLVEPGGARTEFRYGSAQVAALMPVYDATPAHAFLRMLDPANG
                     LAPGDPARMATRIIESVDRQPAPLRMVLGSQALQGMIDVLRERLRDFEQQVELAASTD
                     FPPGT"
     misc_feature    292556..293383
                     /locus_tag="Dda3937_01583"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK08263"
                     /db_xref="CDD:181334"
     misc_feature    292565..293296
                     /locus_tag="Dda3937_01583"
                     /note="17beta hydroxysteroid dehydrogenase-like, classical
                     (c) SDRs; Region: 17beta-HSD-like_SDR_c; cd05374"
                     /db_xref="CDD:187632"
     misc_feature    order(292583..292585,292589..292600,292658..292660,
                     292721..292729,292805..292816,292874..292876,
                     292955..292963,293000..293002,293012..293014,
                     293099..293101,293105..293113)
                     /locus_tag="Dda3937_01583"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187632"
     misc_feature    order(292877..292879,292961..292963,293000..293002,
                     293012..293014)
                     /locus_tag="Dda3937_01583"
                     /note="active site"
                     /db_xref="CDD:187632"
     misc_feature    order(292961..292969,292982..292984,293000..293002,
                     293093..293098,293117..293119,293165..293167,
                     293174..293176)
                     /locus_tag="Dda3937_01583"
                     /note="steroid binding site; other site"
                     /db_xref="CDD:187632"
     gene            complement(293476..294369)
                     /locus_tag="Dda3937_01584"
                     /db_xref="GeneID:9731658"
     CDS             complement(293476..294369)
                     /locus_tag="Dda3937_01584"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881033.1"
                     /db_xref="GI:307129017"
                     /db_xref="ASAP:ABF-0017018"
                     /db_xref="ERIC:ABF-0017018"
                     /db_xref="GeneID:9731658"
                     /translation="MLKENFSDLISFRMVAQEKSFTRAAAKLGISQSALSHAMRSLEE
                     RLGIRLLTRTTRSVSLTEAGERLLGNISPSLNELEFALEDLGEMRDKPAGNIRLTAGE
                     HAVNFVLWPVLKPFLSQHPDIHLEITVDNTLTDIVNERFDAGVRLGEQVAKDMIAVRI
                     GPDMRMAVVGSPAYFANHTAPDTPQSLQQHRCINMRLPTLGGLFAWEFSRDGREIRVR
                     VDGQLTFNNLQHRIDAALSGLGLAYVPEDTIRQAVADGRLIQVLESWCEPFPGYYLYY
                     PSRKQHTAAFSLFIDALRYRG"
     misc_feature    complement(293488..294357)
                     /locus_tag="Dda3937_01584"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(294175..294354)
                     /locus_tag="Dda3937_01584"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(293491..294096)
                     /locus_tag="Dda3937_01584"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_5; cd08474"
                     /db_xref="CDD:176163"
     misc_feature    complement(order(293554..293556,293635..293637,
                     293686..293688,293878..293880,293887..293889,
                     293929..293931,294046..294048,294058..294060))
                     /locus_tag="Dda3937_01584"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176163"
     misc_feature    complement(order(293659..293661,293668..293673,
                     293692..293706,293797..293799,293983..294003,
                     294007..294009,294019..294021,294028..294033,
                     294037..294042,294052..294057))
                     /locus_tag="Dda3937_01584"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176163"
     gene            294604..295077
                     /locus_tag="Dda3937_01585"
                     /db_xref="GeneID:9731659"
     CDS             294604..295077
                     /locus_tag="Dda3937_01585"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_003881034.1"
                     /db_xref="GI:307129018"
                     /db_xref="ASAP:ABF-0017019"
                     /db_xref="ERIC:ABF-0017019"
                     /db_xref="GeneID:9731659"
                     /translation="MGLSCDVIPVSLLMLTPAIRPEVEESMKIIRNGSQPSRPGPEAW
                     FTGHVRIDAPFQATEPARVGGAIVTFEPGARTAWHTHPLGQTLIVVQGRGWVQEWGKE
                     IHEMNPGDIVWIPEGVKHWHGATAETAMTHIAIAESLDGSAVEWMEHVSDEQYPK"
     misc_feature    294679..295056
                     /locus_tag="Dda3937_01585"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            295089..295301
                     /locus_tag="Dda3937_01586"
                     /db_xref="GeneID:9731660"
     CDS             295089..295301
                     /locus_tag="Dda3937_01586"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain alcohol dehydrogenase"
                     /protein_id="YP_003881035.1"
                     /db_xref="GI:307129019"
                     /db_xref="ASAP:ABF-0017020"
                     /db_xref="ERIC:ABF-0017020"
                     /db_xref="GeneID:9731660"
                     /translation="MVWLRMMPGAVESELVRSITDPNMAAGVKSFYDDYAISAESFAR
                     VVAFAIRLPEDVDINDVLFRPTRLEL"
     misc_feature    <295110..295286
                     /locus_tag="Dda3937_01586"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     gene            295338..296384
                     /gene="yahK"
                     /locus_tag="Dda3937_01587"
                     /db_xref="GeneID:9731661"
     CDS             295338..296384
                     /gene="yahK"
                     /locus_tag="Dda3937_01587"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, Zn-dependent and NAD(P)-binding
                     protein"
                     /protein_id="YP_003881036.1"
                     /db_xref="GI:307129020"
                     /db_xref="ASAP:ABF-0017021"
                     /db_xref="ERIC:ABF-0017021"
                     /db_xref="GeneID:9731661"
                     /translation="MKVLGYAAQSSAAPLAPFHFTRRTPRPDDVVVEILYCGVCHSDL
                     HQARNDWGFSHYPLVPGHEIIGRVTAVGAGVTKFKPDDLVGIGCMVDSCRECQPCKQG
                     LEQYCDEGNVQTYNGVDRHDHLPTYGGYSQQIVASQDFVLRIPASMDLKSAAPLLCAG
                     ITTWSPLRHWNVGKGSKVAVVGLGGLGHMAIKLAHALGAEVTLFTRSPGKEADARRLG
                     ADRIVLSTAASQMETVKGQFDLIIDTVPYEHDINPYMPTLTVDGTLVFVGLLGDINPM
                     LNTVSMILGRRSVAGSCIGGIAETQEMLDFCGEHGITSDVEMIDIQNINAAYERMLKS
                     DVKYRFVIDMASLA"
     misc_feature    295338..296375
                     /gene="yahK"
                     /locus_tag="Dda3937_01587"
                     /note="Zn-dependent alcohol dehydrogenases [General
                     function prediction only]; Region: AdhP; COG1064"
                     /db_xref="CDD:223992"
     misc_feature    295350..296366
                     /gene="yahK"
                     /locus_tag="Dda3937_01587"
                     /note="Cinnamyl alcohol dehydrogenases (CAD); Region:
                     CAD1; cd05283"
                     /db_xref="CDD:176186"
     misc_feature    order(295455..295463,295470..295472,295809..295811,
                     295821..295823,295881..295898,295950..295955,
                     295965..295967,296010..296012,296067..296072,
                     296076..296078,296136..296141,296211..296219)
                     /gene="yahK"
                     /locus_tag="Dda3937_01587"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176186"
     misc_feature    order(295455..295457,295461..295463,295521..295523,
                     295599..295601,295809..295811,296217..296219)
                     /gene="yahK"
                     /locus_tag="Dda3937_01587"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176186"
     misc_feature    order(295455..295457,295521..295523,295809..295811)
                     /gene="yahK"
                     /locus_tag="Dda3937_01587"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176186"
     misc_feature    order(295614..295616,295623..295625,295632..295634,
                     295656..295658)
                     /gene="yahK"
                     /locus_tag="Dda3937_01587"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176186"
     misc_feature    order(295653..295655,295830..295832,295842..295844,
                     296118..296120,296133..296141,296145..296147,
                     296175..296177,296181..296186,296193..296216)
                     /gene="yahK"
                     /locus_tag="Dda3937_01587"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176186"
     gene            296712..297932
                     /locus_tag="Dda3937_01588"
                     /db_xref="GeneID:9731662"
     CDS             296712..297932
                     /locus_tag="Dda3937_01588"
                     /function="8.1.4 extrachromosomal; prophage genes and
                     phage related functions; Integration, recombination"
                     /codon_start=1
                     /transl_table=11
                     /product="Integrase"
                     /protein_id="YP_003881037.1"
                     /db_xref="GI:307129021"
                     /db_xref="ASAP:ABF-0017024"
                     /db_xref="ERIC:ABF-0017024"
                     /db_xref="GeneID:9731662"
                     /translation="MAGGTNKLSDTSLRKMMGRESPGDSFYADGDGLSVKVSKIGVMT
                     WYFTFRVGGRSAAPQRIKLGNYPDLSLKAAREKREQCRAWLAEGKNPRHQLSIATQES
                     LKPITVKEALEYWIREYATHKRANVNKHIEQLKKHIYPYIGDYPLSMCETRHWLECFS
                     RVRSEAPVAAGYLLQMCKQALKFCRVHRYADSNALSDLTIDDVGSKQNKRDRVHSRQE
                     LADIWRESTGQKFKPYYASLLHLLVVFGCRTQELRFSLISEWDLDDWVWTVPREHSKG
                     GEKILRPIPEAIRPFVVALCNQHKDSGLLLGEIKSSEAVSQWGRGIYKRLGHSEPWTL
                     HDLRRTFSTTLNNMGIAPHVVEQLLGHTLGGVMAVYNRSQYLPEKLDALNKWMERLEL
                     ISSEHSNVTIFKVK"
     misc_feature    296712..297869
                     /locus_tag="Dda3937_01588"
                     /note="integrase; Provisional; Region: PRK09692"
                     /db_xref="CDD:170049"
     misc_feature    296811..297869
                     /locus_tag="Dda3937_01588"
                     /note="Bacteriophage P4 integrase. P4-like integrases are
                     found in temperate bacteriophages, integrative plasmids,
                     pathogenicity and symbiosis islands, and other mobile
                     genetic elements.  They share the same fold in their
                     catalytic domain and the overall...; Region: INT_P4;
                     cd00801"
                     /db_xref="CDD:238416"
     misc_feature    order(297453..297455,297534..297536,297714..297716,
                     297723..297725,297792..297794,297819..297821)
                     /locus_tag="Dda3937_01588"
                     /note="active site"
                     /db_xref="CDD:238416"
     misc_feature    order(297453..297455,297534..297536,297714..297716,
                     297723..297725,297792..297794,297819..297821)
                     /locus_tag="Dda3937_01588"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238416"
     gene            297932..298669
                     /locus_tag="Dda3937_01589"
                     /db_xref="GeneID:9731663"
     CDS             297932..298669
                     /locus_tag="Dda3937_01589"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881038.1"
                     /db_xref="GI:307129022"
                     /db_xref="ASAP:ABF-0017025"
                     /db_xref="ERIC:ABF-0017025"
                     /db_xref="GeneID:9731663"
                     /translation="MSVKKPERLYYPLHEAAEKLECSIKDIIHYGAIGALCISVYMFN
                     NKGDNQSDIFYLDALKFKVDDDLPSHFLGDKYLIADIHFNHSPYGWCASFLKGFFYIN
                     AVSLTLAEFEINSGSIKIDKLSTAKNALDSIDIYFMNDEGLYELPISRLCVMAEEIDN
                     INQAVKINAFINQEKESDKTVAKKEVLIKSLLRLIPDFYDVDIEAMPVKKIKELLEVT
                     AAQKGIDFPKTDLGTWSKYLERGRHKK"
     gene            298724..298984
                     /locus_tag="Dda3937_01590"
                     /db_xref="GeneID:9731664"
     CDS             298724..298984
                     /locus_tag="Dda3937_01590"
                     /function="8.1.3 extrachromosomal; prophage genes and
                     phage related functions; Regulation"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA binding protein"
                     /protein_id="YP_003881039.1"
                     /db_xref="GI:307129023"
                     /db_xref="ASAP:ABF-0017026"
                     /db_xref="ERIC:ABF-0017026"
                     /db_xref="GeneID:9731664"
                     /translation="MLLNRNKQERFSMNHLKQSKQTTERLIREGECRQLTGLCRTTRY
                     LMEKKGKFPSRRKLGGRSVGWMLSEILEWQHQQPKVIFEKAA"
     misc_feature    298793..298942
                     /locus_tag="Dda3937_01590"
                     /note="Prophage CP4-57 regulatory protein (AlpA); Region:
                     Phage_AlpA; pfam05930"
                     /db_xref="CDD:114641"
     gene            298968..299465
                     /locus_tag="Dda3937_04442"
                     /db_xref="GeneID:9731665"
     CDS             298968..299465
                     /locus_tag="Dda3937_04442"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881040.1"
                     /db_xref="GI:307129024"
                     /db_xref="ASAP:ABF-0046865"
                     /db_xref="ERIC:ABF-0046865"
                     /db_xref="GeneID:9731665"
                     /translation="MKKRHEVGMAHKTKAAMLGRSCQCTKLKRVQNTMLIDQVNDCNH
                     SASGCLSCRDCLRWRRLISPFTAVTINCAFVSPISRLFSNSATTSCGNRAFSCCDLLL
                     TEPVAITESPYNRCDSVYAKKMIIKGLRCDSLNSIFNREGAIHLVSAKPGCATTQTGP
                     LTTIR"
     gene            299480..299701
                     /locus_tag="Dda3937_04443"
                     /db_xref="GeneID:9731666"
     CDS             299480..299701
                     /locus_tag="Dda3937_04443"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881041.1"
                     /db_xref="GI:307129025"
                     /db_xref="ASAP:ABF-0046866"
                     /db_xref="ERIC:ABF-0046866"
                     /db_xref="GeneID:9731666"
                     /translation="MADKQSTQTHAKFTRAAHITHAEEAVTQVVYAMSIIRLIAAQDV
                     GGPVVENSLDAVIEILEKAETELVEVCRG"
     gene            299694..299909
                     /locus_tag="Dda3937_01591"
                     /db_xref="GeneID:9731667"
     CDS             299694..299909
                     /locus_tag="Dda3937_01591"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881042.1"
                     /db_xref="GI:307129026"
                     /db_xref="ASAP:ABF-0017028"
                     /db_xref="ERIC:ABF-0017028"
                     /db_xref="GeneID:9731667"
                     /translation="MDKPIPLDLAAYRAGLNSSLFEVIISKAAEENVSGQLADLIAIA
                     CDLNEEIRDVLAKAVEKRGVIVHGVER"
     gene            299906..301675
                     /locus_tag="Dda3937_01592"
                     /db_xref="GeneID:9731668"
     CDS             299906..301675
                     /locus_tag="Dda3937_01592"
                     /function="8.1.2 extrachromosomal; prophage genes and
                     phage related functions; Replication"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="YP_003881043.1"
                     /db_xref="GI:307129027"
                     /db_xref="ASAP:ABF-0017029"
                     /db_xref="ERIC:ABF-0017029"
                     /db_xref="GeneID:9731668"
                     /translation="MKTAPNVKRLPRDKGTEAVIFAGSNAWDAAKRYQAGNNNGDDIP
                     PIVLDHAQLNDLANLNIVDKGRKYARVYQAGLVDQAKMSLIAKKLAAAGVTEAKLYSE
                     TGELLEDWKGYFERLTTEPPETSAGMVLTDLSRMGASQRGEVLRAHYGGALAVHGDSD
                     TVHHYNSVVWVPVADKELQREMAQIFIDADIAYSQNAIKSAVETMKLSLPVMGVTARN
                     LIGFSNGVFDTRSGQFRCHIKEDWLLIASELPFSAPAEGETLATHAPSFWKWLSRSVG
                     NNKRKADRVLAALFMVLANRYDWQLFLEVTGPGGSGKSVFAEICTMLAGKANTVSASM
                     KALEDPRDRALVVGYSLIIMPDMTRYAGDGAGIKAITGGDKVSIDPKHKAPYSTRIPA
                     VVLAVNNNAMTFSDRSGGISRRRVIFNFSEVVPENERDPMLAEKIEGELAVIIRHLLT
                     RFAKQDEAKRLLHEQQKSEEAMAIKREGDSLVDFCGYLMASVLCDGMFIGNAEIVPFS
                     PRRYLYHAYLAYMRANGLNKPVSLTRFGTDMPGAMAEYGKEYQKRKTKLGLRSNVTLN
                     EDSEDWMPQCDAPQGSQNKEEKK"
     misc_feature    300329..300709
                     /locus_tag="Dda3937_01592"
                     /note="D5 N terminal like; Region: D5_N; smart00885"
                     /db_xref="CDD:197953"
     misc_feature    300557..301510
                     /locus_tag="Dda3937_01592"
                     /note="phage/plasmid primase, P4 family, C-terminal
                     domain; Region: primase_Cterm; TIGR01613"
                     /db_xref="CDD:130674"
     gene            302246..304177
                     /locus_tag="Dda3937_01593"
                     /db_xref="GeneID:9731669"
     CDS             302246..304177
                     /locus_tag="Dda3937_01593"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /codon_start=1
                     /transl_table=11
                     /product="Prophage Clp protease-like protein"
                     /protein_id="YP_003881044.1"
                     /db_xref="GI:307129028"
                     /db_xref="ASAP:ABF-0017034"
                     /db_xref="ERIC:ABF-0017034"
                     /db_xref="GeneID:9731669"
                     /translation="MVMKCWYTIKAASDSASATILIYEEIGAWGITAQKFSEDLKALG
                     DISHITLNIHSPGGDVFDGIAIYNLLSKHPAKITVHIDGLAASMASVIAMAGDRIVMP
                     ENALMMIHKPWGISGGNANDMRDYAELLDKVEHVLIPAYARKTGKSAEELAAMLEEET
                     WMDGRECVAQGFADELLPAVSAMARIESKRIEDFEHMPDNIKGMITQPKGSTGATVPE
                     KDRINGIKDMFAMFGGKHDSLKIQCLEDVGCTPDMAKERLMKELGRGATPSGKFIPEN
                     SAHIYVDNGNITGDGIRNGLFARLGYAPAERGNPYAMMSLFDMAKASLADRGVGISGF
                     GNRSQIVNLAFTHSSSDFSHILAAGAEKSVLTGWQNSGETFQQWTKTGSLSNFHEAKR
                     VGINGFSQLDKVPEGAEYKYVTTGDSGVPIALATYGNIFSVTRQAIINDDLSQLTTIP
                     QAMGRAAARTVGNLVYLLLTTNTAFTDGKALFHADHGNLIAKSLDMDGLNEARKAMRL
                     QEDANGDPINIIPAFILVPAALEGAANRAVLSSSSLFPVDGSGTQNQNPGIINVVKDM
                     AQIVVDPRLDKANNKQWYVASAQGTDTIEVAYLDGVDTPYLEQQEGFTVDGIAWKVRI
                     DAGVAALDYRGLVKSNGTA"
     misc_feature    302297..302773
                     /locus_tag="Dda3937_01593"
                     /note="Caseinolytic protease (ClpP) is an ATP-dependent,
                     highly conserved serine protease; Region: S14_ClpP_1;
                     cd07016"
                     /db_xref="CDD:132927"
     misc_feature    order(302306..302308,302312..302314,302345..302350,
                     302357..302359,302405..302407,302426..302428,
                     302438..302440,302447..302449,302456..302461,
                     302471..302473,302495..302497,302555..302557,
                     302561..302563,302579..302590,302609..302611,
                     302618..302620,302624..302626,302630..302632,
                     302720..302722,302726..302728)
                     /locus_tag="Dda3937_01593"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132927"
     misc_feature    order(302504..302506,302573..302575,302720..302722)
                     /locus_tag="Dda3937_01593"
                     /note="active site residues [active]"
                     /db_xref="CDD:132927"
     misc_feature    <303539..303970
                     /locus_tag="Dda3937_01593"
                     /note="Mu-like prophage major head subunit gpT; Region:
                     Mu-like_gpT; cl01826"
                     /db_xref="CDD:242731"
     gene            304620..307235
                     /locus_tag="Dda3937_01594"
                     /db_xref="GeneID:9731670"
     CDS             304620..307235
                     /locus_tag="Dda3937_01594"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /codon_start=1
                     /transl_table=11
                     /product="tail length tape measure protein"
                     /protein_id="YP_003881045.1"
                     /db_xref="GI:307129029"
                     /db_xref="ASAP:ABF-0017036"
                     /db_xref="ERIC:ABF-0017036"
                     /db_xref="GeneID:9731670"
                     /translation="MDVQYAQLVSHLDAGRIDAGQFERFNGMLSQSRQQILKMTAAAN
                     DLPAALSKQELAAQKAGISIGQYRMAMRSLPAQMTDVVTQLAGGQNPFLIMIQQGGQV
                     KDMFGGFRPMFTGLASAISPTFLAIGATAGAVTALGIAAYKGQQYLSDFNKSLVLTGG
                     QSGQTANSLLFNAEAIANSGRSFGGAAESLNALVKAGANLGVNYKDVAASIASLSKTA
                     GASVDDLAGTFGKITMDPEKGLAAMAEKYGNVTLRQLDYIKSLQDSGKYTEALSYANK
                     IASDGFQEMARSVQDNMGYLERAAASVGGAFSSMWDKMLDVGKSKSLQAQLADATEQF
                     YNLDKSLKASSAQGQQRMGLEQAREQARQLVAQLTDQLHAEQRKGDEQQRQATLQKSA
                     LTNQQHFQALADAGLTKEQQRTDEYLRLNRYIEERKKLNQALSQEEIAQIKKGIEERY
                     KDPKQREYKAPAGDTEQEKALAELTALESQLRVLQQHSSLNDTISQQRKDLWLTESKF
                     AVLDDASQNRKLTKQEQSLLANKDQIVALAQQKALLGDEIVAQERLNKLNDTALKYAT
                     QMSEKGAALTAGSTISDRLAQQQRAMAQLRIGWQNAGGQLSDAGYQKELEAAQAYYAK
                     EDALRNDWLAGAKRGWAEFEDSATNVYSSVQESATSALNGLSDSLTSLVTTGSANIKQ
                     FGTSMLKMIASVINKLIVTYALQQALGWISASASASTSTATASASANSSFSGGAYSNL
                     GFADGGYANLGGFTGIGNKHEPAGIVHRGEFVFTKEATRRIGVGNLYNMMHGFADGGF
                     AGGVAPNTPLASGGGLQITNNVTIQNDGSVSSSTSGNDQVSKATLRLLDDFCQKNIVK
                     ALTPGGSIWNAMKSR"
     misc_feature    304620..307100
                     /locus_tag="Dda3937_01594"
                     /note="Phage-related minor tail protein [Function
                     unknown]; Region: COG5281"
                     /db_xref="CDD:227606"
     misc_feature    304770..305399
                     /locus_tag="Dda3937_01594"
                     /note="Prophage tail length tape measure protein; Region:
                     TMP_2; pfam06791"
                     /db_xref="CDD:253913"
     misc_feature    <305679..305954
                     /locus_tag="Dda3937_01594"
                     /note="Protein of unknown function (DUF3500); Region:
                     DUF3500; pfam12006"
                     /db_xref="CDD:256794"
     misc_feature    306033..307097
                     /locus_tag="Dda3937_01594"
                     /note="Lambda phage tail tape-measure protein
                     (Tape_meas_lam_C); Region: Tape_meas_lam_C; cl19901"
                     /db_xref="CDD:268254"
     gene            complement(307385..307681)
                     /gene="fis"
                     /locus_tag="Dda3937_01595"
                     /gene_synonym="nbp"
                     /db_xref="GeneID:9731671"
     CDS             complement(307385..307681)
                     /gene="fis"
                     /locus_tag="Dda3937_01595"
                     /gene_synonym="nbp"
                     /function="2.1.3 information transfer; DNA related; DNA
                     recombination"
                     /function="2.3.7 information transfer; protein related;
                     nucleoproteins, basic proteins"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="3.1.1.1 regulation; type of regulation; DNA
                     structure level; DNA bending, supercoiling, inversion"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /codon_start=1
                     /transl_table=11
                     /product="global DNA-binding transcriptional dual
                     regulator"
                     /protein_id="YP_003881046.1"
                     /db_xref="GI:307129030"
                     /db_xref="ASAP:ABF-0017037"
                     /db_xref="ERIC:ABF-0017037"
                     /db_xref="GeneID:9731671"
                     /translation="MFEQRVNSDVLTVSTVNSQAQVTQKPLRDSVKQALKNYFAQLNG
                     QDVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN"
     misc_feature    complement(307388..307672)
                     /gene="fis"
                     /locus_tag="Dda3937_01595"
                     /gene_synonym="nbp"
                     /note="global DNA-binding transcriptional dual regulator
                     Fis; Provisional; Region: fis; PRK00430"
                     /db_xref="CDD:179020"
     gene            complement(307705..308670)
                     /gene="dusB"
                     /locus_tag="Dda3937_01596"
                     /gene_synonym="yhdG"
                     /db_xref="GeneID:9731672"
     CDS             complement(307705..308670)
                     /gene="dusB"
                     /locus_tag="Dda3937_01596"
                     /gene_synonym="yhdG"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase B"
                     /protein_id="YP_003881047.1"
                     /db_xref="GI:307129031"
                     /db_xref="ASAP:ABF-0017038"
                     /db_xref="ERIC:ABF-0017038"
                     /db_xref="GeneID:9731672"
                     /translation="MRIGQFQLPNRLIAAPMAGVSDRPFRALCYAMGAGMTVSEMLSS
                     NPEVWRSDKSRLRMVHSDEPGIRAVQIAGGDPDEMAAAARINAENGAQVIDINMGCPA
                     KKVNRKMAGSALLQYPELVKQILIAVVKAVDVPVTLKIRTGWAPEHRNCAEIAKLAED
                     CGIQALTVHGRTRACLFNGEAEYDSIRTVKQSVSIPIIANGDITDPRKARAVLDYTGA
                     DALMIGRAAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLIGHIRELHDFYGPGKGF
                     RIARKHVSWYLQEHAPNDQFRRTFNAIEDASEQLEALKAYFENLA"
     misc_feature    complement(307708..308670)
                     /gene="dusB"
                     /locus_tag="Dda3937_01596"
                     /gene_synonym="yhdG"
                     /note="tRNA-dihydrouridine synthase B; Provisional;
                     Region: PRK10415"
                     /db_xref="CDD:182440"
     misc_feature    complement(307945..308640)
                     /gene="dusB"
                     /locus_tag="Dda3937_01596"
                     /gene_synonym="yhdG"
                     /note="Dihydrouridine synthase-like (DUS-like) FMN-binding
                     domain. Members of this family catalyze the reduction of
                     the 5,6-double bond of a uridine residue on tRNA.
                     Dihydrouridine modification of tRNA is widely observed in
                     prokaryotes and eukaryotes, and also...; Region:
                     DUS_like_FMN; cd02801"
                     /db_xref="CDD:239200"
     misc_feature    complement(order(307996..308001,308065..308067,
                     308071..308073,308164..308166,308254..308256,
                     308380..308382,308461..308463,308548..308550,
                     308620..308628))
                     /gene="dusB"
                     /locus_tag="Dda3937_01596"
                     /gene_synonym="yhdG"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239200"
     misc_feature    complement(order(307996..307998,308065..308070,
                     308155..308160,308164..308169,308248..308250,
                     308254..308256,308368..308373,308461..308463))
                     /gene="dusB"
                     /locus_tag="Dda3937_01596"
                     /gene_synonym="yhdG"
                     /note="active site"
                     /db_xref="CDD:239200"
     misc_feature    complement(order(308158..308160,308164..308166,
                     308248..308250,308371..308373))
                     /gene="dusB"
                     /locus_tag="Dda3937_01596"
                     /gene_synonym="yhdG"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239200"
     misc_feature    complement(order(308065..308070,308155..308157,
                     308167..308169,308254..308256,308368..308370))
                     /gene="dusB"
                     /locus_tag="Dda3937_01596"
                     /gene_synonym="yhdG"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239200"
     gene            complement(309023..309910)
                     /gene="prmA"
                     /locus_tag="Dda3937_01597"
                     /db_xref="GeneID:9731673"
     CDS             complement(309023..309910)
                     /gene="prmA"
                     /locus_tag="Dda3937_01597"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="methylase for 50S ribosomal subunit protein L11"
                     /protein_id="YP_003881048.1"
                     /db_xref="GI:307129032"
                     /db_xref="ASAP:ABF-0017042"
                     /db_xref="ERIC:ABF-0017042"
                     /db_xref="GeneID:9731673"
                     /translation="MPWIQLKINTSGAHAEQLGDALSESGAVSVTFQDTHDTPVFEPL
                     PGETRLWGDTDVIGLYDAETDMAEVIAMLEQEPLLGVGFRHKIEQLEDKDWEREWMEN
                     FHPMQFGKRLWICPSWREVPDPSAVNVMLDPGLAFGTGTHPTTSLCLQWLDGLDLDGK
                     TVIDFGCGSGILAIAALKLGAAHAIGIDIDPQAIQASRDNAQRNGVSERLELYLPKDQ
                     PKDLSADVVVANILAGPLRELAPLIGVLPKNGGHLGLSGILASQAQSVAEAYEDRFQL
                     DPVAEKEEWCRITGIRKPV"
     misc_feature    complement(309032..309907)
                     /gene="prmA"
                     /locus_tag="Dda3937_01597"
                     /note="Ribosomal protein L11 methyltransferase (PrmA);
                     Region: PrmA; pfam06325"
                     /db_xref="CDD:253677"
     misc_feature    complement(<309221..309430)
                     /gene="prmA"
                     /locus_tag="Dda3937_01597"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(309221..309223,309281..309289,
                     309344..309349,309398..309418))
                     /gene="prmA"
                     /locus_tag="Dda3937_01597"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(309925..311376)
                     /gene="panF"
                     /locus_tag="Dda3937_01598"
                     /db_xref="GeneID:9731674"
     CDS             complement(309925..311376)
                     /gene="panF"
                     /locus_tag="Dda3937_01598"
                     /function="4.2.A.21 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Solute:Sodium Symporter (SSS) Family"
                     /function="1.5.3.5 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; Coenzyme
                     A"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.138 transport; substrate; Na+/pantothenate"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate:sodium symporter"
                     /protein_id="YP_003881049.1"
                     /db_xref="GI:307129033"
                     /db_xref="ASAP:ABF-0017043"
                     /db_xref="ERIC:ABF-0017043"
                     /db_xref="GeneID:9731674"
                     /translation="MQSDVILPLIAYLLLVFGLSVYAWRRRQQGNFLTEYFIGNRSMG
                     GFVLAMTLIGTYVSASSFIGGPGAAYKYGLGWVLLSMIQVPTMLLSLSILGKKFAILA
                     RRYNAITLNDMLYARYGSRLLVWFASLSLLVAFIGAMAVQFIGGARLLETVAHVPYNV
                     GLLIFGITIALYTAFGGFRASVLNDALQGIVMLIGTLLLLAGVIYAAGGLPAAVGKLA
                     QINPALVDPHGSNQILSAPFMASFWVLVCFGVIGLPNTAVRCISYRDSKALHRGILIG
                     TLVISVLMLGMHLAGALGRAILPNLTIPDQVLPELMLTVLPPLAAGIFLAAPTAAIMS
                     NINAHLLQASATIVKDLYLSVYPQKISNERYIRHLSSFTTLLLGLLVLLASWRPPEMI
                     IWLNLLAFGGLEAVFLWPLVLGLYWERANAAGALCSMFSGAVSYTLLASFNVQLAGFH
                     PIVPSLLLSLVAFILGNRFGRQPAPAVVASSSL"
     misc_feature    complement(309958..311364)
                     /gene="panF"
                     /locus_tag="Dda3937_01598"
                     /note="Na(+)/pantothenate cotransporters: PanF of
                     Escherichia coli and related proteins; solute binding
                     domain; Region: SLC5sbd_PanF; cd10327"
                     /db_xref="CDD:212037"
     misc_feature    complement(order(310372..310377,310384..310386,
                     311206..311208,311215..311217))
                     /gene="panF"
                     /locus_tag="Dda3937_01598"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212037"
     gene            complement(311366..311608)
                     /gene="yhdT"
                     /locus_tag="Dda3937_01599"
                     /db_xref="GeneID:9731675"
     CDS             complement(311366..311608)
                     /gene="yhdT"
                     /locus_tag="Dda3937_01599"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881050.1"
                     /db_xref="GI:307129034"
                     /db_xref="ASAP:ABF-0017044"
                     /db_xref="ERIC:ABF-0017044"
                     /db_xref="GeneID:9731675"
                     /translation="MDKRFIQAHREARWSLILTLAYLVAWTLFAYLPDNRPGLTGLPH
                     WFELACLALPLLFIGLCWLMVRVVFRDVSLEDHDAE"
     misc_feature    complement(311372..311608)
                     /gene="yhdT"
                     /locus_tag="Dda3937_01599"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10633"
                     /db_xref="CDD:182602"
     gene            complement(311802..313145)
                     /gene="accC"
                     /locus_tag="Dda3937_01600"
                     /gene_synonym="fabG"
                     /db_xref="GeneID:9731676"
     CDS             complement(311802..313145)
                     /gene="accC"
                     /locus_tag="Dda3937_01600"
                     /gene_synonym="fabG"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase, biotin carboxylase
                     subunit"
                     /protein_id="YP_003881051.1"
                     /db_xref="GI:307129035"
                     /db_xref="ASAP:ABF-0017046"
                     /db_xref="ERIC:ABF-0017046"
                     /db_xref="GeneID:9731676"
                     /translation="MLDKIVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLL
                     ADETVCIGPAPSPKSYLNIPAIISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIF
                     IGPRADTIRLMGDKVSAISAMKKAGVPCVPGSDGPLGDDMDKNRAIGKRIGYPVIIKA
                     SGGGGGRGMRVVRSEKELEQSIAMTRAEAKAAFNNDMVYMEKYLENPRHVEIQVLADG
                     QGNAIYLAERDCSMQRRHQKVVEEAPAPGITADLRRYIGERCAKACVDINYRGAGTFE
                     FLFENGEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGQPLSIKQEEVKVRGHA
                     VECRINAEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPHYDSMIGKLITYG
                     ESRDIAISRMKNALAELIIDGIKTNVELQMRIMSDENFQHGGTNIHYLEKKLGLQ"
     misc_feature    complement(311805..313145)
                     /gene="accC"
                     /locus_tag="Dda3937_01600"
                     /gene_synonym="fabG"
                     /note="acetyl-CoA carboxylase biotin carboxylase subunit;
                     Validated; Region: PRK08591"
                     /db_xref="CDD:236307"
     misc_feature    complement(312819..313142)
                     /gene="accC"
                     /locus_tag="Dda3937_01600"
                     /gene_synonym="fabG"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    complement(312174..312803)
                     /gene="accC"
                     /locus_tag="Dda3937_01600"
                     /gene_synonym="fabG"
                     /note="Carbamoyl-phosphate synthase L chain, ATP binding
                     domain; Region: CPSase_L_D2; pfam02786"
                     /db_xref="CDD:190425"
     misc_feature    complement(311823..312140)
                     /gene="accC"
                     /locus_tag="Dda3937_01600"
                     /gene_synonym="fabG"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; smart00878"
                     /db_xref="CDD:214878"
     gene            complement(313157..313582)
                     /gene="accB"
                     /locus_tag="Dda3937_04028"
                     /gene_synonym="fabE"
                     /db_xref="GeneID:9731677"
     CDS             complement(313157..313582)
                     /gene="accB"
                     /locus_tag="Dda3937_04028"
                     /gene_synonym="fabE"
                     /function="1.6.15.3 metabolism; macromolecules (cellular
                     constituent) biosynthesis; large molecule carriers; biotin
                     carboxyl carrier protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl CoA carboxylase, BCCP subunit"
                     /protein_id="YP_003881052.1"
                     /db_xref="GI:307129036"
                     /db_xref="ASAP:ABF-0020596"
                     /db_xref="ERIC:ABF-0020596"
                     /db_xref="GeneID:9731677"
                     /translation="MDIRKIKKLIELVEESGIAELEISEGEESVRISRAPAPGSYPIM
                     QQAYAPMPQFAPAAAPAAISGHVVRSPMVGTFYRTPSPDAKAFVEVGQQVKVGDTLCI
                     VEAMKMMNQIEADKAGVVKAILVESGQPVEFDEPLVVIE"
     misc_feature    complement(313160..313582)
                     /gene="accB"
                     /locus_tag="Dda3937_04028"
                     /gene_synonym="fabE"
                     /note="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein subunit; Validated; Region: PRK06302"
                     /db_xref="CDD:235777"
     misc_feature    complement(313163..313384)
                     /gene="accB"
                     /locus_tag="Dda3937_04028"
                     /gene_synonym="fabE"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    complement(order(313238..313240,313259..313267,
                     313292..313294))
                     /gene="accB"
                     /locus_tag="Dda3937_04028"
                     /gene_synonym="fabE"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    complement(313262..313264)
                     /gene="accB"
                     /locus_tag="Dda3937_04028"
                     /gene_synonym="fabE"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     gene            complement(313618..314112)
                     /gene="aroQ"
                     /locus_tag="Dda3937_04029"
                     /db_xref="GeneID:9731678"
     CDS             complement(313618..314112)
                     /gene="aroQ"
                     /locus_tag="Dda3937_04029"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="YP_003881053.1"
                     /db_xref="GI:307129037"
                     /db_xref="ASAP:ABF-0020597"
                     /db_xref="ERIC:ABF-0020597"
                     /db_xref="GeneID:9731678"
                     /translation="MLCATEPIEGDSSTMADKFHILLLNGPNLNLLGTREPDKYGHTT
                     LAEIVSRLEQDAAALNVQLSHLQSNAEHELIDRIHQARGNTDFILINPAAFTHTSVAL
                     RDALLAVAIPFIEIHLTNVYAREPFRHHSYLSDVSAGVICGLGADGYHYGLQTAVKRL
                     STSN"
     misc_feature    complement(313636..314013)
                     /gene="aroQ"
                     /locus_tag="Dda3937_04029"
                     /note="Dehydroquinase (DHQase), type II. Dehydroquinase
                     (or 3-dehydroquinate dehydratase) catalyzes the reversible
                     dehydration of 3-dehydroquinate to form
                     3-dehydroshikimate. This reaction is part of two metabolic
                     pathways: the biosynthetic shikimate pathway...; Region:
                     DHQase_II; cd00466"
                     /db_xref="CDD:238262"
     misc_feature    complement(order(313729..313731,313756..313764,
                     313801..313803,313822..313824,313831..313836,
                     313840..313842,313993..313995,314008..314010))
                     /gene="aroQ"
                     /locus_tag="Dda3937_04029"
                     /note="active site"
                     /db_xref="CDD:238262"
     misc_feature    complement(order(313729..313731,313789..313791,
                     313798..313803,313810..313812,313831..313833,
                     313876..313878,313885..313887,313894..313908))
                     /gene="aroQ"
                     /locus_tag="Dda3937_04029"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     misc_feature    complement(order(313639..313641,313648..313650,
                     313660..313662,313672..313674,313681..313689,
                     313693..313704,313708..313713,313744..313749,
                     313753..313755))
                     /gene="aroQ"
                     /locus_tag="Dda3937_04029"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     gene            complement(314309..314908)
                     /gene="yedZ"
                     /locus_tag="Dda3937_04030"
                     /db_xref="GeneID:9731679"
     CDS             complement(314309..314908)
                     /gene="yedZ"
                     /locus_tag="Dda3937_04030"
                     /function="6.1 cell structure; membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881054.1"
                     /db_xref="GI:307129038"
                     /db_xref="ASAP:ABF-0020600"
                     /db_xref="ERIC:ABF-0020600"
                     /db_xref="GeneID:9731679"
                     /translation="MRLTARHITALKVVLHLAAFLPLAWLVLAVNQGAFSADPAKDIQ
                     HFTGRMALKLLLATLMVTPLARYGKQPLLIRCRRLLGLWCFAWASLHLLSYTLLELGV
                     NHLDLLGKEIFLRPYLTLGMASWLILLALTLTSTQSAQRKLGARWQKLHNLIYLVAIL
                     APVHYLWSVKSLSPLPIIYASFAVILLLFRYKKLRQWRR"
     misc_feature    complement(314312..314908)
                     /gene="yedZ"
                     /locus_tag="Dda3937_04030"
                     /note="putative sulfite oxidase subunit YedZ; Reviewed;
                     Region: PRK05419"
                     /db_xref="CDD:235452"
     gene            complement(314975..315976)
                     /gene="yedY"
                     /locus_tag="Dda3937_04444"
                     /db_xref="GeneID:9731680"
     CDS             complement(314975..315976)
                     /gene="yedY"
                     /locus_tag="Dda3937_04444"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="reductase"
                     /protein_id="YP_003881055.1"
                     /db_xref="GI:307129039"
                     /db_xref="ASAP:ABF-0046867"
                     /db_xref="ERIC:ABF-0046867"
                     /db_xref="GeneID:9731680"
                     /translation="MSRHRKLTDADVTPESLFHQRRTVLKALGLTAATLSLSSGARAD
                     LLNWFQGKQAPVAPPGKPLAFSQPPQWRPELALTPEDKVTGYNNFYEFGLDKADPAAN
                     AGGLKTEGWKVRIDGEVAKPITLDIDDIRRRFALEERIYRFRCVEAWSMVIPWVGFEL
                     SQLIKLAEPTSDARYVAFQTLYDPAQMPGQKDSFVGGGLDYPYVEGLRMDEAMHPLTL
                     LAVGVYGKTLPPQNGAPIRLVTPWKYGFKNIKSIVHIRLTRQPPPSTWNLSAPNEYGF
                     YANVNPNVDHPRWSQASERVIGAGGLLNVQRQPTLMFNGYADQVAALYQGLDLRANF"
     misc_feature    complement(314978..315976)
                     /gene="yedY"
                     /locus_tag="Dda3937_04444"
                     /note="TMAO/DMSO reductase; Reviewed; Region: PRK05363"
                     /db_xref="CDD:235431"
     misc_feature    complement(315065..315925)
                     /gene="yedY"
                     /locus_tag="Dda3937_04444"
                     /note="Sulfite oxidase and related enzymes [General
                     function prediction only]; Region: COG2041"
                     /db_xref="CDD:224952"
     misc_feature    complement(order(315224..315229,315233..315235,
                     315242..315244,315266..315268,315281..315283,
                     315368..315370,315542..315544,315707..315709,
                     315713..315715,315719..315721))
                     /gene="yedY"
                     /locus_tag="Dda3937_04444"
                     /note="Moco binding site; other site"
                     /db_xref="CDD:238198"
     misc_feature    complement(315542..315544)
                     /gene="yedY"
                     /locus_tag="Dda3937_04444"
                     /note="metal coordination site [ion binding]; other site"
                     /db_xref="CDD:238198"
     gene            complement(316196..317182)
                     /gene="yhdH"
                     /locus_tag="Dda3937_00660"
                     /db_xref="GeneID:9731681"
     CDS             complement(316196..317182)
                     /gene="yhdH"
                     /locus_tag="Dda3937_00660"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, Zn-dependent and NAD(P)-binding
                     protein"
                     /protein_id="YP_003881056.1"
                     /db_xref="GI:307129040"
                     /db_xref="ASAP:ABF-0015647"
                     /db_xref="ERIC:ABF-0015647"
                     /db_xref="GeneID:9731681"
                     /translation="MRALVLRQQNGLTLADVNTLEPSQLPDGDVTVDVDWSGINYKDA
                     LAITGKGKIIRQFPMVPGIDFAGTVRHSDHPDFKAGQPVVLTGWGVGENHWGGLAEQA
                     RVRADWLVPLPQGLTPRQAMIIGTAGFTAMLCVMALEEGGVTPASGEIVVSGASGGVG
                     STAVALLHALGYQVTAISGRADNSAYLQQLGAHQVLDRKEFAVAGRPLEKQRWAGAID
                     TVGDQVLATLLTQMHYGATVAACGLAGGVSLPATVMPFILRNVRLQGVDSVMTPRARR
                     EEAWRRLAALLPAAFYEQVTQEITLEQVPTTAAALLENRVTGRTLVRVGTAD"
     misc_feature    complement(316211..317182)
                     /gene="yhdH"
                     /locus_tag="Dda3937_00660"
                     /note="Yhdh putative quinone oxidoreductases; Region:
                     MDR_yhdh; cd08288"
                     /db_xref="CDD:176248"
     misc_feature    complement(316211..317179)
                     /gene="yhdH"
                     /locus_tag="Dda3937_00660"
                     /note="putative quinone oxidoreductase, YhdH/YhfP family;
                     Region: oxido_YhdH; TIGR02823"
                     /db_xref="CDD:234026"
     misc_feature    complement(order(316235..316237,316241..316243,
                     316250..316252,316376..316387,316448..316462,
                     316523..316528,316589..316591,316643..316651,
                     316706..316717,316721..316723,316793..316795,
                     316802..316807,317060..317065))
                     /gene="yhdH"
                     /locus_tag="Dda3937_00660"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:176248"
     misc_feature    complement(order(316370..316375,316382..316405,
                     316409..316417,316421..316432,316436..316438,
                     316454..316465,316481..316483,316562..316564))
                     /gene="yhdH"
                     /locus_tag="Dda3937_00660"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176248"
     gene            317346..319292
                     /gene="yhdA"
                     /locus_tag="Dda3937_00661"
                     /gene_synonym="csrD"
                     /db_xref="GeneID:9731682"
     CDS             317346..319292
                     /gene="yhdA"
                     /locus_tag="Dda3937_00661"
                     /gene_synonym="csrD"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="CsrB/C sRNA degradation factor"
                     /protein_id="YP_003881057.1"
                     /db_xref="GI:307129041"
                     /db_xref="ASAP:ABF-0015649"
                     /db_xref="ERIC:ABF-0015649"
                     /db_xref="GeneID:9731682"
                     /translation="MGLTVRISILMTMLTTLAVVLMLVSSIFSFVCYSQQRMEHQLRA
                     VAASIDQALLVQPPDSIQFWLPAVMKAAGIVELEIRDGHESLYLLRLPEMLSDGADRA
                     LLYRHTRLSLLHHTDVKVNVTYVDPLFGTPRYLKSTLSIVLVILVIAVTVFHGVRWLR
                     RQMAGQEQLERRARRILAGERDTVMHGSVHEWPATASGALDQLLLDLAEAREARSRVD
                     TLIRSFAAQDAQTGLNNRLFFENQLATQLEDPEDVGTHGVVMMIRLPDFDTLQETHGY
                     GGVLEEYRNTLINLLSTFVLRYPAALLARYYHSDFTVLLPHRTLKEADSIASQLVKAI
                     DILPVTPLIDREDILHIGISAYHGGQTTEQVMESVEDATRNAVLQGGNGWCVYDRRVP
                     EKGRGSVKWRTLLEHTLLRGGPRLYQKPAITRDGEVHHREMFSRIYDGTQELLEAEYM
                     PLVRQLGLTSGYDRQLINRVIALTVSWQDSVLAFPITVDSLLQRPFLRWLRETLLQCP
                     KRQRERLLFELAEADVCQYIGRLRPILAMITGLGCRLAVTQAGLTLVSTAYIKSLQVE
                     VIKLHPGLVRSLDKRPENQLFVSSLTEACKGTHAQVFAAGVRTREEWQTLLDKGVCGG
                     QGDLFAASEPVSNTLKKYSPRTYV"
     misc_feature    317346..319250
                     /gene="yhdA"
                     /locus_tag="Dda3937_00661"
                     /gene_synonym="csrD"
                     /note="regulatory protein CsrD; Provisional; Region:
                     PRK11059"
                     /db_xref="CDD:236833"
     misc_feature    318018..318506
                     /gene="yhdA"
                     /locus_tag="Dda3937_00661"
                     /gene_synonym="csrD"
                     /note="diguanylate cyclase; Region: GGDEF; smart00267"
                     /db_xref="CDD:128563"
     misc_feature    order(318132..318149,318270..318272,318453..318455)
                     /gene="yhdA"
                     /locus_tag="Dda3937_00661"
                     /gene_synonym="csrD"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143637"
     misc_feature    order(318132..318134,318270..318272)
                     /gene="yhdA"
                     /locus_tag="Dda3937_00661"
                     /gene_synonym="csrD"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143637"
     misc_feature    318558..319256
                     /gene="yhdA"
                     /locus_tag="Dda3937_00661"
                     /gene_synonym="csrD"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            319289..319513
                     /locus_tag="Dda3937_04445"
                     /db_xref="GeneID:9731683"
     CDS             319289..319513
                     /locus_tag="Dda3937_04445"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881058.1"
                     /db_xref="GI:307129042"
                     /db_xref="ASAP:ABF-0046868"
                     /db_xref="ERIC:ABF-0046868"
                     /db_xref="GeneID:9731683"
                     /translation="MMSKSEQISVEYRRHSVADRFAERGGAHENVRFYVGGSRNFRGQ
                     LATIPAAARRIAVLQAFIIMAICANIIFSP"
     gene            319607..320650
                     /gene="mreB"
                     /locus_tag="Dda3937_00662"
                     /gene_synonym="envB; mon; rodY"
                     /db_xref="GeneID:9731684"
     CDS             319607..320650
                     /gene="mreB"
                     /locus_tag="Dda3937_00662"
                     /gene_synonym="envB; mon; rodY"
                     /function="MreB, an actin homolog, is a shape-determining
                     factor in rod-shaped prokaryotic cells"
                     /function="5.1 cell processes; cell division"
                     /function="5.6.4 cell processes; protection; drug
                     resistance/sensitivity"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall structural complex MreBCD, actin-like
                     component MreB"
                     /protein_id="YP_003881059.1"
                     /db_xref="GI:307129043"
                     /db_xref="ASAP:ABF-0015652"
                     /db_xref="ERIC:ABF-0015652"
                     /db_xref="GeneID:9731684"
                     /translation="MFKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQD
                     RAGSPKSVAAVGHEAKQMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNS
                     FMRPSPRVLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATG
                     SMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERI
                     KHEIGSAYPGDEVREIEVRGRNLAEGVPRGFNLNSNEILEALQEPLTGIVSAVMVALE
                     QCPPELASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALE
                     MIDMHGGDLFSEE"
     misc_feature    319622..320641
                     /gene="mreB"
                     /locus_tag="Dda3937_00662"
                     /gene_synonym="envB; mon; rodY"
                     /note="rod shape-determining protein MreB; Provisional;
                     Region: PRK13927"
                     /db_xref="CDD:237562"
     misc_feature    319643..320617
                     /gene="mreB"
                     /locus_tag="Dda3937_00662"
                     /gene_synonym="envB; mon; rodY"
                     /note="MreB and similar proteins; Region: MreB_like;
                     cd10225"
                     /db_xref="CDD:212668"
     misc_feature    order(319652..319654,319658..319669,319841..319843,
                     320033..320035,320099..320101,320105..320116,
                     320177..320182,320252..320254,320261..320266,
                     320489..320497,320501..320506,320570..320572,
                     320579..320581)
                     /gene="mreB"
                     /locus_tag="Dda3937_00662"
                     /gene_synonym="envB; mon; rodY"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212668"
     misc_feature    order(319652..319654,320099..320101)
                     /gene="mreB"
                     /locus_tag="Dda3937_00662"
                     /gene_synonym="envB; mon; rodY"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212668"
     misc_feature    order(319730..319732,319790..319792,319814..319816,
                     320078..320080,320084..320086,320144..320146,
                     320240..320242,320246..320248,320315..320317,
                     320339..320341,320348..320350,320438..320440,
                     320447..320449,320543..320545,320615..320617)
                     /gene="mreB"
                     /locus_tag="Dda3937_00662"
                     /gene_synonym="envB; mon; rodY"
                     /note="putative protofilament interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:212668"
     misc_feature    order(320060..320065,320087..320089,320465..320473,
                     320546..320548,320552..320554,320561..320563)
                     /gene="mreB"
                     /locus_tag="Dda3937_00662"
                     /gene_synonym="envB; mon; rodY"
                     /note="RodZ interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212668"
     gene            320754..321890
                     /gene="mreC"
                     /locus_tag="Dda3937_00663"
                     /db_xref="GeneID:9731685"
     CDS             320754..321890
                     /gene="mreC"
                     /locus_tag="Dda3937_00663"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall structural complex MreBCD
                     transmembrane protein MreC"
                     /protein_id="YP_003881060.1"
                     /db_xref="GI:307129044"
                     /db_xref="ASAP:ABF-0015654"
                     /db_xref="ERIC:ABF-0015654"
                     /db_xref="GeneID:9731685"
                     /translation="MKPIFSRGPSLQLRLFLAVIIAIVIIFADSRLGTFVKIRTYMDT
                     AVSPFYFLANGPRAMLDNLSANLTSREQLERENTALRQELLLKNSDLLLLGQFRQENA
                     RLRELLGSPLRQEEQKMVTQVLSSGSDPYSDQVVIDKGNVNGVYEGQPVISDKGVVGQ
                     VVAVGQFTSRVLLICDASHALPIQVLRNDIRVIAAGNGCTEDLQLEHLPNNTDIRVGD
                     VLVTSGLGGRFPEGYPVAVVSSVKVDTQRAYTVIQARPTAELQRLRYLLLMWGVDSNS
                     RTALPPDDVHRVANERLMQMMPHVLPSPEEMGPPAPANTQAPDFVGPPAPPAKTTPVK
                     TNSAAPSKPANATSPRNATTPAANPAAPSQQRATPAPGASGGSR"
     misc_feature    320766..321587
                     /gene="mreC"
                     /locus_tag="Dda3937_00663"
                     /note="rod shape-determining protein MreC; Region: MreC;
                     cl19252"
                     /db_xref="CDD:267605"
     gene            321887..322375
                     /gene="mreD"
                     /locus_tag="Dda3937_00664"
                     /db_xref="GeneID:9731686"
     CDS             321887..322375
                     /gene="mreD"
                     /locus_tag="Dda3937_00664"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.1 cell structure; membrane"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall structural complex MreBCD
                     transmembrane protein MreD"
                     /protein_id="YP_003881061.1"
                     /db_xref="GI:307129045"
                     /db_xref="ASAP:ABF-0015655"
                     /db_xref="ERIC:ABF-0015655"
                     /db_xref="GeneID:9731686"
                     /translation="MNSYRRHGHWIIWLSFLVAMVLQIMPWPDDLYMYRPSWLTLILI
                     YWVMALPHRVNVGTGFVLGMITDLILGSTLGVRALGLSIIAYLVAFKFQLFRNMALWQ
                     QALIVMLLSLVLDLLVFWAEFLVINVSLRPEIFWNSVVDGVLWPWLFLLMRKIRRQFA
                     VQ"
     misc_feature    321887..322372
                     /gene="mreD"
                     /locus_tag="Dda3937_00664"
                     /note="rod shape-determining protein MreD; Provisional;
                     Region: PRK11060"
                     /db_xref="CDD:182936"
     gene            322400..322993
                     /gene="yhdE"
                     /locus_tag="Dda3937_00665"
                     /db_xref="GeneID:9731687"
     CDS             322400..322993
                     /gene="yhdE"
                     /locus_tag="Dda3937_00665"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="5.1 cell processes; cell division"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881062.1"
                     /db_xref="GI:307129046"
                     /db_xref="ASAP:ABF-0015656"
                     /db_xref="ERIC:ABF-0015656"
                     /db_xref="GeneID:9731687"
                     /translation="MTDLYLASASPRRRELLTLLELSFDILKIDVAEQRQPDETPEQY
                     VSRLARDKAAAGVAVAPEDLPVLGADTIVVLNGQVLEKPRDEDDAARILRALSGQRHQ
                     VMTALALADRRESVSARVVTEVQFRTLSDDEITRYIASGEPMDKAGAYGIQGKGGCFV
                     KSIFGSYHAVVGLPLVETLELFTHFSARRKARGTHDR"
     misc_feature    322409..322942
                     /gene="yhdE"
                     /locus_tag="Dda3937_00665"
                     /note="Nucleotide binding protein Maf. Maf has been
                     implicated in inhibition of septum formation in
                     eukaryotes, bacteria and archaea, but homologs in
                     B.subtilis and S.cerevisiae are nonessential for cell
                     division. Maf has been predicted to be a nucleotide-
                     or...; Region: Maf; cd00555"
                     /db_xref="CDD:238310"
     misc_feature    order(322421..322423,322436..322438,322496..322498,
                     322553..322555,322607..322609,322643..322645)
                     /gene="yhdE"
                     /locus_tag="Dda3937_00665"
                     /note="active site"
                     /db_xref="CDD:238310"
     misc_feature    order(322535..322537,322742..322756)
                     /gene="yhdE"
                     /locus_tag="Dda3937_00665"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238310"
     gene            322983..324452
                     /gene="rng"
                     /locus_tag="Dda3937_00666"
                     /gene_synonym="cafA"
                     /db_xref="GeneID:9731688"
     CDS             322983..324452
                     /gene="rng"
                     /locus_tag="Dda3937_00666"
                     /gene_synonym="cafA"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /function="5.1 cell processes; cell division"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="cytoplasmic axial filament protein CafA and
                     ribonuclease G"
                     /protein_id="YP_003881063.1"
                     /db_xref="GI:307129047"
                     /db_xref="ASAP:ABF-0015657"
                     /db_xref="ERIC:ABF-0015657"
                     /db_xref="GeneID:9731688"
                     /translation="MTAELLVNITPSETRVAYIDGGILQEIHIEREARRGIVGNIYKG
                     RVSRVLPGMQAAFVDIGLDKAAFLHASDIMPHTECVAGDEQKNFHVRDIAELVRQGQD
                     LMVQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESEAERERLKKTVAD
                     YCDEQGGFIIRTAAEGVGEEELSQDAAFLKRLWTKVMERKKRNQTKCKLYGELALAHR
                     ILRDFAGASLDRIRVDSKLTYDSLLEFTAEYIPEMTSKLEHYSGKQPIFDLYDVENEI
                     QRALDRKVELKSGGYLIIDQTEAMTTIDINTGAFVGHRNLDETIFNTNIEATQAIARQ
                     LRLRNLGGIIIIDFIDMGNEEHRRRVLHSLEQALSKDRVKTGISGFSQLGLVEMTRKR
                     TRESIEHVLCSECPTCHGRGSVKTVETVCYEIMREIVRVHHAYDSDRFLVYASPAVGD
                     ALKSDESHALAEVEIFVGKQVKVQIEPLYSQEQFDVVMM"
     misc_feature    322983..324449
                     /gene="rng"
                     /locus_tag="Dda3937_00666"
                     /gene_synonym="cafA"
                     /note="ribonuclease G; Provisional; Region: PRK11712"
                     /db_xref="CDD:183285"
     misc_feature    323076..323366
                     /gene="rng"
                     /locus_tag="Dda3937_00666"
                     /gene_synonym="cafA"
                     /note="S1_RNase_E: RNase E and RNase G, S1-like
                     RNA-binding domain. RNase E is an essential
                     endoribonuclease in the processing and degradation of RNA.
                     In addition to its role in mRNA degradation, RNase E has
                     also been implicated in the processing of rRNA, and...;
                     Region: S1_RNase_E; cd04453"
                     /db_xref="CDD:239900"
     misc_feature    order(323109..323111,323274..323276,323286..323288)
                     /gene="rng"
                     /locus_tag="Dda3937_00666"
                     /gene_synonym="cafA"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239900"
     misc_feature    order(323181..323183,323307..323309,323316..323318,
                     323325..323330,323358..323360)
                     /gene="rng"
                     /locus_tag="Dda3937_00666"
                     /gene_synonym="cafA"
                     /note="oligonucleotide binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239900"
     misc_feature    323352..324164
                     /gene="rng"
                     /locus_tag="Dda3937_00666"
                     /gene_synonym="cafA"
                     /note="Ribonuclease E/G family; Region: RNase_E_G;
                     pfam10150"
                     /db_xref="CDD:255792"
     gene            324521..328399
                     /gene="yhdP"
                     /locus_tag="Dda3937_00667"
                     /db_xref="GeneID:9731689"
     CDS             324521..328399
                     /gene="yhdP"
                     /locus_tag="Dda3937_00667"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881064.1"
                     /db_xref="GI:307129048"
                     /db_xref="ASAP:ABF-0015658"
                     /db_xref="ERIC:ABF-0015658"
                     /db_xref="GeneID:9731689"
                     /translation="MTNNEETCVRRLPGIKRLPGIAAATGAILIVLAALLVSGLRMVL
                     PTLDTFRPQVVAWAQSVTGLPMEVESLSGSWETFGPTLDITNLRIHHPDAEWQSERIS
                     VALDVWQSLLHLKWKFRDLTFYHLQVDIKTPIDPDRQRSRTWEPDQLGSLFLRQFDHF
                     DLRNSRIRFLTPAGTQAELQIPQLTWLNGKNRHRAEGQISLSSFNGQHGVVQLRMDLR
                     DEQGWLNNGVVYLQADNIDMKPWLGRWIRNNTGLESANFSLAAWLQVREGDMYGGDLL
                     LSQGDASWRDGDTLHRLGINGMTLHASRYQNGWQLDVPALNLSTDGVDWPKGQLSALW
                     LPADTQLLGPDRLAELRIRGRHLALERLGPLLPLLSTATPELKTRWQALQPQGQLTAL
                     ALDIPLQQPEQTRFQANWQDVGWKNWQLLPGANHVSGEAAGSLARGRVRVNLAQSTLP
                     YQDMFRAPLDIRQADATLDWRSDSQGWELWGQGLDVRSRSLWANGDFRYRHPAQGEPR
                     LDILAGIRLGDAADAWRYYPEPFMGKDLVNYLTGAIKSGQVDNATLVFAGNPAQFPFE
                     HQEGQFQVWVPLEKSRFEFQPGWPALDNLNISLNFLNNGLWMSAPHVMLGDAEGRNVN
                     AVIPDYSKETLLIDGDISGSGKEVSDYFDQTPLKISLGGALTQIQIGGEVQGNLHLDI
                     PLNGGLVKASGDVALNNNHLFIKPLDVSLQSVSGAFHYDNGNLSSQTLQGRWLEQPLT
                     FNFSTQEQEKAFLVNVGLQGNWAASRLPELPKPVAAALNGNANWQSTVQVTLPHQGPS
                     SYDVTVQGDLKEVSSHLPSPLNKAGGAALGLQVSAKGDERGFSLTGSLGKSQSFNSQW
                     LLKDNKVMLTRAAWQEGAKPPPLPDDSSLTLALPPLDGERWLALLPGVRNAVSAQAGA
                     SRFQWPDRVTLTTPELKILGQQWHDLMFTSRSQNGGSEITAAGREIDGRLLIPTSGLW
                     RGDVRYLYYNPQWQGDDATNPAALAEKKSPLNDPSIRFEDWPALQFDCRECWLMGQNV
                     GQVKGTLQPEPNKLVLANGLVDNGKAKLTLDGSWQESGEGTRTAIKGQLSGGSLSDNA
                     DWLGLATPLRAGAFKIDYDLYWHGSPWAPHIPSLSGILKTDIGKGEIVNVGTGQAGQL
                     LRLVSFDALLRKLQFDFSDTFGKGFYFDSVRSTAWIKDGVLHTDNLLVDGLEADIAMK
                     GDIDLVKRELSMEAVVAPEISATVGVATAFAVNPVIGAAVFAASKVLAPLWSKISLIR
                     YHISGSVDQPKIQEVVREPQKAKAAEAAGQ"
     misc_feature    325295..328381
                     /gene="yhdP"
                     /locus_tag="Dda3937_00667"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10899"
                     /db_xref="CDD:236789"
     misc_feature    326069..326926
                     /gene="yhdP"
                     /locus_tag="Dda3937_00667"
                     /note="Protein of unknown function; Region: DUF3971;
                     pfam13116"
                     /db_xref="CDD:257507"
     misc_feature    327608..328339
                     /gene="yhdP"
                     /locus_tag="Dda3937_00667"
                     /note="AsmA-like C-terminal region; Region: AsmA_2;
                     pfam13502"
                     /db_xref="CDD:257822"
     gene            328446..329891
                     /gene="tldD"
                     /locus_tag="Dda3937_00668"
                     /db_xref="GeneID:9731690"
     CDS             328446..329891
                     /gene="tldD"
                     /locus_tag="Dda3937_00668"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="TldD protein"
                     /protein_id="YP_003881065.1"
                     /db_xref="GI:307129049"
                     /db_xref="ASAP:ABF-0015659"
                     /db_xref="ERIC:ABF-0015659"
                     /db_xref="GeneID:9731690"
                     /translation="MSLTFVSEQLLTANKLSHQDLQSVLGTLSERRIDYADLYFQSSY
                     HESWVLEDRIIKDGSYHIDQGVGIRAINGEKTGFAYADQITLNALQQSAQAARSIVRE
                     QGNGAVKTLGEVPHRGLYPQANPLDSLTREEKIALLQRVDATARAADARVQEVTASLT
                     GVYELILVAATDGTLAADVRPLVRLSVSVLVEEDGRRERGSSGGGARTGYDYFWQQAD
                     GEVRAEAWAKEAVRMALVNLSAVAAPAGSMPVVLGAGWPGVLLHEAVGHGLEGDFNRR
                     GTSVFSGQVGKLVASELCTVVDDGTLEGRRGSLAVDDEGVPGQYNVLIENGILKGYMQ
                     DKLNARLMGVAPTGNGRRESYAHLPMPRMTNTYMLAGKSTPEEIIASVDYGLYAPNFG
                     GGQVDITSGKFVFSTSEAYLIENGRVTKPVKGATLIGSGIEAMQQISMVGNDLALDRG
                     VGVCGKEGQSLPVGVGQPTLKLDNITVGGTA"
     misc_feature    328446..329888
                     /gene="tldD"
                     /locus_tag="Dda3937_00668"
                     /note="protease TldD; Provisional; Region: tldD; PRK10735"
                     /db_xref="CDD:182685"
     gene            complement(329980..330924)
                     /gene="aaeR"
                     /locus_tag="Dda3937_00669"
                     /gene_synonym="qseA; tdrA; yhcS"
                     /db_xref="GeneID:9731691"
     CDS             complement(329980..330924)
                     /gene="aaeR"
                     /locus_tag="Dda3937_00669"
                     /gene_synonym="qseA; tdrA; yhcS"
                     /function="In enterohemorrhagic E. coli, QseA controls the
                     Ler regulator that regulates other genes within the locus
                     of enterocyte effacement (LEE)"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /note="QseA is regulated by quorum sensing;
                     Qsea belongs to the lysR family of transcriptional
                     regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003881066.1"
                     /db_xref="GI:307129050"
                     /db_xref="ASAP:ABF-0015660"
                     /db_xref="ERIC:ABF-0015660"
                     /db_xref="GeneID:9731691"
                     /translation="MERLKSMSVFARVVEFGSFTAAARQLQMSVSAVSQTVTRLEDEL
                     QVKLLNRSTRSIGLTEAGRIYYHGCRRMLHEAQEVHEQLYAFNNTPIGTLRIGSSSTM
                     AQNVLANMTTDMLKEYPGLSVNLVCGIPAPDLIADGLDIVIRVGALQDSSLYSTRLGS
                     MPMVVCAARSYLTQHGSPEKPADVSNISWLEYSVRPDSEFELIAPEGITTRLTPQGRF
                     VTNDPVTLIRWLKNGAGIAYVPLMWVFEEIKRGEIEILFPRYHSDPRPVYALYTRRDN
                     LPLKVQVCINYLTEYFNKVALIYQGYRQEHSQAEPPQK"
     misc_feature    complement(330007..330924)
                     /gene="aaeR"
                     /locus_tag="Dda3937_00669"
                     /gene_synonym="qseA; tdrA; yhcS"
                     /note="transcriptional regulator; Provisional; Region:
                     PRK10632"
                     /db_xref="CDD:182601"
     misc_feature    complement(330736..330915)
                     /gene="aaeR"
                     /locus_tag="Dda3937_00669"
                     /gene_synonym="qseA; tdrA; yhcS"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(330061..330651)
                     /gene="aaeR"
                     /locus_tag="Dda3937_00669"
                     /gene_synonym="qseA; tdrA; yhcS"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(330124..330126,330205..330207,
                     330256..330258,330442..330444,330448..330450,
                     330490..330492,330607..330609,330619..330621))
                     /gene="aaeR"
                     /locus_tag="Dda3937_00669"
                     /gene_synonym="qseA; tdrA; yhcS"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(330229..330231,330238..330243,
                     330262..330276,330361..330363,330544..330564,
                     330568..330570,330580..330582,330589..330594,
                     330598..330603,330613..330618))
                     /gene="aaeR"
                     /locus_tag="Dda3937_00669"
                     /gene_synonym="qseA; tdrA; yhcS"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            331263..331466
                     /gene="aaeX"
                     /locus_tag="Dda3937_00670"
                     /gene_synonym="yhcR"
                     /db_xref="GeneID:9731692"
     CDS             331263..331466
                     /gene="aaeX"
                     /locus_tag="Dda3937_00670"
                     /gene_synonym="yhcR"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein of efflux system"
                     /protein_id="YP_003881067.1"
                     /db_xref="GI:307129051"
                     /db_xref="ASAP:ABF-0015661"
                     /db_xref="ERIC:ABF-0015661"
                     /db_xref="GeneID:9731692"
                     /translation="MNSLPVMVLFGLSFPPVFFVLLITLALFFICIRLLHPTGIYDRV
                     WHPALFNTALFVCLFYLLFRFGL"
     misc_feature    331263..331463
                     /gene="aaeX"
                     /locus_tag="Dda3937_00670"
                     /gene_synonym="yhcR"
                     /note="efflux system membrane protein; Provisional;
                     Region: PRK11594"
                     /db_xref="CDD:183220"
     gene            331474..332421
                     /gene="aaeA"
                     /locus_tag="Dda3937_00671"
                     /gene_synonym="yhcQ"
                     /db_xref="GeneID:9731693"
     CDS             331474..332421
                     /gene="aaeA"
                     /locus_tag="Dda3937_00671"
                     /gene_synonym="yhcQ"
                     /function="4.8.A.1 transport; Group Translocators;
                     Accessory Factors Involved in Transport; The Membrane
                     Fusion protein (MFP) Family"
                     /function="4.S.126 transport; substrate; multidrug"
                     /function="5.6.4 cell processes; protection; drug
                     resistance/sensitivity"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /codon_start=1
                     /transl_table=11
                     /product="p-hydroxybenzoic acid efflux pump subunit AaeA"
                     /protein_id="YP_003881068.1"
                     /db_xref="GI:307129052"
                     /db_xref="ASAP:ABF-0015662"
                     /db_xref="ERIC:ABF-0015662"
                     /db_xref="GeneID:9731693"
                     /translation="MKASVVKVMIKKFSRMAITLLLVLLAAVALVRVWSFYTESPWTR
                     DARFSADVVAIAPDVSGLLTDVNVQDNQPVKQGDVLFVIDQPRYQQALEQAQADVAYY
                     QALADEKKRESARRQRLGVQAMSREEIEQSGNALQTTLHQLAKAQAELELAKLDLART
                     VVRAPADGWITNLHVHAGEYITRGATAVALVKKDSFYLLAYMEETKLAGVRPGYRVEI
                     TPLGSNQILFGAVDSIAAGVTNSSSSADTKGLATVDSNLEWVRLAQRVPVKIRLEQQW
                     GDLYPAGTTATVVVTGEHTRNTKPMSPLLQLLHRLREFG"
     misc_feature    331489..332418
                     /gene="aaeA"
                     /locus_tag="Dda3937_00671"
                     /gene_synonym="yhcQ"
                     /note="p-hydroxybenzoic acid efflux subunit AaeA;
                     Provisional; Region: PRK10559"
                     /db_xref="CDD:182548"
     misc_feature    331624..331773
                     /gene="aaeA"
                     /locus_tag="Dda3937_00671"
                     /gene_synonym="yhcQ"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    331954..332259
                     /gene="aaeA"
                     /locus_tag="Dda3937_00671"
                     /gene_synonym="yhcQ"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            332348..334384
                     /gene="aaeB"
                     /locus_tag="Dda3937_00672"
                     /gene_synonym="yhcP"
                     /db_xref="GeneID:9731694"
     CDS             332348..334384
                     /gene="aaeB"
                     /locus_tag="Dda3937_00672"
                     /gene_synonym="yhcP"
                     /function="6.1 cell structure; membrane"
                     /function="4.9.B.4 transport; Transporters of Unknown
                     Classification;  uncharacterized transport protein; The
                     Efflux Transporter (PET) Family"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="p-hydroxybenzoic acid efflux pump subunit AaeB"
                     /protein_id="YP_003881069.1"
                     /db_xref="GI:307129053"
                     /db_xref="ASAP:ABF-0015663"
                     /db_xref="ERIC:ABF-0015663"
                     /db_xref="GeneID:9731694"
                     /translation="MSIPATPSQCRRYCNCCIACASSVKRASMMNSPAFLRLRFAFKL
                     STAIVLSLVLGFHLQLETPRWATLTAAIVAAGPAFAAGGDPFSGAIRHRGMLRVIGTF
                     IGCIGALVIIIATVRAPVVMLMLCCLWAGVCVWISSLVKVENAYVFALAGYTALIIIV
                     TSQSAPLRIPQFAVERCSEIVLGIVCAILADLLFSPRSIKQDIDRAVNELLVGQYQLL
                     QRCVNGMTKEELDAAWNGLVRKTHAINGMRSVLMMESSRWQGANRRIKTLLTQSWIMI
                     TQACETRLTLQDHPDAVKGAIAMMLEQPADTPAEMRRRLRQLRHLAAAHSRSLPPTLV
                     SWLAAAARYQLLAKGVRTNVRISQSEAALLDADVPVKASSAETHHAMINGVRTGIATA
                     LGCLFWLLTGWTSGSVCMVMIAVVTSLAMRLPNPLMAAKDFLVGTLVALPLGAVLFMM
                     VLPSTQQSLLLLCLSLGGVAFVIGIEVQKRRLGSLGALASTINILVLDNPMTFNLAQF
                     LDNAIGQIIGCFLALIVILLIRDNTRDRTGRTLLNRFVFGAVSALSTRPARRRENHLP
                     ALYQHLFLLLNLFPGEIGKYRLALSLIMMHQRLRTLELPVSPSLSAFHRQMRATAEQV
                     IDATRDRSHHFSRLLAQMDEYQHLLRDHQVSDDAIDAVGRLTALLHRHKHALGD"
     misc_feature    332435..334381
                     /gene="aaeB"
                     /locus_tag="Dda3937_00672"
                     /gene_synonym="yhcP"
                     /note="p-hydroxybenzoic acid efflux subunit AaeB;
                     Provisional; Region: PRK10631"
                     /db_xref="CDD:182600"
     misc_feature    332456..334375
                     /gene="aaeB"
                     /locus_tag="Dda3937_00672"
                     /gene_synonym="yhcP"
                     /note="Fusaric acid resistance protein family; Region:
                     FUSC; pfam04632"
                     /db_xref="CDD:252713"
     gene            complement(334391..334924)
                     /locus_tag="Dda3937_00673"
                     /db_xref="GeneID:9731695"
     CDS             complement(334391..334924)
                     /locus_tag="Dda3937_00673"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881070.1"
                     /db_xref="GI:307129054"
                     /db_xref="ASAP:ABF-0015664"
                     /db_xref="ERIC:ABF-0015664"
                     /db_xref="GeneID:9731695"
                     /translation="MQATTREDRSRMTTLFMYYVGGRAQGANIELHDVQFAAVEHPQD
                     GFPLLKANWFGDKSQVHVDSYTPCHWADGYDITLSRQPFQGREKLWFINMGGYLPHDP
                     AEVHQFGLFVATDAEQAKQRAKAVLLTEVFQQHKDDLRDVDDCLPLTLLDRWHIHLTA
                     NPTGRVMPPQWQGYHPL"
     misc_feature    complement(334691..334846)
                     /locus_tag="Dda3937_00673"
                     /note="Domain of Unknown Function (DUF1543); Region:
                     DUF1543; pfam07566"
                     /db_xref="CDD:148918"
     misc_feature    complement(334490..334618)
                     /locus_tag="Dda3937_00673"
                     /note="Domain of Unknown Function (DUF1543); Region:
                     DUF1543; pfam07566"
                     /db_xref="CDD:148918"
     gene            335008..335634
                     /locus_tag="Dda3937_00674"
                     /db_xref="GeneID:9731696"
     CDS             335008..335634
                     /locus_tag="Dda3937_00674"
                     /function="4.2.A.76 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Resistance to homoserine/Threonine (RhtB) Family"
                     /function="4.S.12 transport; substrate; amino acid"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine/homoserine lactone efflux protein"
                     /protein_id="YP_003881071.1"
                     /db_xref="GI:307129055"
                     /db_xref="ASAP:ABF-0015665"
                     /db_xref="ERIC:ABF-0015665"
                     /db_xref="GeneID:9731696"
                     /translation="MTLHLWLVYVGVITALIAVPGPSALLSMTHGLRYGQRRALATVL
                     GGATGSLVLMTASALGLGAILAASATAFLVLKVVGAAYLIWLGISAWRTRESTLTPSV
                     EVEAIAPGLLKLYHRGFMVGVSNPKDILFFAALFPNFIDTGAPQAMQFALLALTWVVL
                     DCSIMFSYACMGNRVSALFAHPRRLRLFNRATGTLFIFAGSALVASTK"
     misc_feature    335008..335631
                     /locus_tag="Dda3937_00674"
                     /note="LysE type translocator; Region: LysE; cl00565"
                     /db_xref="CDD:260502"
     gene            complement(336038..336586)
                     /gene="yjgA"
                     /locus_tag="Dda3937_00675"
                     /db_xref="GeneID:9731697"
     CDS             complement(336038..336586)
                     /gene="yjgA"
                     /locus_tag="Dda3937_00675"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881072.1"
                     /db_xref="GI:307129056"
                     /db_xref="ASAP:ABF-0015666"
                     /db_xref="ERIC:ABF-0015666"
                     /db_xref="GeneID:9731697"
                     /translation="MNKHPEDWQDDVPDASQDDDDEEIIWVSKSEIKRDAEALKALGT
                     ELVELGKNALERIPLDEDLRAAIELAQRITKEGRRRQLQLIGKMLRARDPEPIQTALD
                     KLRNRHNQQVSLFHKLEQLRDRLIAEGDGAVPDILALYPQADRQQLRSLVRNAQKEKA
                     ANKPPKSARLIFQYLRELAEAE"
     misc_feature    complement(336047..336556)
                     /gene="yjgA"
                     /locus_tag="Dda3937_00675"
                     /note="hypothetical protein; Provisional; Region:
                     PRK05255"
                     /db_xref="CDD:235377"
     gene            336729..338117
                     /gene="pmbA"
                     /locus_tag="Dda3937_00676"
                     /gene_synonym="mcb; tldE"
                     /db_xref="GeneID:9731698"
     CDS             336729..338117
                     /gene="pmbA"
                     /locus_tag="Dda3937_00676"
                     /gene_synonym="mcb; tldE"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /function="2.3.4 information transfer; protein related;
                     chaperoning, folding"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="3.5 regulation; trigger modulation"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase required for the maturation and
                     secretion of the antibiotic peptide MccB17"
                     /protein_id="YP_003881073.1"
                     /db_xref="GI:307129057"
                     /db_xref="ASAP:ABF-0015668"
                     /db_xref="ERIC:ABF-0015668"
                     /db_xref="GeneID:9731698"
                     /translation="MHHGLSECFLTHYGKSMTIITQVAEQRKVLEQAVSQALELARAG
                     SDAAEVAVTKTTGISVSSRYGEVENVEFNSDGALGITVYYQQRKGSASSTDMSPDAIA
                     RTVQAALDIARYTSVDPCSGPADKDLLAFEAPDLDLFHPAELDADRGIELAAAAEQAA
                     LKADKRITNTEGGSFNSHYGIKVFGNSHGMLQSYCSSRHSMSVSVIAEHNGDMERDYA
                     YTIGRALGDLDSPAWVGEECARRTLARLSPRKLATMEAPVMFSSEVATGLFGHLVGAI
                     SGGSVYRKSTFLLDSLGKQILPEWLTIQELPHLRKGLASTPFDSEGVRTEQRDIVKEG
                     VLQTWLLTTYAGRKLGMKSTGHAGGIHNWRIAGRGLDFDGMLKEMGTGLLVTSLMGQG
                     VSAVTGDYSRGAAGFWVENGEIQYPVSEITIAGNLKDMLRNMVTIGDDIETRSNIQCG
                     SVLLPSMKIAGV"
     misc_feature    336777..338111
                     /gene="pmbA"
                     /locus_tag="Dda3937_00676"
                     /gene_synonym="mcb; tldE"
                     /note="peptidase PmbA; Provisional; Region: PRK11040"
                     /db_xref="CDD:182922"
     gene            complement(338184..338594)
                     /gene="rnk"
                     /locus_tag="Dda3937_00677"
                     /db_xref="GeneID:9731699"
     CDS             complement(338184..338594)
                     /gene="rnk"
                     /locus_tag="Dda3937_00677"
                     /function="1.7.33 metabolism; central intermediary
                     metabolism; nucleotide and nucleoside conversions"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of nucleoside diphosphate kinase"
                     /protein_id="YP_003881074.1"
                     /db_xref="GI:307129058"
                     /db_xref="ASAP:ABF-0015670"
                     /db_xref="ERIC:ABF-0015670"
                     /db_xref="GeneID:9731699"
                     /translation="MDKPHLTISELDAERLDALLEQPAFADTEVAQALSEELDRADIV
                     QPVEIPGDVVTMNSRVRFRDLLTTEEHIRTLVYPAGLKDSREQISVMAPLGAALLGMH
                     VGNSIAWPLPNGEETRIEVMELLYQPEAAGEYHR"
     misc_feature    complement(338187..338594)
                     /gene="rnk"
                     /locus_tag="Dda3937_00677"
                     /note="nucleoside diphosphate kinase regulator;
                     Provisional; Region: PRK05753"
                     /db_xref="CDD:180236"
     misc_feature    complement(338463..338588)
                     /gene="rnk"
                     /locus_tag="Dda3937_00677"
                     /note="Rnk N-terminus; Region: Rnk_N; pfam14760"
                     /db_xref="CDD:258897"
     misc_feature    complement(338217..338450)
                     /gene="rnk"
                     /locus_tag="Dda3937_00677"
                     /note="Transcription elongation factor, GreA/GreB, C-term;
                     Region: GreA_GreB; pfam01272"
                     /db_xref="CDD:250494"
     gene            complement(338775..339047)
                     /gene="npr"
                     /locus_tag="Dda3937_00678"
                     /gene_synonym="ptsO"
                     /db_xref="GeneID:9731700"
     CDS             complement(338775..339047)
                     /gene="npr"
                     /locus_tag="Dda3937_00678"
                     /gene_synonym="ptsO"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="4.8.A.8 transport; Group Translocators;
                     Accessory Factors Involved in Transport; The
                     Phosphotransferase System HPr (HPr) Family"
                     /function="4.S.173 transport; substrate; sugar"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system phosphohistidinoprotein-hexose
                     phosphotransferase Npr"
                     /protein_id="YP_003881075.1"
                     /db_xref="GI:307129059"
                     /db_xref="ASAP:ABF-0015671"
                     /db_xref="ERIC:ABF-0015671"
                     /db_xref="GeneID:9731700"
                     /translation="MTVRQTVEVKNRLGMHARPAMKLFELVQSFDSAVLLRNESGTEA
                     DASSVIAMLMLDSAKGRHIEVEVTGSDEEQALAAVIQLFEAGFDED"
     misc_feature    complement(338799..339032)
                     /gene="npr"
                     /locus_tag="Dda3937_00678"
                     /gene_synonym="ptsO"
                     /note="Histidine-containing phosphocarrier protein
                     (HPr)-like proteins. HPr is a central component of the
                     bacterial phosphoenolpyruvate sugar phosphotransferase
                     system (PTS). The PTS catalyses the phosphorylation of
                     sugar substrates during their translocation...; Region:
                     PTS-HPr_like; cd00367"
                     /db_xref="CDD:238217"
     misc_feature    complement(339021..339032)
                     /gene="npr"
                     /locus_tag="Dda3937_00678"
                     /gene_synonym="ptsO"
                     /note="dimerization domain swap beta strand [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238217"
     misc_feature    complement(order(338886..338891,338898..338909,
                     338964..338966,338973..338975,338985..338990,
                     338994..338999,339003..339005))
                     /gene="npr"
                     /locus_tag="Dda3937_00678"
                     /gene_synonym="ptsO"
                     /note="regulatory protein interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238217"
     misc_feature    complement(339000..339002)
                     /gene="npr"
                     /locus_tag="Dda3937_00678"
                     /gene_synonym="ptsO"
                     /note="active site"
                     /db_xref="CDD:238217"
     misc_feature    complement(338904..338906)
                     /gene="npr"
                     /locus_tag="Dda3937_00678"
                     /gene_synonym="ptsO"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:238217"
     gene            complement(339044..339898)
                     /gene="yhbJ"
                     /locus_tag="Dda3937_00679"
                     /db_xref="GeneID:9731701"
     CDS             complement(339044..339898)
                     /gene="yhbJ"
                     /locus_tag="Dda3937_00679"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide-binding NTPase"
                     /protein_id="YP_003881076.1"
                     /db_xref="GI:307129060"
                     /db_xref="ASAP:ABF-0015672"
                     /db_xref="ERIC:ABF-0015672"
                     /db_xref="GeneID:9731701"
                     /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPELAHTL
                     AERNISAAVSIDVRNLPETPEVLEHALTRLPQSFSPQLLFLDADRNTLIRRYSDTRRL
                     HPLSSKNLSLESAIDEENDLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKREREL
                     TMVFESFGYKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNF
                     IYQTRSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYIAEQLADYFRSRGKNVQSRH
                     RTLEKRKS"
     misc_feature    complement(339053..339898)
                     /gene="yhbJ"
                     /locus_tag="Dda3937_00679"
                     /note="P-loop ATPase protein family; Region: ATP_bind_2;
                     cl15794"
                     /db_xref="CDD:247071"
     misc_feature    complement(339443..339895)
                     /gene="yhbJ"
                     /locus_tag="Dda3937_00679"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     gene            complement(340047..340535)
                     /gene="ptsN"
                     /locus_tag="Dda3937_00680"
                     /db_xref="GeneID:9731702"
     CDS             complement(340047..340535)
                     /gene="ptsN"
                     /locus_tag="Dda3937_00680"
                     /function="4.S.173 transport; substrate; sugar"
                     /function="4.4.A.2 transport; Group Translocators;
                     Phosphotransferase Systems (PEP-dependent PTS); The PTS
                     Fructose-Mannitol (Fru) Family"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.1.4 metabolism; carbon utilization; amines"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system sugar-specific transporter subunit
                     IIA"
                     /protein_id="YP_003881077.1"
                     /db_xref="GI:307129061"
                     /db_xref="ASAP:ABF-0015673"
                     /db_xref="ERIC:ABF-0015673"
                     /db_xref="GeneID:9731702"
                     /translation="MNNEPVMQLSAVLRKECTRSAVHCQSKKRALEIISELAARQLNL
                     PPQMVFEAILTRERMGSTGIGNGIAIPHGKLEDENTLGAVGVFIQLEQPIAFDAIDNQ
                     PVDLLFALLVPTEQCKTHLHTLSLVAKRLADKTVCKRLRAAQSDDELYQIMTEADLSD
                     QP"
     misc_feature    complement(340080..340499)
                     /gene="ptsN"
                     /locus_tag="Dda3937_00680"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    complement(order(340320..340322,340368..340370))
                     /gene="ptsN"
                     /locus_tag="Dda3937_00680"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    complement(340320..340322)
                     /gene="ptsN"
                     /locus_tag="Dda3937_00680"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            complement(340629..340916)
                     /gene="hpf"
                     /locus_tag="Dda3937_00681"
                     /gene_synonym="yhbH"
                     /db_xref="GeneID:9731703"
     CDS             complement(340629..340916)
                     /gene="hpf"
                     /locus_tag="Dda3937_00681"
                     /gene_synonym="yhbH"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.1 regulation; type of regulation;
                     transcriptional level; sigma factors, anti-sigmafactors"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="In E. coli, yhbH is induced by autoinducer 2"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated factor"
                     /protein_id="YP_003881078.1"
                     /db_xref="GI:307129062"
                     /db_xref="ASAP:ABF-0015674"
                     /db_xref="ERIC:ABF-0015674"
                     /db_xref="GeneID:9731703"
                     /translation="MQLNITGHHVEITDALREFVNLKFAKLEQYFDRINQVYVVLKVE
                     KILHIADATIHVNGGELHATSEADDMYAAIDLLIDKLARQLNKHKDKLKQH"
     misc_feature    complement(340644..340913)
                     /gene="hpf"
                     /locus_tag="Dda3937_00681"
                     /gene_synonym="yhbH"
                     /note="RaiA ('ribosome-associated inhibitor A', also known
                     as Protein Y (PY), YfiA, and SpotY,  is a stress-response
                     protein that binds the ribosomal subunit interface and
                     arrests translation by interfering with aminoacyl-tRNA
                     binding to the ribosomal...; Region: RaiA; cd00552"
                     /db_xref="CDD:238308"
     misc_feature    complement(order(340644..340646,340656..340661,
                     340701..340703,340710..340712,340716..340718,
                     340725..340727,340731..340733,340740..340751,
                     340758..340760,340785..340787,340797..340799,
                     340809..340814,340830..340832,340839..340841,
                     340893..340895,340899..340901,340905..340907))
                     /gene="hpf"
                     /locus_tag="Dda3937_00681"
                     /gene_synonym="yhbH"
                     /note="30S subunit binding site; other site"
                     /db_xref="CDD:238308"
     gene            complement(340941..342374)
                     /gene="rpoN"
                     /locus_tag="Dda3937_00682"
                     /gene_synonym="glnF; ntrA"
                     /db_xref="GeneID:9731704"
     CDS             complement(340941..342374)
                     /gene="rpoN"
                     /locus_tag="Dda3937_00682"
                     /gene_synonym="glnF; ntrA"
                     /function="1.8.3 metabolism; metabolism of other
                     compounds; nitrogen metabolism"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.1 regulation; type of regulation;
                     transcriptional level; sigma factors, anti-sigmafactors"
                     /function="3.3.3 regulation; genetic unit regulated;
                     stimulon"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /function="7.1 location of gene products; cytoplasm"
                     /note="sigma 54 is needed for expression of various
                     regulons, promoter specificity set by various activator
                     proteins required for sigma 54 recruitment, originally
                     identified as the sigma factor for nitrogen-controlled
                     genes"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-54 (sigma N) factor"
                     /protein_id="YP_003881079.1"
                     /db_xref="GI:307129063"
                     /db_xref="ASAP:ABF-0015675"
                     /db_xref="ERIC:ABF-0015675"
                     /db_xref="GeneID:9731704"
                     /translation="MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQEIQLALESN
                     PLLEQADIHDEVETQESSDSETLDTREALEQKDMPDELPLDAAWDEIYTAGTPSGTST
                     DYRDEELPVYQGETTQTLQDYLMWQVELTPFSDTDSAIATSIVDAVDNTGYLTVSLDD
                     IRDSIGNDDVTLEEVEAVLKRVQRFDPVGVAARDLRECLLVQLSQFDNGIPRLAEARL
                     IVSEYLDLLANHDFRTLIRTSRLKEEVLKEALALIQSLDPRPGQSINTGESEYVIPDV
                     LVRKIQGHWAVELNTDSVPRLQINQQYAALGSSARNDSDGQFIRSHLQEARWLIKSLE
                     SRNDTLLKVTRCIVEQQQAFFEHGEEFMKPMVLADIAQAVDMHESTISRVTTQKFLHS
                     PRGIFELKYFFSSHVNTDNGGEASSTAIRALVRKLIAAENPAKPLSDSKLTSLLSEQG
                     IIVARRTVAKYRESLSIPPSNQRKQLV"
     misc_feature    complement(340947..342374)
                     /gene="rpoN"
                     /locus_tag="Dda3937_00682"
                     /gene_synonym="glnF; ntrA"
                     /note="RNA polymerase factor sigma-54; Reviewed; Region:
                     PRK05932"
                     /db_xref="CDD:235648"
     misc_feature    complement(342222..342368)
                     /gene="rpoN"
                     /locus_tag="Dda3937_00682"
                     /gene_synonym="glnF; ntrA"
                     /note="Sigma-54 factor, Activator interacting domain
                     (AID); Region: Sigma54_AID; pfam00309"
                     /db_xref="CDD:249760"
     misc_feature    complement(341463..342059)
                     /gene="rpoN"
                     /locus_tag="Dda3937_00682"
                     /gene_synonym="glnF; ntrA"
                     /note="Sigma-54 factor, core binding domain; Region:
                     Sigma54_CBD; pfam04963"
                     /db_xref="CDD:252909"
     misc_feature    complement(340950..341426)
                     /gene="rpoN"
                     /locus_tag="Dda3937_00682"
                     /gene_synonym="glnF; ntrA"
                     /note="Sigma-54, DNA binding domain; Region: Sigma54_DBD;
                     pfam04552"
                     /db_xref="CDD:252667"
     gene            complement(342422..343147)
                     /gene="yhbG"
                     /locus_tag="Dda3937_00683"
                     /gene_synonym="lptB"
                     /db_xref="GeneID:9731705"
     CDS             complement(342422..343147)
                     /gene="yhbG"
                     /locus_tag="Dda3937_00683"
                     /gene_synonym="lptB"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="LPS ABC transporter ATP-binding protein"
                     /protein_id="YP_003881080.1"
                     /db_xref="GI:307129064"
                     /db_xref="ASAP:ABF-0015676"
                     /db_xref="ERIC:ABF-0015676"
                     /db_xref="GeneID:9731705"
                     /translation="MATLIAENLAKAYKGRKVVENVSLNVNSGEIVGLLGPNGAGKTT
                     TFYMVVGIVPRDEGRIVIDDEDISLLPLHDRARRGIGYLPQEASIFRRLSVYDNLMAV
                     LEIRKDLTREQQQDRAHELMEEFHIVHLRDSLGQSLSGGERRRVEIARALAANPKFIL
                     LDEPFAGVDPISVIDIKKIIEHLRDSGLGVLITDHNVRETLDVCERAYIVSQGQLIAH
                     GSPMDILANEQVKRVYLGEGFRL"
     misc_feature    complement(342425..343147)
                     /gene="yhbG"
                     /locus_tag="Dda3937_00683"
                     /gene_synonym="lptB"
                     /note="lipopolysaccharide ABC transporter ATP-binding
                     protein; Provisional; Region: PRK10895"
                     /db_xref="CDD:182817"
     misc_feature    complement(342440..343138)
                     /gene="yhbG"
                     /locus_tag="Dda3937_00683"
                     /gene_synonym="lptB"
                     /note="ATP-binding cassette component of YhbG transport
                     system; Region: ABC_YhbG; cd03218"
                     /db_xref="CDD:213185"
     misc_feature    complement(343019..343042)
                     /gene="yhbG"
                     /locus_tag="Dda3937_00683"
                     /gene_synonym="lptB"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(order(342563..342565,342659..342664,
                     342893..342895,343016..343024,343028..343033))
                     /gene="yhbG"
                     /locus_tag="Dda3937_00683"
                     /gene_synonym="lptB"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(342893..342904)
                     /gene="yhbG"
                     /locus_tag="Dda3937_00683"
                     /gene_synonym="lptB"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(342707..342736)
                     /gene="yhbG"
                     /locus_tag="Dda3937_00683"
                     /gene_synonym="lptB"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(342659..342676)
                     /gene="yhbG"
                     /locus_tag="Dda3937_00683"
                     /gene_synonym="lptB"
                     /note="Walker B; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(342641..342652)
                     /gene="yhbG"
                     /locus_tag="Dda3937_00683"
                     /gene_synonym="lptB"
                     /note="D-loop; other site"
                     /db_xref="CDD:213185"
     misc_feature    complement(342557..342577)
                     /gene="yhbG"
                     /locus_tag="Dda3937_00683"
                     /gene_synonym="lptB"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213185"
     gene            complement(343163..343741)
                     /gene="yhbN"
                     /locus_tag="Dda3937_00684"
                     /gene_synonym="lptA"
                     /db_xref="GeneID:9731706"
     CDS             complement(343163..343741)
                     /gene="yhbN"
                     /locus_tag="Dda3937_00684"
                     /gene_synonym="lptA"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic protein of an ABC-type LPS
                     transporter complex"
                     /protein_id="YP_003881081.1"
                     /db_xref="GI:307129065"
                     /db_xref="ASAP:ABF-0015677"
                     /db_xref="ERIC:ABF-0015677"
                     /db_xref="GeneID:9731706"
                     /translation="MKSNQKINVLHSILIASSLFAVSVPALALTGDTDQPIHITSDQQ
                     ALDMQGNVVTFTGNVIVTQGSIKAQADKVVVTRPNGQQGHEVIEGYGNPATFYQMQDN
                     GKPVKGHSQKMRYEMDKQLVILTGDAYLEQLDSNVKGDRITYLVQQQQMEAFSDKGKR
                     VTTVLVPTQLQDKGTQNGAKPSGNTGKPTKQQ"
     misc_feature    complement(343190..343720)
                     /gene="yhbN"
                     /locus_tag="Dda3937_00684"
                     /gene_synonym="lptA"
                     /note="lipopolysaccharide transport periplasmic protein
                     LptA; Provisional; Region: PRK10894"
                     /db_xref="CDD:182816"
     misc_feature    complement(343211..343705)
                     /gene="yhbN"
                     /locus_tag="Dda3937_00684"
                     /gene_synonym="lptA"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG1934"
                     /db_xref="CDD:224845"
     gene            complement(343719..344288)
                     /gene="yrbK"
                     /locus_tag="Dda3937_00685"
                     /db_xref="GeneID:9731707"
     CDS             complement(343719..344288)
                     /gene="yrbK"
                     /locus_tag="Dda3937_00685"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881082.1"
                     /db_xref="GI:307129066"
                     /db_xref="ASAP:ABF-0015678"
                     /db_xref="ERIC:ABF-0015678"
                     /db_xref="GeneID:9731707"
                     /translation="MSKTKRWLTLLLALIALVLIGLNLTNQRAGNGPTEVQNNDPAYT
                     MQQNITVVYDPTGKLSYKLVAEKAEHYNADQVSWFTQPVATMFNEQTVATWSVRADRA
                     KLTKDRMLYLYGHVEVNSLTNDSQLERIKTDNAQINLVTQDVTSDDEVTLYGVNFTSN
                     GLKMRGNLRSKTAELIDKVKSYYEIQPKN"
     misc_feature    complement(343722..344288)
                     /gene="yrbK"
                     /locus_tag="Dda3937_00685"
                     /note="lipopolysaccharide exporter periplasmic protein;
                     Provisional; Region: PRK10893"
                     /db_xref="CDD:236788"
     gene            complement(344285..344851)
                     /gene="kdsC"
                     /locus_tag="Dda3937_00686"
                     /gene_synonym="yrbI"
                     /db_xref="GeneID:9731708"
     CDS             complement(344285..344851)
                     /gene="kdsC"
                     /locus_tag="Dda3937_00686"
                     /gene_synonym="yrbI"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonate 8-phosphate
                     phosphatase"
                     /protein_id="YP_003881083.1"
                     /db_xref="GI:307129067"
                     /db_xref="ASAP:ABF-0015679"
                     /db_xref="ERIC:ABF-0015679"
                     /db_xref="GeneID:9731708"
                     /translation="MSEIRPQTDTCYGPVDTQVMQRARDIRLLICDVDGVLSDGLIYM
                     GNQGEELKAFNVRDGYGIRCLLTSDVDVAIITGRSSQLLVDRCQTLGIRHLYQGQSDK
                     LLAFRELLDTLSLTASQVAYIGDDLIDWPVMAETGLSVAVADAHPLLLPNAHYVTRIA
                     GGRGAVREICDLILLAQGKLDFAKGLSI"
     misc_feature    complement(344288..344833)
                     /gene="kdsC"
                     /locus_tag="Dda3937_00686"
                     /gene_synonym="yrbI"
                     /note="3-deoxy-D-manno-octulosonate 8-phosphate
                     phosphatase; Provisional; Region: PRK09484"
                     /db_xref="CDD:181898"
     gene            complement(344901..345887)
                     /gene="kdsD"
                     /locus_tag="Dda3937_00687"
                     /gene_synonym="yrbH"
                     /db_xref="GeneID:9731709"
     CDS             complement(344901..345887)
                     /gene="kdsD"
                     /locus_tag="Dda3937_00687"
                     /gene_synonym="yrbH"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /function="6.7 cell structure; capsule (M and K antigens)"
                     /codon_start=1
                     /transl_table=11
                     /product="D-Arabinose 5-phosphate isomerase"
                     /protein_id="YP_003881084.1"
                     /db_xref="GI:307129068"
                     /db_xref="ASAP:ABF-0015680"
                     /db_xref="ERIC:ABF-0015680"
                     /db_xref="GeneID:9731709"
                     /translation="MSHFELQPGFDFQTAGRQVLSIERDSLAQLDQYIDDNFSRACEK
                     MFYCHGKVVVMGMGKSGHIGCKMAATFASTGTPAFFVHPGEASHGDLGMITAQDIVIA
                     ISNSGESHEILALIPVLKRLQVCLICMTGNPESTMAKAADIHLCVHVSQEACPLGLAP
                     TSSTTATLVMGDALAVALLQARGFTAEDFALSHPGGALGRKLLLRINDIMHTGDEIPR
                     VGRDASLRDALLEITRKNLGMTVICGPDDRIEGIFTDGDLRRVFDMNIDLNSAGIADV
                     MTRGGIRVTPQTLAVDALNLMQSRHITSLLVAEDDRLRGIVHMHDMLRAGVV"
     misc_feature    complement(344904..345881)
                     /gene="kdsD"
                     /locus_tag="Dda3937_00687"
                     /gene_synonym="yrbH"
                     /note="D-arabinose 5-phosphate isomerase; Provisional;
                     Region: PRK10892"
                     /db_xref="CDD:182814"
     misc_feature    complement(345357..345740)
                     /gene="kdsD"
                     /locus_tag="Dda3937_00687"
                     /gene_synonym="yrbH"
                     /note="KpsF-like protein. KpsF is an arabinose-5-phosphate
                     isomerase which contains SIS (Sugar ISomerase) domains.
                     SIS domains are found in many phosphosugar isomerases and
                     phosphosugar binding proteins. KpsF catalyzes the
                     reversible reaction of ribulose...; Region: SIS_Kpsf;
                     cd05014"
                     /db_xref="CDD:240145"
     misc_feature    complement(order(345576..345578,345708..345710))
                     /gene="kdsD"
                     /locus_tag="Dda3937_00687"
                     /gene_synonym="yrbH"
                     /note="putative active site [active]"
                     /db_xref="CDD:240145"
     misc_feature    complement(344913..345251)
                     /gene="kdsD"
                     /locus_tag="Dda3937_00687"
                     /gene_synonym="yrbH"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with KpsF/GutQ domains in the API [A5P (D-arabinose
                     5-phosphate) isomerase] protein.  These APIs catalyze the
                     conversion of the pentose pathway...; Region:
                     CBS_pair_KpsF_GutQ_assoc; cd04604"
                     /db_xref="CDD:239977"
     gene            complement(345918..346880)
                     /gene="yrbG"
                     /locus_tag="Dda3937_00688"
                     /db_xref="GeneID:9731710"
     CDS             complement(345918..346880)
                     /gene="yrbG"
                     /locus_tag="Dda3937_00688"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.2.A.19 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Ca2+:Cation Antiporter (CaCA) Family"
                     /function="6.1 cell structure; membrane"
                     /function="4.S.133 transport; substrate; Na+/Ca+"
                     /codon_start=1
                     /transl_table=11
                     /product="calcium/sodium:proton antiporter"
                     /protein_id="YP_003881085.1"
                     /db_xref="GI:307129069"
                     /db_xref="ASAP:ABF-0015681"
                     /db_xref="ERIC:ABF-0015681"
                     /db_xref="GeneID:9731710"
                     /translation="MLFATVLLIVGLVLLVYGADRLVYGAAVLARTFGVPPMIIGMTI
                     VGMGTSLPELMVSVTAALNHQTDMAVGNVLGSNIANILLILGSAVLIRPLTFHSPLLR
                     QELPPMLVVTLLCGVLLHDSFLSRLDGVILLLTAGGCIVLMLRMARAAQNRGDDSLTR
                     EQMAELPRENNQTVALLWLLIGLIILPMSARIVIDNATVIANYFNISELTIGLTVLAV
                     GTSLPELATAIVGTLKKEDDIALGNLIGSNIFNIVIVLGVPALLSPGAVNPLAFARDY
                     WVMLGVSALLTVLCLRQKRRIGQGAGALLLCAFIAYLSMLFLFS"
     misc_feature    complement(345921..346880)
                     /gene="yrbG"
                     /locus_tag="Dda3937_00688"
                     /note="putative calcium/sodium:proton antiporter;
                     Provisional; Region: PRK10734"
                     /db_xref="CDD:182684"
     misc_feature    complement(346452..346832)
                     /gene="yrbG"
                     /locus_tag="Dda3937_00688"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     misc_feature    complement(345942..346319)
                     /gene="yrbG"
                     /locus_tag="Dda3937_00688"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     gene            347162..347971
                     /gene="yrbF"
                     /locus_tag="Dda3937_00689"
                     /gene_synonym="vpsA"
                     /db_xref="GeneID:9731711"
     CDS             347162..347971
                     /gene="yrbF"
                     /locus_tag="Dda3937_00689"
                     /gene_synonym="vpsA"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="toluene transporter subunit: ATP-binding
                     protein"
                     /protein_id="YP_003881086.1"
                     /db_xref="GI:307129070"
                     /db_xref="ASAP:ABF-0015684"
                     /db_xref="ERIC:ABF-0015684"
                     /db_xref="GeneID:9731711"
                     /translation="MNHENLVEIRGLSFRRGNRPIFSDVSLNVPKQKITAIMGPSGIG
                     KTTLLRLIGGQLQPDSGEIWFDGENIPTLSRSRLYETRKKMSMLFQSGALFTDLNVFD
                     NVAWPLREHTQLPEPLLHSTVMMKLEAVGLRGAAELMPSELSGGMARRAALARAIALD
                     PQLIMFDEPFVGQDPITMGVLVKLIDELNHALGVTCIVVSHDVPEVLSIADYAYIIAD
                     QRVVAEGSPAELQQNGDPRVRQFLDGIADGPVPFRYPAGDYQRGLLGLGSK"
     misc_feature    347162..347965
                     /gene="yrbF"
                     /locus_tag="Dda3937_00689"
                     /gene_synonym="vpsA"
                     /note="putative ABC transporter ATP-binding protein YrbF;
                     Provisional; Region: PRK11831"
                     /db_xref="CDD:236997"
     misc_feature    347180..347884
                     /gene="yrbF"
                     /locus_tag="Dda3937_00689"
                     /gene_synonym="vpsA"
                     /note="ATP-binding cassette transport system involved in
                     resistant to organic solvents; Region:
                     ABC_Org_Solvent_Resistant; cd03261"
                     /db_xref="CDD:213228"
     misc_feature    347276..347299
                     /gene="yrbF"
                     /locus_tag="Dda3937_00689"
                     /gene_synonym="vpsA"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213228"
     misc_feature    order(347285..347290,347294..347302,347429..347431,
                     347660..347665,347762..347764)
                     /gene="yrbF"
                     /locus_tag="Dda3937_00689"
                     /gene_synonym="vpsA"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213228"
     misc_feature    347420..347431
                     /gene="yrbF"
                     /locus_tag="Dda3937_00689"
                     /gene_synonym="vpsA"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213228"
     misc_feature    347588..347617
                     /gene="yrbF"
                     /locus_tag="Dda3937_00689"
                     /gene_synonym="vpsA"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213228"
     misc_feature    347648..347665
                     /gene="yrbF"
                     /locus_tag="Dda3937_00689"
                     /gene_synonym="vpsA"
                     /note="Walker B; other site"
                     /db_xref="CDD:213228"
     misc_feature    347672..347683
                     /gene="yrbF"
                     /locus_tag="Dda3937_00689"
                     /gene_synonym="vpsA"
                     /note="D-loop; other site"
                     /db_xref="CDD:213228"
     misc_feature    347750..347770
                     /gene="yrbF"
                     /locus_tag="Dda3937_00689"
                     /gene_synonym="vpsA"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213228"
     gene            347975..348757
                     /gene="yrbE"
                     /locus_tag="Dda3937_00690"
                     /gene_synonym="vpsB"
                     /db_xref="GeneID:9731712"
     CDS             347975..348757
                     /gene="yrbE"
                     /locus_tag="Dda3937_00690"
                     /gene_synonym="vpsB"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="toluene transporter subunit: membrane protein"
                     /protein_id="YP_003881087.1"
                     /db_xref="GI:307129071"
                     /db_xref="ASAP:ABF-0015685"
                     /db_xref="ERIC:ABF-0015685"
                     /db_xref="GeneID:9731712"
                     /translation="MLLQALASLGRVGIQVCAAFGRAGLMLFNALVGKPEPAKQWPLL
                     RKQLYSVGVQSLLIIMVSGVFIGMVLGLQGYLVLTTYSAEASLGMMVALSLLRELGPV
                     VTALLFAGRAGSALTAEIGLMKTTEQLSSMEMMAVDPLRRVVAPRFWAGVISMPLLTV
                     IFVAVGIWGGALVGVDWKGIDSGFFWSAMQNAVEWRKDLLNCVIKSLVFAITVTWIAL
                     FNGYDAIPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFGK"
     misc_feature    347987..348751
                     /gene="yrbE"
                     /locus_tag="Dda3937_00690"
                     /gene_synonym="vpsB"
                     /note="conserved hypothetical integral membrane protein;
                     Region: TIGR00056"
                     /db_xref="CDD:129166"
     gene            348762..349385
                     /gene="yrbD"
                     /locus_tag="Dda3937_00691"
                     /gene_synonym="vpsC"
                     /db_xref="GeneID:9731713"
     CDS             348762..349385
                     /gene="yrbD"
                     /locus_tag="Dda3937_00691"
                     /gene_synonym="vpsC"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type organic solvent transporter"
                     /protein_id="YP_003881088.1"
                     /db_xref="GI:307129072"
                     /db_xref="ASAP:ABF-0015686"
                     /db_xref="ERIC:ABF-0015686"
                     /db_xref="GeneID:9731713"
                     /translation="MQTKKHEIWVGVFMLIALCAIVFLCLKVADLKSLGQQQTYRLYA
                     TFDNIGGLKARSPVKIGGVVIGRVADISLDTKTYLPRVAIDIDKRYDHIPDTSSLAIR
                     TSGLLGEQYLALNMGFEDEDMGTSILKDGGTIQDTKSAMVLEDLIGQFLYKSGGSNTD
                     NASQNNASHDTVSPNNANPSHAKPVETKPAENSGEAAKPESGAKPAQ"
     misc_feature    348762..>349295
                     /gene="yrbD"
                     /locus_tag="Dda3937_00691"
                     /gene_synonym="vpsC"
                     /note="ABC-type transport system involved in resistance to
                     organic solvents, periplasmic component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: Ttg2C; COG1463"
                     /db_xref="CDD:224380"
     misc_feature    348873..349112
                     /gene="yrbD"
                     /locus_tag="Dda3937_00691"
                     /gene_synonym="vpsC"
                     /note="mce related protein; Region: MCE; pfam02470"
                     /db_xref="CDD:251316"
     gene            349403..350056
                     /gene="yrbC"
                     /locus_tag="Dda3937_00692"
                     /db_xref="GeneID:9731714"
     CDS             349403..350056
                     /gene="yrbC"
                     /locus_tag="Dda3937_00692"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="4.3.A.1 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The ATP-binding Cassette (ABC) Superfamily +
                     ABC-type Uptake Permeases"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type organic solvent transporter"
                     /protein_id="YP_003881089.1"
                     /db_xref="GI:307129073"
                     /db_xref="ASAP:ABF-0015687"
                     /db_xref="ERIC:ABF-0015687"
                     /db_xref="GeneID:9731714"
                     /translation="MLKRLLMVALLVVAPLVSAADQTTPQIDQTNPYSLMNEAANKTF
                     NRLKNEQWPIKQDPNYLRTVVRKELLPYVQVKYAGALVLGQYYKNATPDQREAYFKAF
                     EAYLEQAYGQALASYHGQTYEIASEQPVGNAEIVSIRVTITDNGGRPPIRLDFQWRKN
                     TKTGYWQAYDMIAEGVSMITTKQNEWASTLRQSGVDGLTKQLQAAAQQPISLGQKNG"
     misc_feature    349403..350050
                     /gene="yrbC"
                     /locus_tag="Dda3937_00692"
                     /note="ABC transporter periplasmic binding protein MlaC;
                     Provisional; Region: PRK15117"
                     /db_xref="CDD:237912"
     gene            350049..350351
                     /gene="yrbB"
                     /locus_tag="Dda3937_00693"
                     /db_xref="GeneID:9731715"
     CDS             350049..350351
                     /gene="yrbB"
                     /locus_tag="Dda3937_00693"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881090.1"
                     /db_xref="GI:307129074"
                     /db_xref="ASAP:ABF-0015688"
                     /db_xref="ERIC:ABF-0015688"
                     /db_xref="GeneID:9731715"
                     /translation="MADALRWRQDDGALRLEGDLDRNTLLPLWQQREALLNDSSVLDV
                     GQVARVDSSGLALLVHFYHQQEQRGKPLAIIGASDRLRTLIQLYNLSEIIPVRPAD"
     misc_feature    350088..350342
                     /gene="yrbB"
                     /locus_tag="Dda3937_00693"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist) domain of anti-anti-sigma factors, key
                     regulators of anti-sigma factors by phosphorylation;
                     Region: STAS_anti-anti-sigma_factors; cd07043"
                     /db_xref="CDD:132914"
     misc_feature    order(350103..350105,350109..350117,350133..350135,
                     350193..350195,350199..350207,350211..350219,
                     350226..350231,350295..350297,350307..350312,
                     350316..350318)
                     /gene="yrbB"
                     /locus_tag="Dda3937_00693"
                     /note="anti sigma factor interaction site; other site"
                     /db_xref="CDD:132914"
     misc_feature    350202..350204
                     /gene="yrbB"
                     /locus_tag="Dda3937_00693"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:132914"
     gene            350484..350738
                     /gene="yrbA"
                     /locus_tag="Dda3937_00694"
                     /db_xref="GeneID:9731716"
     CDS             350484..350738
                     /gene="yrbA"
                     /locus_tag="Dda3937_00694"
                     /function="5.1 cell processes; cell division"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator"
                     /protein_id="YP_003881091.1"
                     /db_xref="GI:307129075"
                     /db_xref="ASAP:ABF-0015689"
                     /db_xref="ERIC:ABF-0015689"
                     /db_xref="GeneID:9731716"
                     /translation="MENNEIKDVLMSALALQEVHVSGDGSHFQVIVIGELFKGMSRVK
                     QQQTVYAPLMEYIADNRIHALSIKAYTPEEWQRDRKLSGL"
     misc_feature    350484..350723
                     /gene="yrbA"
                     /locus_tag="Dda3937_00694"
                     /note="Predicted transcriptional regulator, BolA
                     superfamily [Transcription]; Region: COG5007"
                     /db_xref="CDD:227340"
     gene            350796..352058
                     /gene="murA"
                     /locus_tag="Dda3937_00695"
                     /gene_synonym="mrbA; murZ"
                     /db_xref="GeneID:9731717"
     CDS             350796..352058
                     /gene="murA"
                     /locus_tag="Dda3937_00695"
                     /gene_synonym="mrbA; murZ"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /note="first step in murein biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="YP_003881092.1"
                     /db_xref="GI:307129076"
                     /db_xref="ASAP:ABF-0015691"
                     /db_xref="ERIC:ABF-0015691"
                     /db_xref="GeneID:9731717"
                     /translation="MDKFRVQGPTRLAGEVTISGAKNAALPILFAALLAEEPVEIQNV
                     PKLRDIDTTMKLLSQLGARVERNGSVHVDASTVNVFCAPYDLVKTMRASIWALGPLVA
                     RFGQGQVSLPGGCAIGARPVDLHINGLEQLGAHITLEEGYVKATVDGRLKGAHIVMDK
                     VSVGATVTIMSAATLAVGKTIIENAAREPEIVDTANFLNTLGAKISGAGSDKIVIEGV
                     ERLGGGVYRVLPDRIETGTFLVAAAVSGGKVMCRHTRPDTLDAVLSKLREAGADIEIG
                     EDWISLDMHGRRPKAVNVRTAPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMH
                     IPELIRMGAQAEIESNTVICHGVGHLSGAQVMATDLRASASLVLAGCIAEGTTLVDRI
                     YHIDRGYERIEDKLRALGANIERVSAND"
     misc_feature    350811..352013
                     /gene="murA"
                     /locus_tag="Dda3937_00695"
                     /gene_synonym="mrbA; murZ"
                     /note="EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase); Region: EPSP_synthase;
                     pfam00275"
                     /db_xref="CDD:249736"
     misc_feature    350829..352022
                     /gene="murA"
                     /locus_tag="Dda3937_00695"
                     /gene_synonym="mrbA; murZ"
                     /note="UDP-N-acetylglucosamine enolpyruvyl transferase
                     catalyzes enolpyruvyl transfer as part of the first step
                     in the biosynthesis of peptidoglycan, a component of the
                     bacterial cell wall. The reaction is phosphoenolpyruvate +
                     UDP-N-acetyl-D-glucosamine =...; Region: UdpNAET; cd01555"
                     /db_xref="CDD:238796"
     misc_feature    order(350847..350858,351477..351488)
                     /gene="murA"
                     /locus_tag="Dda3937_00695"
                     /gene_synonym="mrbA; murZ"
                     /note="hinge; other site"
                     /db_xref="CDD:238796"
     misc_feature    order(350862..350864,351066..351068,351078..351080,
                     351153..351170,351273..351275,351282..351287,
                     351708..351710)
                     /gene="murA"
                     /locus_tag="Dda3937_00695"
                     /gene_synonym="mrbA; murZ"
                     /note="active site"
                     /db_xref="CDD:238796"
     gene            complement(352117..353178)
                     /gene="degS"
                     /locus_tag="Dda3937_00696"
                     /gene_synonym="hhoB; htrH"
                     /db_xref="GeneID:9731718"
     CDS             complement(352117..353178)
                     /gene="degS"
                     /locus_tag="Dda3937_00696"
                     /gene_synonym="hhoB; htrH"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="2.3.6 information transfer; protein related;
                     turnover, degradation"
                     /function="3.1.3.4 regulation; type of regulation;
                     posttranscriptional; proteases, cleavage of compounds"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /codon_start=1
                     /transl_table=11
                     /product="serine endoprotease, periplasmic"
                     /protein_id="YP_003881093.1"
                     /db_xref="GI:307129077"
                     /db_xref="ASAP:ABF-0015692"
                     /db_xref="ERIC:ABF-0015692"
                     /db_xref="GeneID:9731718"
                     /translation="MLTKLLRSALFGVIVAGILLLAIPALRSNQGLLKSGGDNSQETP
                     VSYYQGVRRAAPAVVNVYNQANDPTAKNELNIRTLGSGVIMNNKGYILTNKHVISNAE
                     QIVVTLQDGRIFEALLVGSDSLTDLAVLKIEGANLPEIPINPKRVFHVGDVVMAIGNP
                     YNLGQTVTQGIVSATGRVGLSSSGRQNFLQTDASINRGNSGGALVNTLGELVGINTLS
                     FDKSNDGGTPEGIGFAIPVALATKIMNKLIRDGRVIRGYIGISGAQRERLGNQVTGLE
                     RLQGIVVNQVETGGPADKAGIKEGDLLLEVNNKPARSVIETMDQVAEIRPGSVIPVVI
                     FRDNQEIKLDMTIQEYPSD"
     misc_feature    complement(352126..353178)
                     /gene="degS"
                     /locus_tag="Dda3937_00696"
                     /gene_synonym="hhoB; htrH"
                     /note="serine endoprotease; Provisional; Region: PRK10898"
                     /db_xref="CDD:182820"
     misc_feature    complement(352537..352941)
                     /gene="degS"
                     /locus_tag="Dda3937_00696"
                     /gene_synonym="hhoB; htrH"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    complement(352150..352413)
                     /gene="degS"
                     /locus_tag="Dda3937_00696"
                     /gene_synonym="hhoB; htrH"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(352225..352230,352237..352242,
                     352393..352395,352399..352410))
                     /gene="degS"
                     /locus_tag="Dda3937_00696"
                     /gene_synonym="hhoB; htrH"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     gene            complement(353267..354637)
                     /gene="degQ"
                     /locus_tag="Dda3937_00697"
                     /db_xref="GeneID:9731719"
     CDS             complement(353267..354637)
                     /gene="degQ"
                     /locus_tag="Dda3937_00697"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="2.3.6 information transfer; protein related;
                     turnover, degradation"
                     /codon_start=1
                     /transl_table=11
                     /product="Protease"
                     /protein_id="YP_003881094.1"
                     /db_xref="GI:307129078"
                     /db_xref="ASAP:ABF-0015693"
                     /db_xref="ERIC:ABF-0015693"
                     /db_xref="GeneID:9731719"
                     /translation="MKKTSLLYSALALGIGLSLSSLPPANAALPAVVEGQALPSLAPM
                     LEKVLPAVVSVHVEGTQVQRQRIPEEFKFFFGPNTPSEKQNSRPFEGLGSGVIINAEK
                     GYVLTNNHVVNNADKIQVQLNDGREYDAKLIGRDEQTDIALLQLNDAKNLTEVKMADS
                     DQLRVGDFAVAVGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGNSGGA
                     LVNLRGELIGINTAILAPSGGNVGIGFAIPSNMAQNLTQQLVEFGEVKRGLLGIKGSE
                     MTSEIAKAFKVDAQRGAFVSEVIPKSAAAKAGIKAGDVLVSLDGKPISSFAELRAKIG
                     TTAPGKTVRIGLLRDGKQQEVAVVLDNSANVTTNADTLSPALQGATLNNGQLKDGSKG
                     VTIDNVAKDSAAAKVGLQKGDIIVGVNRERVENITQLRKILEAKPSVLALNIVRGDES
                     IYLLLR"
     misc_feature    complement(353270..354637)
                     /gene="degQ"
                     /locus_tag="Dda3937_00697"
                     /note="serine endoprotease; Provisional; Region: PRK10139"
                     /db_xref="CDD:182262"
     misc_feature    complement(353951..354361)
                     /gene="degQ"
                     /locus_tag="Dda3937_00697"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    complement(353567..353836)
                     /gene="degQ"
                     /locus_tag="Dda3937_00697"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(353648..353653,353660..353665,
                     353816..353818,353822..353833))
                     /gene="degQ"
                     /locus_tag="Dda3937_00697"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     misc_feature    complement(353279..353497)
                     /gene="degQ"
                     /locus_tag="Dda3937_00697"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     gene            complement(354874..355278)
                     /gene="yhcB"
                     /locus_tag="Dda3937_04695"
                     /pseudo
                     /db_xref="GeneID:9731720"
     misc_feature    complement(354874..355278)
                     /gene="yhcB"
                     /locus_tag="Dda3937_04695"
                     /note="internal nonsense mutation split yhcB into two open
                     reading frames, yhcB_1 and yhcB_2"
                     /pseudo
                     /db_xref="ASAP:ABF-0061330"
                     /db_xref="ERIC:ABF-0061330"
     gene            355489..356619
                     /gene="yhcM"
                     /locus_tag="Dda3937_04446"
                     /db_xref="GeneID:9731721"
     CDS             355489..356619
                     /gene="yhcM"
                     /locus_tag="Dda3937_04446"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881095.1"
                     /db_xref="GI:307129079"
                     /db_xref="ASAP:ABF-0046871"
                     /db_xref="ERIC:ABF-0046871"
                     /db_xref="GeneID:9731721"
                     /translation="MQRTTPLALYQQALAAQTYQPDEVQHQTVVRLNAIHQTLTEQVW
                     APAESSAPGLMAKWRTWLGQKEKSPSPVQGLYMWGGVGRGKTWLMDLFFHSLPSERKL
                     RLHFHRFMLRVHEELNQLQGQENPLEKVADGFKAQTDILCFDEFFVSDITDAMLLAEL
                     LRALFSRGIALVATSNIPPDELYRNGLQRARFLPAIELIKQHCGVLNVDAGIDYRLRT
                     LTQAHLYLTPSNADTDAEMQAMFRCLSGRDFSQPGPVLEINHRPLTTLSAGDGVLAVD
                     FATLCLEARSQNDYIALSRLYHTVLLHHVPVMEVKDENAARRFLALVDEFYERRVKLI
                     MSAQATMFEIYQGEHLKFEYQRCLSRLQEMQSEEYLRQPHLP"
     misc_feature    355489..356613
                     /gene="yhcM"
                     /locus_tag="Dda3937_04446"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG1485"
                     /db_xref="CDD:224402"
     gene            complement(356675..357562)
                     /locus_tag="Dda3937_00700"
                     /db_xref="GeneID:9731722"
     CDS             complement(356675..357562)
                     /locus_tag="Dda3937_00700"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881096.1"
                     /db_xref="GI:307129080"
                     /db_xref="ASAP:ABF-0015698"
                     /db_xref="ERIC:ABF-0015698"
                     /db_xref="GeneID:9731722"
                     /translation="MTRLTAKDFQPELLELYDYYAHGKLTKREFLERAARYAAGGLTA
                     MTILSLMSPNYALAQQVEFTDPAIIPEYITYPSPNGHGSVRGYLVRPAKTNSPVPAVV
                     VVHENRGLNPYIEDVARRLAKEGFIALAPDGLSSVGGYPGNDDKGRELQQQIDPTKLM
                     NDFFAAVEFLMKHKDATGKVGITGFCYGGGVANAAAVAYPELAAAVPFYGRQPKPEDV
                     SRIKAPLLLHYAERDDNINAGWPAYESALKAASKTYEAYIYPGTNHGFHNDSTPRYDK
                     AAADLAWNRTLAWFRRYLA"
     misc_feature    complement(356678..357355)
                     /locus_tag="Dda3937_00700"
                     /note="Dienelactone hydrolase and related enzymes
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG0412"
                     /db_xref="CDD:223489"
     misc_feature    complement(356681..357202)
                     /locus_tag="Dda3937_00700"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            357584..358015
                     /locus_tag="Dda3937_04447"
                     /db_xref="GeneID:9731723"
     CDS             357584..358015
                     /locus_tag="Dda3937_04447"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881097.1"
                     /db_xref="GI:307129081"
                     /db_xref="ASAP:ABF-0046872"
                     /db_xref="ERIC:ABF-0046872"
                     /db_xref="GeneID:9731723"
                     /translation="MFQINVAKSKASRCGRVRGYRSASVKDSNKNIYLLLCYVGVAKR
                     RCSRGDAVSTILTILYVSFDNALQGGTDVRLKRFAIQLRKKSIFEIDFSIILRPHVTT
                     KFFPETLIALAIAIRRGRFAGLDSRVNLNTIYLSVWVFTNV"
     gene            358037..358465
                     /gene="rplM"
                     /locus_tag="Dda3937_00701"
                     /db_xref="GeneID:9731724"
     CDS             358037..358465
                     /gene="rplM"
                     /locus_tag="Dda3937_00701"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="YP_003881098.1"
                     /db_xref="GI:307129082"
                     /db_xref="ASAP:ABF-0015699"
                     /db_xref="ERIC:ABF-0015699"
                     /db_xref="GeneID:9731724"
                     /translation="MKTFTAKPETVKRDWYVVDASGKTLGRLATELARRLRGKHKAEY
                     TPHVDTGDYIIVLNAEKVAVTGNKRSDKMYYHHTGHIGGIKEATFEEMIARRPERVIE
                     IAVKGMLPKGPLGRAMYRKLKVYAGNEHNHAAQQPQVLDI"
     misc_feature    358079..358420
                     /gene="rplM"
                     /locus_tag="Dda3937_00701"
                     /note="Ribosomal protein L13.  Protein L13, a large
                     ribosomal subunit protein, is one of five proteins
                     required for an early folding intermediate of 23S rRNA in
                     the assembly of the large subunit. L13 is situated on the
                     bottom of the large subunit, near the...; Region:
                     Ribosomal_L13; cd00392"
                     /db_xref="CDD:238230"
     misc_feature    order(358106..358108,358112..358117,358124..358126,
                     358133..358135,358145..358147,358229..358231,
                     358235..358237,358319..358324,358340..358348,
                     358352..358360,358364..358372,358376..358378,
                     358382..358384,358394..358396,358403..358408)
                     /gene="rplM"
                     /locus_tag="Dda3937_00701"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238230"
     misc_feature    358322..358324
                     /gene="rplM"
                     /locus_tag="Dda3937_00701"
                     /note="L3 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238230"
     gene            358481..358873
                     /gene="rpsI"
                     /locus_tag="Dda3937_00702"
                     /db_xref="GeneID:9731725"
     CDS             358481..358873
                     /gene="rpsI"
                     /locus_tag="Dda3937_00702"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="YP_003881099.1"
                     /db_xref="GI:307129083"
                     /db_xref="ASAP:ABF-0015700"
                     /db_xref="ERIC:ABF-0015700"
                     /db_xref="GeneID:9731725"
                     /translation="MAENQYYGTGRRKSSAARVFIKPGSGNIVINQRTLEQYFGRETA
                     RMVVRQPLELVDMVGKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAG
                     FVTRDARQVERKKVGLRKARRRPQFSKR"
     misc_feature    358481..358870
                     /gene="rpsI"
                     /locus_tag="Dda3937_00702"
                     /note="30S ribosomal protein S9; Reviewed; Region: rpsI;
                     PRK00132"
                     /db_xref="CDD:178888"
     gene            359171..359797
                     /locus_tag="Dda3937_00703"
                     /db_xref="GeneID:9731726"
     CDS             359171..359797
                     /locus_tag="Dda3937_00703"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_003881100.1"
                     /db_xref="GI:307129084"
                     /db_xref="ASAP:ABF-0015703"
                     /db_xref="ERIC:ABF-0015703"
                     /db_xref="GeneID:9731726"
                     /translation="MQARTLSVDRICVAAAAHFAEHGYDAASLNEIAKAVNIKKASLY
                     SHFASKNALFMTVFDDTLQIETAFAQQCFNDEAPDALPGSHYFSCLAKRYADSVYLRF
                     LLRTGYLAPAALYDQISLGYEKYLEQLQDAFINKLHSGHDTRLLPADDVEQLGQAYLG
                     IVDSLHVKLVYTAEPDLSLRLTAMRRLLSDTLQCAILSSRQSREQHHV"
     misc_feature    359195..359734
                     /locus_tag="Dda3937_00703"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    359210..359341
                     /locus_tag="Dda3937_00703"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            359790..361043
                     /locus_tag="Dda3937_00704"
                     /db_xref="GeneID:9731727"
     CDS             359790..361043
                     /locus_tag="Dda3937_00704"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="4 transport"
                     /codon_start=1
                     /transl_table=11
                     /product="Bcr/CflA family multidrug resistance
                     transporter"
                     /protein_id="YP_003881101.1"
                     /db_xref="GI:307129085"
                     /db_xref="ASAP:ABF-0015704"
                     /db_xref="ERIC:ABF-0015704"
                     /db_xref="GeneID:9731727"
                     /translation="MSERYEHSAAAMTYSLILLLALLTALDAMAIDMYLPAMPALAMD
                     FGASSGKVQQTLSVFLVGLALGQGICGPLLDRYGRRIPLLAGLVIFIGGSVMAALSSS
                     IEWLMLARFLQALGASAGLVAPRAIVADLYSVAESARIFSLLMQVMMIAPILAPLLGG
                     YLLAHGEWRLVFWVLAGLGGAGLIWGIRTIPESLSEEKRLASRAGNLSPGNIVRAYVR
                     QLGYGVFMAYTLAGGVIFGSLFVYISSSSFVFTQSFGLTPAQFSYIFAANAVSLVIGG
                     QISTTLLRRRVGEQRIMMFGIVIHILAGLVLSVLILSGWIGLWGYLLLLATAIGALGL
                     VFGNLTALTMAYAGRQAGVASALMGMLQYLIAALVGYCASQVLQGPVVLPVVIVLCGV
                     VAMLLCIMASHMAQAAFSTCYDDRE"
     misc_feature    359880..360995
                     /locus_tag="Dda3937_00704"
                     /note="bicyclomycin/multidrug efflux system; Provisional;
                     Region: PRK11102"
                     /db_xref="CDD:182964"
     misc_feature    359886..360992
                     /locus_tag="Dda3937_00704"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(359889..359897,359901..359906,359955..359957,
                     359964..359969,359976..359978,359988..359993,
                     359997..360002,360138..360143,360150..360155,
                     360162..360167,360174..360176,360210..360215,
                     360222..360227,360243..360245,360495..360497,
                     360504..360509,360516..360521,360528..360530,
                     360570..360572,360582..360584,360594..360596,
                     360603..360605,360615..360617,360774..360776,
                     360783..360788,360795..360797,360807..360812,
                     360819..360821,360849..360854,360861..360866,
                     360873..360878,360885..360887)
                     /locus_tag="Dda3937_00704"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            361274..361915
                     /gene="sspA"
                     /locus_tag="Dda3937_00705"
                     /gene_synonym="pog"
                     /db_xref="GeneID:9731728"
     CDS             361274..361915
                     /gene="sspA"
                     /locus_tag="Dda3937_00705"
                     /gene_synonym="pog"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="3.3.3 regulation; genetic unit regulated;
                     stimulon"
                     /function="5.5.3 cell processes; adaptation to stress;
                     starvation response"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="stringent starvation protein A"
                     /protein_id="YP_003881102.1"
                     /db_xref="GI:307129086"
                     /db_xref="ASAP:ABF-0015706"
                     /db_xref="ERIC:ABF-0015706"
                     /db_xref="GeneID:9731728"
                     /translation="MAVAANKRSVMTLFSGPSDIFSHQVRIVLAEKGVSVEIEQVDMD
                     NLPQDLIDLNPYGSVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGNSRLM
                     MHRIEQDWYSLMKTVLNGNTQDAEAARKQLREELLAIAPVFNEAPYFMSEEFSLVDCY
                     LAPLLWRLPLLGIELSGSGAKELKGYMTRVFERDAFLASLTEAEREIRLQSRG"
     misc_feature    361274..361900
                     /gene="sspA"
                     /locus_tag="Dda3937_00705"
                     /gene_synonym="pog"
                     /note="stringent starvation protein A; Provisional;
                     Region: sspA; PRK09481"
                     /db_xref="CDD:236537"
     misc_feature    361304..361522
                     /gene="sspA"
                     /locus_tag="Dda3937_00705"
                     /gene_synonym="pog"
                     /note="GST_N family, Stringent starvation protein A (SspA)
                     subfamily; SspA is a RNA polymerase (RNAP)-associated
                     protein required for the lytic development of phage P1 and
                     for stationary phase-induced acid tolerance of E. coli. It
                     is implicated in survival...; Region: GST_N_SspA; cd03059"
                     /db_xref="CDD:239357"
     misc_feature    order(361322..361327,361334..361336,361340..361345,
                     361349..361354,361361..361366,361490..361492,
                     361499..361504)
                     /gene="sspA"
                     /locus_tag="Dda3937_00705"
                     /gene_synonym="pog"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239357"
     misc_feature    order(361334..361336,361445..361453,361484..361489)
                     /gene="sspA"
                     /locus_tag="Dda3937_00705"
                     /gene_synonym="pog"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239357"
     misc_feature    order(361439..361441,361472..361477,361490..361492,
                     361502..361504,361514..361516)
                     /gene="sspA"
                     /locus_tag="Dda3937_00705"
                     /gene_synonym="pog"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239357"
     misc_feature    361550..361873
                     /gene="sspA"
                     /locus_tag="Dda3937_00705"
                     /gene_synonym="pog"
                     /note="C-terminal, alpha helical domain of Stringent
                     starvation protein A; Region: GST_C_SspA; cd03186"
                     /db_xref="CDD:198295"
     misc_feature    order(361559..361561,361565..361567,361571..361576,
                     361586..361588,361598..361600)
                     /gene="sspA"
                     /locus_tag="Dda3937_00705"
                     /gene_synonym="pog"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198295"
     misc_feature    order(361571..361573,361604..361606,361748..361753,
                     361760..361762,361772..361774,361850..361852,
                     361856..361858,361868..361870)
                     /gene="sspA"
                     /locus_tag="Dda3937_00705"
                     /gene_synonym="pog"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198295"
     gene            361920..362417
                     /gene="sspB"
                     /locus_tag="Dda3937_00706"
                     /db_xref="GeneID:9731729"
     CDS             361920..362417
                     /gene="sspB"
                     /locus_tag="Dda3937_00706"
                     /function="5.5.3 cell processes; adaptation to stress;
                     starvation response"
                     /codon_start=1
                     /transl_table=11
                     /product="ClpXP protease specificity-enhancing factor"
                     /protein_id="YP_003881103.1"
                     /db_xref="GI:307129087"
                     /db_xref="ASAP:ABF-0015707"
                     /db_xref="ERIC:ABF-0015707"
                     /db_xref="GeneID:9731729"
                     /translation="MTLSQLSPRRPYLLRAFYDWLLDNQLTPHLVVDVTVPGVQVPME
                     FARDGQIVLNIAPRAVGNLELADDSVRFNARFGGVPREVFVPMASVMAIYARENGAGT
                     MFEPEPAYEIVEEFGEQPQAEEESKPTLMSVVDNESPSSQDEQPDDEPPQPPRGGRPS
                     LRVVK"
     misc_feature    361929..362306
                     /gene="sspB"
                     /locus_tag="Dda3937_00706"
                     /note="ClpXP protease specificity-enhancing factor;
                     Provisional; Region: PRK11798"
                     /db_xref="CDD:236987"
     gene            362547..362960
                     /locus_tag="Dda3937_00707"
                     /db_xref="GeneID:9731730"
     CDS             362547..362960
                     /locus_tag="Dda3937_00707"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881104.1"
                     /db_xref="GI:307129088"
                     /db_xref="ASAP:ABF-0015709"
                     /db_xref="ERIC:ABF-0015709"
                     /db_xref="GeneID:9731730"
                     /translation="MMKTSQGRCLCGAVTITVPESCTHDVYVCHCGMCRTWGGGPLMA
                     IETQHGVTLEGEEHVGRYRSSDWAERAFCRTCGTHLFYRLFEPEIYSISAGLFPNIPK
                     QLVSQVYIDNKPDYYDFLQQTPTMTEQDIIDLYKK"
     misc_feature    362550..362936
                     /locus_tag="Dda3937_00707"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3791"
                     /db_xref="CDD:226314"
     gene            complement(363034..364452)
                     /gene="gltD"
                     /locus_tag="Dda3937_00708"
                     /gene_synonym="aspB; ossB"
                     /db_xref="GeneID:9731731"
     CDS             complement(363034..364452)
                     /gene="gltD"
                     /locus_tag="Dda3937_00708"
                     /gene_synonym="aspB; ossB"
                     /function="1.5.1.1 metabolism; building block
                     biosynthesis; amino acids; glutamate"
                     /function="1.8.3 metabolism; metabolism of other
                     compounds; nitrogen metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase, 4Fe-4S protein, small
                     subunit"
                     /protein_id="YP_003881105.1"
                     /db_xref="GI:307129089"
                     /db_xref="ASAP:ABF-0015710"
                     /db_xref="ERIC:ABF-0015710"
                     /db_xref="GeneID:9731731"
                     /translation="MSQNVYQFIDLQRVDPPKKPLKIRKIEFVEIYEPFSESQSKAQA
                     DRCLACGNPYCEWKCPVHNYIPNWLKLANEGRIIEAAELSHQTNSLPEVCGRVCPQDR
                     LCEGSCTLNDEFGAVTIGNIERYINDKAIEMGWRPDVSSVQPTGKRVAIIGAGPAGLA
                     CADVLTRSGVKAVVYDRHPEIGGLLTFGIPAFKLEKEVMTKRREIFTEMGIEFQLNTE
                     VGKDIQLSDLLTEYDAVFLGVGTYQSMRGGLENEDAPGVYDALPFLIANTKHLMGFET
                     GEQEPYTSMQGKRVVVLGGGDTAMDCVRTSIRQGATHVTCAYRRDEENMPGSKREVKN
                     AREEGVEFRFNLQPLSIEINGSGKVCGVRMVRTELGAPDANGRRRPEAVEGSEHVLEA
                     DAVIMAFGFRPHKMAWLAEHGVDLDTQGRIIAPEQSDSAFQTSNPKIFAGGDAVRGSD
                     LVVTAIAEGRKAADGIMNYLEV"
     misc_feature    complement(363037..364437)
                     /gene="gltD"
                     /locus_tag="Dda3937_00708"
                     /gene_synonym="aspB; ossB"
                     /note="glutamate synthase small subunit family protein,
                     proteobacterial; Region: gltD_gamma_fam; TIGR01318"
                     /db_xref="CDD:130385"
     misc_feature    complement(364048..364383)
                     /gene="gltD"
                     /locus_tag="Dda3937_00708"
                     /gene_synonym="aspB; ossB"
                     /note="Dihydroprymidine dehydrogenase domain II, 4Fe-4S
                     cluster; Region: Fer4_20; pfam14691"
                     /db_xref="CDD:258829"
     misc_feature    complement(363490..364005)
                     /gene="gltD"
                     /locus_tag="Dda3937_00708"
                     /gene_synonym="aspB; ossB"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(363376..363588)
                     /gene="gltD"
                     /locus_tag="Dda3937_00708"
                     /gene_synonym="aspB; ossB"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            complement(364462..368922)
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /db_xref="GeneID:9731732"
     CDS             complement(364462..368922)
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /function="1.5.1.1 metabolism; building block
                     biosynthesis; amino acids; glutamate"
                     /function="1.8.3 metabolism; metabolism of other
                     compounds; nitrogen metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase, large subunit"
                     /protein_id="YP_003881106.1"
                     /db_xref="GI:307129090"
                     /db_xref="ASAP:ABF-0015711"
                     /db_xref="ERIC:ABF-0015711"
                     /db_xref="GeneID:9731732"
                     /translation="MLYDASHERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGA
                     ILADGKTGDGCGLLLQKPDRFFRLVAEEHGWRLANNYAVGMLFLSRDEEKARATRRIV
                     EEELQNETLSVLGWREVPTNPDVLGEIALSSLPRIEQIFVNAPAGWRPRDMERRLFMA
                     RRRIEKRVQDKDFYVCSLSNLVNIYKGLCMPADLPRFYLDLADLRLESAICLFHQRFS
                     TNTVPRWRLAQPFRYLAHNGEINTITGNRQWARARAYKFKTPLIPDLLDAAPFVDESG
                     SDSMSLDNMLELFLAGGMDIVRAMRLLVPPAWQNNPNMDPELRAFFDFNSMHMEPWDG
                     PAGLVLSDGRYAACNLDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEKGRVGP
                     GELMVIDTRTGRILHSTETDDDLKSRHPYKEWMEKNVKRLVPFEELPDDQVGSRELDD
                     ALLETYQKQFGYSNEELDQVIRVLGENGQEATGSMGDDTPFAVLSSRPRIIYDYFRQQ
                     FAQVTNPPIDPLRESHVMSLATCIGREMNVFCEAEGQAHRLSFKSPILLYSDFIQLIN
                     QDPEHYRAEKLDITFDPKQRSLQDTVEKLCDEAEYKVRAGAVLLVLTDRGIAQDRLPV
                     PAPMAVGAIQARLVEKSLRCDANIIVETASARDPHHFAVLLGFGATAVYPYLAYETLA
                     RLVDNHTIDKPYRNVMQNYRNGINKGLYKIMSKMGISTIASYRCSKLFEAVGLHNDVA
                     SRCFQGVVSRIGGASFSDFEQDLQNLSKRAWLKRQKLEQGGLLKFVYDGEYHAYNPDV
                     VKTLQTAVHSGDYQDYQQYAKLVNERPASMLRDLLALQPQEGAAIPLEQVEPDTELFK
                     RFDTAAMSIGALSPEAHESLAEAMNSLGGFSNSGEGGEDPARYGTNKVSRIKQVASGR
                     FGVTPAYLVNADVIQIKVAQGAKPGEGGQLPGDKVTPYIARLRYSVPGVTLISPPPHH
                     DIYSIEDLAQLIFDLKQVNPKAMISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGT
                     GASPLSSVKYAGCPWELGLVETQQALVANGLRHKIRLQVDGGLKTGLDIVKAAILGAE
                     SFGFGTGPMVALGCKYLRICHLNNCATGVATQDDKLRRDHYHGLPERVVNYFTFIARE
                     TRELMAELGISRLVDLIGRTDLLVELDGITAKQNKLDLSPMLHTVAPQPGKALYCTEG
                     NPSFDKGLLNKELIAQAQAHVDARQSKTLYFDIRNTDRSVGATLSGVIAAKHGDQGLA
                     SDPIKAHFTGTAGQSFGVWNAGGVELTLTGDANDYVGKGMAGGVISVRPPVGSAFRSH
                     EASIIGNTCLYGATGGKLFAAGRAGERFAVRNSGAITVVEGIGDNGCEYMTGGIVCIL
                     GRTGVNFGAGMTGGFAYVLDEDGEFRKRVNPELVEVLEVENLAIHEEHLRGLITEHVQ
                     HTGSQRGEEILANWPVWASKFALVKPKSSDVKALLGHRSRSAAELRVQAQ"
     misc_feature    complement(364480..368922)
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="glutamate synthase subunit alpha; Provisional;
                     Region: gltB; PRK11750"
                     /db_xref="CDD:236968"
     misc_feature    complement(367666..368889)
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="Glutamine amidotransferases class-II (Gn-AT),
                     glutamate synthase (GltS)-type. GltS is a homodimer that
                     synthesizes L-glutamate from 2-oxoglutarate and
                     L-glutamine, an important step in ammonia assimilation in
                     bacteria, cyanobacteria and plants. The...; Region: GltS;
                     cd00713"
                     /db_xref="CDD:238365"
     misc_feature    complement(order(368089..368091,368206..368214,
                     368275..368277,368797..368799,368887..368889))
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="active site"
                     /db_xref="CDD:238365"
     misc_feature    complement(order(368257..368259,368509..368511,
                     368521..368523,368554..368556,368569..368571,
                     368575..368577,368614..368616,368626..368628,
                     368635..368637))
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238365"
     misc_feature    complement(366712..367566)
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="Glutamate synthase central domain; Region:
                     Glu_syn_central; pfam04898"
                     /db_xref="CDD:252865"
     misc_feature    complement(365416..366540)
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="Glutamate synthase (GltS) FMN-binding domain.  GltS
                     is a complex iron-sulfur flavoprotein that catalyzes the
                     reductive synthesis of L-glutamate from 2-oxoglutarate and
                     L-glutamine via intramolecular channelling of ammonia, a
                     reaction in the plant, yeast...; Region: GltS_FMN;
                     cd02808"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(365584..365586,365599..365601,
                     365617..365619,365641..365646,365707..365709,
                     365713..365715,365830..365838,365926..365928,
                     366052..366054,366112..366114,366130..366132,
                     366196..366198,366250..366252,366331..366342))
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="active site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(365641..365646,365707..365709,
                     365713..365715,365833..365838,365926..365928,
                     366130..366132,366196..366198,366250..366252,
                     366331..366342))
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(365830..365835,366052..366054,
                     366112..366114))
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(365584..365586,365599..365601,
                     365617..365619))
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="3Fe-4S cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239202"
     misc_feature    complement(364534..365286)
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="gltb_C. This domain is found at the C-terminus of
                     the large subunit (gltB) of glutamate synthase (GltS).
                     GltS encodes a complex iron-sulfur flavoprotein that
                     catalyzes the synthesis of L-glutamate from L-glutamine
                     and 2-oxoglutarate. It requires the...; Region: gltB_C;
                     cd00982"
                     /db_xref="CDD:238482"
     misc_feature    complement(order(364699..364710,364753..364755,
                     364762..364764,364771..364773,364810..364812,
                     364816..364821,364828..364839,364864..364866,
                     364870..364875,364882..364896,364921..364923,
                     364930..364932,364939..364941,364948..364959,
                     365014..365016,365023..365025,365038..365046,
                     365080..365082,365092..365097,365104..365106,
                     365161..365166,365173..365175,365182..365187))
                     /gene="gltB"
                     /locus_tag="Dda3937_00709"
                     /gene_synonym="aspB; ossB"
                     /note="domain interface; other site"
                     /db_xref="CDD:238482"
     gene            369116..369235
                     /locus_tag="Dda3937_00710"
                     /db_xref="GeneID:9731733"
     CDS             369116..369235
                     /locus_tag="Dda3937_00710"
                     /function="0 unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881107.1"
                     /db_xref="GI:307129091"
                     /db_xref="ASAP:ABF-0015712"
                     /db_xref="ERIC:ABF-0015712"
                     /db_xref="GeneID:9731733"
                     /translation="MLDEGVFFLLHKYDETLTRRESFQRIPKLARNPVQVKSP"
     gene            369641..370570
                     /gene="yhcC"
                     /locus_tag="Dda3937_00711"
                     /db_xref="GeneID:9731734"
     CDS             369641..370570
                     /gene="yhcC"
                     /locus_tag="Dda3937_00711"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S oxidoreductase"
                     /protein_id="YP_003881108.1"
                     /db_xref="GI:307129092"
                     /db_xref="ASAP:ABF-0015713"
                     /db_xref="ERIC:ABF-0015713"
                     /db_xref="GeneID:9731734"
                     /translation="MQLQKLINMFGGDLQRRYGEKIHKLTLHGGFSCPNRDGTLGRGG
                     CTFCNVASFADEQMQQRSIAEQLAAQAGKVNRARRYLAYFQAYTSTYAEVQVLASMYR
                     QALTQADMVGLCVGTRPDCVPDTVLDLLADYHAQGYEVWLELGLQSAHDRTLRRINRG
                     HDFACYRQTAQRARARGLKVCSHLIVGLPGESEEHCLSTLRQVVEAGVDGIKLHPLHI
                     VTGSVMAKAWGAGRLPELPLARYVSIAGEMIRHTPPEIVYHRISASARRPTLLAPLWC
                     ENRWTGMVGVHDYLQQHGAQGSALGLPFHYSTN"
     misc_feature    369641..370561
                     /gene="yhcC"
                     /locus_tag="Dda3937_00711"
                     /note="Predicted Fe-S oxidoreductase [General function
                     prediction only]; Region: COG1242"
                     /db_xref="CDD:224163"
     misc_feature    369737..370351
                     /gene="yhcC"
                     /locus_tag="Dda3937_00711"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(369737..369739,369743..369745,369773..369775,
                     369779..369787,369890..369892,369896..369901,
                     369986..369994,370073..370075,370193..370195,
                     370283..370288)
                     /gene="yhcC"
                     /locus_tag="Dda3937_00711"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            370664..373003
                     /gene="arcB"
                     /locus_tag="Dda3937_04694"
                     /pseudo
                     /db_xref="GeneID:9731735"
     misc_feature    370664..373003
                     /gene="arcB"
                     /locus_tag="Dda3937_04694"
                     /note="internal nonsense mutation split arcB into two open
                     reading frames, arcB_1 and arcB_2"
                     /pseudo
                     /db_xref="ASAP:ABF-0061329"
                     /db_xref="ERIC:ABF-0061329"
     gene            complement(373009..373132)
                     /gene="ryhA"
                     /locus_tag="Dda3937_04681"
                     /db_xref="GeneID:9731736"
     ncRNA           complement(373009..373132)
                     /gene="ryhA"
                     /locus_tag="Dda3937_04681"
                     /ncRNA_class="other"
                     /product="small RNA"
                     /note="ortholog of an RNA identified from E. coli K-12 in
                     a large scale screen; function unknown;
                     5' end less conserved, endpoint inexact; secondary
                     structure partially conserved; genome context conserved;
                     no match to Rfam found"
                     /db_xref="ASAP:ABF-0061315"
                     /db_xref="ERIC:ABF-0061315"
                     /db_xref="GeneID:9731736"
     gene            373240..373893
                     /gene="elbB"
                     /locus_tag="Dda3937_00714"
                     /gene_synonym="yhbL"
                     /db_xref="GeneID:9731737"
     CDS             373240..373893
                     /gene="elbB"
                     /locus_tag="Dda3937_00714"
                     /gene_synonym="yhbL"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenoid biosynthesis protein"
                     /protein_id="YP_003881109.1"
                     /db_xref="GI:307129093"
                     /db_xref="ASAP:ABF-0015716"
                     /db_xref="ERIC:ABF-0015716"
                     /db_xref="GeneID:9731737"
                     /translation="MKKVGVVLSGCGVYDGSEIHEVVLTLLAIDRAGAEAVCFAPDKQ
                     QLHVINHLTGEVTGEKRNVLAESARIARGKIQPLSSADPQQLDALIVPGGFGAAKNLS
                     DFATRGADCEIDNELKILTREIHKKNKPIGFICIAPAMLPKLLDTSVQLTIGNDEGTA
                     QAIEAMGGVHVTCPVDDIVVDVAHKVVTTPAYMLANSIGEAASGIEKLVTRVLELAE"
     misc_feature    373240..373890
                     /gene="elbB"
                     /locus_tag="Dda3937_00714"
                     /gene_synonym="yhbL"
                     /note="isoprenoid biosynthesis protein with
                     amidotransferase-like domain; Provisional; Region:
                     PRK11780"
                     /db_xref="CDD:236980"
     misc_feature    373249..373887
                     /gene="elbB"
                     /locus_tag="Dda3937_00714"
                     /gene_synonym="yhbL"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in zebrafish ES1; Region: GATase1_ES1;
                     cd03133"
                     /db_xref="CDD:153227"
     misc_feature    373642..373644
                     /gene="elbB"
                     /locus_tag="Dda3937_00714"
                     /gene_synonym="yhbL"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153227"
     gene            373890..374639
                     /gene="mtgA"
                     /locus_tag="Dda3937_00715"
                     /db_xref="GeneID:9731738"
     CDS             373890..374639
                     /gene="mtgA"
                     /locus_tag="Dda3937_00715"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /codon_start=1
                     /transl_table=11
                     /product="biosynthetic peptidoglycan transglycosylase"
                     /protein_id="YP_003881110.1"
                     /db_xref="GI:307129094"
                     /db_xref="ASAP:ABF-0015717"
                     /db_xref="ERIC:ABF-0015717"
                     /db_xref="GeneID:9731738"
                     /translation="MRSAGLFGKGRLGRLAVCVRRWVLRIFIGVVAMWLAAILLFAFL
                     PVPFSAVMIDRQLSAWLSGDFAYVAHSDWVSMDEIAAVAPLAVIAAEDQKFPQHWGFD
                     FDAISAALRHNERHENRIRGASTLSQQTVKNLLLWDGRSWVRKGLEAGLTAVVELVWT
                     KRRILTVYLNIAEFGPGIFGIEAASRQFFNKPASRLTASEAAMLAAVLPNPIRYRASK
                     PSGYVMRRQQWILRQMSQIGGENFLEANRLY"
     misc_feature    373914..>374633
                     /gene="mtgA"
                     /locus_tag="Dda3937_00715"
                     /note="Membrane carboxypeptidase (penicillin-binding
                     protein) [Cell envelope biogenesis, outer membrane];
                     Region: MrcB; COG0744"
                     /db_xref="CDD:223815"
     misc_feature    373923..374630
                     /gene="mtgA"
                     /locus_tag="Dda3937_00715"
                     /note="monofunctional biosynthetic peptidoglycan
                     transglycosylase; Provisional; Region: mtgA; PRK00056"
                     /db_xref="CDD:234603"
     gene            374649..376034
                     /locus_tag="Dda3937_00716"
                     /db_xref="GeneID:9731739"
     CDS             374649..376034
                     /locus_tag="Dda3937_00716"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881111.1"
                     /db_xref="GI:307129095"
                     /db_xref="ASAP:ABF-0015718"
                     /db_xref="ERIC:ABF-0015718"
                     /db_xref="GeneID:9731739"
                     /translation="MTDKFFPMSGFPFLCPYGKSRPHEQGGIMRYGLVFLMTLSLWGL
                     EVSAAAVSVKNDNSAYVFLQADKLAQVKQQLRNQSAPPQMQLAYQQLLRAADSDMKKT
                     DLSVTQKLSMPPGGNRHDYLSLAAYWWPDPQRKDGLPWVRHDGKVNPATKGEETDAIR
                     LATFTDRVQVLALAWYFSDRPEYAAKAASMIRTWFITPDTRMNPNLNYAQAIPGRNDG
                     RGAGVLDGRFFATRIVDALVILRQAPGWSVSDEQQMRQWMTDYLQWLLSSHNGKQEAA
                     AKNNHGSWYTVQVAGIAAYLGQPETVKAMAALQRQKLDHQLAADGSQPEELARTRSFH
                     YSGFNLQAVSMMAAVAGKYGDNLWLYRTPNGSSLLSALDFMTPYLDESRPWPYKTMGR
                     EGSPLIPLMMQAEQAIGSPRYQAAIRQAGFAPLLTGASEGKKDAEVSVDTRRRIWLLS
                     PPSSTGNTPTP"
     misc_feature    374961..375803
                     /locus_tag="Dda3937_00716"
                     /note="Alginate lyase; Region: Alginate_lyase; pfam05426"
                     /db_xref="CDD:253191"
     gene            complement(376127..376702)
                     /gene="yraP"
                     /locus_tag="Dda3937_00717"
                     /gene_synonym="ecfH"
                     /db_xref="GeneID:9731740"
     CDS             complement(376127..376702)
                     /gene="yraP"
                     /locus_tag="Dda3937_00717"
                     /gene_synonym="ecfH"
                     /note="ecfH shows sigmaE-dependent transcription in E.
                     coli;
                     E. coli ecfH is a paralog of osmY, an osmotically
                     regulated periplasmic protein of unknown function"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881112.1"
                     /db_xref="GI:307129096"
                     /db_xref="ASAP:ABF-0015719"
                     /db_xref="ERIC:ABF-0015719"
                     /db_xref="GeneID:9731740"
                     /translation="MRIYSCIAVLSACLMLQGCIGAVAIGSAAVATKSATDPRTVGTQ
                     VDDGTLEVRVSNALSKDTQLSKEARISVTAYQGKVLLTGQAPSTELASRAKQIAMGVE
                     GTTEVYNEIRKGTPISLGTASMDTWITTKVRSQLLASDTVKSSNVKVTTENGEVFLLG
                     LVTRREGTSAAQIASKVGGVKHVTTAFSYLD"
     misc_feature    complement(376130..376702)
                     /gene="yraP"
                     /locus_tag="Dda3937_00717"
                     /gene_synonym="ecfH"
                     /note="outer membrane lipoprotein; Provisional; Region:
                     PRK11023"
                     /db_xref="CDD:182907"
     misc_feature    complement(376367..376507)
                     /gene="yraP"
                     /locus_tag="Dda3937_00717"
                     /gene_synonym="ecfH"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    complement(376151..376279)
                     /gene="yraP"
                     /locus_tag="Dda3937_00717"
                     /gene_synonym="ecfH"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     gene            complement(376713..377303)
                     /gene="diaA"
                     /locus_tag="Dda3937_00718"
                     /gene_synonym="yraO"
                     /db_xref="GeneID:9731741"
     CDS             complement(376713..377303)
                     /gene="diaA"
                     /locus_tag="Dda3937_00718"
                     /gene_synonym="yraO"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaA initiator-associating factor"
                     /protein_id="YP_003881113.1"
                     /db_xref="GI:307129097"
                     /db_xref="ASAP:ABF-0015720"
                     /db_xref="ERIC:ABF-0015720"
                     /db_xref="GeneID:9731741"
                     /translation="MLERIKVCFTESIQTQIAAAEALPDAISRAALAMVQSLLNGNKI
                     LCCGNGTSAANAQHFAASMINRFETERPSLPAIALNADNVVLTAIANDRLHEEVYAKQ
                     VRALGQAGDVLLAISTRGNSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQQDVE
                     IRIPSHRSARIQEMHMLTVNCLCDLIDNTLFPHQND"
     misc_feature    complement(376740..377279)
                     /gene="diaA"
                     /locus_tag="Dda3937_00718"
                     /gene_synonym="yraO"
                     /note="Phosphoheptose isomerase is a member of the SIS
                     (Sugar ISomerase) superfamily. Phosphoheptose isomerase
                     catalyzes the isomerization of sedoheptulose 7-phosphate
                     into D-glycero-D-mannoheptose 7-phosphate. This is the
                     first step of the biosynthesis of...; Region: SIS_GmhA;
                     cd05006"
                     /db_xref="CDD:240139"
     misc_feature    complement(order(376740..376742,376752..376754,
                     376764..376766,376773..376775,376785..376790,
                     377130..377135,377151..377153,377211..377213,
                     377220..377222,377256..377258,377268..377270))
                     /gene="diaA"
                     /locus_tag="Dda3937_00718"
                     /gene_synonym="yraO"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240139"
     misc_feature    complement(order(376788..376790,376800..376802,
                     376938..376940,376947..376955,377151..377159))
                     /gene="diaA"
                     /locus_tag="Dda3937_00718"
                     /gene_synonym="yraO"
                     /note="active site"
                     /db_xref="CDD:240139"
     gene            complement(377341..377622)
                     /gene="yraN"
                     /locus_tag="Dda3937_00719"
                     /db_xref="GeneID:9731742"
     CDS             complement(377341..377622)
                     /gene="yraN"
                     /locus_tag="Dda3937_00719"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881114.1"
                     /db_xref="GI:307129098"
                     /db_xref="ASAP:ABF-0015721"
                     /db_xref="ERIC:ABF-0015721"
                     /db_xref="GeneID:9731742"
                     /translation="MAANVTVRGGELDLIMRDGGTWVFVEVRYRRNSDFGGAVASITR
                     QKQQSLLRAAAVWLSRQGASFDSTDCRFDVLAVTGSQVEWLPNAFGQSE"
     misc_feature    complement(377353..>377619)
                     /gene="yraN"
                     /locus_tag="Dda3937_00719"
                     /note="hypothetical protein; Reviewed; Region: PRK12497"
                     /db_xref="CDD:237119"
     gene            complement(377694..379745)
                     /gene="yraM"
                     /locus_tag="Dda3937_00720"
                     /db_xref="GeneID:9731743"
     CDS             complement(377694..379745)
                     /gene="yraM"
                     /locus_tag="Dda3937_00720"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_003881115.1"
                     /db_xref="GI:307129099"
                     /db_xref="ASAP:ABF-0015722"
                     /db_xref="ERIC:ABF-0015722"
                     /db_xref="GeneID:9731743"
                     /translation="MLPLNSVRTHAGRLVPVMLAALFLAGCPSQAPQGTATQQHIEGK
                     AGASSDYYLQQMQQSGDDSKADWQLLAIHALIQEGKLPQANGQLNALPSQLNDKQRQE
                     QRLLLAELAVAQNDLNAANSTLAQLDVKSLSPQQQERYYQTQIKAAQDRPSLMLIRAY
                     IGQEPLLQGDAHQRNIDQTWAALTRLTQQDMGSMVINVDENTLQGWLDLLNLWQTKAQ
                     VPSDLQAAIEDWKRRYPRHPAAKQLPSQLGGTPPAAAAQPGDNAPAGGNAIALLLPLN
                     GQAQVFANAIQQGFSAARSGQVSLAMPVQTAQSASTAATTASPAAPATTTPDMIGTSP
                     TAPTTSSAPSTTATAVPALTTAAAGTIPVKVYDTSNQALANVIAQAQKDGATTIVGPL
                     LKNEVEQLPGLNPTLNVLALNQPEHIQPNPNICYFALSPEDEAADAAQFIHKQGKQHP
                     LILAPRGNLGDRVVAAFAKSWQQQAGGVVLQQRTGGVYDLKQALNSGAGIPLNGQPVI
                     TAASAPQPSTTVGGLTIPNQAPPIATATSDGNVDAVYIIATPDELTLLKPMIDMRNKG
                     ALRPALYASSRSYQAGLGPDFRFEMEGLQFSDIPLLTGASPALMQQISTQFRNDYSLV
                     RLFAMGMDAWKLASNFSQLHQPGNSLSGATGVLSTSPDCVVNRKLTWLQFRQGQLVPA
                     S"
     misc_feature    complement(377697..379745)
                     /gene="yraM"
                     /locus_tag="Dda3937_00720"
                     /note="Putative lipoprotein [General function prediction
                     only]; Region: LppC; COG3107"
                     /db_xref="CDD:225649"
     misc_feature    complement(377730..378941)
                     /gene="yraM"
                     /locus_tag="Dda3937_00720"
                     /note="Periplasmic binding component of lipoprotein LppC,
                     an immunodominant antigen; Region:
                     PBP1_YraM_LppC_lipoprotein_like; cd06339"
                     /db_xref="CDD:107334"
     misc_feature    complement(order(378018..378020,378099..378101,
                     378369..378371,378504..378509,378564..378572))
                     /gene="yraM"
                     /locus_tag="Dda3937_00720"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107334"
     gene            379805..380674
                     /gene="rsmI"
                     /locus_tag="Dda3937_00721"
                     /gene_synonym="yraL"
                     /db_xref="GeneID:9731744"
     CDS             379805..380674
                     /gene="rsmI"
                     /locus_tag="Dda3937_00721"
                     /gene_synonym="yraL"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA C1402 ribose 2'-O-methyltransferase"
                     /protein_id="YP_003881116.1"
                     /db_xref="GI:307129100"
                     /db_xref="ASAP:ABF-0015723"
                     /db_xref="ERIC:ABF-0015723"
                     /db_xref="GeneID:9731744"
                     /translation="MNQDQQAQISASTLYIVPTPIGNLADITQRALAVLQQVDLIAAE
                     DTRHTGLLLQHFAINARLFALHDHNEQQKAEQLLARLQQGMSIALVSDAGTPLINDPG
                     YHLVRRCREAGVRVMPLPGPCAAITALSAAGLPSDRFCYEGFLPAKTKARKDTLRDLL
                     EEPRTLIFYESTHRLLDSLQDMVDVWGPERYVVLARELTKTWESLYGAPVAELLAWVQ
                     DDDNRRKGEMVLIVEGHRPDEEALSAAALRTLQLLRAELPLKKAAALAAEIHGVKKNA
                     LYRYGLEQEDGHA"
     misc_feature    379844..380506
                     /gene="rsmI"
                     /locus_tag="Dda3937_00721"
                     /gene_synonym="yraL"
                     /note="Ribosomal RNA small subunit methyltransferase I,
                     also known as rRNA (cytidine-2'-O-)-methyltransferase
                     RsmI; Region: RsmI; cd11648"
                     /db_xref="CDD:212507"
     misc_feature    order(379865..379867,380081..380089,380096..380101,
                     380171..380176,380309..380311,380387..380389,
                     380393..380398,380483..380491)
                     /gene="rsmI"
                     /locus_tag="Dda3937_00721"
                     /gene_synonym="yraL"
                     /note="putative SAM binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212507"
     misc_feature    order(379883..379894,379898..379900,380087..380104,
                     380111..380116,380120..380125,380156..380158,
                     380162..380173,380177..380182,380189..380194,
                     380219..380233)
                     /gene="rsmI"
                     /locus_tag="Dda3937_00721"
                     /gene_synonym="yraL"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212507"
     gene            380717..381097
                     /gene="rnpB"
                     /locus_tag="Dda3937_04682"
                     /db_xref="GeneID:9731745"
     ncRNA           380717..381097
                     /gene="rnpB"
                     /locus_tag="Dda3937_04682"
                     /ncRNA_class="RNase_P_RNA"
                     /product="RNase P, RNA component; M1 RNA"
                     /note="secondary structure conserved; genome context not
                     conserved (rnpB context is not conserved among
                     Enterobacteriacea in general);
                     match to Rfam RNaseP_bact_a (RF00010) with bit score =
                     355.11"
                     /function="RNase P is an essential enzyme responsible for
                     the processing of the 5' ends of precursors to tRNA and
                     other naturally occurring stable RNA molecules"
                     /db_xref="ASAP:ABF-0061316"
                     /db_xref="ERIC:ABF-0061316"
                     /db_xref="GeneID:9731745"
     gene            381360..382169
                     /locus_tag="Dda3937_00722"
                     /db_xref="GeneID:9731746"
     CDS             381360..382169
                     /locus_tag="Dda3937_00722"
                     /function="1.5.1 metabolism; building block biosynthesis;
                     amino acids"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="YP_003881117.1"
                     /db_xref="GI:307129101"
                     /db_xref="ASAP:ABF-0015726"
                     /db_xref="ERIC:ABF-0015726"
                     /db_xref="GeneID:9731746"
                     /translation="MLNKDTKLCISLSGRPSNIGTRFHNYLYQKLDLDFIYKAFTTSD
                     IEHAVKGVRALGIRGCSVSMPFKESCIPFIDTLSDSAKAIDSVNTIVNENGHLTAYNT
                     DYIAVKYLINQNLKDKTMHVLIKGSGGMAKAVIAAFRDSDFRQVTILARNEERGLSLA
                     NKYGFQWCRDAAGIKADILVNVTPVGMAGGEEQNQLAFTEDQIRIASHIFDVVAFPAE
                     TPLIQLARKGDKPVITGAQVIALQALEQFALYTGIRPSEALMQEASVYSRS"
     misc_feature    381360..382166
                     /locus_tag="Dda3937_00722"
                     /note="shikimate 5-dehydrogenase; Reviewed; Region:
                     PRK12550"
                     /db_xref="CDD:183587"
     misc_feature    381429..381629
                     /locus_tag="Dda3937_00722"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    381663..382115
                     /locus_tag="Dda3937_00722"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    order(381666..381668,381999..382001,382074..382076,
                     382083..382085)
                     /locus_tag="Dda3937_00722"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    order(381738..381740,381747..381749,381807..381812,
                     381903..381911,381993..381995,382062..382064,
                     382071..382076)
                     /locus_tag="Dda3937_00722"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133443"
     gene            382348..383136
                     /gene="ygiD"
                     /locus_tag="Dda3937_00723"
                     /db_xref="GeneID:9731747"
     CDS             382348..383136
                     /gene="ygiD"
                     /locus_tag="Dda3937_00723"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase"
                     /protein_id="YP_003881118.1"
                     /db_xref="GI:307129102"
                     /db_xref="ASAP:ABF-0015728"
                     /db_xref="ERIC:ABF-0015728"
                     /db_xref="GeneID:9731747"
                     /translation="MSTSRMPALFLGHGSPMNALDENDYTLAWRKLGETLPRPKAIVA
                     VSAHWYTRGTAVTAMDKPRTIHDFGGFPQALFDTQYPAPGAPDVAKRVQDVLAPVSVY
                     ADHQEWGLDHGTWGVLIKVYPEADIPVVQLSVDGTKPPAYHYELGRKLAALRDEGIMI
                     VASGNVVHNLRMIKWNGDGAPYGWATSFNDFVRSNLAWQGDAAEHPLVNFMQHNDAAL
                     SNPTPDHFLPLLYVLGSWDGQEPVSTPTDGIVMGSLSMMSVQVG"
     misc_feature    382366..383127
                     /gene="ygiD"
                     /locus_tag="Dda3937_00723"
                     /note="The Class III extradiol dioxygenase, 4,5-DOPA
                     Dioxygenase, catalyzes the incorporation of both atoms of
                     molecular oxygen into 4,5-dihydroxy-phenylalanine; Region:
                     45_DOPA_Dioxygenase; cd07363"
                     /db_xref="CDD:153375"
     misc_feature    order(382384..382392,382489..382491,382681..382683,
                     382849..382851,383020..383022,383104..383109)
                     /gene="ygiD"
                     /locus_tag="Dda3937_00723"
                     /note="putative active site [active]"
                     /db_xref="CDD:153375"
     misc_feature    order(382384..382386,382489..382491,383020..383022)
                     /gene="ygiD"
                     /locus_tag="Dda3937_00723"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153375"
     gene            complement(383261..384421)
                     /gene="ygiC"
                     /locus_tag="Dda3937_00724"
                     /db_xref="GeneID:9731748"
     CDS             complement(383261..384421)
                     /gene="ygiC"
                     /locus_tag="Dda3937_00724"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathionylspermidine synthase"
                     /protein_id="YP_003881119.1"
                     /db_xref="GI:307129103"
                     /db_xref="ASAP:ABF-0015730"
                     /db_xref="ERIC:ABF-0015730"
                     /db_xref="GeneID:9731748"
                     /translation="MKRIAINERPNWQEKAAEYGFRFHTMYGEPYWCEDAYYQFTLAQ
                     IEELEDATAELNQMCLQVVDKVVNSEALLTKFRIPRHTWDFVRSSWLSRQPALYARLD
                     LAYDGKNPAKLLENNADTPTSLYESAFFQWIWLEDQINAGRLPQHADQYNSLQEQLIE
                     RFEYLRTHHGFGNMHFTCCRDTDEDRGTVQYLQDCAQEAGVPSQFLYIDEIGLGDRGQ
                     FTDLQDNTIGNLFKLYPWEFMLRETFSTKLADAGVRWLEPGWKSVVSNKALLPMLWQM
                     FPNHPNLLPAYFTEDNPPAMSDYVVKPLFSREGANIRIYRQGQQVAAVDGPYGEEGSI
                     VQQFHPLPRFNDSYTLIGSWLVGDNPCGIGLREDRELITQDLSRLYPHIILD"
     misc_feature    complement(383264..384421)
                     /gene="ygiC"
                     /locus_tag="Dda3937_00724"
                     /note="Glutathionylspermidine synthase [Amino acid
                     transport and metabolism]; Region: Gsp; COG0754"
                     /db_xref="CDD:223825"
     gene            complement(384433..385251)
                     /gene="ygiB"
                     /locus_tag="Dda3937_00725"
                     /db_xref="GeneID:9731749"
     CDS             complement(384433..385251)
                     /gene="ygiB"
                     /locus_tag="Dda3937_00725"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003881120.1"
                     /db_xref="GI:307129104"
                     /db_xref="ASAP:ABF-0015731"
                     /db_xref="ERIC:ABF-0015731"
                     /db_xref="GeneID:9731749"
                     /translation="MMGTMPFCSGINFVLGSTTMKRTSNINHARFRKRWGYRIAPIAL
                     AVGAVFILSGCEKTDETVSLYQNADDCSRANPAMKDQCTTTYNNARKEAERTAPKYAT
                     REECVAAFGESQCTQSATTSTTASAAAPQQSGSFWMPLMAGFMMGKLMGGNNFAQQPV
                     FRPNTPNNPANGSYVDASGKNYGSATGRTITVPKDAMTPKPTSSVRPSSITTTRGGFG
                     DSVNKLNSTPAANMTGNQDRDRAATSTSSSSSSATGSSTRQTGSSTPIRRSFGG"
     misc_feature    complement(384532..385194)
                     /gene="ygiB"
                     /locus_tag="Dda3937_00725"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11653"
                     /db_xref="CDD:236948"
     gene            complement(385387..386799)
                     /gene="tolC"
                     /locus_tag="Dda3937_00726"
                     /gene_synonym="colE1-i; hasF; mtcB; mukA; refI; toc; weeA"
                     /db_xref="GeneID:9731750"
     CDS             complement(385387..386799)
                     /gene="tolC"
                     /locus_tag="Dda3937_00726"
                     /gene_synonym="colE1-i; hasF; mtcB; mukA; refI; toc; weeA"
                     /function="tolC is involved in resistance to antimicrobial
                     plant chemicals and is essential for phytopathogenesis"
                     /function="7.4 location of gene products; outer membrane"
                     /function="6.1 cell structure; membrane"
                     /function="5.1 cell processes; cell division"
                     /function="4.1.B.17 transport; Channel-type Transporters;
                     Beta barrel porins (The Outer Membrane Porin (OMP)
                     Functional Superfamily); The Outer Membrane Factor (OMF)
                     Family"
                     /codon_start=1
                     /transl_table=11
                     /product="transport channel"
                     /protein_id="YP_003881121.1"
                     /db_xref="GI:307129105"
                     /db_xref="ASAP:ABF-0015732"
                     /db_xref="ERIC:ABF-0015732"
                     /db_xref="GeneID:9731750"
                     /translation="MKKLLPLLISLGLGGFSAVSQAEDLLQVYQQAKTTNPDLRSAAA
                     NRDAAFEKINEARSSLLPQLGLGADYTYTSGYRDRRDINSNATSASLQLTQSIFNMSL
                     WRALTLQEKQAGIQDVSYQTSQQTLLLNTATAYFNVLRAIDSLSYVSAQKQSIYRELD
                     QTTQRFNVGLVAITDVQNARAQYDSVLASEVTARNNLDNAMETLRQVTGQFYPQLAGL
                     NIDRFSPQKPDAVNGLLKEAENRNLSLLSARLSQDLAREQIRSAESGHLPTLNLTAST
                     GVTNTDYSGSRAVGDNFNNTYVGQNQVGLSFSLPIYSGGGTSSRVKQAQHSFVASSES
                     MESAHRSVIQTLRSAHNNISASISSVNAYKQAVISAQSSLDAMEAGYQVGTRTIVDVL
                     DATTTLYNAKQQLSGARYDYLINQLNLKQALGTLNEDDLRTLNAMLGKPVSTSAAIGD
                     DVPAPATTPAAAKTAAKAKP"
     misc_feature    complement(385456..386799)
                     /gene="tolC"
                     /locus_tag="Dda3937_00726"
                     /gene_synonym="colE1-i; hasF; mtcB; mukA; refI; toc; weeA"
                     /note="outer membrane channel protein; Reviewed; Region:
                     tolC; PRK09465"
                     /db_xref="CDD:236529"
     misc_feature    complement(386173..386727)
                     /gene="tolC"
                     /locus_tag="Dda3937_00726"
                     /gene_synonym="colE1-i; hasF; mtcB; mukA; refI; toc; weeA"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    complement(385528..386100)
                     /gene="tolC"
                     /locus_tag="Dda3937_00726"
                     /gene_synonym="colE1-i; hasF; mtcB; mukA; refI; toc; weeA"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            387203..387838
                     /gene="nudF"
                     /locus_tag="Dda3937_04303"
                     /gene_synonym="aspP; trgB; yqiE"
                     /db_xref="GeneID:9731751"
     CDS             387203..387838
                     /gene="nudF"
                     /locus_tag="Dda3937_04303"
                     /gene_synonym="aspP; trgB; yqiE"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.1 metabolism; carbon utilization"
                     /function="1.7.8 metabolism; central intermediary
                     metabolism; gluconeogenesis"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="YP_003881122.1"
                     /db_xref="GI:307129106"
                     /db_xref="ASAP:ABF-0046536"
                     /db_xref="ERIC:ABF-0046536"
                     /db_xref="GeneID:9731751"
                     /translation="MASSGTHPGTFTKDDVEIIARETLYKGFFSLQRYRFRHRLFNGG
                     MSGEVSREILERGHAVVLLPYDPVRDEVVLIEQIRIAAYDTSTSPWLFELVAGMIEPG
                     ESLEEVARREAQEEAGLMVQRCRPALSYLASPGGTSERLAIWVGEVDAGAAGGIHGLA
                     EEHEDIRVHVVSREQSYQWVEQGIIDNAASVIALQWLALHHETLKKDWVDG"
     misc_feature    387230..387832
                     /gene="nudF"
                     /locus_tag="Dda3937_04303"
                     /gene_synonym="aspP; trgB; yqiE"
                     /note="ADP-ribose pyrophosphatase NudF; Provisional;
                     Region: nudF; PRK10729"
                     /db_xref="CDD:182682"
     misc_feature    387368..387802
                     /gene="nudF"
                     /locus_tag="Dda3937_04303"
                     /gene_synonym="aspP; trgB; yqiE"
                     /note="ADP-ribose pyrophosphatase (ADPRase) catalyzes the
                     hydrolysis of ADP-ribose and a variety of additional
                     ADP-sugar conjugates to AMP and ribose-5-phosphate. Like
                     other members of the Nudix hydrolase superfamily, it
                     requires a divalent cation, such as Mg2+; Region:
                     ADPRase_NUDT5; cd03424"
                     /db_xref="CDD:239516"
     misc_feature    order(387368..387370,387374..387376,387428..387430,
                     387434..387436,387440..387442,387470..387472,
                     387587..387598,387602..387604,387608..387622,
                     387692..387697,387701..387703,387740..387745,
                     387764..387766,387776..387778,387785..387787,
                     387797..387802)
                     /gene="nudF"
                     /locus_tag="Dda3937_04303"
                     /gene_synonym="aspP; trgB; yqiE"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239516"
     misc_feature    order(387377..387379,387437..387439,387494..387496,
                     387536..387538,387548..387550,387617..387619)
                     /gene="nudF"
                     /locus_tag="Dda3937_04303"
                     /gene_synonym="aspP; trgB; yqiE"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239516"
     misc_feature    order(387437..387439,387488..387496,387536..387538,
                     387548..387550,387617..387619,387692..387694)
                     /gene="nudF"
                     /locus_tag="Dda3937_04303"
                     /gene_synonym="aspP; trgB; yqiE"
                     /note="active site"
                     /db_xref="CDD:239516"
     misc_feature    order(387491..387502,387506..387559)
                     /gene="nudF"
                     /locus_tag="Dda3937_04303"
                     /gene_synonym="aspP; trgB; yqiE"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239516"
     misc_feature    order(387536..387538,387548..387550,387692..387694)
                     /gene="nudF"
                     /locus_tag="Dda3937_04303"
                     /gene_synonym="aspP; trgB; yqiE"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239516"
     gene            387838..388260
                     /gene="yqiB"
                     /locus_tag="Dda3937_04304"
                     /db_xref="GeneID:9731752"
     CDS             387838..388260
                     /gene="yqiB"
                     /locus_tag="Dda3937_04304"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_003881123.1"
                     /db_xref="GI:307129107"
                     /db_xref="ASAP:ABF-0046537"
                     /db_xref="ERIC:ABF-0046537"
                     /db_xref="GeneID:9731752"
                     /translation="MKRYVPDFPEMMRLSEINFAQLRRLLPRNEEAGAAVVYQVHNAS
                     YRLTILESTRYTALVEIQQIAPSVSYWSLPTLVVRLYYDAMVAEVCSSQQIFRFKARY
                     DYPNKKLHQRDEKHQINQFLADWLRYCLACGSMSVPVC"
     misc_feature    387838..388257
                     /gene="yqiB"
                     /locus_tag="Dda3937_04304"
                     /note="putative dehydrogenase; Provisional; Region:
                     PRK11039"
                     /db_xref="CDD:182921"
     gene            388465..389292
                     /gene="cpdA"
                     /locus_tag="Dda3937_01249"
                     /gene_synonym="icc"
                     /db_xref="GeneID:9731753"
     CDS             388465..389292
                     /gene="cpdA"
                     /locus_tag="Dda3937_01249"
                     /gene_synonym="icc"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="3.1.3.4 regulation; type of regulation;
                     posttranscriptional; proteases, cleavage of compounds"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="Icc protein"
                     /protein_id="YP_003881124.1"
                     /db_xref="GI:307129108"
                     /db_xref="ASAP:ABF-0016521"
                     /db_xref="ERIC:ABF-0016521"
                     /db_xref="GeneID:9731753"
                     /translation="MESLLTLPVARGARIRILQITDTHLFAGERETLLGVDTYRSYQA
                     VLDAIAAQQCDFDLITATGDLAQDHTQEAYTRFADGIRRFNAPCVWLPGNHDFQPAMV
                     DVLARSGIAPSKHVLLGEHWQVILLDSQVFGVPHGELSEYQLEWLERSLQSQPERYTL
                     LMLHHHPLPSGCTWLDQHSLRNAHSLDALLARFPRVRTVLCGHIHQEMDLDWNGRRLL
                     ATPSTCVQFKPHCTSFTIDNVAPGWRYLELLPDGVLETQVCRLEGNEFLPDMDSDGY"
     misc_feature    388507..389289
                     /gene="cpdA"
                     /locus_tag="Dda3937_01249"
                     /gene_synonym="icc"
                     /note="Predicted phosphohydrolases [General function
                     prediction only]; Region: Icc; COG1409"
                     /db_xref="CDD:224327"
     misc_feature    388510..389220
                     /gene="cpdA"
                     /locus_tag="Dda3937_01249"
                     /gene_synonym="icc"
                     /note="Enterobacter aerogenes GpdQ and related proteins,
                     metallophosphatase domain; Region: MPP_GpdQ; cd07402"
                     /db_xref="CDD:163645"
     misc_feature    order(388528..388530,388534..388536,388654..388656,
                     388663..388665,388744..388749,388954..388956,
                     389071..389073,389077..389079,389137..389139)
                     /gene="cpdA"
                     /locus_tag="Dda3937_01249"
                     /gene_synonym="icc"
                     /note="active site"
                     /db_xref="CDD:163645"
     misc_feature    order(388528..388530,388534..388536,388654..388656,
                     388744..388746,388954..388956,389071..389073,
                     389077..389079)
                     /gene="cpdA"
                     /locus_tag="Dda3937_01249"
                     /gene_synonym="icc"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163645"
     misc_feature    order(388573..388575,388582..388584,388591..388596,
                     388603..388608,388663..388665,388672..388674,
                     388699..388701,388966..388968,388972..388977,
                     389056..389058,389062..389064,389083..389097,
                     389104..389112,389116..389118,389203..389205,
                     389212..389214,389218..389220)
                     /gene="cpdA"
                     /locus_tag="Dda3937_01249"
                     /gene_synonym="icc"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163645"
     gene            389292..389873
                     /gene="yqiA"
                     /locus_tag="Dda3937_01250"
                     /db_xref="GeneID:9731754"
     CDS             389292..389873
                     /gene="yqiA"
                     /locus_tag="Dda3937_01250"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="YP_003881125.1"
                     /db_xref="GI:307129109"
                     /db_xref="ASAP:ABF-0016522"
                     /db_xref="ERIC:ABF-0016522"
                     /db_xref="GeneID:9731754"
                     /translation="MPTLLYLHGFNSSPLSAKATALQQWLAQHHPHIDMLVPQLPPYP
                     ADAAEMVEQLVMERAGRPLGLVGSSMGGYYATWLSQRFRLPAVVVNPAVRPYELLLDF
                     LGDQQNPYTGEQYVLESRHIYDLKVMQVDPLESPDLLWCLLQTGDEVLDYRQAVAYYT
                     ACRQTVESGGNHAFVGFEHYFAPIIDFLGLTAD"
     misc_feature    389292..389861
                     /gene="yqiA"
                     /locus_tag="Dda3937_01250"
                     /note="esterase YqiA; Provisional; Region: PRK11071"
                     /db_xref="CDD:182945"
     misc_feature    389301..>389594
                     /gene="yqiA"
                     /locus_tag="Dda3937_01250"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            390060..391955
                     /gene="parE"
                     /locus_tag="Dda3937_01251"
                     /db_xref="GeneID:9731755"
     CDS             390060..391955
                     /gene="parE"
                     /locus_tag="Dda3937_01251"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="3.1.1.1 regulation; type of regulation; DNA
                     structure level; DNA bending, supercoiling, inversion"
                     /function="7.1 location of gene products; cytoplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="Topoisomerase IV subunit B"
                     /protein_id="YP_003881126.1"
                     /db_xref="GI:307129110"
                     /db_xref="ASAP:ABF-0016524"
                     /db_xref="ERIC:ABF-0016524"
                     /db_xref="GeneID:9731755"
                     /translation="MTQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNS