GenomeNet

Database: RefSeq
Entry: NC_014500
LinkDB: NC_014500
Original site: NC_014500 
LOCUS       NC_014500            4922802 bp    DNA     circular CON 01-MAR-2015
DEFINITION  Dickeya dadantii 3937, complete genome.
ACCESSION   NC_014500
VERSION     NC_014500.1  GI:307128764
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603422
            Assembly: GCF_000147055.1
KEYWORDS    RefSeq.
SOURCE      Dickeya dadantii 3937
  ORGANISM  Dickeya dadantii 3937
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Dickeya.
REFERENCE   1  (bases 1 to 4922802)
  AUTHORS   Glasner,J.D., Yang,C.H., Reverchon,S., Hugouvieux-Cotte-Pattat,N.,
            Condemine,G., Bohin,J.P., Van Gijsegem,F., Yang,S., Franza,T.,
            Expert,D., Plunkett,G. III, San Francisco,M.J., Charkowski,A.O.,
            Py,B., Bell,K., Rauscher,L., Rodriguez-Palenzuela,P., Toussaint,A.,
            Holeva,M.C., He,S.Y., Douet,V., Boccara,M., Blanco,C., Toth,I.,
            Anderson,B.D., Biehl,B.S., Mau,B., Flynn,S.M., Barras,F.,
            Lindeberg,M., Birch,P.R., Tsuyumu,S., Shi,X., Hibbing,M., Yap,M.N.,
            Carpentier,M., Dassa,E., Umehara,M., Kim,J.F., Rusch,M., Soni,P.,
            Mayhew,G.F., Fouts,D.E., Gill,S.R., Blattner,F.R., Keen,N.T. and
            Perna,N.T.
  TITLE     Genome sequence of the plant-pathogenic bacterium Dickeya dadantii
            3937
  JOURNAL   J. Bacteriol. 193 (8), 2076-2077 (2011)
   PUBMED   21217001
REFERENCE   2  (bases 1 to 4922802)
  CONSRTM   International Erwinia Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (14-MAY-2010) Department of Genetics, University of
            Wisconsin, 425 Henry Mall, Madison, WI 53706, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Source DNA and bacteria strain is available from Jeremy Glasner,
            jglasner@wisc.edu.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 02/26/2015 11:44:12
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 458994)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,328
            CDS                          :: 4,188
            Pseudo Genes                 :: 36
            CRISPR Arrays                :: 4
            rRNAs                        :: 22 ( 5S, 16S, 23S )
            tRNAs                        :: 75
            ncRNA                        :: 7
            Frameshifted Genes           :: 29
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4922802
                     /organism="Dickeya dadantii 3937"
                     /mol_type="genomic DNA"
                     /strain="3937"
                     /db_xref="taxon:198628"
     gene            complement(32..475)
                     /locus_tag="DDA3937_RS00005"
                     /old_locus_tag="Dda3937_00155"
                     /db_xref="GeneID:9735696"
     CDS             complement(32..475)
                     /locus_tag="DDA3937_RS00005"
                     /old_locus_tag="Dda3937_00155"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="5.1 cell processes; cell division"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315713.1"
                     /note="An electron-transfer protein; flavodoxin binds one
                     FMN molecule, which serves as a redox-active prosthetic
                     group; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding protein MioC"
                     /protein_id="WP_013315713.1"
                     /db_xref="GI:503080828"
                     /db_xref="GeneID:9735696"
                     /translation="MADITLISGSTLGSAEYVTEHLESLLQQHDFTTTLLHGPELDEV
                     TPENLWLVVTSTHGAGDLPDNLQPFYDDLQTKRPDLSAVRYGAIGIGSSEYDTFCGAI
                     VKVDQLLQDLGARRIGDMLKIDITQHDIPEDPAEVWLGSWVNLLK"
     gene            complement(567..1031)
                     /locus_tag="DDA3937_RS00010"
                     /old_locus_tag="Dda3937_00156"
                     /db_xref="GeneID:9731388"
     CDS             complement(567..1031)
                     /locus_tag="DDA3937_RS00010"
                     /old_locus_tag="Dda3937_00156"
                     /function="asnC regulates the expression of the genes
                     asnA, asnC and gidA involved in the synthesis of
                     asparagine"
                     /function="1.5.1.6 metabolism; building block
                     biosynthesis; amino acids; asparagine"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.2 regulation; genetic unit regulated;
                     regulon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315714.1"
                     /note="transcriptional repressor of asnA which codes for
                     aspartate-ammonia ligase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013315714.1"
                     /db_xref="GI:503080829"
                     /db_xref="GeneID:9731388"
                     /translation="MAADTYTMDELDRGILNALMENARTPYAELAKQFSVSPGTIHVR
                     VEKMKQAGIIVGTRLDVNPKQLGYDVCCFIGIILKSAKDYPSAVEKLSNLEEVVEAYY
                     TTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
     gene            complement(1178..2653)
                     /locus_tag="DDA3937_RS00015"
                     /old_locus_tag="Dda3937_00157"
                     /db_xref="GeneID:9731389"
     CDS             complement(1178..2653)
                     /locus_tag="DDA3937_RS00015"
                     /old_locus_tag="Dda3937_00157"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019844291.1"
                     /note="contains a von Willibrand factor type A domain;
                     stimulates the ATPase activity of RavA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="WP_013315715.1"
                     /db_xref="GI:503080830"
                     /db_xref="GeneID:9731389"
                     /translation="MLTLESLEMLLSIDENDLLDDVIITLMATPQLMMFFDKYPRLKA
                     AVMRDLPEWKENLRQRLRNTQAPPELEKEFTCYQQTQLISDHTFQSNLPDIMSTLHNV
                     DSPFLNQAEKLVHSASHSSESRISSSQHSLFMQRWRLSLTLQTLNLHQQIMEQERDQL
                     LDEIQKRLTISGALEPILADNDTAAGRLWDLSASKRMKQPFNALLEVGAFLRQQPELQ
                     RLAERLGRSRETKSVLSQDAPKEAFQVMVREPAFAPEQVSGIHQSDDILRLLPTELST
                     LGISELEFEFYRRLSEHRLLTYRLQGESWREKTLERPVVHQHNEQQPRGPFIVCVDTS
                     GSMGGFNERCAKAFCLALMRIALADNRRCYIMLFSTGIVSYDLTSESGLEEAIRFLSQ
                     TFRGGTDLNSCLSALLEKMDSQSWQDADAVIISDFIAQRLPDELVNEVKRRQHRLQHR
                     FHAVAMSAHGKPGILRIFDHIWRFDTGLKSRLLRRFQHEKV"
     gene            complement(2659..4155)
                     /locus_tag="DDA3937_RS00020"
                     /old_locus_tag="Dda3937_00158"
                     /db_xref="GeneID:9731390"
     CDS             complement(2659..4155)
                     /locus_tag="DDA3937_RS00020"
                     /old_locus_tag="Dda3937_00158"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886740.1"
                     /note="interacts with LdcI, lysine decarboxylase; may be
                     active in late log/ early stationary phase; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory ATPase RavA"
                     /protein_id="WP_013315716.1"
                     /db_xref="GI:503080831"
                     /db_xref="GeneID:9731390"
                     /translation="MIQPTALADRISRLSHALEHGLYERQHAIRLCLLAALSGESVFL
                     LGPPGIAKSLIARRLKYAFRHARAFEYLMTRFSTPEEVFGPLSIQALKDEGRYQRLTT
                     GYLPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGNSEEPIPMRLLVTASNELPEA
                     DSSLEALYDRMLIRIWLDRVQDKHNFRAMLTASPGEQDNLVSPALSVSDEEYQQWQSH
                     IDHIPLPENCFELIYQLRQRLDSQDGSPYVSDRRWKKAIRLLQACAFFSGRETITPVD
                     LILLKDCLWHDLGTHDLVEQQLQQLMSEQAYQQRALLYRLQQLNVKRQQYQQQQSEQQ
                     AFRVERQVNFFGRKPHHTLPESLTSTELTLMLQKPLLLNDYTVTHVVLDREALAGWLQ
                     KGGEIRGKLNGVGFSQRLDMEVDERQHLIIRDISLQSTVLSLPGVLKGELPEEMLQEY
                     ETLKIQLREQRRLFERHQPCLFVPKEWLARIEESLQQVDEQIEQSQRE"
     gene            4431..6299
                     /gene="trkD"
                     /locus_tag="DDA3937_RS00025"
                     /old_locus_tag="Dda3937_00159"
                     /db_xref="GeneID:9731391"
     CDS             4431..6299
                     /gene="trkD"
                     /locus_tag="DDA3937_RS00025"
                     /old_locus_tag="Dda3937_00159"
                     /function="4.2.A.72 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The K+ uptake permease (KUP) Family"
                     /function="5.5.1 cell processes; adaptation to stress;
                     osmotic pressure"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.96 transport; substrate; K+"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848467.1"
                     /note="Responsible for the low-affinity transport of
                     potassium into the cell; involved in potassium ion uptake
                     under hyper-osmotic stress at a low pH; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter Kup"
                     /protein_id="WP_013315717.1"
                     /db_xref="GI:503080832"
                     /db_xref="GeneID:9731391"
                     /translation="MNSEHKRSLPAITLAAIGVVYGDIGTSPLYTLRECLSGQFGFGV
                     EPDSVFGFLSLIFWLLVLVVSLKYLSYVMRADNAGEGGILTLMSLAGRNTSDKVTAMV
                     VIMGLIGGSFFYGEVVITPAISVMSAIEGLDIVAPSLDTYIVPISIVVLTLLFMIQKH
                     GTGRVGSLFAPIMTVWFLSLGVLGARSIIANPEVLQALNPKWAINFFIQYKAVSFFAL
                     GAVVLAITGVEALYADMGHFGKLPIRIAWFSAVLPSLVLNYFGQGALLLKNPEAIKNP
                     FFLLAPDWALIPLLVLATLATIIASQAVISGVFSLTRQAVRLGYLPPMRIVHTSDMES
                     GQIYIPFINWLLYVAVVIVIVSFEHSSNLAAAYGIAVTGTMVLTSILSCTVAVKNWHW
                     YRHLVWLLLVALLAIDLPMFLANVVKIISGGWLPLALGMVMFTIMTTWKSERFRLLRR
                     IHEHGNSLDAMITSLEKNPPVRVTGTAVYLSRATHVIPFALLHNLKHNKVLHERVVLL
                     TMRTEDAPYVHNARRVSVEQLSPTFWRVVASYGWRETPNVEEVFHRCWQDGLTCQMME
                     TTFFLSNESLMMGNRPWYLRVRGKLFMMLSRNALRAADQFEIPPNRLIELGIQVEI"
     gene            6696..7115
                     /locus_tag="DDA3937_RS00030"
                     /old_locus_tag="Dda3937_02355"
                     /db_xref="GeneID:9731392"
     CDS             6696..7115
                     /locus_tag="DDA3937_RS00030"
                     /old_locus_tag="Dda3937_02355"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.48 transport; substrate; D-ribose"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886738.1"
                     /note="cytoplasmic mutarotase that catalyzes the
                     conversion between beta-pyran and beta-furan forms of
                     D-ribose; RbsD is required for efficient ribose
                     utilization in E. coli; rbsD-mutant E. coli strains are
                     unable to use ribose as a sole carbon source; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose pyranase"
                     /protein_id="WP_013315718.1"
                     /db_xref="GI:503080833"
                     /db_xref="GeneID:9731392"
                     /translation="MKKGALLNSDISSVISRLGHTDQIVIADAGLPIPETTTRIDLAL
                     THNVPGFLQVLNVVTAEMQVEAAILAQEIIEKNTQLHDALLKQLAQLEQHQGNTISLH
                     YVSHEDFKKQSGQSRAIIRTGECSPYANVILCAGVTF"
     gene            7123..8628
                     /locus_tag="DDA3937_RS00035"
                     /old_locus_tag="Dda3937_02356"
                     /db_xref="GeneID:9731393"
     CDS             7123..8628
                     /locus_tag="DDA3937_RS00035"
                     /old_locus_tag="Dda3937_02356"
                     /function="4.3.A.1.am transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, ATP binding and membrane component"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010300119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose transporter ATP binding protein"
                     /protein_id="WP_013315719.1"
                     /db_xref="GI:503080834"
                     /db_xref="GeneID:9731393"
                     /translation="MQPLLQLQGITKTFPGVKALSGAALNVYPGKVMALVGENGAGKS
                     TMMKVLTGIYRKDAGSIHFLGKDVDFSGPKASQEAGIGIIHQELNLIPQLTIAENIFL
                     GREFTNRLGRIDWKQMYAEADKLLKRLNLRYDSRRLVGELSIGDQQMVEIAKVLSFES
                     RVIIMDEPTDALTDTETASLFSVIKELQSQGCGIVYISHRLKEIFEICDDVTVFRDGQ
                     FIGERPVSELQEDSLIEMMVGRKLEDQYPRLNQAPGEVRLQVSELSGPGVENVSFTLR
                     KGEILGVAGLMGAGRTELMKVLYGALPRTHGKVHLDGKDVVTRSPQDGLASGIVYISE
                     DRKHDGLVLGMSVKENMSLTALRYFSNAAGSLRHGDEQQAVNDFIRMFNIRTPSMSQP
                     IGLLSGGNQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFKQEGLSIIL
                     VSSEMPEVLGMSDRIIVMHEGRLSGEFPIEQATQETLMAAAVGKQYGVKQE"
     gene            8636..9604
                     /gene="rbsC"
                     /locus_tag="DDA3937_RS00040"
                     /old_locus_tag="Dda3937_02357"
                     /db_xref="GeneID:9731394"
     CDS             8636..9604
                     /gene="rbsC"
                     /locus_tag="DDA3937_RS00040"
                     /old_locus_tag="Dda3937_02357"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.48 transport; substrate; D-ribose"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016941665.1"
                     /note="functions to transport ribose at high affinity;
                     forms a complex with RbsA2C2B; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter permease"
                     /protein_id="WP_013315720.1"
                     /db_xref="GI:503080835"
                     /db_xref="GeneID:9731394"
                     /translation="MSSQTITAKRWLSKEWLMEQKSLIALLILIAVVSSMSPNFFTLN
                     NLFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASIVGLEINALVAVF
                     AALALGAVIGAGTGIVIAKGRVQAFIATLVMMLLLRGVTMVYTNGSPINTGFSDSADA
                     LGWFGIGRPLGIPTPIWIMAVVFLATWYMLHHTRIGRYIYALGGNEAATRLSGISVDR
                     VKVVVYALCGLLSALAGIIEVARLSSAQPTAGTGYELDAIAAVVLGGTSLSGGKGRVV
                     GTLIGALILGFLNNGLNLLGVSSYYQMIVKAVVILLAVLVDNKGSK"
     gene            9631..10518
                     /locus_tag="DDA3937_RS00045"
                     /old_locus_tag="Dda3937_02358"
                     /db_xref="GeneID:9731395"
     CDS             9631..10518
                     /locus_tag="DDA3937_RS00045"
                     /old_locus_tag="Dda3937_02358"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="4.S.48 transport; substrate; D-ribose"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315721.1"
                     /note="periplasmic substrate-binding component of the
                     ATP-dependent ribose transport system; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose transporter subunit RbsB"
                     /protein_id="WP_013315721.1"
                     /db_xref="GI:503080836"
                     /db_xref="GeneID:9731395"
                     /translation="MNLKKIATLVSAVALSAAVSTNALAKDTIALVVSTLNNPFFVSL
                     KDGAQKEADKLGYNLVILDSQNNPAKELSNVQDLTVRGTKLLLINPTDSNAVGNAVKL
                     ANQAKIPVITLDRVAASGEVVSHVASDNAFGGKVAGDFIAKKLGEGAKVIQLEGLAGT
                     SAARERGAGFMKSAEKNKFAMLASQPADFDRTKGLNVMQNLLTAHPDVKAVFAQNDEM
                     ALGALRALQTAGRDDVLVVGFDGTADGVKAVEGGKLAATVAQRPEQIGIIGVETADKV
                     LKGEKVQPIIPVDLKLVTK"
     gene            10604..11530
                     /locus_tag="DDA3937_RS00050"
                     /old_locus_tag="Dda3937_02359"
                     /db_xref="GeneID:9731396"
     CDS             10604..11530
                     /locus_tag="DDA3937_RS00050"
                     /old_locus_tag="Dda3937_02359"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315722.1"
                     /note="catalyzes the formation of D-ribose 5-phosphate
                     from ribose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="WP_013315722.1"
                     /db_xref="GI:503080837"
                     /db_xref="GeneID:9731396"
                     /translation="MKSGKLVVLGSINADHILNLAQFPRPGETVIGKQYGVAFGGKGA
                     NQAVAAGRSGADIEFIACVGADDIGERIRQQLIKDRIDVSAVEAISGQTTGVALIFVN
                     GEAENMIGIHAGANAAVTPDYLNRYQQKIIDASALLMQLESPLETVTAAARLAHDHGT
                     KVILNPAPACSLPDELLSLVDMITPNETEAQILTGVAVETEDDAQRAAQVLHDKGIAT
                     VLITLGSRGVWLSEQGKGQRIPGFRVKAVDTIAAGDTFNGALVTALLESRPMEAAVKF
                     AHAAAAIAVTRHGAQPSVPWREEIDAFLNAQE"
     gene            11543..12538
                     /locus_tag="DDA3937_RS00055"
                     /old_locus_tag="Dda3937_02360"
                     /db_xref="GeneID:9731397"
     CDS             11543..12538
                     /locus_tag="DDA3937_RS00055"
                     /old_locus_tag="Dda3937_02360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315723.1"
                     /note="binds to the purF operator and coregulates other
                     genes for de novo purine nucleotide synthesis; is involved
                     in regulation of purB, purC, purEK, purHD, purL, purMN and
                     guaBA expression; binds hypoxanthine and guanine as
                     inducers; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_033111483.1"
                     /db_xref="GI:696580304"
                     /db_xref="GeneID:9731397"
                     /translation="MKDVARLAGVSTSTVSHVINNNRYVSDAIRDRVMKAVEELNYAP
                     SALARSLKINQTRTIGMLLTASSNPFYAEVVRGVERCCYERGYSLILCNTEGDHHRLS
                     RSLETLLQKRVDGLLLMCTESHMPSPDIIRRYPSIPVVMMDWAPFEGSSDVIKDNSLQ
                     GGEMATHYLISQGYRNIACIAGPQDKTTAHNRLEGYRKAMYQAGLPILPGYEVVGDFE
                     FETGFRAMQQLLALPERPDAVFTSNDAMAVGVYRALHDAGLSIPDDMAVVGYDDIELA
                     RYLSPPLTTIHQPKDELGELAIDTLLHRLEHPDTEHNVLVLTPELIVRDSVGKRS"
     gene            12974..14522
                     /locus_tag="DDA3937_RS00060"
                     /old_locus_tag="Dda3937_04660"
                     /db_xref="GeneID:9731398"
     rRNA            12974..14522
                     /locus_tag="DDA3937_RS00060"
                     /old_locus_tag="Dda3937_04660"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:9731398"
     gene            14604..14679
                     /locus_tag="DDA3937_RS00065"
                     /old_locus_tag="Dda3937_04671"
                     /db_xref="GeneID:9731399"
     tRNA            14604..14679
                     /locus_tag="DDA3937_RS00065"
                     /old_locus_tag="Dda3937_04671"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:14638..14640,aa:Glu,seq:ttc)
                     /db_xref="GeneID:9731399"
     gene            14865..17799
                     /locus_tag="DDA3937_RS00070"
                     /old_locus_tag="Dda3937_04661"
                     /db_xref="GeneID:9731400"
     rRNA            14865..17799
                     /locus_tag="DDA3937_RS00070"
                     /old_locus_tag="Dda3937_04661"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:9731400"
     gene            17890..18005
                     /locus_tag="DDA3937_RS00075"
                     /old_locus_tag="Dda3937_04662"
                     /db_xref="GeneID:9731401"
     rRNA            17890..18005
                     /locus_tag="DDA3937_RS00075"
                     /old_locus_tag="Dda3937_04662"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="GeneID:9731401"
     gene            complement(18263..18790)
                     /locus_tag="DDA3937_RS00080"
                     /old_locus_tag="Dda3937_01107"
                     /db_xref="GeneID:9731402"
     CDS             complement(18263..18790)
                     /locus_tag="DDA3937_RS00080"
                     /old_locus_tag="Dda3937_01107"
                     /function="1.5.3.4 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier;
                     molybdenum"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315724.1"
                     /note="in Escherichia coli the MobB protein is not
                     essential but has been found to interact with multiple
                     proteins involved in the molybdopterin guanine
                     dinucleotide cofactor biosynthesis pathway; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein B"
                     /protein_id="WP_013315724.1"
                     /db_xref="GI:503080839"
                     /db_xref="GeneID:9731402"
                     /translation="MTEIPLLAITAHSGTGKTTLLKQLIPLLNAMGIRVGIIKHTHHD
                     MDVDKPGKDSYELRKAGADQTLVASNTRWALMTETPEQQEPDLYFLASRMDSSKLDLI
                     LVEGFKHEPVDKILLYRCGSGRDIAALIDADTLAVATDTALTLALPCLDLNQPAQIAA
                     FIRDWLRRRTGAAGD"
     gene            complement(18783..19358)
                     /gene="mobA"
                     /locus_tag="DDA3937_RS00085"
                     /old_locus_tag="Dda3937_01108"
                     /db_xref="GeneID:9731403"
     CDS             complement(18783..19358)
                     /gene="mobA"
                     /locus_tag="DDA3937_RS00085"
                     /old_locus_tag="Dda3937_01108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315725.1"
                     /note="in Escherichia coli MobA links a guanosine
                     5'-phosphate to molydopterin to form molybdopterin guanine
                     dinucleotide during molybdenum cofactor biosynthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobA"
                     /protein_id="WP_033112173.1"
                     /db_xref="GI:696580994"
                     /db_xref="GeneID:9731403"
                     /translation="MITGVILAGGQSSRMGGNDKGLIELEGKPLYQHVLDRLKPQVDT
                     LLINANRHQERYQQSGYPVIGDINRNFSGPLAGIFTGLSLAKTDWVVFVPCDVPALPV
                     DLVSRLLPLNDNYLAAYATDGSREHPTLLAIHTSLIGKLEAYLSNGDRKLMLFLEQIG
                     AKAVSFADQPLSFRNLNTPEDLARWQEPHHD"
     gene            19469..19738
                     /locus_tag="DDA3937_RS00090"
                     /old_locus_tag="Dda3937_01109"
                     /db_xref="GeneID:9731404"
     CDS             19469..19738
                     /locus_tag="DDA3937_RS00090"
                     /old_locus_tag="Dda3937_01109"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005968263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315726.1"
                     /db_xref="GI:503080841"
                     /db_xref="GeneID:9731404"
                     /translation="MKCHRLNELIELLHPAWQKEPDLNLVQFLQKLAQEAGFKGALSD
                     LTDDILIYHLKLRDADSAQPIPGLQKDYEEDFKTALLRARGVIKD"
     gene            19780..20766
                     /locus_tag="DDA3937_RS00095"
                     /old_locus_tag="Dda3937_01110"
                     /db_xref="GeneID:9731405"
     CDS             19780..20766
                     /locus_tag="DDA3937_RS00095"
                     /old_locus_tag="Dda3937_01110"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315727.1"
                     /note="catalyzes the phosphorylation of protein substrates
                     at serine and threonine residues in vitro; specific
                     substrate in vivo has not been identified yet; plays a
                     role in long-term cell survival and expression of surface
                     appendages; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_013315727.1"
                     /db_xref="GI:503080842"
                     /db_xref="GeneID:9731405"
                     /translation="MHDSVFNFHTLSPDVVMDALWSVDIRVDSGLTALNSYENRVYQF
                     SDEERKRYVVKFYRPQRWNAAQISEEHHFAAELFDDEVPVVAPLALQGSTLHEHDGFW
                     FAVFPSVGGRQYEMDNDDQLEEVGRYLGRIHQTGSRNLFSTRPTIGLLEYLDDPLVTL
                     TDSSLISDAQKAPFLTVTTRLIDEVKQHWNTHWQARRLHGDCHPGNILWRDGPLFVDL
                     DDARNGPAVQDLWMLLHGDRQEQRIQLDILLDAYSEFASFDEAELALIEPLRAMRMVH
                     YLAWVARRWHDPAFPRSFPWMQEADFWAKQATIFTEQVRLLQEPPLQLTPMY"
     gene            20789..21412
                     /locus_tag="DDA3937_RS00100"
                     /old_locus_tag="Dda3937_01111"
                     /db_xref="GeneID:9731406"
     CDS             20789..21412
                     /locus_tag="DDA3937_RS00100"
                     /old_locus_tag="Dda3937_01111"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /function="2.3.4 information transfer; protein related;
                     chaperoning, folding"
                     /function="5.5 cell processes; adaptation to stress"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P52234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide isomerase"
                     /protein_id="WP_013315728.1"
                     /db_xref="GI:503080843"
                     /db_xref="GeneID:9731406"
                     /translation="MKKLWLALAGMVLAFSASAADFSDGKQYATLDKPVPQSPQVLEF
                     FSFYCPHCYQFAQVYHIPDAIQKALPADAKLTKYHVDFLGELGKELTQAWAVAIALGV
                     EDKVSPLMFDAVQKTQTVKQPQDIRQVFVAAGVKAEDYDSALNSFVVKSLVAQQEKAA
                     ADLQLRGVPAVFVNGKYMIKSDGLDTSSMDNYVKQYADVVKFLLSQK"
     gene            21791..24625
                     /locus_tag="DDA3937_RS00105"
                     /old_locus_tag="Dda3937_01112"
                     /db_xref="GeneID:9731407"
     CDS             21791..24625
                     /locus_tag="DDA3937_RS00105"
                     /old_locus_tag="Dda3937_01112"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315729.1"
                     /note="has 3'-5' exonuclease, 5'-3' exonuclease and
                     5'-3'polymerase activities, primarily functions to fill
                     gaps during DNA replication and repair; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_013315729.1"
                     /db_xref="GI:503080844"
                     /db_xref="GeneID:9731407"
                     /translation="MVQIAENPLILVDGSSYLYRAYHAFPPLTNGAGEPTGAMYGVLN
                     MLRSLLQQYHPSHVAVVFDAKGKTFRDDLFEHYKSHRPPMPDDLRAQIEPLHRMVKAM
                     GLPLLSVSGVEADDVIGTLAQQAERAGKPVLISTGDKDMAQLVTPNITLINTMNNTIL
                     GPDEVCAKYGIPPSLIIDFLALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDTLYADL
                     DKIASLTFRGAKTMAAKLEQNKELAYLSYQLATIKTDVELELGCEQLTVNEPDVAELH
                     ELFTRYEFKRWLADVEDGKWLQGGRKSQPAVPFVKATVEATPKEAASVLSQDGYVTIL
                     DEKVLLDWLERIKTAALFSFDTETDGLDTLTANLVGVSLAIKPGEAAYLPLGHITSRV
                     YSSNIYSSTVSPATRMSTQLDRDRVLALLKPLLEDDGIRKIGQNLKFDKGVMARYGID
                     LRGIAFDTMLESYVLDSVAGRHDMDSLSERYLQHKTITFEEIAGKGKNQLTFDQIPLA
                     QASVYAAEDADVTLRLHETLWAKLEPQQELRKVFQNIDMPLVPVLSRIERTGVLIDTT
                     ILAEHSRELTQRLAELEVQAHELAGEAFNLSSPKQLGAILYEKLQLPVIKKTPKGAPS
                     TNEEVLAELALDYPLPKLILEHRGLAKLKSTYTDKLPQMINPLTRRVHTSYHQAVTAT
                     GRLSSSDPNLQNIPVRNEEGRRIRQAFIAPEGYRILAADYSQIELRIMAHLSRDAGLL
                     RAFSHGLDIHRATAAEVFGLPLDRVTTEQRRSAKAINFGLIYGMSAFGLSRQLAIPRS
                     EAQKYMNLYFERYPGVQEYMERTRQQAVDQGYVSTLDGRRLYLPDIHSRNVNSRKAAE
                     RAAINAPMQGTAADIIKKAMIAIDAWLRQEKPLVTMLMQVHDELVFEVHHSVLDEASA
                     KIRNLMEGCMQLDVPLQVDIGTGSNWDQAH"
     gene            24873..24981
                     /gene="spf"
                     /locus_tag="DDA3937_RS21610"
                     /db_xref="GeneID:9731408"
     ncRNA           24873..24981
                     /gene="spf"
                     /locus_tag="DDA3937_RS21610"
                     /ncRNA_class="antisense_RNA"
                     /product="Spot 42 RNA"
                     /note="secondary structure conserved; genome context
                     conserved;
                     match to Rfam Spot_42 (RF00021) with bit score = 42.62;
                     Rfam sequence is longer (includes conserved flanking
                     sequence)"
                     /function="antisense regulator of galK translation"
                     /db_xref="ASAP:ABF-0061314"
                     /db_xref="ERIC:ABF-0061314"
                     /db_xref="GeneID:9731408"
     gene            complement(25090..25734)
                     /locus_tag="DDA3937_RS00110"
                     /db_xref="GeneID:23677375"
     CDS             complement(25090..25734)
                     /locus_tag="DDA3937_RS00110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_033111484.1"
                     /db_xref="GI:696580305"
                     /db_xref="GeneID:23677375"
                     /translation="MTQQYNYHVTHFVTSAPDIRHLPADSGIEVAFAGRSNAGKSSAL
                     NTLTNQKSLARTSKTPGRTQLINLFEVADGVRLVDLPGYGYAEVPEEMKRKWQRALGE
                     YLQKRDCLKGLVVLMDIRHPLKDLDQQMLEWAVDVGLPVLVLLTKADKLAQGARKSQL
                     NMVREAVLPFMGDIQVEAFSSLKKTGVDKLRQKLDSWFSTLPSAELQSQPESDL"
     gene            25958..26491
                     /locus_tag="DDA3937_RS00115"
                     /old_locus_tag="Dda3937_01114"
                     /db_xref="GeneID:9731410"
     CDS             25958..26491
                     /locus_tag="DDA3937_RS00115"
                     /old_locus_tag="Dda3937_01114"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315731.1"
                     /db_xref="GI:503080846"
                     /db_xref="GeneID:9731410"
                     /translation="MKQPSKGAERKASAPKIKRKSREQLDLEARDRKRQKKHRGHAAG
                     SRAQPSGDHQQNAASGKAKDPRIGSKKPVSLLPEGTTVAVKAPVPAAEKPVRQSPQDE
                     LEMLENDPRLDALLDRLEKGETLSAKEQSWLDETLDRIDILMEQLGISLDDDEEDEEQ
                     EEDMLQLLRRGNPKDGY"
     gene            26673..28046
                     /locus_tag="DDA3937_RS00120"
                     /old_locus_tag="Dda3937_01115"
                     /db_xref="GeneID:9731411"
     CDS             26673..28046
                     /locus_tag="DDA3937_RS00120"
                     /old_locus_tag="Dda3937_01115"
                     /function="1.5.3.12 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; heme,
                     porphyrine"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315732.1"
                     /note="catalyzes the oxygen-independent formation of
                     protoporphyrinogen-IX from coproporphyrinogen-III; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_013315732.1"
                     /db_xref="GI:503080847"
                     /db_xref="GeneID:9731411"
                     /translation="MPEQTIDWDLSLIQKYNYSGPRYTSYPTALEFSDSYDNAAFAQA
                     VARYPNRPLSLYLHIPFCHRLCYFCGCNKLVTRQLHKADEYLDRLALEIRQRAPLFAG
                     RVVTQMHWGGGTPTFLNKTQISRLMGLLRQYFHFAEQAEMSLEVDPREIELDVLDHLR
                     AEGFNRLSMGVQDFNKEVQRLVNREQDEAFIFALIERAKALGFASTNIDLIYGLPKQT
                     PDSFAFTLQRVAALRPDRLSVFNYAHLPSLFAAQRKIKEADLPDAEQKLAILQQTIQS
                     LTAAGYQFIGMDHFARPDDELAVAQREGKLHRNFQGYTTQGDTDLLGLGVSAISMIGD
                     SYAQNQKELKQYYADVEQHGHALWRGLALTRDDCLRRDVIKALICHFQLEFAAIERAY
                     GLSFGEYFREDLALLAPMAQDGLVDILPDRIQVTPKGRLLIRNICMCFDVYLRSKMRE
                     RQFSRVI"
     gene            complement(28390..29802)
                     /gene="glnG"
                     /locus_tag="DDA3937_RS00125"
                     /old_locus_tag="Dda3937_01116"
                     /db_xref="GeneID:9731412"
     CDS             complement(28390..29802)
                     /gene="glnG"
                     /locus_tag="DDA3937_RS00125"
                     /old_locus_tag="Dda3937_01116"
                     /function="GlnG is involved in the activation of nitrogen
                     assimilatory genes such as glnA , argT, hisY, nagP,
                     nifL..."
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="1.5.1.2 metabolism; building block
                     biosynthesis; amino acids; glutamine"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017493413.1"
                     /note="response regulator of a two-component regulatory
                     system involved in the activation of nitrogen assimilation
                     genes; interacts with sigma-54; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(I)"
                     /protein_id="WP_013315733.1"
                     /db_xref="GI:503080848"
                     /db_xref="GeneID:9731412"
                     /translation="MQRGIVWIVDDDSSIRWVLERALTGAGLTCATFDNGTQALNALT
                     TQTPDVLLSDIRMPGMDGLALLQQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYL
                     PKPFDIDEAVALVERAISHYMEQQQPVRSQPISGPTTDIIGEAPAMQDVFRIIGRLSR
                     SSISVLINGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAF
                     TGANQIRQGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAAVKVDVR
                     IIAATHQNLELRVQEGKFREDLFHRLNVIRVHLPPLRERREDIPRLARYFLQATAREL
                     GVEPKNLHPETEAALTRLPWPGNVRQLENTCRWLTVMAAGQEVLIQDLPPELFETTAP
                     DATVHVMPDSWATLLAQWADRALRSGHQNLLAEAQPEMERTLLTTALRHTQGHKQEAA
                     RLLGWGRNTLTRKLKELGME"
     gene            complement(29811..30860)
                     /gene="glnL"
                     /locus_tag="DDA3937_RS00130"
                     /old_locus_tag="Dda3937_01117"
                     /db_xref="GeneID:9731413"
     CDS             complement(29811..30860)
                     /gene="glnL"
                     /locus_tag="DDA3937_RS00130"
                     /old_locus_tag="Dda3937_01117"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="1.5.1.2 metabolism; building block
                     biosynthesis; amino acids; glutamine"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /function="3.1.3.2 regulation; type of regulation;
                     posttranscriptional; covalent modification,
                     demodification, maturation"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004712545.1"
                     /note="sensory histidine kinase in two-component
                     regulatory system with GlnG; acts as a signal transducer
                     which responds to the nitrogen level of cell and modulates
                     the activity of ntrC by phosphorylation/dephosphorylation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulation protein NR(II)"
                     /protein_id="WP_013315734.1"
                     /db_xref="GI:503080849"
                     /db_xref="GeneID:9731413"
                     /translation="MATGTLPDAGQILNSLINSILLLDKDLAIHYSNPAAQQLLAQSS
                     RKLSGTPLPELLGYFSLNLDLMRESLDSGQGFTDNEVTLVVDGRAHIMSLTAQRIQHD
                     FILLEMAPMDNQRRLSQEQLQHAQQQAARDLVRGLAHEIKNPLGGLRGAAQLLSKALP
                     DPALMEYTKVIIEQADRLRNLVDRLLGPQQPGLHVTQSIHQVAERVFQLVSMEKADNV
                     TLVRDYDPSLPELMHDPDQIEQVLLNITRNAMQALGEEGGTITIRTRTAFQLTLHGVR
                     YRLVARIDIEDDGPGVPAHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFNS
                     WPGHTEFSVYLPIRQ"
     gene            complement(31065..32474)
                     /gene="glnA"
                     /locus_tag="DDA3937_RS00135"
                     /old_locus_tag="Dda3937_01118"
                     /db_xref="GeneID:9731414"
     CDS             complement(31065..32474)
                     /gene="glnA"
                     /locus_tag="DDA3937_RS00135"
                     /old_locus_tag="Dda3937_01118"
                     /function="1.5.1.2 metabolism; building block
                     biosynthesis; amino acids; glutamine"
                     /function="1.8.3 metabolism; metabolism of other
                     compounds; nitrogen metabolism"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855604.1"
                     /note="forms a homododecamer; forms glutamine from ammonia
                     and glutamate with the conversion of ATP to ADP and
                     phosphate; also functions in the assimilation of ammonia;
                     highly regulated protein controlled by the
                     addition/removal of adenylyl groups by adenylyltransferase
                     from specific tyrosine residues; addition of adenylyl
                     groups results in inactivation of the enzyme; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_013315735.1"
                     /db_xref="GI:503080850"
                     /db_xref="GeneID:9731414"
                     /translation="MSVEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNADFF
                     EDGKMFDGSSIGGWKGINESDMVLMPDATTAVLDPFFEESTLIIRCDILEPGTMQGYD
                     RDPRSIAKRAEDFLRSSGIADTVLFGPEPEFFLFDDVRFGSSISGSHVAIDDIEGAWN
                     SSTKYEDGNKGHRPAVKGGYFPVPPVDSAQDLRSAMCLTMEQMGLVVEAHHHEVATAG
                     QNEVATRFNTMTKKADEIQIYKYVVHNVAHAFGKTATFMPKPMFGDNGSGMHCHMSLA
                     KDGTNLFSGDKYGGLSETALYYIGGVIKHAKAINALSNPTTNSYKRLVPGYEAPVMLA
                     YSARNRSASIRIPVVSSPKARRIEVRFPDPAANPYLCFAALLMAGLDGIINKIHPGDA
                     MDKNLYDLPPEEAKEIPTVAGSLEEALNALNADREFLTRGGVFTDDAIDAYIELRIAE
                     NDRVRMTPHPVEFELYYSV"
     gene            32852..34675
                     /locus_tag="DDA3937_RS00140"
                     /old_locus_tag="Dda3937_01119"
                     /db_xref="GeneID:9731415"
     CDS             32852..34675
                     /locus_tag="DDA3937_RS00140"
                     /old_locus_tag="Dda3937_01119"
                     /function="5.10 cell processes; defense/survivial"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein TypA"
                     /protein_id="WP_013315736.1"
                     /db_xref="GI:503080851"
                     /db_xref="GeneID:9731415"
                     /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTLGERNEATERVMD
                     SNDLEKERGITILAKNTAINWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLLVDAM
                     DGPMPQTRFVTQKAFAYGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLGATDEQLDF
                     PIVYASALNGIAGLDHNDMAEDMTPLFEAIVKHVEAPNVDLNGPFQMQISQLDYNNYV
                     GVIGIGRIKRGVVKPNQQVSIIDSEGKVRNGKVSQVLGHLGLQRIESTLAEAGDIIAI
                     TGLGELNISDTICETSCVEALPALSVDEPTVTMYFCVNTSPFCGKEGKYVTSRQILDR
                     LRKELVHNVALRVEETEDPDAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFRTI
                     DGRRQEPFEQVTVDIEEQHQGSVMEALGLRKGEMRDMIPDGKGRVRLDYVIPSRGLIG
                     FRTDFMTMTSGTGLLYSTFSHYDDIRPGEIGQRQNGVLISNGQGKAVAYALFSLQDRG
                     KLFLGHGAEVYEGQIIGIHTRSNDLTVNCLTGKKLTNMRASGTDEATVLVPPVKMTLE
                     QALEFIDDDELVEVTPTSIRLRKRHLTENDRRRANRSAKDE"
     gene            34898..35509
                     /locus_tag="DDA3937_RS00145"
                     /old_locus_tag="Dda3937_01120"
                     /db_xref="GeneID:9731416"
     CDS             34898..35509
                     /locus_tag="DDA3937_RS00145"
                     /old_locus_tag="Dda3937_01120"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-D-glucose-1-phosphatase"
                     /protein_id="WP_013315737.1"
                     /db_xref="GI:503080852"
                     /db_xref="GeneID:9731416"
                     /translation="MLYIFDLGNVVIDIDFNRVVGVWSSLSGAPLAALRERFVLGNTF
                     EQHERGEISDEEFASRLCHELGITLSFEQFSTGWQAIFIGVRKDVIDIMHRLRQEGHR
                     VVILSNTNRLHCQFWPGEYPEVQQAVDRLYLSQDIGQRKPEAAIYHHVLREEGVDASE
                     ALFFDDNAANVDAANALGIRSILVSDRQVVPDFFASQVFKQES"
     gene            35517..35954
                     /locus_tag="DDA3937_RS00150"
                     /old_locus_tag="Dda3937_01121"
                     /db_xref="GeneID:9731417"
     CDS             35517..35954
                     /locus_tag="DDA3937_RS00150"
                     /old_locus_tag="Dda3937_01121"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315738.1"
                     /note="hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and
                     free tRNA(Tyr); possible defense mechanism against a
                     harmful effect of D-tyrosine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="WP_013315738.1"
                     /db_xref="GI:503080853"
                     /db_xref="GeneID:9731417"
                     /translation="MIALIQRVSGASVAVDGAIVGEIDHGLLVLLGVEQDDDEQKAAR
                     LCEKVIGYRIFSDDNGKMNLNVQQAGGSLLVVSQFTLAADTQKGMRPSFSRGAAPAEA
                     DRLYQYFVGQCRERGLTTETGRFAADMKVSLVNDGPVTFWLQV"
     gene            35988..36929
                     /locus_tag="DDA3937_RS00155"
                     /old_locus_tag="Dda3937_01122"
                     /db_xref="GeneID:9731418"
     CDS             35988..36929
                     /locus_tag="DDA3937_RS00155"
                     /old_locus_tag="Dda3937_01122"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315739.1"
                     /db_xref="GI:503080854"
                     /db_xref="GeneID:9731418"
                     /translation="MYYLRVPESAEELDAYYQFRWEMLRKPLHQPLGSERDAYDALAH
                     HQTIVDGHGKLVAVGRLSINADNEASIRFLAVHPDVQRKGLGTLMAMALESVARQEGV
                     KRVVCSAREDAMAFFSRLGFVNQGEITTPMTTPVRHFLMIKPVATLDDILHRPDWCGQ
                     LQQAWYNHIPLSEKMGVRISQYTGQKFITTMPETGNQNPHHTLFAGSMFSLATLTGWG
                     LIWLLLRERQLGGTIILADAHIRYSTPVTGRPSAVADLGSLSGDLDRLARGRKARVQL
                     QVELFGNDKKGAVFEGIYIVLPPDPNELLEQGGSAIR"
     gene            complement(36993..38735)
                     /locus_tag="DDA3937_RS00160"
                     /old_locus_tag="Dda3937_01123"
                     /db_xref="GeneID:9731419"
     CDS             complement(36993..38735)
                     /locus_tag="DDA3937_RS00160"
                     /old_locus_tag="Dda3937_01123"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315740.1"
                     /db_xref="GI:503080855"
                     /db_xref="GeneID:9731419"
                     /translation="MKLIGKLLLTLLLLALLAVVVLYVLAQTEWGARHISQWVNQRTE
                     YQVSFRKMAHDWSSPGRIQLLDVSFGHKDQPVTLVAQSVSMGFSVRQITEPRHFSSLM
                     LEGGTLNLGQTGFTLPIEADVLQLKAMALHAQDGDWRLRGEQVTGGITPWQPEPGYLL
                     GKKAAFQLSAHSLLLNDLPASKVLVQGQFNNQQLTLDNFGADVARGELTGNASRAEDG
                     SWLVNNLRLSNVRLQTRQSMADFWQPVTRLPAVTVNRFDLIDARIEGQNWAFTDLDVT
                     LQNVTFRQNDWQSDDGSLSFNATDIVNGNMHLVDPIVSLDLSKQGVNIKQFSTRWEGG
                     LLRTSGNWQRSNQRLTLDELVVAGMEYTLPADWRQRWQQTLPDWLAEVELRKFTANHN
                     LLIDINPAFPFQLTALDGVGSNLLLARNHQWGVWQGALTLNASDATFNKVDVRRPSLA
                     LNANDNQITLTDLSAFTQSGLLEAKAVIAQQPARAFTLDLTGKAVAFDVLTRWGWPVP
                     ATAPTGNTNLQLHLNGRLEAASPLRPTLNGTLQGIDSAGHAISQAMHQGTTADSAPAT
                     STPPPAPAAPAAQP"
     gene            complement(38891..40279)
                     /locus_tag="DDA3937_RS00165"
                     /old_locus_tag="Dda3937_01124"
                     /db_xref="GeneID:9731420"
     CDS             complement(38891..40279)
                     /locus_tag="DDA3937_RS00165"
                     /old_locus_tag="Dda3937_01124"
                     /function="4.2.A.40 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Nucleobase:Cation Symporter-2 (NCS2) Family"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.162 transport; substrate; purine/xanthine"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315741.1"
                     /note="high-affinity transporter for xanthine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine permease"
                     /protein_id="WP_013315741.1"
                     /db_xref="GI:503080856"
                     /db_xref="GeneID:9731420"
                     /translation="MSLSTTELPQADAATPANSELIYRLEDRPPLPQTLFAACQHLLA
                     MFVAVITPALLICQALGLPAQDTQHIISMSLFASGLASILQIKTWGPVGSGLLSIQGT
                     SFNFVTPLIMGGMALKNGGADVPTMMAALFGTLMVASCTEILLSRVLHLARRIITPLV
                     SGIVVMIIGLSLIQVGLTSIGGGFAAMSNHTFGAPKNLLLAAIVLAVIIILNRQRNPY
                     LRVASLVIAMAVGYLAAWLMGMLPESAGTSSHALINVPTPLYYGLGFDWNLLIPLMLV
                     FMVTSLETIGDITATSDVSEQPVSGPLYMKRLKGGVLANGLNSCLSAVFNTFPNSCFG
                     QNNGVIQLTGVASRYVGFVVALMLIVLGLFPAVSGFVQHIPEPVLGGATIVMFGTIAA
                     SGVRIVSREPLNRRAIMIIALSLAVGLGVSQQPLILQFAPEWLKTLLSSGIAAGGITA
                     IVLNLVFPQEKE"
     gene            complement(40461..42542)
                     /locus_tag="DDA3937_RS00170"
                     /old_locus_tag="Dda3937_01125"
                     /db_xref="GeneID:9731421"
     CDS             complement(40461..42542)
                     /locus_tag="DDA3937_RS00170"
                     /old_locus_tag="Dda3937_01125"
                     /function="2.1.3 information transfer; DNA related; DNA
                     recombination"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848438.1"
                     /note="catalyzes branch migration in Holliday junction
                     intermediates; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_013315742.1"
                     /db_xref="GI:503080857"
                     /db_xref="GeneID:9731421"
                     /translation="MDSRLLHTQPLSTLAGVGASQAEKLARLGLETVQDLLLHLPLRY
                     EDRTHLYLINDVLPGMYATVEGDVLRSDITFGRRRMLTCQISDGSGMLTLRFFNFNAA
                     MKNSLSPGQRVLAYGEVRRGKLGGEMIHPEYRVQGESATVELQETLTPVYPTTEGIRQ
                     ATLRKLTDQALELLNTHPIDELLPQEMRHGLISLPDALRTLHRPPPDVQLAELEQGKH
                     PAQQRLVMEELLAHHLSMLAVRAGAQRHRALALGPKDNLKQQLLAALPFSPTGAQQRV
                     VAEIEQDMNKPFPMMRLVQGDVGSGKTLVAALAALQAIAHGKQVALMAPTELLAEQHA
                     ANFRRWFEPLGVEVGWLAGKQKGKARQAQQEAIASGQVSMVVGTHAIFQQQVQFNGLA
                     LVIIDEQHRFGVHQRLALWEKGEEQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDE
                     LPPGRTPVTTVAIPDTRRDDIIQRVRNACLQEGRQAYWVCTLIEESELLEAQAAEATC
                     QELKAALPDLTIGLVHGRMKAQEKQAVMAAFKTNQLHLLVATTVIEVGVDVPNASLMI
                     IENPERLGLAQLHQLRGRVGRGAVASHCVLLYKSPLSKTAQMRLQVLRDSNDGFVIAQ
                     RDLEIRGPGELLGTRQTGNAAFRVADLLRDQALIPQVQRVSRHLHEHYPEHARALIDR
                     WLPERTRYTNA"
     gene            complement(42542..43234)
                     /locus_tag="DDA3937_RS00175"
                     /old_locus_tag="Dda3937_01126"
                     /db_xref="GeneID:9731422"
     CDS             complement(42542..43234)
                     /locus_tag="DDA3937_RS00175"
                     /old_locus_tag="Dda3937_01126"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855596.1"
                     /note="specifically modifies tRNA at position G18; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA methyltransferase"
                     /protein_id="WP_013315743.1"
                     /db_xref="GI:503080858"
                     /db_xref="GeneID:9731422"
                     /translation="MTPERYTRIREMLNNRQPDLTVCMEQVHKPHNVSAVIRTADAVG
                     VHQVHAVWPTNRMRTLVSTAAGSNSWVQVETHRTVQDAVGHLKTQGMQILATNLSASA
                     VDFREVDYTRPTCILLGQEKTGITADALALADQDIIIPMVGMVQSLNVSVASALILYE
                     AQRQRQLAGMYQRECSPLDEEEQQRLLFEGGYPVLARVARRKGLPRPFIDHTGQVIAD
                     APWWAAMQSTEQ"
     gene            complement(43241..45343)
                     /locus_tag="DDA3937_RS00180"
                     /old_locus_tag="Dda3937_01127"
                     /db_xref="GeneID:9731423"
     CDS             complement(43241..45343)
                     /locus_tag="DDA3937_RS00180"
                     /old_locus_tag="Dda3937_01127"
                     /function="1.7.33 metabolism; central intermediary
                     metabolism; nucleotide and nucleoside conversions"
                     /function="3.1.3.4 regulation; type of regulation;
                     posttranscriptional; proteases, cleavage of compounds"
                     /function="5.5.3 cell processes; adaptation to stress;
                     starvation response"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015842293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional (p)ppGpp synthetase II/
                     guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase"
                     /protein_id="WP_013315744.1"
                     /db_xref="GI:503080859"
                     /db_xref="GeneID:9731423"
                     /translation="MYLFESLNLLIQRYLPEDQIKRLKQAYLVARDAHEGQTRSSGEP
                     YITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSK
                     LDKLKFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIAR
                     ETLEIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILS
                     EIEGRLKEAGISCRVSGREKHLYSIYCKMHLKEQRFHSIMDIYAFRVIVREVDTCYRV
                     LGQVHSLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMG
                     VAAHWAYKEGESSSTTAQVRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFT
                     PEGRIVELPAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQALSSGQTIEIITAPG
                     ARPNAAWLNFVVSSKARAKIRQMLKNLKRDDSVSLGRRLINHALGSGRKLSDIPEQNI
                     QRELERMKLASLDDLLAEIGLGNAMSVVVARNLLEEHAETGAAGIRKLPIKGADGVLI
                     TFAKCCRPIPGDPIIAHVSPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDEVTEQEFM
                     TEIKVDMFNHQGALANLTAAISSSNSNIQSINTEERDGRVYSAFIRLTTRDRIHLANI
                     MRKIRVMPDVIKVNRNRN"
     gene            complement(45368..45643)
                     /gene="rpoZ"
                     /locus_tag="DDA3937_RS00185"
                     /old_locus_tag="Dda3937_01128"
                     /db_xref="GeneID:9731424"
     CDS             complement(45368..45643)
                     /gene="rpoZ"
                     /locus_tag="DDA3937_RS00185"
                     /old_locus_tag="Dda3937_01128"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013511051.1"
                     /note="Promotes RNA polymerase assembly; latches the N-
                     and C-terminal regions of the beta' subunit thereby
                     facilitating its interaction with the beta and alpha
                     subunits; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="WP_013315745.1"
                     /db_xref="GI:503080860"
                     /db_xref="GeneID:9731424"
                     /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQIQVGGKEPLVPEEND
                     KYTVIALREIEEGLINGQILDTRERQEQQEQEAAEIQAVTAIAEGRR"
     gene            complement(45698..46321)
                     /locus_tag="DDA3937_RS00190"
                     /old_locus_tag="Dda3937_01129"
                     /db_xref="GeneID:9731425"
     CDS             complement(45698..46321)
                     /locus_tag="DDA3937_RS00190"
                     /old_locus_tag="Dda3937_01129"
                     /function="1.5.2.1 metabolism; building block
                     biosynthesis; nucleotide; purine biosynthesis"
                     /function="1.7.33 metabolism; central intermediary
                     metabolism; nucleotide and nucleoside conversions"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014702085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_013315746.1"
                     /db_xref="GI:503080861"
                     /db_xref="GeneID:9731425"
                     /translation="MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAM
                     RPGEVHGEHYFFVPVDEFKRMIEEDDFLEYAEVFGNYYGTSRAAIEQVLSTGVDVFLD
                     IDWQGARQIRERMPQARSIFILPPSQEELERRLRGRGQDSEEVIARRMKQAVAEMSHY
                     AEYDYLIVNDDFDLALLDLKTIIRAERLRLSRQKVRHDALITKLLAD"
     gene            46628..48310
                     /gene="ligB"
                     /locus_tag="DDA3937_RS00195"
                     /old_locus_tag="Dda3937_01130"
                     /gene_synonym="yicF"
                     /db_xref="GeneID:9731426"
     CDS             46628..48310
                     /gene="ligB"
                     /locus_tag="DDA3937_RS00195"
                     /old_locus_tag="Dda3937_01130"
                     /gene_synonym="yicF"
                     /EC_number="6.5.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315747.1"
                     /note="this ligase is similar to LigA but it lacks the
                     C-terminal BRCT domain; catalyzes strand joining of nicked
                     DNA in the presence of a divalent cation and NAD+; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase LigB"
                     /protein_id="WP_033111485.1"
                     /db_xref="GI:696580306"
                     /db_xref="GeneID:9731426"
                     /translation="MRYRYALAAVLFAVSGLAEAASCPAWSSTRAEQEITQLGQQLTQ
                     WDNAYYEQGQSPVDDQVYDQLRQTLATWQVCFQADAGRFAISLPTTGRRQHPVAHTGL
                     KKLSEPTELKQWIAQHNDLWVQPKIDGVAVTLVYEQGKLVAAISRGNGRQGEDWTDKV
                     RQMNSVPQQLSAMSGRQVFQGELYLQVTDHRQQQVGGINARAQVAGEMRRKQPSPLLS
                     RIGVFVWAWPDGPADMPARLAKLRELGFGLTADYTQPVSSLEAAAQWRERWYRAPLPF
                     VTDGVVVRQAQEPAGRYWQDTPAEWAVAWKYPLVNRVTEVTGVDVEVGRTGRMTVVLQ
                     LQPVILDDKTVSRVNLGSVSRWRQWDVLPGDRVSISLAGLGIPRLDAVVWRGAVREAI
                     TVPATSPFDVFSCLQWSRECQPQFLARLVWMSGRNGLSLSGISEATWQRLTQRGALVD
                     VVSWLALEPAQLAAAGDFGEQQAERIHRQFQLARRQPLRNWLLALGLPVPSRVRHALD
                     GASLEQLQQRSAAEWQQFSGIGVRRAQRIRDFLHHTDIVRQLAWLNEHGVKS"
     gene            48677..50359
                     /locus_tag="DDA3937_RS00200"
                     /old_locus_tag="Dda3937_01131"
                     /db_xref="GeneID:9731427"
     CDS             48677..50359
                     /locus_tag="DDA3937_RS00200"
                     /old_locus_tag="Dda3937_01131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315748.1"
                     /note="catalyzes the addition of a phosphoethanolamine
                     group to the outer Kdo residue of lipopolysaccharide;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoethanolamine transferase"
                     /protein_id="WP_033111486.1"
                     /db_xref="GI:696580307"
                     /db_xref="GeneID:9731427"
                     /translation="MKSLLALSQSKLSWLLAIYIGFFLNLPVFYRRVDAFPFFTENPV
                     AKYIPLLVESMACILFTFFLMRILSLGGRRFFRVMASLLVLISVAASYYMTFFNVVIG
                     YGIIAAVMTTDIDLSKEVVGLFFVLWVAALSLPPVFLIWKNRLQQTLIEQLRTSGRRR
                     IALLGLVASAALVWLPLRYLAQINTSAEKLSNQDLPSYGGVVAHSYLPANWLSAFGLF
                     AYARYDENQDDDELIDPSKQFTYQAPPGIDDTYVVFIIGETTRWDHMGLLGYERDTTP
                     QLAKEKNLLAFRGHSCDTSTKLSMRCMFVREGGTSDNPQRTLREKNIFAVMKSLGFSS
                     ELFAMQSEVWFYNNIQADNYAFREMIASEKRNEGKAVDDMLLVDEMSQSLMRYPNGKH
                     LVVLHTKGSHYLYSMRYPRSYARYQPECMGVDASCSREQLINAFDNSVLYTDAVIKRV
                     IDQLRDKKALLVYASDHGESIDDNYHLHGTPRQMAPPEQFRSPIMLWASDKYLAQPRN
                     QQAFEQLRAQQQQGKVLRHEEIFDSMLGCLGYTSPDGGIQEKNNWCNMPGRG"
     gene            50513..50589
                     /locus_tag="DDA3937_RS00205"
                     /old_locus_tag="Dda3937_04245"
                     /db_xref="GeneID:9731428"
     tRNA            50513..50589
                     /locus_tag="DDA3937_RS00205"
                     /old_locus_tag="Dda3937_04245"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:50547..50549,aa:Pro,seq:cgg)
                     /db_xref="GeneID:9731428"
     gene            complement(51020..51646)
                     /locus_tag="DDA3937_RS00210"
                     /old_locus_tag="Dda3937_01132"
                     /db_xref="GeneID:9731429"
     CDS             complement(51020..51646)
                     /locus_tag="DDA3937_RS00210"
                     /old_locus_tag="Dda3937_01132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeats containing protein"
                     /protein_id="WP_033111487.1"
                     /db_xref="GI:696580308"
                     /db_xref="GeneID:9731429"
                     /translation="MILRTAMLLLGGLLTVNMGHASDTSMDIHRQWSVCQYKTLASRK
                     EECFAALSQLAQEQTESHPDRADYLIWSAMVDSSWAGVKDGMEALNLAGQAKSTLEKA
                     IALDPHALNGAAYTILGVLYYQVPGWPLGFGDEKKAEQYLKMALKINPASIDANFFYG
                     DFLLKAGRKNEARQYLTAAQNAAPRPGREIADLGRRAEAEKALVQLKY"
     gene            complement(51748..52542)
                     /locus_tag="DDA3937_RS00215"
                     /old_locus_tag="Dda3937_01133"
                     /db_xref="GeneID:9731430"
     CDS             complement(51748..52542)
                     /locus_tag="DDA3937_RS00215"
                     /old_locus_tag="Dda3937_01133"
                     /function="1.7 metabolism; central intermediary
                     metabolism"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013315750.1"
                     /db_xref="GI:503080865"
                     /db_xref="GeneID:9731430"
                     /translation="MKLKNKRILLTGASSNTGQELALSLAARGARLYLVGRNEKALLA
                     LQQRLPDAGHHNILLADLCDEQDRDALAECFPENVRLDVLINNIDTSTFGLFEEQSHD
                     VIRRQLTLNTEVPILLTHSLLDCINKPGIIMNIGSTLDGIGYPGYSAYCASKFALRGF
                     SEALHRELSSKGIKVLHLAPRAIDAGRNAPKTHALTQALGYHSDKPAWVADQVVNALE
                     RETVRRWLGWPEKLFVRLNALVPAVVDNAIRRQLAAIQHYARAQKK"
     gene            complement(52547..53185)
                     /locus_tag="DDA3937_RS00220"
                     /old_locus_tag="Dda3937_01134"
                     /db_xref="GeneID:9731431"
     CDS             complement(52547..53185)
                     /locus_tag="DDA3937_RS00220"
                     /old_locus_tag="Dda3937_01134"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty acid--CoA ligase"
                     /protein_id="WP_013315751.1"
                     /db_xref="GI:503080866"
                     /db_xref="GeneID:9731431"
                     /translation="MSFYQQLQSATSTSQQLMMSAPVIDACRQGTITGDMYIAFLTQA
                     YHHVSYTVPLLMAASGRLPRHQAWVREAIEEYINAEYDHKASILHKIRACGGKTETLG
                     QNAAAQWIELMAAYLYDQIQRDNPMSIFGLIHVLEGIQANIAPDMIRQIDAEQDLPVN
                     AINGLQEQDPCPNVFAALMDNINDSADQTAIIHAAHVVYQLYGDMLRSLTEH"
     gene            53451..54629
                     /locus_tag="DDA3937_RS00225"
                     /old_locus_tag="Dda3937_01135"
                     /db_xref="GeneID:9731432"
     CDS             53451..54629
                     /locus_tag="DDA3937_RS00225"
                     /old_locus_tag="Dda3937_01135"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013315752.1"
                     /db_xref="GI:503080867"
                     /db_xref="GeneID:9731432"
                     /translation="MSTSRRAHQLAILVVMISASLVGLVQGYSIPLVTLKLTALGYGS
                     ALTGMMSALPAIGVFVSSWVAAPVAMRLPVGRLLALSTWGMGVSLTLSFYLDNVALLA
                     APRFLMGFCCGLIIVIGESWVSGHTAEHRRGVLVGLYATAFTGLQLLGPLLISLTGLD
                     DPTGLLLILALHGVCLLMVPGSSFSGLALSAHRQHNLFSLLLAAPALAAAVFAFAFFD
                     GAVLSMLPLYGMAHGYEEQLAVLLVTVLFIGDALLQVPLGWVSDKLGTVRVHLACGGL
                     FVLMLVGLPFSYGTGWVWANVFLLGAVAGSIYTLALVRAGKQFSGVNLVAINALFGVL
                     WGVGSFSGPLVSGSLMQWYGRDGLIAVLGVLGLLFLAANALSATQRNAAGQTDPELAE
                     "
     gene            54672..55562
                     /locus_tag="DDA3937_RS00230"
                     /old_locus_tag="Dda3937_01136"
                     /db_xref="GeneID:9731433"
     CDS             54672..55562
                     /locus_tag="DDA3937_RS00230"
                     /old_locus_tag="Dda3937_01136"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013315753.1"
                     /db_xref="GI:503080868"
                     /db_xref="GeneID:9731433"
                     /translation="MDRLATLETFICVYESGSFSAASRRLGIGQPAISKAIMQLEQQL
                     AVKLLLRSTRGLTPTEAGQRFYEQVAPALQQLHEAQDGVRGGNGELSGYLRVSAPVTF
                     ARLHVLPRLHVFMSQHPQLKVDIILDDRPVDLIAEGIDVALRLGEMKDSGLTARKIGS
                     APMRLLATPAYFAARGTPASPEALEDHDAVIYLQTDAPGNWLFCRDDRQCRVTMSGRI
                     RTSAAEGVREAVLAGNGLTVASAWMFAPELASGAVTTALADWHIGVMDLWAVYPGGRL
                     TSARARAFTEFVAQHLSVPA"
     gene            55731..56900
                     /locus_tag="DDA3937_RS00235"
                     /old_locus_tag="Dda3937_01137"
                     /db_xref="GeneID:9731434"
     CDS             55731..56900
                     /locus_tag="DDA3937_RS00235"
                     /old_locus_tag="Dda3937_01137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_033112175.1"
                     /db_xref="GI:696580996"
                     /db_xref="GeneID:9731434"
                     /translation="MSTLSYSDDTVRTGKPLIFAMAAASGVAVANIYYNQPMLGLMTA
                     SFPGSGATSMIPTATQLGYALGLLMLVPLGDKFERRRLIVWQFLLLALASVLAALAPS
                     APVLLVASVLIGVGATVAQQIVPVAATVASEGQRGAVVGTVMSGLLSGILLSRTLAGL
                     VADAAGWRAMFWLSVPLALAGAALMGRMLPVLPPSSALSWRSLMRSLLTLWRAEPALR
                     RATWIQGALFASFSAFWSILALYLASGSHPLGAAAAGLFGVIGVAGITAAPVAGRLAD
                     RIGSRPVILLGALLTLLAWGVFGLWGAVAGLIVGVILLDLGVQSALIAHQHVIYGLQP
                     TARGRINTLFMGGMFLGGALGSSGAMAAWQAGGWMPVTLFAGGVTLLALVAASRR"
     gene            complement(57019..58296)
                     /locus_tag="DDA3937_RS00240"
                     /old_locus_tag="Dda3937_01138"
                     /db_xref="GeneID:9731435"
     CDS             complement(57019..58296)
                     /locus_tag="DDA3937_RS00240"
                     /old_locus_tag="Dda3937_01138"
                     /function="1.7.9 metabolism; central intermediary
                     metabolism; glucose metabolism"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine acid phosphatase"
                     /protein_id="WP_013315755.1"
                     /db_xref="GI:503080870"
                     /db_xref="GeneID:9731435"
                     /translation="MLFTRKTVAGLLLSALPWLGAQAETAPSGWALEKVVEISRHGVR
                     PPTEGNVKTIQEGTGRDWPTWLTHYGELTGHGYAAAVLKGQYEGQYLRQHGLLTHNCP
                     APDDVFVWASPLQRTQETAMALMDGVFPGCGVVIRGPESEDNDPLFHAETAGVLVDQE
                     QVKVDLQKAMQGKSAEQIQAEWQPAIDRLKQAVCLPDKPCPAFSAKWELKESKKGNTS
                     LHGPEALANMAETIRLAYSNNNPLGQVAFGNARTATAVGSLMSLLTANYDFTNDLPYV
                     ARRGGSVLMNQIALALNPEHQADAPPDAKWLLYVAHDTNIAKLRAMLGFTWQMGDYPR
                     GNIPPAGSLIFERWRNPQGQRFVRIYFQAQSLDQIRGLTALDNDHPPLRSEFSMGGCQ
                     KTDVGTLCPYDAVMKRLNGSVDRTALLPVRYTL"
     gene            58611..59504
                     /locus_tag="DDA3937_RS00245"
                     /old_locus_tag="Dda3937_01139"
                     /db_xref="GeneID:9731436"
     CDS             58611..59504
                     /locus_tag="DDA3937_RS00245"
                     /old_locus_tag="Dda3937_01139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_042318702.1"
                     /db_xref="GI:754962779"
                     /db_xref="GeneID:9731436"
                     /translation="MPTLFNRGGFGGSGFIGFGFIAPLLIPLLLFWVIPFFCSLYISL
                     TDWDYISPDYHLVGVDNYRDLLLSDDFTGALVNTLTFAIAVVIPVVVLGLGFALLLHR
                     QCRGQRCYQAMIFSPWITPTVAVSVVWSWVFDSRAGLANQLLGLFGVAGVPWLERPGS
                     AMLAVVIVTVWQGIGWTMMFFISALNRIPAELYEAARLDGGSRARRLLTITLPLISPT
                     TFFLLIVNLVNAVQAFDQFQMLTQGGPGNSTRTLMYLFYQQAFQQFSMGPAAATAVMI
                     LLLAGSLSLVNTLIARRWVYF"
     gene            59510..60403
                     /locus_tag="DDA3937_RS00250"
                     /old_locus_tag="Dda3937_01140"
                     /db_xref="GeneID:9731437"
     CDS             59510..60403
                     /locus_tag="DDA3937_RS00250"
                     /old_locus_tag="Dda3937_01140"
                     /function="4.3.A.1 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The ATP-binding Cassette (ABC) Superfamily +
                     ABC-type Uptake Permeases"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013315757.1"
                     /db_xref="GI:503080872"
                     /db_xref="GeneID:9731437"
                     /translation="MGMVSSPITLAEPGVSTAARRPAFRRRGMLKHLLLMMAGLLMVF
                     PFVWMLSGALKTNDEIFRHPLQLLPSHPDFSSFAAVWRETHFGLFMYNSLTVALLTSL
                     LVVINSVLFAYAIVQWRGKASRLLYGVVMACYMLPGAVTYIPCYIILAKLHLLDTHIG
                     LIFSNAVSAMGVFYLHQALKKIHPSLLEAARIDGAGEWSLLRTIVLPQIKPVLATLFL
                     LIFITNYNSYMWPSLVITSPSLNLISIGIRQYFISGGDYGFNWSNIMAASAIVVMPML
                     FLFLLCQRIILSGFSDNGVKE"
     gene            60424..61683
                     /locus_tag="DDA3937_RS00255"
                     /old_locus_tag="Dda3937_01141"
                     /db_xref="GeneID:9731438"
     CDS             60424..61683
                     /locus_tag="DDA3937_RS00255"
                     /old_locus_tag="Dda3937_01141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_042318704.1"
                     /db_xref="GI:754962781"
                     /db_xref="GeneID:9731438"
                     /translation="MRFVGGALCALLLTVQAQAATEVNFWYSGGTKPQKMMLTLIDEF
                     NRSQDQYVVKGALQGNYDETWQKMQAGMAAQNAPAFALLTASQGTALAERKLLRDLRP
                     YMDDSFHFTDFIGAFRRQVTRPDGSVYGLPAYGTTQVLYYNKAVLAQHGFTPDDLKTW
                     QGLAKVATAVTQKDAGGDTRYYGWEPMWGPGNLIDAALSNGGRILSEDGKKVLIDSPA
                     WVEVWDSFRRWIHDERIMRIYHGGQGWEYWYKTIDDVMKDRALGYTGSSGDQGDLDFQ
                     RLAALPQPGWGNHPAAPQAGALIFVMPTGTPDAAAKGAFAFMRFYTSAVNTARWSMFT
                     GYIPVRESVLQDADYQKYVAANPQAAVPVQQAKSASMDFIDPTKGKILDALTVAADQV
                     EIENKPAQQALTEAARKAQKALDRINE"
     gene            61709..63106
                     /locus_tag="DDA3937_RS00260"
                     /old_locus_tag="Dda3937_01142"
                     /db_xref="GeneID:9731439"
     CDS             61709..63106
                     /locus_tag="DDA3937_RS00260"
                     /old_locus_tag="Dda3937_01142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042318707.1"
                     /db_xref="GI:754962784"
                     /db_xref="GeneID:9731439"
                     /translation="MTTGRGQVAFTVPEGIDCLTLTAHNHNKSYLYAFVYDARQQLRA
                     NLLIEPTAKSVTIAARRALPLGGIPGPLPPGAWRLVLCSIPAQASHPTQADYQITVAF
                     DPPLPPPDEMLLTVALRGDHQVCFDYSACLEPASRWYRGDLHAHTRLSDGHNSLTAAV
                     ALAQAQQLDFMFLTEHNLCHPALPTGGRTLFLPALEVTTDIGHFNVHGPRRVLTLEDG
                     DMAPETLIRQGLSLNVTGDGNISINHPMMPPWHWQYAAMPLARINTLEVCCDPSWPTS
                     AAATERALQLLSTLWNGGWRIAAVGGSDCHLRPDERYDGTTQPSVYGDPTTLVFAHGL
                     SGDAILHGLRQGRVYIDRQCGLRFRFDDGEVLPGQNVGARTVQATLAVEDDRPGYVAE
                     CVAGGTVISRHALGRDEVSVALPLASWPWCRIDIRGPDGGFAGLINPLYNGTHPIFSC
                     QTFTTWGEAVARLPK"
     gene            63252..64259
                     /locus_tag="DDA3937_RS00265"
                     /old_locus_tag="Dda3937_01143"
                     /db_xref="GeneID:9731440"
     CDS             63252..64259
                     /locus_tag="DDA3937_RS00265"
                     /old_locus_tag="Dda3937_01143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenic resistance protein"
                     /protein_id="WP_042318710.1"
                     /db_xref="GI:754962787"
                     /db_xref="GeneID:9731440"
                     /translation="MPTSLLSRWSGWLERRQTVIYLLTLLVAAVLAWRWTPPDALASA
                     INPALALMLFVTFLQLPLSRLLAALTHLRFMLALVATNFVAIPLLVAVLLRLWPLEPL
                     VAVGVAIILLCPCVDYVVTFSHQGGADSRLLLAATPVLLVLQMLLLPLWLPLLLPQTT
                     AVDIGMAPFLHAFIVLMALPLLLAAVVQRWAARYAAGAAVTNWLGLLPVPATALVLAL
                     IIAFVVPRLGLATGAVRQALPVYLLFAVLAPALSWLMARLWSLPAPSGRALVFSGATR
                     NALVILPLALAIPDALPVIPAVVVTQTLVELLAELVYIRWVPRLRFAGGQPHSSAPSG
                     K"
     gene            64272..65327
                     /locus_tag="DDA3937_RS00270"
                     /old_locus_tag="Dda3937_01144"
                     /db_xref="GeneID:9731441"
     CDS             64272..65327
                     /locus_tag="DDA3937_RS00270"
                     /old_locus_tag="Dda3937_01144"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315761.1"
                     /db_xref="GI:503080876"
                     /db_xref="GeneID:9731441"
                     /translation="MQAFKPLRGPERLIRMGQWAVALLFAYFLVMISAAVLEDLPSLT
                     REPDRGSFIDQTAVDAQKARMAPIQAAQETLDNALADKREAREIATNDYAKAKASFDN
                     WRATRSSTELSDQNPEVIKRNHELDRLLALQRQLDGQLADLQKQRAQLQLQLAPITLA
                     VSRLYGDADARYGEALRKAELQAFFIRLAFVGPLLLAALWLFRRYRKGNQWPFVWGFI
                     LFALFGFFVELVPYLPSFGGYIRYGVGVVLTYFGGRALLRRLQAYLERKKQEQAASQE
                     ERKESIHYEAALTSLARNQCPSCDRPLILQNGATPAFCMHCGLQLLSPCPSCGLRKNA
                     FYHYCPDCGEPAETSEN"
     gene            complement(<65750..66100)
                     /locus_tag="DDA3937_RS00275"
                     /db_xref="GeneID:23677376"
     CDS             complement(<65750..66100)
                     /locus_tag="DDA3937_RS00275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315762.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_033112178.1"
                     /db_xref="GI:696580999"
                     /db_xref="GeneID:23677376"
                     /translation="MSLVDFTPADYPRLIRWVDSAELNLLWGGPTYSFPLTATQITDH
                     LANPQFVPYLFEHQGDIVGFVELSQVEPHHSRLCRVFIDPAYRGRGLARAMLQAAIRQ
                     AVERFEAQAVSLSVF"
     gene            complement(66100..67473)
                     /locus_tag="DDA3937_RS00280"
                     /old_locus_tag="Dda3937_01146"
                     /db_xref="GeneID:9731443"
     CDS             complement(66100..67473)
                     /locus_tag="DDA3937_RS00280"
                     /old_locus_tag="Dda3937_01146"
                     /EC_number="4.3.1.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315763.1"
                     /note="catalyzes the formation of pyruvate from serine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-serine dehydratase"
                     /protein_id="WP_033111488.1"
                     /db_xref="GI:696580309"
                     /db_xref="GeneID:9731443"
                     /translation="MADAVYGKSLPQWFHDFPLLEPLVNRQPVCWFNPAAASVSDALG
                     DVPLTGADVADASRRLQRFAPFLRQAFPELEASHGIIESELVPVPAFAAAIARQAGLD
                     APPSVLLKLDSHLPVAGSVKARGGIYEVLYHAEQLALRHGLLRESDDYRRLLDDDCQQ
                     WFRRHKVAVGSTGNLGMSIGIASARLGFDTTVHMSADARQWKKDRLRAHGVRVVEYDG
                     DYGQAVAQGRREALSDPSCHFIDDENSTSLFLGYAVAGERLKAQFAAQGRVVNAEHPL
                     FVYLPCGVGGAPGGISFGLKLAFGDHVHCIFAEPTESPCMLMGVYTGLHDQLAVQDFG
                     ISNRTTADGLAVGRPSGFVGKAMQRLIDGYYTLTDDDMLALLHVMHDTQQILLEPSAL
                     AGAPGFLRLLQENQGYRQRAPLTPQRCRQGTHVIWATGGGMVPEEEMMRYLQAGAASR
                     LNGKETP"
     gene            67850..68131
                     /locus_tag="DDA3937_RS00285"
                     /db_xref="GeneID:23677377"
     CDS             67850..68131
                     /locus_tag="DDA3937_RS00285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111489.1"
                     /db_xref="GI:696580310"
                     /db_xref="GeneID:23677377"
                     /translation="MKVNRLAAGGLLLMLPLCGLAIAPYPADGNREFTEAQRAEIRRI
                     VTEYLLTHPDRVQAIGQTPAIDGCMPARPAAGNGKLNPCGNTLWVCPPQ"
     gene            68310..68576
                     /locus_tag="DDA3937_RS00290"
                     /old_locus_tag="Dda3937_01148"
                     /db_xref="GeneID:9731445"
     CDS             68310..68576
                     /locus_tag="DDA3937_RS00290"
                     /old_locus_tag="Dda3937_01148"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multiple stress resistance protein BhsA"
                     /protein_id="WP_013315765.1"
                     /db_xref="GI:503080880"
                     /db_xref="GeneID:9731445"
                     /translation="MKAIKNFVAVIALATVSFGTFAATTSTATEVQQSASLSVGTVST
                     TANTLDGLQASLSEKASAAGAKSFRIISATGNENQMRGVAELYN"
     gene            complement(69021..70124)
                     /locus_tag="DDA3937_RS00295"
                     /old_locus_tag="Dda3937_01149"
                     /db_xref="GeneID:9731447"
     CDS             complement(69021..70124)
                     /locus_tag="DDA3937_RS00295"
                     /old_locus_tag="Dda3937_01149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family transcriptional regulator"
                     /protein_id="WP_033111490.1"
                     /db_xref="GI:696580311"
                     /db_xref="GeneID:9731447"
                     /translation="MEKRELTATHRKLLGLLRRSGSLSRSALAAASGLTTAAVSMMTR
                     DMLNLGLLEESDRAQGRRGPPQINLRPAAHAGYVLGVYAEYDLICLILMDYAGQCVAE
                     TTLHGDFRIVDSVADTLADAIRTLLDAQPQARDRLLAVSLALPARFDGGAMPVWIAPG
                     LAAWRGVDIARQLGDRLGCPVLVENDANCAAIGELHFGSAAPDDSFFYLYIGKGIGGA
                     LILNGELHRGKQGNAGEIGALRTRAQPRPSFDDLHDCLLAAGEPLPFTTADADWQALA
                     ASPAGEGWVQRAAGELYGLLYSVTALLDPSCLYLGGTLPAPFMAGLQAAVMTQTPAPD
                     DDAPLTLPPVRLSTLPTQNSAAFGAAALALNQY"
     gene            70225..71595
                     /locus_tag="DDA3937_RS00300"
                     /old_locus_tag="Dda3937_01150"
                     /db_xref="GeneID:9731448"
     CDS             70225..71595
                     /locus_tag="DDA3937_RS00300"
                     /old_locus_tag="Dda3937_01150"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012764964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013315768.1"
                     /db_xref="GI:503080883"
                     /db_xref="GeneID:9731448"
                     /translation="MRKLVSLSLSVLLASGLIAHSAVADVIKLKLWTLNDRNAPMRTV
                     NIEEAAGVLNQQFAAAGVDRKIVIDTHASAVQGWDDLALDTLKAFGVNQGPDIVLLPH
                     EWIGEFARNGYAMPMDGQIKANPWVYADILPVLWEAMKYQGKVYGVPQDAEIRMFFYN
                     KDMLRKIGKDEAFIDSLPARVDSGEFTMDDLTALAKEVVDRHAAPIGMLHRPNVGIDY
                     LMVFAACGAKFMDEKTGKLLFAKKEVETALSWYARNVAAGVTPTDNTAMSWDTIQTAF
                     KQEKAFLFHQGIWAMAWQVNDNFGPAWPADKAGYTHKIGWIPAPAAVKGGKPANLSHP
                     IAYVVSNKSQYKDLAAQLVAIASLPYYNNRHAVSSYHTAISYAQTAMPQYTDNWALSE
                     AGKMMKNITFVPNHARFGDYNRVLFKGLQAVETKRMTPAQAVDFIADELETQLGKDVE
                     IVDSLH"
     gene            71649..72566
                     /locus_tag="DDA3937_RS00305"
                     /old_locus_tag="Dda3937_01151"
                     /db_xref="GeneID:9731449"
     CDS             71649..72566
                     /locus_tag="DDA3937_RS00305"
                     /old_locus_tag="Dda3937_01151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_033112179.1"
                     /db_xref="GI:696581000"
                     /db_xref="GeneID:9731449"
                     /translation="MPVTLSNRPAGVHPARWLAPAISVLAVFFVAPMLLNLVIAFSDM
                     GSNLQISAFGTDNLMRLLVADKRLPAILLTTLVYVVSTLLLFNLGLGIVLAIATTAVP
                     PALGALFRGIWFLPRISPSVLYALLWIWAADPSPHSLINQVVVGVFRLPPLNLRNDHP
                     MILIVVANGLVGTSFAMVILASTIRAIPAHLWHAARVDGAGEWSVIRHVVLPALKSPV
                     CFIALYQALSLMVTYEYILLITGGGPVYDTTTYALYIYRRAFESGAYGYGAMLALGLM
                     VFGGLLTLLQWRMMNMRAQFTPPRIEVMR"
     gene            72563..73609
                     /locus_tag="DDA3937_RS00310"
                     /old_locus_tag="Dda3937_01152"
                     /db_xref="GeneID:9731450"
     CDS             72563..73609
                     /locus_tag="DDA3937_RS00310"
                     /old_locus_tag="Dda3937_01152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_033111491.1"
                     /db_xref="GI:696580312"
                     /db_xref="GeneID:9731450"
                     /translation="MTTMNAVDWARQAARSRWNRVGFLASVVLFLTLVSIPIVTPYLW
                     LLAISFTHRDGDSEYQVLWRLLTIAALAYGLLLAVAWRARTEQRARRLRWLVGLAALL
                     VFGLWVAPQLTLHNYRFLWNPDVQATGMQSGTLPSVWTALGNSLLFAGGHTLLVTLLA
                     VPADYALSRLGFRRREGVLKALLLLHAFPVMALTVALFIQLYWMGLLNSLWGVMLVMC
                     ALELPFAIFVMKNFFDGVSWDIEMSAITDGASRFQAFRLVVLPQVTGGIIAIATFAFL
                     RGWEEYIFVRTLLIDSGRMTMSLYLFWASQDSMGADSGLIAAVGVIYILPVLALYLLT
                     QKYLTQMSVGGIKG"
     gene            73614..74717
                     /locus_tag="DDA3937_RS00315"
                     /old_locus_tag="Dda3937_01153"
                     /db_xref="GeneID:9731451"
     CDS             73614..74717
                     /locus_tag="DDA3937_RS00315"
                     /old_locus_tag="Dda3937_01153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_033112180.1"
                     /db_xref="GI:696581001"
                     /db_xref="GeneID:9731451"
                     /translation="MAEIVLDGVTKAWGDTPVLHPVNLTLADGEFVAILGPSGCGKST
                     TLFLLAGLYAPTQGQILFDGQRVNGVDARDRNVGVVFQSYALYPHLSVYDNIAFPLRF
                     KPAERAERDQRVREAAALVQVTELLERKPSALSGGQQQRVALARALVKRPSLLLLDEP
                     LSNLDATLRMTMRTELKAIHARSRATTLMVTHDQLEAMTLASRIICMNQGRVEQIGTP
                     QQLYRQPANTFVAGFIGSPPICLLPGQANGRWLTVGEISWGLSSTYHGALTLGIRPED
                     VTLTPLGAGPLSGRIEHIEPMGREVLYRLHTSLGPLQALAAGSTAQYDAGMLVGVSPS
                     VDALLLFDADGNRLPDVGVVLPADVVSACRTAG"
     gene            74745..75608
                     /locus_tag="DDA3937_RS00320"
                     /old_locus_tag="Dda3937_01154"
                     /db_xref="GeneID:9731452"
     CDS             74745..75608
                     /locus_tag="DDA3937_RS00320"
                     /old_locus_tag="Dda3937_01154"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013315772.1"
                     /db_xref="GI:503080887"
                     /db_xref="GeneID:9731452"
                     /translation="MHIVSYNIQYGLGRDGRYDLARIADEVRGADIICMQEVERFWQR
                     SGMMDQPAELAALLGEYHWVYGANLDMDASTVSADGRVVNRRRQFGTLTLSRRPILSS
                     RNFPLPKFGTLTQHSIQQGVLETVIDTGAGAIRIYNTHLSHLCAGTRLPQVEAMLALF
                     ARAPDEGGAWCGGHPDPSAGWTEGRMPLMPLEMILMGDLNCLPDSEEYSRLVGPVSPH
                     HGRLVRHRGLMDAWVAAGQPESSGSTHPSVGGRIDHCLLTPSLGLTVRRCWADTENQG
                     SDHHPLWVELQ"
     gene            75807..76073
                     /locus_tag="DDA3937_RS00325"
                     /old_locus_tag="Dda3937_01155"
                     /db_xref="GeneID:9731453"
     CDS             75807..76073
                     /locus_tag="DDA3937_RS00325"
                     /old_locus_tag="Dda3937_01155"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multiple stress resistance protein BhsA"
                     /protein_id="WP_013315773.1"
                     /db_xref="GI:503080888"
                     /db_xref="GeneID:9731453"
                     /translation="MKAIKNFVAVIALATVSFGTFAATTSTATEVQQSASLSVGTVSA
                     TAATLDGLQASLSQKAGAAGAKSFRIISATSGENQMHGVAELYN"
     gene            complement(76197..76829)
                     /locus_tag="DDA3937_RS00330"
                     /old_locus_tag="Dda3937_01156"
                     /db_xref="GeneID:9731454"
     CDS             complement(76197..76829)
                     /locus_tag="DDA3937_RS00330"
                     /old_locus_tag="Dda3937_01156"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315774.1"
                     /db_xref="GI:503080889"
                     /db_xref="GeneID:9731454"
                     /translation="MRKITKGTEPASLTAWKRANPTGRYDDLTETERQDIRDACAKEQ
                     FYLCAYCCKPISGDNSDTMNEHVQARKLAPHRSLDFTNIAASCTTPNQCDAAHGSQPF
                     SLTPLMAECETELQFMISGRVSGTTARAQDAIRVLNLGDNETHNKKLIEIRKQFIDSL
                     LWTNGIDPDEGLEDDDLLTAVINDFSSPQNGRLTPYAPVLVNILRGWLSA"
     gene            complement(76813..78273)
                     /locus_tag="DDA3937_RS00335"
                     /old_locus_tag="Dda3937_01157"
                     /db_xref="GeneID:9731455"
     CDS             complement(76813..78273)
                     /locus_tag="DDA3937_RS00335"
                     /old_locus_tag="Dda3937_01157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_033111492.1"
                     /db_xref="GI:696580313"
                     /db_xref="GeneID:9731455"
                     /translation="MKIKQFRLHNVGRFTSLDALIAPTADYPSNVTVLVGNNGAGKTS
                     ILQALATSLSWLVARVRSEKGSGSGINEGTITNGHTSAAIEVMAQDTPPLSGHAADND
                     AEYHWTLAKTRSGKKGQHTSQLNAVSALADHYRSALTQNEQSSLPLIAFYPVERSVLD
                     IPLKIKNKHHFQQVDGYDNALNQGVDFRRFFEWFREREDIENENDGVVLTNLFESNPE
                     GVLKVFEDIEDADYRVDKLEIFDWAGLSEEFKKLNNALKLMQEVQDKAKDPQLNAVRS
                     AITAFMPGFSNLKVRRKPRLHMSVDKNGEAFNVLQLSQGEKSLMALVGDIARRLAIMN
                     PTLDNPLHGQGIVLIDEVDMHLHPSWQRSIIERLTTTFPHCQFILTTHSPLVISDYKD
                     VLVYSLDNGELTVVPSQYGQDANSVLLEVMDTHIRNARIAEKFSDLLDMIQRQQLTPA
                     KALLDELTAELPATNLELTKARLLLRKQELRGEKNH"
     gene            complement(78371..79555)
                     /locus_tag="DDA3937_RS00340"
                     /old_locus_tag="Dda3937_01158"
                     /db_xref="GeneID:9731456"
     CDS             complement(78371..79555)
                     /locus_tag="DDA3937_RS00340"
                     /old_locus_tag="Dda3937_01158"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013315776.1"
                     /db_xref="GI:503080891"
                     /db_xref="GeneID:9731456"
                     /translation="MEQFDVIIIGAGAAGLFCAAQAGQRGLRALLVDNGKKPGRKILM
                     SGGGRCNFTNLYAEPAAYLSNNPHFCKSALARYTQWDFIDLVNRHGIAYHEKTLGQLF
                     CDDSAQQIVDMLMKECETGKVTLRLRSEVSSVEKSEQFQVTLNTGVVQAPAVVVATGG
                     LSMPGLGATPFGYQLATQFGLKVLPTRAALVPFTLHKPLLEQLQTLSGVSVPAVVTAE
                     NGTTFRENILFTHRGLSGPAVLQLSSYWQPGEFVTINLLPNLDLTECLNNERLAHPNQ
                     SLKNTLAQWLPKRLVESLQALGQLPDVTLKQLNKPQQAEVETTLQQWRVQPNGTEGYR
                     TAEVTLGGVDTRELSSKTMEANNVPGLYFIGEVVDVTGWLGGYNFQWAWSSAWACAQA
                     LG"
     gene            79859..81367
                     /locus_tag="DDA3937_RS00345"
                     /old_locus_tag="Dda3937_01159"
                     /db_xref="GeneID:9731457"
     CDS             79859..81367
                     /locus_tag="DDA3937_RS00345"
                     /old_locus_tag="Dda3937_01159"
                     /function="4.2.A.20 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Inorganic Phosphate Transporter (PiT) Family"
                     /function="4.S.155 transport; substrate; phosphate"
                     /function="1.8.1 metabolism; metabolism of other
                     compounds; phosphorous metabolism"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315777.1"
                     /note="involved in the transport of inorganic phosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transporter PitA"
                     /protein_id="WP_013315777.1"
                     /db_xref="GI:503080892"
                     /db_xref="GeneID:9731457"
                     /translation="MLHLFAGLDFHTGLMLVLALLFVLFYEAINGFHDTANAVATVIY
                     TRAMRAQLAVVMAGVFNFLGVLLGGLSVAYAIVHLLPTDLLLNVSSTHGLAMVFSMLL
                     AAIIWNLGTWYFGLPASSSHTLIGSIIGIGLTNALVTHTSVVDALNIPKMVSIFLSLL
                     VSPVVGMIIAGLMVYLLRRYWSNNKKRQRVHLTPAEREKQDGKRKPPFWTRTALILSA
                     VGVSFSHGANDGQKGIGLIMLVLIGVAPAGFMLNMNASGYDISRTRDAVLNLQAYYQS
                     HSAALTQVIDLSHPVIPAPENVIPSTGNKPDFHCDTSRAMIAIDRVQGLLNNIKSYDE
                     LAADDRARARRLLMCMADTLDRVVKLPETSSDDKRLLNNLRSDLLYTVEYAPLWIIVA
                     VALALSLGTMVGWKRVAVTIGEKIGRKGMTYAQGVSAQVTAAMSIGIASYTGMPVSTT
                     HVLSSAVAGTMIVDGGGVQGKTVKSILLAWVFTLPVSMLLSGVLYWLSLKLI"
     gene            complement(81499..81834)
                     /locus_tag="DDA3937_RS00350"
                     /old_locus_tag="Dda3937_01160"
                     /db_xref="GeneID:9731458"
     CDS             complement(81499..81834)
                     /locus_tag="DDA3937_RS00350"
                     /old_locus_tag="Dda3937_01160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315778.1"
                     /note="ppGpp-dependent, membrane associated, stress
                     protein produced under conditions of nutrient deprivation,
                     osmotic shock and oxidative stress; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein B"
                     /protein_id="WP_024104057.1"
                     /db_xref="GI:568599975"
                     /db_xref="GeneID:9731458"
                     /translation="MISTFALFWALCVVCVINMARYYSSLRVLLLILRDCDPLLYQYV
                     DGGGFFTSHGQPSKQLRLVRYIYAQRYLDHHDPEFIRRCARVRGQFLLTSALCGLVVV
                     SLIALIIWH"
     gene            82453..82887
                     /locus_tag="DDA3937_RS00355"
                     /old_locus_tag="Dda3937_01161"
                     /db_xref="GeneID:9731460"
     CDS             82453..82887
                     /locus_tag="DDA3937_RS00355"
                     /old_locus_tag="Dda3937_01161"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /function="5.5 cell processes; adaptation to stress"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315780.1"
                     /note="involved in resistance to DNA-damaging agents;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein A"
                     /protein_id="WP_013315780.1"
                     /db_xref="GI:503080895"
                     /db_xref="GeneID:9731460"
                     /translation="MAYKHILIAVDLSPESKVLVEKAVSMARPYDAKVSLIHVDVNYS
                     DLYTGLIDVNLGDMQQRISEETQNALKELADNAGYPISETLSGSGDLGQVLVDAIRKY
                     DVDLVLCGHHQDFWSKLMSSARQLINTVHIDMLIVPLREEEE"
     gene            complement(82990..84996)
                     /locus_tag="DDA3937_RS00360"
                     /old_locus_tag="Dda3937_01162"
                     /db_xref="GeneID:9731461"
     CDS             complement(82990..84996)
                     /locus_tag="DDA3937_RS00360"
                     /old_locus_tag="Dda3937_01162"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019845320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_013315781.1"
                     /db_xref="GI:503080896"
                     /db_xref="GeneID:9731461"
                     /translation="MSIELISYPSSIQTPQVSPSATGKKTLSTRALVLITTVFIITCG
                     FILTIGFLLWQSGQQQKTTAQQLLEQTAYTSAYSVQNRLDVALFAARDLVQSVISLRE
                     AGAPDRATAEQLLKNALKSHPDLLSMSLAWEPNAFDGKDQQYVSQPEQDPKGRFVRYV
                     DRDGSGKVALHNLTDYETPGSGDYYLLPGKLQKEVILEPYSYPYNGVDVLLTSIAVPI
                     MIDGKFYGSVTADFSLDTLQQMVNGIKPYQGAGYATMLSASGAYIAHPDKTRIAKKLE
                     GDPPLMDSITAGKPYTRQRFNSFTNAEMMNAYVPVTIGNTGTPWMLGVSVPEQVVMAE
                     SVRLRYIGALMTLLSILVVSGVIGLIFTRKVLRPVGGEPADAAAIALAVAQGNLTLHI
                     PVQPKDTSSIFYAMSEMQQQLRTIVEQLMSTSESVSHGAAEISAGNVDLASRTEQQAA
                     ALEETAASMEQITATVKQNADNAHSATRLTQNAAHIAQRGDEIVSQVVTVMGSIDESS
                     KKISEITGIISSIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSASAVKD
                     ITALIGESAERVGHGVGMVENAGKTMRDMLTAVTSVNDIMSEIVAASDEQSRGISQVT
                     QAVHEMDGVTQQNAALVQQATAAAASLEDQARQLAQLVQVFRIH"
     gene            85230..86045
                     /locus_tag="DDA3937_RS00365"
                     /old_locus_tag="Dda3937_02521"
                     /db_xref="GeneID:9731462"
     CDS             85230..86045
                     /locus_tag="DDA3937_RS00365"
                     /old_locus_tag="Dda3937_02521"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315782.1"
                     /note="YidA; catalyzes the dephosphorylation of erythrose
                     4-phosphate (preferred substrate), mannose 1-phosphate and
                     p-nitrophenyl phosphate; hydrolyzes the
                     alpha-D-glucose-1-phosphate but not the beta form; member
                     of the haloacid dehalogenase-like hydrolases superfamily
                     and Cof family of proteins; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate phosphatase"
                     /protein_id="WP_013315782.1"
                     /db_xref="GI:503080898"
                     /db_xref="GeneID:9731462"
                     /translation="MAIKLIAIDMDGTLLTPENQISPAVKQAIVAAREKGVYVALATG
                     RPFIGVERYLKQLGLQQEGHYCITNNGALVQRTATGECVAQTTLSFDDYLHFEALSRE
                     LGVHFHALDFNYVYTANKDISAYTVHESHLTSMPLKYRAVEEMDPSLRFPKVMMIDEP
                     EVLDAAIARIPREDFARYTIMKSAAFYLEILDKRVNKGEGVKMLAQHLGLERDEVMAL
                     GDQENDLAMIEFAGLGVAMGNAIDVVKAASQFVTRSNSEDGVAYAIEKFVLNV"
     gene            complement(86351..87535)
                     /locus_tag="DDA3937_RS00370"
                     /old_locus_tag="Dda3937_02522"
                     /db_xref="GeneID:9731463"
     CDS             complement(86351..87535)
                     /locus_tag="DDA3937_RS00370"
                     /old_locus_tag="Dda3937_02522"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886681.1"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-D-gluconate from mannonate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannonate dehydratase"
                     /protein_id="WP_013315783.1"
                     /db_xref="GI:503080899"
                     /db_xref="GeneID:9731463"
                     /translation="MEHTWRWYGPNDPVSLDDARQAGATGIVTALHHIPNGEVWSIEE
                     IKKRQAQLAEKGLIWSVVESVPIHEAIKTQTGDYRKYIANYQQSLRNLGACGIDTVCY
                     NFMPVLDWTRTDLEYPLPDGSRALRFDHTAFAAFELHLLKRDGAAADYTDDEQRQAAA
                     YFAAMSDADKDKLTRNIIAGLPGAEEGYTLDQFRAQLAQYDGIDKAKLREHMAEFLRA
                     IVPVAEEAGIVLAVHPDDPPRPILGLPRIVSTIEDMQWLKDAVDSIHNGFTMCTGSYG
                     VRADNDLVKMIETFADRIHFTHLRATCREDNPKSFHEAAHLHGDVDMVKVVKAILAEE
                     YRRRQQGNTRAIPMRPDHGHQMLDDLKKKTNPGYSAIGRLKGLAEVRGVELAIKQTFF
                     ND"
     gene            87794..88489
                     /locus_tag="DDA3937_RS00375"
                     /old_locus_tag="Dda3937_02523"
                     /db_xref="GeneID:9731464"
     CDS             87794..88489
                     /locus_tag="DDA3937_RS00375"
                     /old_locus_tag="Dda3937_02523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_033111493.1"
                     /db_xref="GI:696580314"
                     /db_xref="GeneID:9731464"
                     /translation="MVLPTLKVERLYRQISNLLINCIRNGQFAAGQLLPSERELAKQL
                     GVSRSSIREALIALEITGWVEIRTGNGVYVNDPLPDAPPAAPPEEEFSLRAFIQARQV
                     YEAMMAELAAVHATDEQRAALQDITRDLSRLHVNDAQFLHEDKRFHLLISEMSGNEVL
                     QDMMDYLWNKRQSSRFVRLETLYADSDFPRTMNQDHADIAEAIVARDPARARASMERH
                     LQHVYDHLFSGDK"
     gene            complement(88792..89796)
                     /locus_tag="DDA3937_RS00380"
                     /old_locus_tag="Dda3937_02524"
                     /db_xref="GeneID:9731465"
     CDS             complement(88792..89796)
                     /locus_tag="DDA3937_RS00380"
                     /old_locus_tag="Dda3937_02524"
                     /function="8.3.1 extrachromosomal; transposon related;
                     transposases"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013315785.1"
                     /db_xref="GI:503080901"
                     /db_xref="GeneID:9731465"
                     /translation="MQNVTLIGIDLGKHSFHVHAQDKNGNALLRKKFSRNQLTAFLST
                     CTASTVVMESCAGAHFMARHISQFGHQVKLISPQFVRPFVKSNKNDFIDAEAICEAAS
                     RPSMRFVTPRTEDQQAMSAFHRVRDTLVRERVKTTNQMHAFLLEFGISMPRGIAIIRR
                     LAVVLEEHELPPYLARLLMRLHQHYACLTEQIKELEQELKIHIAGDDTAQRLLTIPGV
                     GLITASLLATKLGDGKSYASSRDFAASTGLVPRQYSTGGKSTLMGISKRGDKNLRRLL
                     VQCARAFMQRLEHNQGRLADWVKTQLSRHHSNVVACGLANKLARIAWSVTTHRTAFIQ
                     "
     gene            complement(89920..90177)
                     /locus_tag="DDA3937_RS00385"
                     /old_locus_tag="Dda3937_02525"
                     /db_xref="GeneID:9731466"
     CDS             complement(89920..90177)
                     /locus_tag="DDA3937_RS00385"
                     /old_locus_tag="Dda3937_02525"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315786.1"
                     /db_xref="GI:503080902"
                     /db_xref="GeneID:9731466"
                     /translation="MKNVKTIAIAATLATLSFGAFAAQSVSYEQAQQLDKIGSVSATA
                     NDLSSLQAKLAHQAEAAGASAYTITYAGGDNTLRGNAVIYK"
     gene            90607..91893
                     /locus_tag="DDA3937_RS00390"
                     /old_locus_tag="Dda3937_02526"
                     /db_xref="GeneID:9731467"
     CDS             90607..91893
                     /locus_tag="DDA3937_RS00390"
                     /old_locus_tag="Dda3937_02526"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter Tol"
                     /protein_id="WP_013315787.1"
                     /db_xref="GI:503080903"
                     /db_xref="GeneID:9731467"
                     /translation="MKNKDNQITHNAFSHQLTNINIWSCDGKWLIYDVRPHGSSFTGL
                     TIERVNVETRRREVLYRAGQGAHVGVATGSPAAPQRYVFIHGPENPDEHWRYDFHHRR
                     GVVMHDDDRRQATTLDACVLTSPYLAGALRGGSHVHVFSPDGSRLSFTYNDHVLHERD
                     PALDLRNVGVAVPLHPVVAPHRHPREHDGSHFCVLVSDTTPQPRSGSDDINRAYEEGW
                     VGTAGYLRPDGRRQRWALAFIGDTLSARGEKVPEVFLVDLPEQLDDYARPGDRPLGGT
                     DAALPAPPAGVRQRRLTFTADRSYPGVVNQPRHWLRSSPDGSQIAFLMKDDRGVVQLW
                     TVSPNGGAPRQVTQGDWPVQSAFSWHPDGRHLAFICDNSVMLCEVATGRLIRQTARSE
                     TPPVGDAVVFSPNGDRIAYLRDIDGYNQIFVVTVMR"
     gene            92176..93762
                     /locus_tag="DDA3937_RS00395"
                     /old_locus_tag="Dda3937_02527"
                     /db_xref="GeneID:9731468"
     CDS             92176..93762
                     /locus_tag="DDA3937_RS00395"
                     /old_locus_tag="Dda3937_02527"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar kinase"
                     /protein_id="WP_013315788.1"
                     /db_xref="GI:503080904"
                     /db_xref="GeneID:9731468"
                     /translation="MKNGCFIGVDVGSASVRAGVFDGAGQRLAFAVRPIEQFHPRTHM
                     VEQSSADIWQAVGACVREALSVAAVAPSLVRAIGFDATCSLVAVGPQGQSVSMAEQHD
                     PQRDIIMWMDHRAAVETADINATGDEALRYVGGEVSIEMELPKILWLKRHFPARYQQV
                     WRFFDLADYLVWRATGADAASVCTLTCKWNYLAHENRFSDSLLQAVGLADLPQKIPPR
                     ILQLGEAAGTLAADVARDWGLPENVVVAGGIIDAHAGGLALVGSEPQGSLAVISGTSN
                     CHMLVSRQPVEVPGVWGPYWGAMLPQWWLNEGGQSAAGALVEWTLRQHAQWPALTAQA
                     EQQRRSPYALLNEWVASLEQREPLPTRHLHVLADHHGNRSPRANPDARGMVMGLTLEQ
                     GPDALARLYLATLQAIAYGTRHIIEALNQAGHQITRLTMCGGATKNPLWLREYAAITG
                     CDIQLASEEDAVTLGAALLGAVACGAYPSLPQAAQALVQPGPLIRADRRNQPFHDAKY
                     QIYLQMYDYQQAAQQQMSRH"
     gene            93813..95483
                     /locus_tag="DDA3937_RS00400"
                     /old_locus_tag="Dda3937_02528"
                     /db_xref="GeneID:9731469"
     CDS             93813..95483
                     /locus_tag="DDA3937_RS00400"
                     /old_locus_tag="Dda3937_02528"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction protein"
                     /protein_id="WP_013315789.1"
                     /db_xref="GI:503080905"
                     /db_xref="GeneID:9731469"
                     /translation="MLEQRVSLTLNLPASPRRLSVGEREVLLVTNADLRESANLTCWP
                     TQQQFEGRLQSALEQLGYRMTRAHAVDSARGHGFISSQREGSDVFAALDPDAPVIVLL
                     TAWQYSHHVAPSLVHHRGPVLLLANFDGTWPGLVGMLCMAGCLTSLGRDYSRLWSATF
                     DDDAFRQGLATWLRDGTVSHKTGYLRPVAASHPVLATPAGQIGRQVGEYILRHKAIIG
                     LFDTFCMGMINGVFPQQAMVTIGMPIESLSQSALLVEMAKVPYALRESCLAWYEQRGM
                     RFEFGDDGSRQLTRDQVLEQCAMMIAMARFTQRFGLAAVGVQYQQGLKDSCAASDFAE
                     GAIGNAERFPLPDEQGEPIRPDVAIPCINEVDMGSAIPQVMLWHLLHGLGLPAETTLH
                     DIRWGSEHQGVFYWDLEISGAVPFAHLKGGIAGATGYRQPPMFFPYGGSTIAGQGKAG
                     RFVWARAHYEGTQVMMHIGTGTAVELPADEFERRRRATNYEWPLLNAVLDGVTRDDLM
                     AGHQSNHLTVAYVDEDKLAEVLKAFVAQALTQHIQVWTAGDAHRLLVE"
     gene            95487..96446
                     /locus_tag="DDA3937_RS00405"
                     /old_locus_tag="Dda3937_02529"
                     /db_xref="GeneID:9731470"
     CDS             95487..96446
                     /locus_tag="DDA3937_RS00405"
                     /old_locus_tag="Dda3937_02529"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.5.1.7 metabolism; building block
                     biosynthesis; amino acids; lysine, diaminopimelate"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="WP_013315790.1"
                     /db_xref="GI:503080906"
                     /db_xref="GeneID:9731470"
                     /translation="MTYDNPSFNDENKYAGIWPVMLTPFDARGEIDYASLARLVEWYL
                     DAGVHGLFAACQSSEMFFLSDAETRELVRFIVAQVDGRVPVVASGHTASAFSQQVDQL
                     NGVAETGVDGVILISNRLALAGEPDEQALARLQALTAQLPAQVDLGIYECPYPYKRLL
                     SDETVAWCARSGRYTFIKDTCCDLPTIRRRLQLAQNSRLHLANANSQTLLASLQAGCQ
                     AYSGVMANFHPQLYVWLFEHWREHPAAAQQLADYLGTAALAEFLDYPACAKFYQQQCG
                     TFSTHVCRVRNSAAYGESFFPQAIESMLRLGQTLETQLPASLR"
     gene            96463..97509
                     /locus_tag="DDA3937_RS00410"
                     /old_locus_tag="Dda3937_02530"
                     /db_xref="GeneID:9731471"
     CDS             96463..97509
                     /locus_tag="DDA3937_RS00410"
                     /old_locus_tag="Dda3937_02530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111494.1"
                     /db_xref="GI:696580315"
                     /db_xref="GeneID:9731471"
                     /translation="MKLTMTTQQFVLPEGHDYFGNCHASTVAVLPEGRLRVAWFAGEK
                     EGSGDTAIWLACAEQGRWLQPVRVAWEDGVAHWNPVLHWQAGTLWLFYKVGADVHHWQ
                     TRVAVSTDDGASWSAPRLLVPGDSAPRGPVKNKLLVMSNGEWLAPASVEDDRHWDAFV
                     DLSGDRGRSWQTAPIPLTHRTPGERDGEALWQGLEQAALWENDLTRVFQWDGVIQPSA
                     WESSPGQVHVLMRSTRGALYRSDSDDYGRRWREAYAIDLPNNNSGVDLAHLGAGRLVL
                     VYNPVTGNWRHRYPLTVACSTDNGEHWENSIDLEQEPGEFSYPAIIADGDTLHVTYTW
                     NRKNIVYCALIFSG"
     gene            97623..98972
                     /locus_tag="DDA3937_RS00415"
                     /old_locus_tag="Dda3937_02531"
                     /db_xref="GeneID:9731472"
     CDS             97623..98972
                     /locus_tag="DDA3937_RS00415"
                     /old_locus_tag="Dda3937_02531"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.2.A.1 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Major Facilitator Superfamily (MFS)"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013315792.1"
                     /db_xref="GI:503080908"
                     /db_xref="GeneID:9731472"
                     /translation="MSISVELSQHQAMHNKSNIRRVVISSWIGNTIEFYDFLLYGLAS
                     ALVFGKLFFPTVSPMAAMLASFATFGVGFIARPLGGIFFGHMGDTLGRKLTLLITLGG
                     MGMATFLIGCLPTYHQIGVWAPVLLVVLRFVQGFLVGGEWGGAMLMVVETAPANRRGL
                     LGSIPQTGGFSGQLLATAIFAMVSTLPEDQLMSWGWRVPFMLSVALVLVGLYMRRKVD
                     ETPVFQQVQQQQQQQTHEQEPVRRQSPVVEVLRKQWRSVCLIMVLRFAESVPFFLATV
                     FAVSYATVQLGVPKQTMLNVIMATCVMAFPMHALFGALSDRVGRRPIYIFGALCAAAM
                     AFPFFYLLESGSFGLMVLGYILLINIAHNSINAVQPAFFTELFGPKVRYSGASIGAQL
                     GAIVAGGFTPFIAKGLTAMDNESWTLVATYVTVAALVAAFAAWKAPETSHRDMTKDV"
     gene            99073..100077
                     /locus_tag="DDA3937_RS00420"
                     /old_locus_tag="Dda3937_02532"
                     /db_xref="GeneID:9731473"
     CDS             99073..100077
                     /locus_tag="DDA3937_RS00420"
                     /old_locus_tag="Dda3937_02532"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_013315793.1"
                     /db_xref="GI:503080909"
                     /db_xref="GeneID:9731473"
                     /translation="MAKTVEQIASALKLSVTTVRLVLNGKAEQYRISAKTQQRIHQYV
                     TEYGYTVNHVARSLKLNKTETLGLIVPRLSNLFFSTLAEKLETRCREVGYQLMISCSY
                     SDPQYENRLVEALLQRNVDGLFVVPSSLQAAQHHAKVVKKPLVLLDRDFGIDQLPLVM
                     SDNLQGGAALTEAMLAAQPAAPLFFMAGDVQQSAIRDRLRGYRQSVQQAGLTPAVLEA
                     SHNRREDGMLMMEQFLRQHDAPPPAFIASSLPVLEGMLSVVRERYGYIPAHINIGTFD
                     EHAMLGFLPNTLWSMRQNEDAWTEQAFAAMQQALNGEAQPHKAVIPMTLIHRRQAERH
                     "
     gene            complement(100071..100439)
                     /locus_tag="DDA3937_RS00425"
                     /old_locus_tag="Dda3937_02533"
                     /db_xref="GeneID:9731474"
     CDS             complement(100071..100439)
                     /locus_tag="DDA3937_RS00425"
                     /old_locus_tag="Dda3937_02533"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111495.1"
                     /db_xref="GI:696580316"
                     /db_xref="GeneID:9731474"
                     /translation="MTILKNASLSFVLSGGILVTCGGCSSVMTHSGGEQGYYSGTKSS
                     MTTLKNEDTSWAMMPMVALDVPFSAMLDTLLLPYDYYRTHSDHHNTSARDRLEEYERR
                     KPAGDPPPTMIPVSANNAGQ"
     gene            100743..101156
                     /locus_tag="DDA3937_RS00430"
                     /old_locus_tag="Dda3937_02534"
                     /db_xref="GeneID:9731475"
     CDS             100743..101156
                     /locus_tag="DDA3937_RS00430"
                     /old_locus_tag="Dda3937_02534"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="5.5.2 cell processes; adaptation to stress;
                     temperature extremes"
                     /function="5.5.6 cell processes; adaptation to stress;
                     other (mechanical, nutritional, oxidative stress)"
                     /function="2.3.4 information transfer; protein related;
                     chaperoning, folding"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848396.1"
                     /note="with IbpB associates with aggregated proteins to
                     stabilize and protect them from irreversible denaturation
                     and extensive proteolysis during heat shock and oxidative
                     stress; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein IbpA"
                     /protein_id="WP_013315795.1"
                     /db_xref="GI:503080911"
                     /db_xref="GeneID:9731475"
                     /translation="MRNPDFSPLYRSAIGFDRLFNLLEAGQSQGNGGYPPYNVELVDE
                     NQYRIAIAVAGFAESELEITAHDNMLIVKGSHSGDATPRNYLYQGIAERNFERKFQLA
                     EHIQINGANLENGLLFIDLQRVIPETLKPRRIEIK"
     gene            101307..101756
                     /locus_tag="DDA3937_RS00435"
                     /old_locus_tag="Dda3937_02535"
                     /db_xref="GeneID:9731476"
     CDS             101307..101756
                     /locus_tag="DDA3937_RS00435"
                     /old_locus_tag="Dda3937_02535"
                     /function="5.5.2 cell processes; adaptation to stress;
                     temperature extremes"
                     /function="5.5.6 cell processes; adaptation to stress;
                     other (mechanical, nutritional, oxidative stress)"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315796.1"
                     /note="16 kDa heat shock protein B; associates with
                     aggregated proteins, together with ibpA, to stabilize and
                     protect them from irreversible denaturation and extensive
                     proteolysis during heat shock and oxidative stress;
                     ATP-independent; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat-shock protein"
                     /protein_id="WP_013315796.1"
                     /db_xref="GI:503080912"
                     /db_xref="GeneID:9731476"
                     /translation="MRNYDLSPLLRQWIGFDKLASAMGSQEAVEFPPYNIEKVDDNHY
                     RITLALAGFRQSELDIEVEGQRLTVKGAPTLPEKKAQYLHQGLVFKPFSLSFTLAEHL
                     HVSDAQFQHGLLHIDLIRDVPQALQPQRIAIGRRAPELQEKAPDEQA"
     gene            102431..103843
                     /locus_tag="DDA3937_RS00440"
                     /old_locus_tag="Dda3937_02536"
                     /db_xref="GeneID:9731477"
     CDS             102431..103843
                     /locus_tag="DDA3937_RS00440"
                     /old_locus_tag="Dda3937_02536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate translocator"
                     /protein_id="WP_033111496.1"
                     /db_xref="GI:696580317"
                     /db_xref="GeneID:9731477"
                     /translation="MSANNSRLVKLLIILGIAVIFWFVPVPEGVSPAAWHLLAIFIAT
                     VIGLILSPYPLGAIAIFSITAVAALGLLPVKDVLVGFGDPTIWMIACAFFISRSFIKT
                     GFGRRIGFLFISKLGNSSLGLAYGLVFTDLLFSPAMPSTSARCGGIITPLFRSIAEAY
                     GSTPEQGTQRRIGSFLVQTIFQCNAITSAMFMTSMAGNPLISKLATQFGVHLTWTEWA
                     AATLVPGLLSLIVIPLVLYRFYPPELKKTPEMRELAKVRLHEMGPMSRNEWIVLCVFL
                     GLVVFWVLGSTLNIDATLTALGGLSVLLLTRALSWEDVTGEKEAWHTVVWFAVLMMLA
                     TQLNKMGLIAWLGGIAGHAVAGMHWLPMVGLLLLVYYYSHYFMASAVAHISAMYAIFV
                     SIAIAAGAPPVLTVLAFAAFSNLFMATTHYSGGPAPIMFGCGYLSLGTWWKIGFLVGL
                     VVIPIWLGIGSLWWKVLGMW"
     gene            104003..105616
                     /locus_tag="DDA3937_RS00445"
                     /old_locus_tag="Dda3937_02537"
                     /db_xref="GeneID:9731478"
     CDS             104003..105616
                     /locus_tag="DDA3937_RS00445"
                     /old_locus_tag="Dda3937_02537"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="3.1.3.2 regulation; type of regulation;
                     posttranscriptional; covalent modification,
                     demodification, maturation"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942755.1"
                     /note="C4-dicarboxylate-sensing histidine kinase; part of
                     two-component regulatory system with DcuR; regulates
                     anaerobic fumarate respiration; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensory histidine kinase"
                     /protein_id="WP_013315798.1"
                     /db_xref="GI:503080914"
                     /db_xref="GeneID:9731478"
                     /translation="MSKKKTPLKLGTSIILMVSAVIGSVLLVVYALLFFRITELTETH
                     LKDKAFAIARTVANSPIVVDDLKGIGDPMLVQRFSEDVKSRNHLLFVIVTDMDGIRHS
                     HPEPGQIGRHFIGDDLYPALLGLENTAVNRGVLDPALRVFTPVFDKNNQQLGVVAVGI
                     SLSSVQSVINENRWIIPWTILFGALVGLLGTYFLVKTLKRIMLGFEPFEISNLFEQRN
                     AMLKQIKEGVIAVDTDLRVTIINDEAKRLFSQHGSGETLAIGSTISRWPALMNLEKVL
                     ETGAPRQDEEINFNGNLLLINTVPVVVKGDIIGTIATFRDKTEVSQLLQRLTGMSYYA
                     DALRAQSHEFMNKLHVILGMLHLKYYPQLEEYILKTANNYQAEIGSIIRKVKSPVIAG
                     FLLGKINRARDLGVTLSISEDSLLPDTDDAQATNELITVLGNLIENAMDALSGLENRE
                     ISVTFHHQDGQLHCTVSDDGPGIAPDIQQRIYQEGFSTKGSGRGIGLYLTRQSLEKIG
                     GTIDFESEPDVYTQFFVNIPYQARQFDHD"
     gene            105629..106351
                     /locus_tag="DDA3937_RS00450"
                     /old_locus_tag="Dda3937_02538"
                     /db_xref="GeneID:9731479"
     CDS             105629..106351
                     /locus_tag="DDA3937_RS00450"
                     /old_locus_tag="Dda3937_02538"
                     /function="DcuR controls the genes encoding anaerobic
                     fumarate respiratory system"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005976762.1"
                     /note="response regulator in two-component regulatory
                     system with DcuS; phosphorylated DcuR activates
                     transcription of genes involved in anaerobic fumarate
                     respiration; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013315799.1"
                     /db_xref="GI:503080915"
                     /db_xref="GeneID:9731479"
                     /translation="MINVLIVDDDAMVAELNKCYLNQISGFSCYATVPTLQQARNLLM
                     QPDCEIDLVLLDIYMQQDNGLDLLPTIREFSEHTDVIIISSASDVYTIKKALHYGVVD
                     YLIKPFQFARFEQALTAYREEANLLKHREFVAQSDIDNLIRRTSGTPTVERKKLPKGL
                     TSLTLRTVCEWVEGNQGAEFSTEMLANAIGISRVSCRKYLIYLADTGILDTNILYGST
                     GRPVYLYRLLPEKQDALRQYCE"
     gene            complement(106457..107800)
                     /locus_tag="DDA3937_RS00455"
                     /old_locus_tag="Dda3937_02539"
                     /db_xref="GeneID:9731480"
     CDS             complement(106457..107800)
                     /locus_tag="DDA3937_RS00455"
                     /old_locus_tag="Dda3937_02539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate permease"
                     /protein_id="WP_033111497.1"
                     /db_xref="GI:696580318"
                     /db_xref="GeneID:9731480"
                     /translation="MKNIETEIMSDNTLATTAPSGLLESLNKTRIGSVPFILFLVISA
                     VVFIAAYASYLPKNMIGGFAVIMTMGFLLAYIGQRIPVLKEIGGPAILCLMVPSILVY
                     FHLFNANTLDTVKLLMKDANFLYFVIASLVVGSILGMNRVILIQGMIRMFIPLVIGTA
                     AAVVTGLLVGKLFGYSFYHTFFFIIVPIIGGGIGEGILPLSLAYSAILGQAPDVYVAQ
                     LVPAAVVGNIFAIICAGVLARIGVWRSDLNGNGNLVRNEADNALFAVKDAPKTVDFHL
                     MGGGLLLICTFFIVGGLFEKVLHIPGPVLMILIAVLCKYGRVIPSSMETGANSFYKFV
                     SSSLVWPLMIGLGMLYVPLESVVAVFSVGYVVVCGSVVLSMALISFFIAPYLKMYPVE
                     ASIVTSCHSGLGGTGDVAILSASNRMSLMPFAQIATRIGGASTVIAATLLLGWLV"
     gene            109081..110688
                     /locus_tag="DDA3937_RS00460"
                     /old_locus_tag="Dda3937_02540"
                     /db_xref="GeneID:9731481"
     CDS             109081..110688
                     /locus_tag="DDA3937_RS00460"
                     /old_locus_tag="Dda3937_02540"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="4.S.47 transport; substrate; dipeptide"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315801.1"
                     /note="DppABCDF is involved in the transport of
                     dipeptides; also binds heme and mediates chemotaxis to
                     dipeptides; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013315801.1"
                     /db_xref="GI:503080917"
                     /db_xref="GeneID:9731481"
                     /translation="MAKSLMKSRVLKFSLGLLALSVAAGVQAKTLVYCSEGSPEGFNP
                     QLFTSGTTFDASSIPIYNRLVEFKNGTTEIEPGLAEKWDISADGKTYTFHLRKDVKWQ
                     DNKEFKPSRTFNADDVLFSFQRQMDANHPFHKVSGGSYEYFEGMGMPDLISKIEKVDD
                     YTVRFQLTRAEAPFLADLAMDFASIMSAEYGDKMLKAGSPEKIDLDPIGTGPFQLQQY
                     QKDSRILYKRFDSFWGTKPGIDRLVFSITPDASVRYAKLQKDECQVMPYPNPADLASM
                     KQDKNIELLQKPGLNVGYLSFNVEKKPLDNVKVRQALTYAVNKQAIIEAVYQGAGQAA
                     KNLIPPTMWGYNDDVKDYAYDPAKAKALLKEAGLENGFEIDLWAMPVQRPYNPNARRM
                     AEMIQADWAKVGVKAKIVTYEWGEYLKRAKAGEHQTVLMGWTGDNGDPDNFLATLFSC
                     DAAKKGSNYSKWCYKPFEDLIQPARAVSDQAKRIELYKQAQVVMHDQAPALIVAHSTV
                     YEPIRKNVKGYVIEPRGVHSFNHVSVD"
     gene            110917..111936
                     /locus_tag="DDA3937_RS00465"
                     /old_locus_tag="Dda3937_02541"
                     /db_xref="GeneID:9731482"
     CDS             110917..111936
                     /locus_tag="DDA3937_RS00465"
                     /old_locus_tag="Dda3937_02541"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="4.S.47 transport; substrate; dipeptide"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009110842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_013315802.1"
                     /db_xref="GI:503080918"
                     /db_xref="GeneID:9731482"
                     /translation="MLQFILRRLGLVIPTFIGITLLTFAFVHLIPGDPVMIMAGERGI
                     SPERHAQLMAELGLDKPLWEQYLHYINGVLHGDLGMSLKSRIPVWDEFVPRFKATLEL
                     GVCAMIFAVIVGIPVGVLAAVKRGSVFDHTAVSIALTGYSMPIFWWGMMLIMLVSVQL
                     NLTPVSGRVGDTVFLDDSLPLTGFMLIDTLIWGAEGDFKDAVMHMLLPAVVLGTIPLA
                     VIVRMTRSAMLEVLGEDYIRTARAKGLGRLRVIVVHALRNAMLPVVTVIGLQVGTMLA
                     GAILTETIFSWPGLGRWLIDALQRRDYPVVQSGVLLVATMIILVNLLVDVLYGVVNPR
                     IRHKK"
     gene            111949..112851
                     /locus_tag="DDA3937_RS00470"
                     /old_locus_tag="Dda3937_02542"
                     /db_xref="GeneID:9731483"
     CDS             111949..112851
                     /locus_tag="DDA3937_RS00470"
                     /old_locus_tag="Dda3937_02542"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="4.S.47 transport; substrate; dipeptide"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010281086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter"
                     /protein_id="WP_013315803.1"
                     /db_xref="GI:503080919"
                     /db_xref="GeneID:9731483"
                     /translation="MTHVTESAATTAPKPMTPLQEFWHYFKRNKGAVVGLVYIILMLV
                     VAIGASVLAPHSPAEQFRDALLKPPVWQEGGSWQYIFGTDDVGRDVLSRLMYGARLSL
                     LVGCLVVVMSLILGVVFGLVAGYFGGAVDAAIMRLVDIMLALPSLLLALVLVAIFGPS
                     IVNASLALTFVSLPHYVRLTRAAVLVEVNRDYVTASRVAGAGPLRQMFVNILPNCLAP
                     LIVQASMGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAI
                     LLTVLAFNLMGDGLRDALDPKLKQ"
     gene            112880..113860
                     /gene="dppD"
                     /locus_tag="DDA3937_RS00475"
                     /old_locus_tag="Dda3937_02543"
                     /db_xref="GeneID:9731484"
     CDS             112880..113860
                     /gene="dppD"
                     /locus_tag="DDA3937_RS00475"
                     /old_locus_tag="Dda3937_02543"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="4.S.47 transport; substrate; dipeptide"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004957243.1"
                     /note="DppD and DppF are the ATP-binding components of the
                     ABC dipeptide transport system DppABCDF; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_013315804.1"
                     /db_xref="GI:503080920"
                     /db_xref="GeneID:9731484"
                     /translation="MALLNVEKLSVHFGDEGLPFRAVDRISYQVEQGQVVGIVGESGS
                     GKSVSSLAIMGLIDFPGKVMADRLEFNQRDLQTLSDRERRQLVGAEVAMIFQDPMTSL
                     NPCYTVGFQIMEAIKVHQGGNRKTRRQRAIDLLNQVGIPDPESRLDVYPHQLSGGMSQ
                     RVMIAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQKENMALILITHDLALVA
                     EAAHHIIVMYAGQVVESGKASDIFRAPRHPYTQALLRALPEFAVDKSRLASLPGVVPG
                     KYDRPNGCLLNPRCPYASDRCRQEEPEMRDIPGRQVKCHTPLDDAGRPTV"
     gene            113857..114864
                     /gene="dppF"
                     /locus_tag="DDA3937_RS00480"
                     /old_locus_tag="Dda3937_01979"
                     /db_xref="GeneID:9731485"
     CDS             113857..114864
                     /gene="dppF"
                     /locus_tag="DDA3937_RS00480"
                     /old_locus_tag="Dda3937_01979"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="4.S.47 transport; substrate; dipeptide"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848385.1"
                     /note="Part of the ABC transporter complex DppABCDF
                     involved in the transport of dipeptides; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_013315805.1"
                     /db_xref="GI:503080921"
                     /db_xref="GeneID:9731485"
                     /translation="MSQTMNAAGQPYLLQAIDLKKHYPVKKGLFAPERLVKALDGVSF
                     TLERGKTLAVVGESGCGKSTLGRLLTMIETPSHGELYYQGQDLLKPDPAAQKLRRQKI
                     QIVFQNPYASLNPRKKVGQILEEPLVINTDLSKAERREKALAMMAKVGLKTEHYDRYP
                     HMFSGGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQDLGLSYVF
                     ISHDLSVVEHIADEVMVMYLGRCVEKGSKDAIFSNPRHPYTQALLSATPRLNPDARRE
                     RIKLTGELPSPLSPPPGCAFNARCQHRFGTCTQLQPQLKPHGEQLVACFAVEQEDSQV
                     S"
     gene            complement(114970..115503)
                     /locus_tag="DDA3937_RS00485"
                     /old_locus_tag="Dda3937_01980"
                     /db_xref="GeneID:9731486"
     CDS             complement(114970..115503)
                     /locus_tag="DDA3937_RS00485"
                     /old_locus_tag="Dda3937_01980"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003825424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315806.1"
                     /db_xref="GI:503080922"
                     /db_xref="GeneID:9731486"
                     /translation="MNKLLPLALLLSAASYAADAPAPKHADADTLKAELTAPSAAPAA
                     EEEEEEYVDTDAAAKQAIAFYQWYLGQIMQNKLPIQDNDPALEKYVARDTVKALRTSK
                     VSTDVDFFLRSNGPDEEDWLPNVRVVGTDVDPVCVNLYMELGKRSPKRLVSCYVQENS
                     VWKLRSVTDLDEMFTKK"
     gene            complement(115562..115789)
                     /locus_tag="DDA3937_RS00490"
                     /db_xref="GeneID:23677378"
     CDS             complement(115562..115789)
                     /locus_tag="DDA3937_RS00490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111498.1"
                     /db_xref="GI:696580319"
                     /db_xref="GeneID:23677378"
                     /translation="MTAFNGHGSRITLSTMEQLAGQAGLSKAKAVLDMADELYDVAKG
                     FHQEASHFNLPAPLITTIQREIDSKWRQLRE"
     gene            complement(115906..116178)
                     /locus_tag="DDA3937_RS00495"
                     /old_locus_tag="Dda3937_01982"
                     /db_xref="GeneID:9731488"
     CDS             complement(115906..116178)
                     /locus_tag="DDA3937_RS00495"
                     /old_locus_tag="Dda3937_01982"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.5 regulation; type of regulation;
                     transcriptional level; action unknown"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013315808.1"
                     /db_xref="GI:503080924"
                     /db_xref="GeneID:9731488"
                     /translation="MLSLHTAYDIQQNLKQHLKAMRKHRKLSVDALARQSGVPNSTIR
                     KFEATGNISLRQFLMLYEVLGNLNDLNTLINQAHTPTSIEEVLKNA"
     gene            complement(116276..117709)
                     /locus_tag="DDA3937_RS00500"
                     /old_locus_tag="Dda3937_01983"
                     /db_xref="GeneID:9731489"
     CDS             complement(116276..117709)
                     /locus_tag="DDA3937_RS00500"
                     /old_locus_tag="Dda3937_01983"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_033111499.1"
                     /db_xref="GI:696580320"
                     /db_xref="GeneID:9731489"
                     /translation="MPDTPRYRQIADHFIRAIQSGTLPAHHRLPSVRALAQQHGTSAT
                     TAMKVLRTLEDEHFALARSKSGFFVADTRRGNAMAPVPQPVALPVLDEQTELHLSLVG
                     TECRVRLDLANGDNALYPLKKMGRLIRQASYTNPMMLGNDVKGSGYLPLKEEIARRAL
                     NYGCHLHPDDILITNGCIEALSLSLRAVTHSGDAVAVQSPCYFVLLQMLRNLGLRVVE
                     VGQDASGHVDAEQLESLFSRRQVSAFISLTNINNPLGTSLPDTYKRRIAEAADRYGIA
                     LIEDDTFADTAFGEQRPFPLRAFSPNVLLCNGFSKTVGPGIRIGWVSGAHWQRKLAAL
                     KFTSTMGTSLTPQVALAELLRNGGYDAHLRKLRRELARQVARLRQAVLHYFPADTQVS
                     QPEGGYAIWVTLPPGCCSSRELFSRARQEGIGIAPGHIFATDRRYDHCLRLNAGFGWN
                     EEVHDAIRLLARWVLENRTERPSGLMT"
     gene            complement(117829..118200)
                     /locus_tag="DDA3937_RS00505"
                     /old_locus_tag="Dda3937_01984"
                     /db_xref="GeneID:9731490"
     CDS             complement(117829..118200)
                     /locus_tag="DDA3937_RS00505"
                     /old_locus_tag="Dda3937_01984"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019845341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="drug:proton antiporter"
                     /protein_id="WP_033111500.1"
                     /db_xref="GI:696580321"
                     /db_xref="GeneID:9731490"
                     /translation="MTDAHYVLFYVDNPARSARFYSQLLELAPVEQSPTFAMFALKAD
                     LVLGLWSKHTVEPAVAQPGFSGELAFRLPDQAAVDACYARWTAQDVTVIQIPTTVDFG
                     YTFTVQDPDGHRLRVFAYPNA"
     gene            complement(118322..119023)
                     /locus_tag="DDA3937_RS00510"
                     /old_locus_tag="Dda3937_01985"
                     /db_xref="GeneID:9731491"
     CDS             complement(118322..119023)
                     /locus_tag="DDA3937_RS00510"
                     /old_locus_tag="Dda3937_01985"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.5 regulation; type of regulation;
                     transcriptional level; action unknown"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013315811.1"
                     /db_xref="GI:503080927"
                     /db_xref="GeneID:9731491"
                     /translation="MSRAQRLLALIQLLRSHRFAVPGPQLADKLGISLRTLYRDIATL
                     QSQGAPIIGEAGLGYVLQPGFTLPPLMFTDEEIEALVLGSRWVARQADPRLQEGARNA
                     LMKIAAVLPEALRDTLDGTTLLVAPTNQTARDSVDLQPLRQAIRDGRKVTLHYQDGQG
                     NTSTRLIWPFVLGYFEQVRVLGAWCETRQAFRHFRTDRILAFTVEADTYPVSRRRLFK
                     QWREQQGIQLPKEGY"
     gene            119187..120095
                     /locus_tag="DDA3937_RS00515"
                     /old_locus_tag="Dda3937_01986"
                     /db_xref="GeneID:9731492"
     CDS             119187..120095
                     /locus_tag="DDA3937_RS00515"
                     /old_locus_tag="Dda3937_01986"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylserine transporter"
                     /protein_id="WP_033111501.1"
                     /db_xref="GI:696580322"
                     /db_xref="GeneID:9731492"
                     /translation="MTIKDQLLALCVVVVWGVNFVVMKIGLHDMPPFLLAGLRFLLVA
                     LPAVLLVPRPALPLRWLAAYGMTISFGQFAFLFCAIKMGMPVGMASLVIQSQAFFTLM
                     LGAWWLGERLQWNQWLGILVAALGMVVLAEGNAANASLPGMTLTTLLLTLAAAASWAC
                     GNICNKQIMRHHPVNAMSLVVWSALIPVGPFLLCSWLFEGADTIVASLTSIRLPTVLA
                     LMYLSFISTLIGYAIWGNLLARYETWRVAPLSLLVPVVGILSAALLLGEHLSTGQLLG
                     ALLVMLGLLVNVFGARLWPLRSARQP"
     gene            120558..121163
                     /locus_tag="DDA3937_RS00520"
                     /old_locus_tag="Dda3937_01988"
                     /db_xref="GeneID:9731494"
     CDS             120558..121163
                     /locus_tag="DDA3937_RS00520"
                     /old_locus_tag="Dda3937_01988"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315814.1"
                     /db_xref="GI:503080930"
                     /db_xref="GeneID:9731494"
                     /translation="MKSYDDMQRFKDKAQIKDINFMDMSGQVLQSETVVWPIMKQLLR
                     NQTGDDTLSGAQPVSIAQPVPVSQHVLSAPASPRRVTPSSSLNVNADPSGGNQHSLFN
                     AIAASLPSAESVSAPAPQPIAPPTPVSQPQPAALTIETVPPATVRPHPLASAPAVSEA
                     SAASEAGRFRQLFSRHHHDEIHSVSKTMLLKPLLEKIALCR"
     gene            121154..121969
                     /locus_tag="DDA3937_RS00525"
                     /old_locus_tag="Dda3937_01989"
                     /db_xref="GeneID:9731495"
     CDS             121154..121969
                     /locus_tag="DDA3937_RS00525"
                     /old_locus_tag="Dda3937_01989"
                     /function="5.1 cell processes; cell division"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_013315815.1"
                     /db_xref="GI:503080931"
                     /db_xref="GeneID:9731495"
                     /translation="MPLVCVCSPKGGVGKTTMAANLAYALARGGSKVLAIDFDMQNAL
                     RLHFGVPLGDERGYVAKSGETADWSQSILTTDDNIFVLPYGNVTEDQRLAFEHNLASD
                     PLFLKRGLSTVMNYPGLVIVADFPPGPSPALKAMTDLADLHLVVMMADTASLSLMPHI
                     EGNKLTGQALNRRKGSYLLLNQTDNRRAISSQVSSFVQQRMPDKLIGSVHRDESVAEA
                     NASQRSIFDFSPVSAAAFDIELIGKRVAALLDIRIGNGEVHAEFPAYQAVPAS"
     operon          122078..131056
                     /operon="bcsABCD"
                     /db_xref="ASAP:ABF-0174118"
                     /db_xref="ERIC:ABF-0174118"
     gene            122078..>124084
                     /locus_tag="DDA3937_RS00530"
                     /old_locus_tag="Dda3937_01990"
                     /operon="bcsABCD"
                     /db_xref="GeneID:9731496"
     CDS             122078..>124084
                     /locus_tag="DDA3937_RS00530"
                     /old_locus_tag="Dda3937_01990"
                     /operon="bcsABCD"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012699190.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase"
                     /protein_id="WP_033112181.1"
                     /db_xref="GI:696581002"
                     /db_xref="GeneID:9731496"
                     /translation="MKKILFLTLLLLLLPVAAVIVITPMDSEKQYIFGLISLALMFLL
                     GLSKRRQVTIILIVLSVLTSTRYIYWRATETLHFNSEIEAILGIGLFIAELYVWVILI
                     LGFLQTAWPLERVIEPMPEDTGLWPTVDVYIPTYNESLDVVRDTVLAAQCIDYPRDKM
                     KIYLLDDGRRSEFAVFASQAGVGYITRDNNAHAKAGNLNHALKLTQGDLICVFDCDHV
                     AKRIFLQATVGPFLSDPKLALLQTPHYFYSPDPFERNLRAARDMPNEGALFYGPVQQG
                     NDLWNAAFFCGSCAVIRRAALDEIGGFAVETVTEDAHTAIKMQRKGWKSAFLSIPLAA
                     GLATERLVLHVIQRTRWARGMTQIFRVDNPLLGRGLTWQQRLCYLNAMLHFQFGLPRV
                     VFLTAPLAYLLFNLNIIHASAAMIFAYALPHLVVSMYLNSRMNGRFRYSFWGEIYETV
                     MAFHLVIPTLVTLFSPTRGKFNVTDKGGLLDEGFFDFRIVRPHIVAAILLGAGVLAGI
                     TRIVAHDYFNVDPYVIVLNVVWALLSLLTLLAAIAVARETKQVRKTIRVDVDVPAIIH
                     YASGIASRATTINLSMGGVQLKAPDQRHKSDEIEAVELLLQSSEICLPVQLVAADDDI
                     IRLQFVDIPLAQRRALVRVVLSRADAWMNPPWPQDRPLRSLWAVV"
     gene            124165..126678
                     /locus_tag="DDA3937_RS00535"
                     /old_locus_tag="Dda3937_01991"
                     /operon="bcsABCD"
                     /db_xref="GeneID:9731497"
     CDS             124165..126678
                     /locus_tag="DDA3937_RS00535"
                     /old_locus_tag="Dda3937_01991"
                     /operon="bcsABCD"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase"
                     /protein_id="WP_033111502.1"
                     /db_xref="GI:696580323"
                     /db_xref="GeneID:9731497"
                     /translation="MMTPRFMKALLSLCVGSVLTLGGNGALAAGDAADEPLPAMLSPG
                     GGNPQPAATEPAPVTDSAPALAPAPTTALPTMPPITSPLISPETPSADVPPPPSLTTP
                     SMLLPAPVGDQTAAGYQPLSSSVSVAQMGQTHGITLAGGQAQAGVIFTLPGDQVVTNA
                     RLDLALRVSPELAALNTSMQLMLNGQPLGTVPLNAATGDSTLFQLDIPAAMVVSSNNL
                     SFRINDADRLLCERDSATRYNLTILPTTTLNLEGQQLDIGTRLENFPRPFIDPLQMTP
                     ATVPMVFPADVTPEQVGAASLVASWLGMRMDGYGVTFPVIRDALPEKSGMVFGRPGDK
                     VGTLTLPEVAGPTLQLIDNPVNPVYKLMLVVGKDDEQLRQAAYRLVSQPLTGDASTLS
                     VAQQTIPFRRAYDAPRWISTDRPVRLSELLRNDQSMTVSGLWHEALRINFRAAPDLFL
                     WDGDTIPVKVDYRFPSESWIDESRSYLNVMLNGTFLRNLTVNKVGVLQQLWREMGGDT
                     RQENYTLKVDPYLIYGYNQFQLYFNIRAKDDAPCSVLLNNNIKSQIADSASIDLSRTR
                     HFTLLPNLSYFVGVAFPFTRQADYAQTVMLLPEKPTNAEIGLLLDLAGRASDATGVSL
                     NHNRVMFGLPTNAADRQKLENSDVLAVTTLPQAAFNQHLLSGSPYTVNDRTFGVKEPG
                     AWERARTLLTGDWDRTPLDADRYFSSNEAWRGFLSYRSPWNPERVVVVATGSGDEQLL
                     RLYDDLNSPNINAAVRGDTAIITDENGVRSFRVGPQFPSGEMPWYMMIVWYANQHSVL
                     LALAALLLAAAVGLSLASILRRLAEKRLSTRRDAGSDKK"
     gene            126690..130586
                     /locus_tag="DDA3937_RS00540"
                     /old_locus_tag="Dda3937_01992"
                     /operon="bcsABCD"
                     /db_xref="GeneID:9731498"
     CDS             126690..130586
                     /locus_tag="DDA3937_RS00540"
                     /old_locus_tag="Dda3937_01992"
                     /operon="bcsABCD"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.6 metabolism; macromolecules (cellular
                     constituent) biosynthesis"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase operon protein C"
                     /protein_id="WP_013315818.1"
                     /db_xref="GI:503080934"
                     /db_xref="GeneID:9731498"
                     /translation="MKMTTLTARIRRSLSLTGVVVGGVLSASALAAQANPALQALFEQ
                     ADYWHQRSHDDLARDALQKILRVDADNPRALYLMALYAQNSGDGAEAAKWRERLSKAS
                     PQDPLLQALDNARQAATIPQAQLALARQQARSGNISAALQTWRNLFSGSQPPASIAAE
                     YYLTMAGDRTLLPQAIDHLREFAAAHPQDTNAAVALGKALTYQEPTRREGVQILSGLA
                     SGSADADQAMRQALLWLGPKADDAPFYQLYQQRHPQDTAVMDYYRKNVGGSEKDKGFT
                     ALNSGDLSNAQTAFSQVLQANPEDADALAGMGYAAQRRGDFAAAASYLERAARQGGEN
                     SAQRQQQADDARFYAQLANAQQAMKNGDTAQALTLSEPLAQAGGDKGLTAKLFRADVL
                     RRTNNFPQAERLYRDVLQTDADNRNAKEGLYYVLREQNRADEANTLFAALPENVRRSM
                     APRPVATSAPVRNEAKQALAAGDTVRAIGLLQQGIQRFPNDGWLKLDLARIYQQQGNM
                     AAATSLMQPLFRAGAGADDLYAAALFASENNAWQQASTLLSRIPPRNQNEDTRSLARR
                     VNFNLQMATAQVYLSRGENAAAANTLRALSVTPPDNPADAGKLAKSLAAAGDTAAAVA
                     VVRNNMQRGVQGNAGDYADQVGVLNQAGLSDEAQSWLSRPELVARSSATQLDGLRTGF
                     VVREADRLRENQQYAQAYDKLARALQRDPKNTDLMFAMARLYQSGKMNKEAADVYDYL
                     LSHDTPTQEARVGAINVALERHDANKAHALSTGLQGEQTPERLLLLARIADAEGNRDQ
                     AMAYLKTARSKAVGLEGAAPGAAPAIGGLAMTDNPFIDRSTPTATRVASSSSSYGSVM
                     PWQQRNGVATGDTAAGATTQQQAATLTQINGMMADLERDTGGWVQTGVQIRARDGESG
                     LSRLTEAKVPLTWSSGSFGDARINFSVTPMTLSAGTSSGDSNRQFGTGALAQVVNASA
                     QTLVNELGRNFNFSSLSSAQVLNILQNSTNKPNIDQVTVDSQGKQNASGAELNLSLIS
                     KNYKLDLGSTPLGQDLNTLVGGIQWSPKLTDFLTLVVTGERRAVTDSLLSYVGAKDAL
                     TGKRWGQVTKNGGNVLLSYDNGDIGFYGGGGAYSYLGENVKNNTGVMANAGAYIRPFH
                     DRDRELKTGVSLSWMNFSQNLGYYSYGQGGYFSPQDYVSVSLPVEWSQKYDDLSVKAG
                     VAVGYQSYSRDRSAYFPNNPDWQTLLESAESLGLAKESHYAGDSKSGIGYNVHVGADY
                     RVTKDVTVGGQMGYDTFGNYNETTARLYFRYGLGGK"
     gene            130589..131056
                     /locus_tag="DDA3937_RS00545"
                     /old_locus_tag="Dda3937_01993"
                     /operon="bcsABCD"
                     /db_xref="GeneID:9731499"
     CDS             130589..131056
                     /locus_tag="DDA3937_RS00545"
                     /old_locus_tag="Dda3937_01993"
                     /operon="bcsABCD"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.6 metabolism; macromolecules (cellular
                     constituent) biosynthesis"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulose synthase"
                     /protein_id="WP_013315819.1"
                     /db_xref="GI:503080935"
                     /db_xref="GeneID:9731499"
                     /translation="MSDLQQHALNYYRQQQLPSGWADLFGVIVNGMMDNAGEREGLAF
                     LRHIGGQLAERYPLPAAVTVVDLEREINRVLSLFHWGCVDLRPYENRLEIYHLALPAS
                     VNSSGSVRWRMAMAAVLQGLYSRWLREQGGVESVPLSCEETDSESTLLFRYQH"
     gene            131069..132067
                     /locus_tag="DDA3937_RS00550"
                     /old_locus_tag="Dda3937_01994"
                     /db_xref="GeneID:9731500"
     CDS             131069..132067
                     /locus_tag="DDA3937_RS00550"
                     /old_locus_tag="Dda3937_01994"
                     /function="7.5 location of gene products; extracellular"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="1.2.4 metabolism; macromolecule degradation;
                     polysaccharides"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P27032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoglucanase"
                     /protein_id="WP_013315820.1"
                     /db_xref="GI:503080936"
                     /db_xref="GeneID:9731500"
                     /translation="MGKPMWRCWALMLMVWFSASATAANGWEIYKSRFMTTDGRIQDT
                     GNKNVSHTEGQGFAMLMAVHYDDRIAFDNLWNWTQSHLRNTTSGLFYWRYDPSAANPV
                     VDKNNASDGDVLIAWALLKAGNKWQDNRYLQASDSIQKAIIASNIIQFAGRTVMLPGA
                     YGFNKNSYVILNPSYFLFPAWRDFANRSHLQVWRQLIDDSLSLVGEMRFGQVGLPTDW
                     AALNADGSMAPATAWPSRFSYDAIRIPLYLYWYDAKTTALVPFQLYWRNYPRLTTPAW
                     VDVLSSNTATYNMQGGLLAVRDLTMGNLDGLSDLPGASEDYYSSSLRLLVMLARGK"
     gene            132468..133754
                     /locus_tag="DDA3937_RS00555"
                     /old_locus_tag="Dda3937_01995"
                     /db_xref="GeneID:9731501"
     CDS             132468..133754
                     /locus_tag="DDA3937_RS00555"
                     /old_locus_tag="Dda3937_01995"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="4.2.A.23 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Dicarboxylate/Amino Acid:Cation (Na+ or H+) Symporter
                     (DAACS) Family"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.134 transport; substrate;
                     Na+/dicarboxylate"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315821.1"
                     /note="involved in the transport of C4-dicarboxylates
                     across the membrane; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_013315821.1"
                     /db_xref="GI:503080937"
                     /db_xref="GeneID:9731501"
                     /translation="MKKSIFKSLYFQVLAAITIGILLGHFYPALGQQMQPLGDGFVKL
                     IKMVIAPVIFCTVVTGIAGMESMKAVGRTGAVALLYFEVVSTLALIIGLVVVNVLQPG
                     AGMNVDPAALNVAAVANYATEAGKQGVVPFLMDVIPSSVIGAFASGNILQVLLFAVMF
                     GFALHRLGDKGVLIFDVIESFSKVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGTLVQ
                     LGQLIICFYITCILFVVLVLGSIARATGFSIFKFIRYIREELLIVLGTSSSESALPRM
                     LEKMEKLGCKKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLV
                     VLLLSSKGAAGVTGSGFIVLAATISAVGHLPLAGLALILGIDRFMSEARALTNLVGNG
                     VATVVVAKWCKQLDSKQMNDVLSGRNDGPAAESRPS"
     gene            134031..135494
                     /locus_tag="DDA3937_RS00560"
                     /old_locus_tag="Dda3937_01996"
                     /db_xref="GeneID:9731502"
     CDS             134031..135494
                     /locus_tag="DDA3937_RS00560"
                     /old_locus_tag="Dda3937_01996"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315822.1"
                     /db_xref="GI:503080938"
                     /db_xref="GeneID:9731502"
                     /translation="MQGTKFGLFVGGVLLATAVGNVQAEALQPDPAWQQGKLDNGFSW
                     QLLATPQRPSDRIELRLMINTGSLTENAQQTGFSHFIPRLALLPRDTFSAGQLPSLWQ
                     QSESETRPLPPATTSYDFTSYNLSLPNNRPDLLKDALSWLADTAGQLQINDKRIASAM
                     KMIDPVATAPTNPQDPSWRYRLKGSSLLSYAPGQPLKASVNAEQLSKYYKTWYTPDAM
                     TLYVVGNVDSRAIAEQIDRVFSPLQGKRVTPSPLPTLSAMPSTPISLMDSSVKQDILS
                     LVWDMPWQPIRDSQALARYWHSDLAREALFWHMQQVLTKSPLKDTNVRFDCNVVYGRA
                     QCAIHLDNVNVTSESAQAGVTFLSKELLALRDKGLSQAEFDALMARKTEELSKLFATY
                     ARASTDILMDQRLRSQKNGVVDIAPEQYQKLRQNYLSSVTLEMLNQELHQQLSQEATL
                     VMLQPQGEPEANMKALRETYMSIMQPDNGAASAAPAQ"
     gene            complement(135723..136748)
                     /locus_tag="DDA3937_RS00565"
                     /old_locus_tag="Dda3937_01997"
                     /db_xref="GeneID:9731503"
     CDS             complement(135723..136748)
                     /locus_tag="DDA3937_RS00565"
                     /old_locus_tag="Dda3937_01997"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyacid dehydrogenase"
                     /protein_id="WP_013315823.1"
                     /db_xref="GI:503080939"
                     /db_xref="GeneID:9731503"
                     /translation="MADNTPQAPQGEFVLFTSADGQTRVECRFESDTLWLSQAMIAEL
                     YGKAKATISEHIKNIFTEGELDENSVVRLYRTTAADGKSYNVQYFSLPLVLAVGYRVR
                     SSRGTQFRQWATQTLQEYLIKGFVMDDERLKNPPVGHSAVPDYFDEMLERIRDIRASE
                     RRVYLRVKEIFTMAADYEPSNQETNRFFQTIQNKLHYACTHMTAAELIASRVDASKPD
                     MGLTSYKGDEVRKTDVTIAKNYLREDEIKELNRIVNMWLDFAEDQALRRKQVFLQDWA
                     DKLDQFLSFNDRDVLSGAGKISKKDADDKAKVEFERFAAQRRRLKEAEGAQANIAALK
                     AILKKDK"
     gene            complement(136767..137036)
                     /locus_tag="DDA3937_RS00570"
                     /old_locus_tag="Dda3937_01998"
                     /db_xref="GeneID:9731504"
     CDS             complement(136767..137036)
                     /locus_tag="DDA3937_RS00570"
                     /old_locus_tag="Dda3937_01998"
                     /function="0 unknown function"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system
                     restriction subunit"
                     /protein_id="WP_013315824.1"
                     /db_xref="GI:503080940"
                     /db_xref="GeneID:9731504"
                     /translation="MGDEPGRRNFANGTIARVTENPIVVEQVEKHDKTIALKGDLPQA
                     VKQAVVQALLKEGDIARTLLKDPQVMASYVELIFDMMKQRSRATQ"
     gene            complement(137428..137928)
                     /locus_tag="DDA3937_RS00575"
                     /old_locus_tag="Dda3937_02000"
                     /db_xref="GeneID:9731506"
     CDS             complement(137428..137928)
                     /locus_tag="DDA3937_RS00575"
                     /old_locus_tag="Dda3937_02000"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module antitoxin"
                     /protein_id="WP_013315826.1"
                     /db_xref="GI:503080942"
                     /db_xref="GeneID:9731506"
                     /translation="MKVTKLDNQLLEKATDIFAKLGLPIEQAINVFLAKSVQAKGFPF
                     SVALESESQPEGSSQSKITNAEITEVIHDLVENTLPLSEIENLTQLTYCRNTFGLSFP
                     VLKLAKSPRPEDIRSAAKDAKERNRYSTTRVAQRADKTYVICTQWTDRHRNAFCRWQG
                     IFSHNE"
     gene            complement(138241..139173)
                     /locus_tag="DDA3937_RS00580"
                     /old_locus_tag="Dda3937_02001"
                     /db_xref="GeneID:9731507"
     CDS             complement(138241..139173)
                     /locus_tag="DDA3937_RS00580"
                     /old_locus_tag="Dda3937_02001"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848367.1"
                     /note="catalyzes the formation of
                     2-dehydro-3-deoxy-D-gluconate-6-phosphate from
                     2-dehydro-3-deoxy-D-gluconate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketodeoxygluconokinase"
                     /protein_id="WP_013315827.1"
                     /db_xref="GI:503080943"
                     /db_xref="GeneID:9731507"
                     /translation="MTTKNIAIIGECMIELSQKGADLNRGFGGDTLNTAVYISRQVKP
                     DALDVHYVTALGTDSFSSEMMASWQKEGVKTDLIQRLDNKLPGLYFIETDATGERTFY
                     YWRNDAAARYWLESPDADTISQQLAQFDYIYLSGISLAILNQASRARLLTVLRACRAN
                     GGKVIFDNNYRPRLWQSKEETRQAYSDMLACTDIAFLTLDDEDMLWGELPVDEVLKRT
                     HGAGVMEVVIKRGADACLVSIQGEALLEVPAIKLPKEKVVDTTAAGDSFSAGYLSVRL
                     NGGSAQDAAKRGHLTASTVIQYRGAIIPLEAMPA"
     gene            complement(139357..139560)
                     /locus_tag="DDA3937_RS00585"
                     /old_locus_tag="Dda3937_02002"
                     /db_xref="GeneID:9731509"
     CDS             complement(139357..139560)
                     /locus_tag="DDA3937_RS00585"
                     /old_locus_tag="Dda3937_02002"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P45418.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tautomerase"
                     /protein_id="WP_013315829.1"
                     /db_xref="GI:503080945"
                     /db_xref="GeneID:9731509"
                     /translation="MPFVNIRITKDGVTAEQKKQLIAGVTQLLVDTLGKNPATTVVII
                     DEVETDNWGIGGESVTERRQQAS"
     gene            complement(139606..140592)
                     /locus_tag="DDA3937_RS00590"
                     /old_locus_tag="Dda3937_02003"
                     /db_xref="GeneID:9731510"
     CDS             complement(139606..140592)
                     /locus_tag="DDA3937_RS00590"
                     /old_locus_tag="Dda3937_02003"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P45417.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013315830.1"
                     /db_xref="GI:503080946"
                     /db_xref="GeneID:9731510"
                     /translation="MPVKPNQPRPSTKQDPSSGASRQRFGYVTGWLHRIRSVPAIAHF
                     IRAGDRFNDRMGNQFGAAITYFSFLSLIPILMVSFATAGFVLASNPDLLTGLINRIVN
                     SISDPSLARTLKNTVNTAVRQRTTVGLTGLLIALYSGVNWIGNLREAIHAQSRDVWER
                     QPHEEEKIYLRYLWDFLSLIGLLLALVITLFLTSVAGSAQATIVRALGLNGIDWLRPV
                     MTLIALSISIFANYLLFLWILWVLPRHNPRRGPLLRGTLMAAIGFEALKFAMTVALPE
                     LATSPSGAAFGSVIGLMTFFYFFARLTLFCAAWIATADPKTDINTQAPLPGA"
     gene            140798..142021
                     /locus_tag="DDA3937_RS00595"
                     /old_locus_tag="Dda3937_02004"
                     /db_xref="GeneID:9731511"
     CDS             140798..142021
                     /locus_tag="DDA3937_RS00595"
                     /old_locus_tag="Dda3937_02004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111503.1"
                     /db_xref="GI:696580324"
                     /db_xref="GeneID:9731511"
                     /translation="MPVSTPPVSTPPKPSPGGLRLNLRIMSVVMFNFASYLNIGLPLA
                     VLPGYVHEHLGFSAFWAGLVISLQYFSTLLSRPRAGRHADEKGPKQVVVFGLSGVLLS
                     GVFYALAAWNDGSPVLALALLCVGRLVLGIGQSFAGTGATLWGVGVVGSLHIGRVISW
                     NGVATYGAMAIGAPLGVWIYHLGGLRLLAIVIVLVAGAAILLALPRPAVTVTPGKKLP
                     FREVLGKVWLYGVILSLASAGFGVISTFITLFYASRQWDGAALTLSLFSCAFVGTRLL
                     FPNVINRFGGLRVALACFLVESAGLLLVWLASHPLMAEAGAFFAGAGFSLVFPALGVV
                     AVKAVSAQNQGSALATYTIFLDLSLGVVGPAAGVMMAYTDIDAIYLAAAGLALVGLLL
                     TVRLYQRGGRDAKAV"
     gene            complement(142077..142640)
                     /locus_tag="DDA3937_RS00600"
                     /old_locus_tag="Dda3937_02005"
                     /db_xref="GeneID:9731512"
     CDS             complement(142077..142640)
                     /locus_tag="DDA3937_RS00600"
                     /old_locus_tag="Dda3937_02005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019845358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DcrB protein"
                     /protein_id="WP_033111504.1"
                     /db_xref="GI:696580325"
                     /db_xref="GeneID:9731512"
                     /translation="MPNLAKYIGIGLLAATLAACDGNSDKKTSAPAASPAAEKTTAQN
                     VSLLSGKLTFTLPDGLSDQSGKLGNQNNNMHVYADQSGQKAIIVIVGDDTPLDLPALG
                     QRLEQQQRGRDANLQVLGNKTAEINGHQIQQLDSVLTSNGQKAFSSIVLAKADSRLLT
                     LQITLPADNLQQAQADAGKIINTLKLN"
     gene            complement(142826..143497)
                     /locus_tag="DDA3937_RS00605"
                     /old_locus_tag="Dda3937_02006"
                     /db_xref="GeneID:9731513"
     CDS             complement(142826..143497)
                     /locus_tag="DDA3937_RS00605"
                     /old_locus_tag="Dda3937_02006"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013315833.1"
                     /db_xref="GI:503080949"
                     /db_xref="GeneID:9731513"
                     /translation="MFQFSAQQRLTALCWLSLFHILVIISSNYLVQLPITLFGFHTTW
                     GAFTFPFIFLASDLTVRIFGAPLARRIILTVMVPALVASYLVSSLFYKGEWQGFSALS
                     QVNPMVARIAAASLMAYLLGQILDVQVFNRLRRLKAWWVAPAASAVLGNLSDTVAFFF
                     IAFYRSTDPFMATHWMEIATVDYFFKIAINLIFFLPMYGVLLNMVLRRLSQPGSNAPY
                     QDQTA"
     gene            144107..144352
                     /locus_tag="DDA3937_RS00610"
                     /old_locus_tag="Dda3937_02007"
                     /db_xref="GeneID:9731514"
     CDS             144107..144352
                     /locus_tag="DDA3937_RS00610"
                     /old_locus_tag="Dda3937_02007"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315834.1"
                     /note="TusA; transfers sulfur to TusBCD complex; involved
                     in thiouridation of U34 position of some tRNAs; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_013315834.1"
                     /db_xref="GI:503080950"
                     /db_xref="GeneID:9731514"
                     /translation="MTDIFANPDRTLDAQGLRCPEPVMMVRKTVRQMDAGQTLLILAD
                     DPATTRDIPGFCRYMEHELLAQMTEQLPYRYLLRKGA"
     gene            complement(144435..145064)
                     /locus_tag="DDA3937_RS00615"
                     /old_locus_tag="Dda3937_02008"
                     /db_xref="GeneID:9731515"
     CDS             complement(144435..145064)
                     /locus_tag="DDA3937_RS00615"
                     /old_locus_tag="Dda3937_02008"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013315835.1"
                     /db_xref="GI:503080951"
                     /db_xref="GeneID:9731515"
                     /translation="MLWSFIAVFFSGWLYVDASYRGPVWQRWLFKPVTLLLMMLMVWQ
                     TPMLGIPGYLVVLGLAATLIGDALMQLSGDRLRFALSTYLASHLLYTISFFASRPSLG
                     FFWPLPLTLLILSALLLALLWSRLEAERLTVTALVLVTAFMAWVAGEHYFALGNESNF
                     SLLLGTLLLFAGHAIWLVNHFRVNFRAHQALVAICYFGGHFLIVRSLYV"
     gene            145336..145662
                     /locus_tag="DDA3937_RS00620"
                     /old_locus_tag="Dda3937_02009"
                     /db_xref="GeneID:9731516"
     CDS             145336..145662
                     /locus_tag="DDA3937_RS00620"
                     /old_locus_tag="Dda3937_02009"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019845362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315836.1"
                     /db_xref="GI:503080952"
                     /db_xref="GeneID:9731516"
                     /translation="MSNEPVLYRIQFINNGKNYQLYVRELVQSNLFGFIEIADFVFDN
                     PSTVLVDPTTEKLKTEFAGVDRSYIPLQAVIRIDAVTGRERDSARISELGDNVTHFPS
                     LPGKKP"
     gene            complement(145723..146004)
                     /locus_tag="DDA3937_RS00625"
                     /old_locus_tag="Dda3937_02010"
                     /db_xref="GeneID:9731517"
     CDS             complement(145723..146004)
                     /locus_tag="DDA3937_RS00625"
                     /old_locus_tag="Dda3937_02010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033112182.1"
                     /db_xref="GI:696581003"
                     /db_xref="GeneID:9731517"
                     /translation="MWINLGRLLMLGIWGFLVMNLIHPFPRPLNIFMILAMGFMLLMH
                     GVQFLLLKASQPKDAPPLSGLLQLRIFLFGVFELLDWQRKQPAPPRKRR"
     gene            complement(145994..146617)
                     /gene="rsmD"
                     /locus_tag="DDA3937_RS00630"
                     /old_locus_tag="Dda3937_02011"
                     /db_xref="GeneID:9731518"
     CDS             complement(145994..146617)
                     /gene="rsmD"
                     /locus_tag="DDA3937_RS00630"
                     /old_locus_tag="Dda3937_02011"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315838.1"
                     /note="catalyzes the methylation of 16S rRNA at position
                     G966; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_013315838.1"
                     /db_xref="GI:503080954"
                     /db_xref="GeneID:9731518"
                     /translation="MVKHQATSAPGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETL
                     FNWLAPVIQQSRCLDCFAGSGALGLEALSRYAAHATLLEAERNVARQLTQNLSLLRAD
                     NAEVVNADTLQWLAKPASAQPYDVVFLDPPFRRGLLDDTLRLLETGGWLAQETWIYIE
                     TEAENRTLAIPPTWTLHREKTAGQVSYRLYIRHASDAASGGNDEHLD"
     gene            146929..148269
                     /locus_tag="DDA3937_RS00635"
                     /old_locus_tag="Dda3937_02012"
                     /db_xref="GeneID:9731519"
     CDS             146929..148269
                     /locus_tag="DDA3937_RS00635"
                     /old_locus_tag="Dda3937_02012"
                     /function="5.1 cell processes; cell division"
                     /function="4.3.A.5 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The Type II (General) Secretory Pathway
                     (IISP) Family"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsY"
                     /protein_id="WP_013315839.1"
                     /db_xref="GI:503080955"
                     /db_xref="GeneID:9731519"
                     /translation="MAKEKKRGFFSWLGLGRQDEDKTEQPQPAPEAPQADDATPAAPE
                     PAQNTSDEAPEQPAPNNTALAETGETPAPESQPTETAAEIPPTPVEPPETVALVAEPT
                     ADAEPQTDTVAEDGVEPEPETVIVPAAPVVSQEQERPTKEGFFARLKRSLVKTRQNLG
                     SGFVGLFRGKKIDDDLFDELEEQLLIADVGVETTRKIIDRLTEHASRKQLKDAEALIA
                     LLKAEMSDILAKVDAPLDIDSKTPFVILMVGVNGVGKTTTIGKLARQYQAQGKSVMLA
                     AGDTFRAAAVEQLQVWGQRNNVPVVAQHTGADSASVIFDALQAARARGVDVLIADTAG
                     RLQNKSHLMEELKKIVRVMKKLDENAPHEVMLTLDASTGQNAVSQAKLFNETVGLSGI
                     TLTKLDGTAKGGVIFAIADQFGIPIRYIGVGESIDDLRPFKADDFIEALFARED"
     gene            148275..148943
                     /locus_tag="DDA3937_RS00640"
                     /old_locus_tag="Dda3937_02013"
                     /db_xref="GeneID:9731520"
     CDS             148275..148943
                     /locus_tag="DDA3937_RS00640"
                     /old_locus_tag="Dda3937_02013"
                     /function="5.1 cell processes; cell division"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="4.3.A.5 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The Type II (General) Secretory Pathway
                     (IISP) Family"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848356.1"
                     /note="ATP-binding protein of an ATP-binding cassette
                     transporter; when bound to FtsX, FtsEX localizes to the
                     cell division site and plays a role in the assembly or
                     stability of the septal ring under low-salt growth
                     conditions; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsE"
                     /protein_id="WP_013315840.1"
                     /db_xref="GI:503080956"
                     /db_xref="GeneID:9731520"
                     /translation="MIRFEQVSKAYLGGRQALQGVDFHIRPAEMVFLTGHSGAGKSTL
                     LKLICGIERPSAGHILFGGHDISRLKKSEVPFLRRQIGMIFQDHHLLMDRTVYENVAM
                     PLIIAGASAEDIRRRVSAALDKVGLLDKARSYPIQLSGGEQQRVGIARAVVNKPAVLL
                     ADEPTGNLDEALSEGILRLFEEFNRVGVTVLMATHDTGLIARRHYRVLTLSQGRMLGG
                     HDGE"
     gene            148933..149904
                     /gene="ftsX"
                     /locus_tag="DDA3937_RS00645"
                     /old_locus_tag="Dda3937_02014"
                     /db_xref="GeneID:9731521"
     CDS             148933..149904
                     /gene="ftsX"
                     /locus_tag="DDA3937_RS00645"
                     /old_locus_tag="Dda3937_02014"
                     /function="7.3 location of gene products; inner membrane"
                     /function="5.1 cell processes; cell division"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315841.1"
                     /note="ABC transporter, membrane protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsX"
                     /protein_id="WP_013315841.1"
                     /db_xref="GI:503080957"
                     /db_xref="GeneID:9731521"
                     /translation="MANNTRAQRAGSKTKTRSLQGGWQEQWRYAWANTLRDMLRQPLA
                     TLLTIMVIAISLTLPSICYLVWKNVSQAASQWYPTPQLTVYLDKSLDDNAAEAVIGKI
                     KAEEGVDKVNYLSRNEAMGEFRNWSGFGGALDMLEENPLPAVAVVSPKLGFQNNQTLN
                     TLRDRIAAVQGVDEVRMDDSWFSRLVALTGLVGQIAATIGILMVVAVFLVIGNSVRLS
                     IFSRRDTINVMKLIGATDGFILRPFLHGGALLGLCGAVLSLILSQALVWKLSGAVAQV
                     AAVFGTTFTVRGLGWDETLLLILIAVMIGWLAAWLATVQHLRRFTPE"
     gene            150265..151122
                     /locus_tag="DDA3937_RS00650"
                     /old_locus_tag="Dda3937_02015"
                     /db_xref="GeneID:9731522"
     CDS             150265..151122
                     /locus_tag="DDA3937_RS00650"
                     /old_locus_tag="Dda3937_02015"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.1 regulation; type of regulation;
                     transcriptional level; sigma factors, anti-sigmafactors"
                     /function="5.5.2 cell processes; adaptation to stress;
                     temperature extremes"
                     /function="3.3.3 regulation; genetic unit regulated;
                     stimulon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011409952.1"
                     /note="binds with the catalytic core of RNA polymerase to
                     produce the holoenzyme; this sigma factor is responsible
                     for the expression of heat shock promoters; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-32"
                     /protein_id="WP_013315842.1"
                     /db_xref="GI:503080958"
                     /db_xref="GeneID:9731522"
                     /translation="MTKDMQTFALVPQGSLEGYIRAANAYPMLTAEEERALAERLHYH
                     GDLDAAKQLILSHLRFVIHVARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLV
                     SFAVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVELVARE
                     LGVTSKDVREMESRMAAQDMTFDPSPEDDAQPGQPMAPMLYLQDKSSDFADGIEEDNW
                     ETHAADKLTYALEGLDERSQHIIRARWLDDDNKSTLQELADHYGVSAERVRQLEKNAM
                     KKLRAAIEA"
     gene            complement(151241..151678)
                     /locus_tag="DDA3937_RS00655"
                     /old_locus_tag="Dda3937_02016"
                     /db_xref="GeneID:9731523"
     CDS             complement(151241..151678)
                     /locus_tag="DDA3937_RS00655"
                     /old_locus_tag="Dda3937_02016"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_013315843.1"
                     /db_xref="GI:503080959"
                     /db_xref="GeneID:9731523"
                     /translation="MRLSVERLTKISEQDRHDLAFIWPHQNFDALERDLNHEHRLFAA
                     RFNDRLLAGVIVEIDNNSDSAELTDLQVRTSTRRHGVGKYLVEEVLRACPDVKEWWLD
                     AADHALVSEAVMDTFMQSCGFYPVSGGWEYVVNQEKEMNREEK"
     gene            152082..153194
                     /locus_tag="DDA3937_RS00660"
                     /old_locus_tag="Dda3937_02017"
                     /db_xref="GeneID:9731524"
     CDS             152082..153194
                     /locus_tag="DDA3937_RS00660"
                     /old_locus_tag="Dda3937_02017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315844.1"
                     /note="with LivFGHM is involved in the high affinity
                     leucine transport; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_033111505.1"
                     /db_xref="GI:696580326"
                     /db_xref="GeneID:9731524"
                     /translation="MKLSKGKALLVGCLAAAMSHAVNAADIKVAIVGAMSGPVAQYGD
                     MEFTGARQAIADINAKGGVNGNKLVGVEYDDACDPKQAVAVANKVINDGIHYVIGHLC
                     SSSTQPASDIYEDEGVIMITPAATAPDLTTRGYKLVMRTTGLDSDQGPTAAKYILEHV
                     KPQRIAVVHDKQQYGEGLARAVQDSLKKSKANVVLFEGVTAGDKDFSTLVARLKKENV
                     DFVYFGGYYPEMGQILRQARAAGLTTKFMGPEGVGNSSLSNIAGAASEGMLVTLPKRY
                     DQVPTNQPIVDALKAKKLDPTGPFVWTTYAALQSLTTAMQRTGSTEPAKLAADLKAKS
                     VDTVMGPLSWDEKGDLKGFEFGVFEWHADGTSSPVK"
     gene            153273..154199
                     /locus_tag="DDA3937_RS00665"
                     /old_locus_tag="Dda3937_02018"
                     /db_xref="GeneID:9731525"
     CDS             153273..154199
                     /locus_tag="DDA3937_RS00665"
                     /old_locus_tag="Dda3937_02018"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="4.S.108 transport; substrate;
                     L-leucine/L-valine/L-iso-leucine"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.5.1.18 metabolism; building block
                     biosynthesis; amino acids; isoleucine/valine"
                     /function="1.5.1.19 metabolism; building block
                     biosynthesis; amino acids; leucine"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006659036.1"
                     /note="LivHMGF is the membrane component of the LIV-I/LS
                     branched-chain amino acid transporter; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transporter permease
                     subunit LivH"
                     /protein_id="WP_013315845.1"
                     /db_xref="GI:503080961"
                     /db_xref="GeneID:9731525"
                     /translation="MSEQFLYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHG
                     EVYMIGSYVSFIVIAALMMMGIDAGWLLIGVAFIAAVVISSAYGWSIERVAYKPVRNS
                     KRLIALISAIGMSIFLQNYVSLTQGSRDVALPSLIHGQWVLGESNGFAATLSSMQLTI
                     WIVTFLAMLALTLFIRYSRMGRACRACAEDLKMASLLGISTDRVISLTFVIGAVMAAV
                     AGVLLGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLVLGIAEALTSAYLS
                     TEYKDVVSFALLIGVLLVMPTGILGRPEVEKV"
     gene            154196..155470
                     /gene="livM"
                     /locus_tag="DDA3937_RS00670"
                     /old_locus_tag="Dda3937_02019"
                     /db_xref="GeneID:9731526"
     CDS             154196..155470
                     /gene="livM"
                     /locus_tag="DDA3937_RS00670"
                     /old_locus_tag="Dda3937_02019"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="4.S.108 transport; substrate;
                     L-leucine/L-valine/L-iso-leucine"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.5.1.18 metabolism; building block
                     biosynthesis; amino acids; isoleucine/valine"
                     /function="1.5.1.19 metabolism; building block
                     biosynthesis; amino acids; leucine"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848349.1"
                     /note="Part of the ABC transporter complex LivFGHMJ and
                     LivFGHMK involved in the high-affinity transport of
                     branched-chain amino acids; LivFGHMK is specific for the
                     transport of leucine, while LivFGHMJ is a transporter for
                     leucine, isoleucine, and valine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine/isoleucine/valine transporter permease
                     subunit"
                     /protein_id="WP_013315846.1"
                     /db_xref="GI:503080962"
                     /db_xref="GeneID:9731526"
                     /translation="MKLHTLVNAVVSALVLLVLATFVMGMQLSLDGTQLVVHGAEKVR
                     WMWIIAACVLVFLFQLLRPVLAQGAKKVSGPGLVLPSFDGSTPRQKLLALALIIAAVA
                     WPFVVSRGTVDIATLTMIYIILGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLSHYY
                     GLGFWQCLPLAGLTAALSGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTGFTGG
                     PNGISQIPKPTFFGLEFSRSPREGGWDTFHHFFGLTYDPSDRIIFLYMVALLLVLLTL
                     FVINRLLRMPLGRAWEALREDEIACRSLGLSPTKIKLTAFTISAAFAGFAGTLFAARQ
                     GFVSPESFTFVESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDLNEYSMLLLGA
                     LMVLMMIWRPQGLLPMKRTQIKLQVEKKEEQA"
     gene            155467..156237
                     /gene="livG"
                     /locus_tag="DDA3937_RS00675"
                     /old_locus_tag="Dda3937_02020"
                     /db_xref="GeneID:9731527"
     CDS             155467..156237
                     /gene="livG"
                     /locus_tag="DDA3937_RS00675"
                     /old_locus_tag="Dda3937_02020"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="4.S.108 transport; substrate;
                     L-leucine/L-valine/L-iso-leucine"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="1.5.1.18 metabolism; building block
                     biosynthesis; amino acids; isoleucine/valine"
                     /function="1.5.1.19 metabolism; building block
                     biosynthesis; amino acids; leucine"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012772850.1"
                     /note="Part of the ABC transporter complexes LivFGHMJ and
                     LivFGHMK involved in the high-affinity transport of
                     branched-chain amino acids; LivFGHMK is specific for the
                     transport of leucine, while LivFGHMJ is a transporter for
                     leucine, isoleucine, and valine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_013315847.1"
                     /db_xref="GI:503080963"
                     /db_xref="GeneID:9731527"
                     /translation="MSTQPLLSVRGLMMRFGGLLAVNNVELDLHQGEIVSLIGPNGAG
                     KTTVFNCLTGFYRPTGGTILLRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENL
                     LVAQHQHLKSGVFAGLLKTPAFRRAEADAQQRAAVWLERVGLLELANRQAGNLAYGQQ
                     RRLEIARCMVTRPELLMLDEPAAGLNPKETEELNELIIDLRGNHQVSVLLIEHDMKLV
                     MGISDRIYVVNQGTPLANGTPAEIRNNPDVVRAYLGEG"
     gene            156244..156945
                     /gene="livF"
                     /locus_tag="DDA3937_RS00680"
                     /old_locus_tag="Dda3937_02021"
                     /db_xref="GeneID:9731528"
     CDS             156244..156945
                     /gene="livF"
                     /locus_tag="DDA3937_RS00680"
                     /old_locus_tag="Dda3937_02021"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="4.S.108 transport; substrate;
                     L-leucine/L-valine/L-iso-leucine"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="1.5.1.18 metabolism; building block
                     biosynthesis; amino acids; isoleucine/valine"
                     /function="1.5.1.19 metabolism; building block
                     biosynthesis; amino acids; leucine"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014542670.1"
                     /note="with LivGHMJ and LivGHMK is part of the
                     high-affinity branched-chain amino acid transport system;
                     LivFGHMK is specific for the transport of leucine, while
                     LivFGHMJ is a transporter for leucine, isoleucine, and
                     valine; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_013315848.1"
                     /db_xref="GI:503080964"
                     /db_xref="GeneID:9731528"
                     /translation="MLSLNQVSAHYGKIQALHQVSLHINQGEIVTLIGANGAGKTTLL
                     GTLCGEPRASEGSIVFDGKDITDWQTARIMREAIAIVPEGRRVFSRMTVEENLAMGGF
                     FASREQYQQRIARVYDLFPRLYERRIQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEP
                     SLGLAPIIILQIFDTIQQLREEGMTIFLVEQNANQALRLADRGYVLENGRVVLEDTGD
                     ALLANEAVRSAYLGG"
     gene            157016..158200
                     /locus_tag="DDA3937_RS00685"
                     /old_locus_tag="Dda3937_02022"
                     /db_xref="GeneID:9731529"
     CDS             157016..158200
                     /locus_tag="DDA3937_RS00685"
                     /old_locus_tag="Dda3937_02022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_033111506.1"
                     /db_xref="GI:696580327"
                     /db_xref="GeneID:9731529"
                     /translation="MSTDGLLAQRMARLKSSAIRELLKHSKMDGVISLAGGIPSDALF
                     DFQGLNEATQLAITEQPKSAFQYGLTEGSPLLRERIAELCALRGVHTQAQDIVVTAGS
                     QQALDLVMRATTNPQDIFVVERPTYLAALQTLELAEAQVMSVSSDENGMVVDELAALL
                     ETTRIKGVYLVPNFGNPSGVTLSDARRRQLVALAARHDFLIVEDDPYGELRFTEERHA
                     TLYQLAKEAGHADRVVYTSSFSKILAPGLRLGWAILPDWLLHKVAIIKQAADLHASSL
                     SQTIVEYYLGTGRLPAQIDKIRQAYRQKGELLSELMASELGDVLSFNQPKGGMFLWAR
                     FRQPFDTTAWLQKTLAQGVVFVPGEFFFADNPDQSTLRLSFATATEEQMHEAVARLRR
                     AL"
     gene            complement(158331..159968)
                     /locus_tag="DDA3937_RS00690"
                     /old_locus_tag="Dda3937_02023"
                     /db_xref="GeneID:9731530"
     CDS             complement(158331..159968)
                     /locus_tag="DDA3937_RS00690"
                     /old_locus_tag="Dda3937_02023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_033111507.1"
                     /db_xref="GI:696580328"
                     /db_xref="GeneID:9731530"
                     /translation="MNLFKKMKLGTLLSISFAAVIIIGFLVASFGRFQLHQLSGNIET
                     LAQNRLVKLVLIHNYKDNINIVANAIRNMVMMTDQAQMAAESKRIRETIDKSTEIINT
                     FSNMTVSPDAKVLLKHLENVRPENIQALKKAEALALENRDEEAKAVILNEFQPAQNKV
                     FNAIDDIINYQKNATADLAHSSEQRADSAGQTMLVLALIAMAIGCLVAWFITRQVRSK
                     LGGEPADAASIAQQIAQGNLITTIPIRDKDSGSVLAAIDQMRGGLINIVEQVSQSSHA
                     IASGANEIAAGTNDLSQRTEEQAASLQQTAASMEQISNAVSHNVETIRMAAELANATS
                     QTASKGNQVVGDVVATMADITQSSHQIVEIISLIDNIAFQTNILALNAGVEAARAGEE
                     GKGFAVVAHEVRSLAQHSASAAREIKSLIIESVKKIETGADRVNLAGSTISELLEQSR
                     QVAQLINEIGITTNEQQQGIAQINTAIAQLDQVTHQNAALVEESACATDNLNHQAAHL
                     VEVISVFVVDDVISRKRLDTPDEHSLVPVAGQQLATH"
     gene            160727..161644
                     /locus_tag="DDA3937_RS00695"
                     /old_locus_tag="Dda3937_02024"
                     /db_xref="GeneID:9731531"
     CDS             160727..161644
                     /locus_tag="DDA3937_RS00695"
                     /old_locus_tag="Dda3937_02024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein TolA"
                     /protein_id="WP_033111508.1"
                     /db_xref="GI:696580329"
                     /db_xref="GeneID:9731531"
                     /translation="MTSPISFNRSAAGTSAQNARTDNDAGSTARAGAQADASQEQPSV
                     TSVLVQFSDEVRKRIDSAMRTNMSKINESKQDLARGRIEEIKRRIQMLKMMMMMSPGQ
                     SVPPGVLREIRQLAAELGQAAKTLNDGGGNGAANAGTAGGEGSSGAVANGVGDASASA
                     LSGAMSVSAAGENASAESDGLADEDQAVGASPAAKSGEEASAQEAEQLQNVVAAITER
                     GAGSQQRRMDAKSVQDAVRELKSLLAMVKNASKNDDKEAQKQIQAINQSIADIEKTVQ
                     SMNMTGGGADISVDLSVGPAGNVSIDVQV"
     gene            complement(161743..163362)
                     /locus_tag="DDA3937_RS00700"
                     /old_locus_tag="Dda3937_02025"
                     /db_xref="GeneID:9731532"
     CDS             complement(161743..163362)
                     /locus_tag="DDA3937_RS00700"
                     /old_locus_tag="Dda3937_02025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_033111509.1"
                     /db_xref="GI:696580330"
                     /db_xref="GeneID:9731532"
                     /translation="MQILKNMKLGAMLGSGFILVILIGFIVAIFGRSQLIHVGNNLDY
                     LSNIRLNNLIAMQEIKDNLNAAARIIRESAIQTDAAHLAQEKHDLEQLIDRNNDLLRQ
                     LDEKLKLKKSRELLAQINQARPPYSNAVRKVIELSLSGQQEQARALILGDLLTTQTTL
                     FNAMDTMITEHKNDTIAMSQRFMADASYSGTLLLIVTAISALLGALVAWLITRRVKGQ
                     LGGEPTYASHIAQQVAQGDLSIDVMLKTSDHHSLLAAMRTMRDSLSHIVSQVRQSSES
                     IATGSQQIAIGNADLSQRTEEQAASLQQTAASMEQISQTIRQNGDTVREAAQLATTAS
                     QTAAKGSEVVSDVIRTMEEITSSSRKIGDIISVIDGIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRSLAQRSASAAREIKELITESMEKVESGSQRVGHAGVTMEEIVSQAH
                     HVAELIKEIGVTTTEQESGIGQIHQAVSQLDQVTQQNAALVEQSASAADSLNAQAGHL
                     VQLMNVFVLDGHAAQPQRSHGGDWRLALASR"
     gene            complement(163808..165436)
                     /locus_tag="DDA3937_RS00705"
                     /old_locus_tag="Dda3937_02026"
                     /db_xref="GeneID:9731533"
     CDS             complement(163808..165436)
                     /locus_tag="DDA3937_RS00705"
                     /old_locus_tag="Dda3937_02026"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_013315853.1"
                     /db_xref="GI:503080969"
                     /db_xref="GeneID:9731533"
                     /translation="MRFFKEMKLGSMLGTGFAMVIVIGFLVAIYGQLQLRQLSTNIQT
                     LSKERITNLLLIQEYKDNLNIAARVIRNIALLSDHQQMTFEKQRLDNMAPRNDDIIAI
                     LHKVAVTPEQQALIAQLDQNRPVYEDAVGRAIEKGLENKDDDARNLILTDVRRAQENM
                     FKVIDSLLAYQKSATSTTADDSESRASNAGILMLSLAALIAVTGSLIAWLITRRIKGQ
                     LGGEPTYASHIAQQVAQGDLSVDVMLKTRDHHSLLAAMRTMRDSLSHIVSQVRQSSES
                     IATGSQQIAMGNADLSQRTEEQAASLQQTAASMEQISQTIRQNGETVREAAQLATTAS
                     DTAAKGSEVVSNVIRTMGDITASSRKIGDIISVIDSIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRSLAQRSASAAREIKELITESMEKVESGSQLVGHAGTTMDDIVTQAR
                     HVADLIKEIGVTTTEQESGISQINLAVNQLDQVTQQNAALVEQSASAADSLSDQARHL
                     VQLMNVFVVAGNNRQDEHAAYPPRADLRLALTSG"
     gene            complement(166251..167912)
                     /locus_tag="DDA3937_RS00710"
                     /old_locus_tag="Dda3937_02027"
                     /db_xref="GeneID:9731534"
     CDS             complement(166251..167912)
                     /locus_tag="DDA3937_RS00710"
                     /old_locus_tag="Dda3937_02027"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_013315854.1"
                     /db_xref="GI:503080970"
                     /db_xref="GeneID:9731534"
                     /translation="MSIIKNMKLTTMLGTGFAIVLIISFFVSTYGQFQLRQQSDNVNA
                     LAGDQLEGLLLVQELKDNLNSVAISIRNLTLFTAPDQVAQEKQLITKTITRNSEILKR
                     IAELASTPREKALFDVIDQARPASLAATQKALSLIQDNKLDETKAVIMNEVKPAQDTY
                     FKAINDMVSYQKSDTRRSADEAGQSASFAGMLMLTFAGISTVLGIAIAWLIARRIKKL
                     LGGEPAYTSDIASQIASGNLAINVELQSGDTTSLLAAMNDMRARLSGIVQQVHDSSAS
                     ISTGSSEIAIGSNDLSRRTEEQASSVQQTAASMEQISQTIRQNGDTVREAAQLASSAS
                     QTATKGNEVVRNVITTMSDISTSSRKIGDIITVIDSIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRNLAQRSASAAREIKELITTSMEKVESGSQLVAHAGETMVDIVTQAQ
                     HVANLISEIGVTTREQESGISQINQAITQMDSATQQNAALVEESASAADSLSDQAAKL
                     VELMSVFTIHNTFSKTSPRQQSHTSPALKKPALANKGSTHNWEQF"
     gene            complement(168379..170061)
                     /locus_tag="DDA3937_RS00715"
                     /old_locus_tag="Dda3937_02028"
                     /db_xref="GeneID:9731535"
     CDS             complement(168379..170061)
                     /locus_tag="DDA3937_RS00715"
                     /old_locus_tag="Dda3937_02028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_033111510.1"
                     /db_xref="GI:696580331"
                     /db_xref="GeneID:9731535"
                     /translation="MNALKKTKLGTMLSAGFALVIVIGLLVATFGRTQLAGLGDDIDH
                     LSTTTLTNMMLIQEAKTGFDTNSRLVRNIALSNDPERIAREKQLIDRQIARNTEVLKQ
                     LSERLDTPETRDQLNQLTLARPAYLKAFNNAVQLGISGQSEQREQARELILNDMQTAQ
                     NGVFKALDNMLDFQKKITMNVVADSMQNARSDGTLMLALALVAAVLGALTAWLITRTV
                     KGQLGGEPVYAAAVAQRISDGDLAFNVELRAGDDHSVLAAMNDMREKLGQIVTQVRQS
                     SESIATGASEIAAGSTDLSQRTEEQAASLQQTAASMEQMSQTIRQNGDTVRTATKLAQ
                     SASSTAAKGGEAVNNIVRTMEDISVSSHKIGDIISVIDGIAFQTNILALNAAVEAARA
                     GEQGRGFAVVAGEVRNLAQRSASAAKEIKELITASVEKVETGSTLVSEAGSTIDELVK
                     QARHVADLIGEIGVTTHEQESGISQINDAVNQLDQVTQQNASLVEESASAADSLSDQA
                     ARLVELMSIFNIQNSFNHQTTLLQTPGTGQKKPMPSKLVLANNASNSNWEQF"
     gene            171109..172428
                     /locus_tag="DDA3937_RS00720"
                     /old_locus_tag="Dda3937_02029"
                     /db_xref="GeneID:9731536"
     CDS             171109..172428
                     /locus_tag="DDA3937_RS00720"
                     /old_locus_tag="Dda3937_02029"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="4.S.78 transport; substrate; glycerol-3-P"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="1.3.6 metabolism; energy metabolism, carbon;
                     aerobic respiration"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="1.6.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; phospholipid"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886609.1"
                     /note="with UgpACE is involved in the uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_013315856.1"
                     /db_xref="GI:503080972"
                     /db_xref="GeneID:9731536"
                     /translation="MFQHAIRKTAAVVIMALAASAQAQAVTEIPFWHSMEGELGKTVN
                     SLADRFNQTHSDVKIVPVYKGNYEQSLAAGIAAFRSDNAPAILQVYEVGTATMMASKA
                     IKPVYQVFKDAGVPYDEKIFVPTVSGYYSDAKTGHLLSQPFNSSTPVLYYNKDAFKKA
                     GLDPEQPPKTWQQMAEYTAKLRASGMKCGYASGWQGWIQIENFSAWHGLPIATKNNGF
                     DGLDAVLEFNKPVQVKHIQMLEDMNKKGDFTYYGRKDEPTEKFYNGDCAMTTASSGSL
                     ANIRQYAKFNYGVAMMPYDADVKGAPQNAIIGGASLWVMNGKDAATYKGVAEFMQFLS
                     TPEIAAEWHQKTGYLPITTAAYELTKQQGFYDKNPGADIATRQMLNKEPLPFTKGLRL
                     GNMPQIRTIVDEELESVWTGKKTPQQALDAAVERGNALLRRFEQANK"
     gene            172528..173415
                     /locus_tag="DDA3937_RS00725"
                     /old_locus_tag="Dda3937_04431"
                     /db_xref="GeneID:9731537"
     CDS             172528..173415
                     /locus_tag="DDA3937_RS00725"
                     /old_locus_tag="Dda3937_04431"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="7.3 location of gene products; inner membrane"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942805.1"
                     /note="with UgpEC is involved in the uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter permease"
                     /protein_id="WP_013315857.1"
                     /db_xref="GI:503080973"
                     /db_xref="GeneID:9731537"
                     /translation="MTASRPVFGRSLLPYLLVLPQLTITVIFFLWPAGQALWYSVQSV
                     DPFGLSSQFVGLDNFTNLFHDSYYLGSFYTTLLFSFLVAASGLIVSLFLAALVDYTLR
                     FSRLYQTLLILPYAVAPAVAAVLWMFLFNPGLGLITWLLHQWGYDWNHAQHSGQAMFL
                     VVLASVWKQISYNFLFFLAALQSIPRSLIEAAAIDGAGPVRRFFNLVLPLISPVSFFL
                     LVVNLTYAFFDTFPVIDAATGGGPVQATTTLIYKIYREGFAGLDLSSSAAQSVVLMLV
                     VTVLTVIQFRFVERKVNYQ"
     gene            173457..174305
                     /locus_tag="DDA3937_RS00730"
                     /old_locus_tag="Dda3937_03043"
                     /db_xref="GeneID:9731538"
     CDS             173457..174305
                     /locus_tag="DDA3937_RS00730"
                     /old_locus_tag="Dda3937_03043"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.78 transport; substrate; glycerol-3-P"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="1.3.6 metabolism; energy metabolism, carbon;
                     aerobic respiration"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="1.6.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; phospholipid"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886607.1"
                     /note="with UgpABC is involved in uptake of
                     glycerol-3-phosphate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter membrane
                     protein"
                     /protein_id="WP_013315858.1"
                     /db_xref="GI:503080974"
                     /db_xref="GeneID:9731538"
                     /translation="MIENRRGLDIFSHAMLVVAILAVLFPLYVAFIAATLSQEQMSQV
                     PMSLIPGGHLWENMTYIWRHGVGDNNSAPFGLMLFNSFVMALAITVGKISVSMLSAFA
                     IVYFRFPCRNLFFWMIFSTLMLPVEVRIFPTVEVISHLSMTNSYVGLTLPVMASATAT
                     FLFRQFFMTLPDELLEAARIDGAGPMRFFFDMVLPLSKTNLAALFVITFIYGWNQYLW
                     PLLIVNDPNLGTAVAGIQSMIATGDTATPWHQVMAAMLMTMLPPLLIVLLMQRWFVRG
                     LVDSEK"
     gene            174312..175388
                     /gene="ugpC"
                     /locus_tag="DDA3937_RS00735"
                     /old_locus_tag="Dda3937_03044"
                     /db_xref="GeneID:9731539"
     CDS             174312..175388
                     /gene="ugpC"
                     /locus_tag="DDA3937_RS00735"
                     /old_locus_tag="Dda3937_03044"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="4.S.78 transport; substrate; glycerol-3-P"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="1.3.6 metabolism; energy metabolism, carbon;
                     aerobic respiration"
                     /function="1.3.7 metabolism; energy metabolism, carbon;
                     anaerobic respiration"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="1.6.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; phospholipid"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942807.1"
                     /note="part of the UgpABCE glycerol-3-phosphate uptake
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_013315859.1"
                     /db_xref="GI:503080975"
                     /db_xref="GeneID:9731539"
                     /translation="MACLKLQAVTKSYDGKTQVIQPIDLDVADGEFVVMVGPSGCGKS
                     TLLRMVAGLEQTTSGDIYIGDERVTDKEPKDRGIAMVFQNYALYPHMSVYDNMAYGLK
                     IRGFGKAQIRQRVEEAARILELQPLLHRKPRELSGGQRQRVAMGRAIVREPAVFLFDE
                     PLSNLDAKLRVQMRLELQQLHKRLKTTSLYVTHDQVEAMTLAHRVIVMNKGVAEQIGA
                     PAEIYRKPASLFVASFIGSPAMNLWAGQVSMDGSRVALSADFSLPLPVAKPEWQGRAV
                     TLGMRPEHILQSTADAGGVPLVVETLELLGADNLAHGKWAGQNIVVRLSHEHCPAVGE
                     TLWLTLPAASWHIFDSQSGLRMEA"
     gene            175385..176134
                     /gene="ugpQ"
                     /locus_tag="DDA3937_RS00740"
                     /old_locus_tag="Dda3937_03045"
                     /db_xref="GeneID:9731540"
     CDS             175385..176134
                     /gene="ugpQ"
                     /locus_tag="DDA3937_RS00740"
                     /old_locus_tag="Dda3937_03045"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315860.1"
                     /note="hydrolyzes diesters during transport at the inner
                     face of the cytoplasmic membrane to glycerol-3-phosphate
                     and alcohol; induced when cells are starved for inorganic
                     phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytoplasmic glycerophosphodiester
                     phosphodiesterase"
                     /protein_id="WP_013315860.1"
                     /db_xref="GI:503080976"
                     /db_xref="GeneID:9731540"
                     /translation="MTPNWPYPAIVAHRGGGSLAPENTLAAIDVGAHHGHRMIEFDAK
                     LSQDGQIFLLHDDTLERTSNGWGVAGDLPWDKLVGLDVGSWYSRQFRGERLPLLSEVA
                     KRCAQYGMAANIEIKPTTGCEDQTGRVVALAARALWQNHPVAPLLSSFSVAALEAAQQ
                     AAPELPRGLLLDEWDDDWRALTERLGCVSIHLNHQLLDEARVRLLKDAGLRILVYTVN
                     QPDRARNLLLWGVDCICTDRIDLIGPQFNAS"
     gene            176340..177296
                     /locus_tag="DDA3937_RS00745"
                     /old_locus_tag="Dda3937_03046"
                     /db_xref="GeneID:9731541"
     CDS             176340..177296
                     /locus_tag="DDA3937_RS00745"
                     /old_locus_tag="Dda3937_03046"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="4.9.B transport; Transporters of Unknown
                     Classification;  uncharacterized transport protein"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019845393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013315861.1"
                     /db_xref="GI:503080977"
                     /db_xref="GeneID:9731541"
                     /translation="MPTFILSLWHQIFLSLPLFVLIALGYALIRFGRWPSTVTDALTK
                     FVFSVALPAMLFRMMCDFSKRPAVDARLLIAFFGSCLIVFVLGRIVASRVFRLDGVSG
                     SVFSLSGIFSNNVMLGLPIATLMLGPQAIPSVALVLVFNGLILWTLVTVSVEWARNGS
                     LSMQGFTKTALGVLKNPLIIGILSGTFYSLTGLPLPDSIDKPIGMLSQIGVPLSLVAL
                     GMGLAEYRIRDGWQISVAICLIKLVVQPLVVWVLAVALGLPEMETRVVVLLGSMAVGV
                     NIYLMSRQFNVLGGPVAASLLMSTALAAVTTPLILTLMGVRV"
     gene            complement(177370..177654)
                     /locus_tag="DDA3937_RS00750"
                     /old_locus_tag="Dda3937_03047"
                     /db_xref="GeneID:9731542"
     CDS             complement(177370..177654)
                     /locus_tag="DDA3937_RS00750"
                     /old_locus_tag="Dda3937_03047"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315862.1"
                     /db_xref="GI:503080978"
                     /db_xref="GeneID:9731542"
                     /translation="MKIISPLMLLLSLPLLAQAATQQISPQQQQFENGISSQKRLLQD
                     MQQNQALQQQQLNSDIQQRSREQQRQLQQQLEQNRQRIQQSAPGNTNRTY"
     gene            177824..178288
                     /locus_tag="DDA3937_RS00755"
                     /old_locus_tag="Dda3937_03048"
                     /db_xref="GeneID:9731543"
     CDS             177824..178288
                     /locus_tag="DDA3937_RS00755"
                     /old_locus_tag="Dda3937_03048"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848330.1"
                     /note="member of the SPOUT superfamily of RNA
                     methyltransferases; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA methyltransferase"
                     /protein_id="WP_013315863.1"
                     /db_xref="GI:503080979"
                     /db_xref="GeneID:9731543"
                     /translation="MFHIALYEPQIAPNTGNIIRLAANNGCSLHLIEPLGFDFEEKKL
                     RRAGLDYHDLASVSRHRNYQDFLQAVAGRRIFACTTKGSRPYDEPDYQPGDVLLFGSE
                     TAGLPDDIRNGFAPECRIRIPMEPNCRSLNLSNSVAIISYEAWRQNGFGGRR"
     gene            178343..178933
                     /locus_tag="DDA3937_RS00760"
                     /old_locus_tag="Dda3937_03049"
                     /db_xref="GeneID:9731544"
     CDS             178343..178933
                     /locus_tag="DDA3937_RS00760"
                     /old_locus_tag="Dda3937_03049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111511.1"
                     /db_xref="GI:696580332"
                     /db_xref="GeneID:9731544"
                     /translation="MTRSIPASALRRTLIMGNSGSGKSWLAEQLAARLQAPAIDLDLI
                     NWEPGGYGKARERALVKAEARELAQAECWIMEGVYGWLMQEVVQQATALIWLDIPVDE
                     CLNNIRQRGLRRGGDEAALAELLRWAGEYRERQSNSSFSGHQRVFEQCAPEAPSQRMV
                     VPQRMVVSQRMVVPQRIMLHSREDIERFMAGILSND"
     gene            complement(178969..179742)
                     /locus_tag="DDA3937_RS00765"
                     /old_locus_tag="Dda3937_03050"
                     /db_xref="GeneID:9731545"
     CDS             complement(178969..179742)
                     /locus_tag="DDA3937_RS00765"
                     /old_locus_tag="Dda3937_03050"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315865.1"
                     /db_xref="GI:503080981"
                     /db_xref="GeneID:9731545"
                     /translation="MGATAQILLVVRYTVVLTSLLCLSVTAHSATVNAARYHAFWLWA
                     AVQPQPVLSQADTLYLHQGEIARRGGKVEFLRQGIPVSALPVRHLWLSFRVSELRLGE
                     PELRRLLQLRQRWAAAGNRVDGIQIDFDAKSYHLSHYVAFLQMLRQRLPPDCRLSVTG
                     LLDWAKTGDVRQLNRLDGVVDELVVQTYQGRRTVENYAAYLPALMNLTLPFRLGLVQH
                     GKWDEQWQRRLAASPFYRGEVVFLLNPIPARRSPILQQR"
     gene            complement(179712..181913)
                     /locus_tag="DDA3937_RS00770"
                     /old_locus_tag="Dda3937_03051"
                     /db_xref="GeneID:9731546"
     CDS             complement(179712..181913)
                     /locus_tag="DDA3937_RS00770"
                     /old_locus_tag="Dda3937_03051"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315866.1"
                     /db_xref="GI:503080982"
                     /db_xref="GeneID:9731546"
                     /translation="MKGLALLAGFIATLVQMPAYASGDGVCGFSDADCGMPALPYLLP
                     DNDTRTNLVLLQSSRNHIPLPIPQPEPDQTRSRVDPFTAYRVMGLAATEDNSASAKTD
                     TPADPSAPSDDKADEENTSLLQKATQLHFPDAELGKLRDLTPVDLDGRWVSNDLTTLE
                     SFFDLLLADKELNDAQRTQLALVRMRILSSEYGVSDANTDLAGVPDAGHAGELRRYLA
                     SAVAFYEGQLDQADKGFQQLLSASQPWVAETARYMLIRVSINQAMKDAQDEYNMFDPR
                     KMDKAAGKQAAQRVDEYLKQYPRGKYADSAEGLYRRAEWISGDTVALASHFSQVLASA
                     KSVDQLQAIGNEIDNKLLEDNQFVSSADTPILMLVQDIKRLRSPDGWMMLPALTQEEI
                     TRQQPLFEKAGMQEEFRYLQAAFQYYQQRDYAAVLKTLPMTTAEDITNVTAFSSQVLR
                     GLAMQRQKQWDDAEAHWRHLLMLKTTYTQQQFLQLMLAQTLVDSGQPGRVFTPESPVK
                     NLRFRSAILKVSADADLLHRQTGPQQTHEERAIALHTLLTKQLTHRDYAGFLKDSALL
                     KTIAPLKSTENMSWNEEDLTVFGWDGSDTEEGYECPTLQETVTTLNQNANDAHALNCL
                     GEFVLRTGNGVGFDWGESNMLNGLTDAASYYPGKEFNRLDNYMQVIADAKAPPEDKSY
                     ALYRAIYCYAPSGYNDCGSQDISKETRKAWFRQLKADFKGSQWARQLKYYW"
     gene            complement(182150..183523)
                     /gene="cpxA"
                     /locus_tag="DDA3937_RS00775"
                     /old_locus_tag="Dda3937_03052"
                     /db_xref="GeneID:9731547"
     CDS             complement(182150..183523)
                     /gene="cpxA"
                     /locus_tag="DDA3937_RS00775"
                     /old_locus_tag="Dda3937_03052"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="3.1.3.2 regulation; type of regulation;
                     posttranscriptional; covalent modification,
                     demodification, maturation"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315867.1"
                     /note="part of two-component CpxA/CpxR system; senses
                     envelope stress; upregulates a number of periplasmic
                     folding and trafficking factors; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013315867.1"
                     /db_xref="GI:503080983"
                     /db_xref="GeneID:9731547"
                     /translation="MINSLTARIFAIFWLTLALVLMLVLMLPKLDSRQLTPLLENEQR
                     QGLMLEQHIEAELASDPANDLLWWRRLFRVIEKWAPPGQRLLLVTSEGRVIGAQRNEM
                     QMVRNFIGQSDSADFPQKKKYGRLELLGPFSVRDGEDSYLMYMLRPASSPQSDFINLL
                     FDRPLLLLIVTMLTSSPLLLWLAWSLAKPARKLKNAADEVARGNLKQHPELESGPQEF
                     RATGSSFNQMVSALERMVTAQQRLLSDISHELRTPLTRLQLATALLRRRQGEGNELNR
                     IETETQRLDGMINDLLVLSRNQHKHELSREELQADELWNDVLDDARFEAEQMGKTLEV
                     LSPPGPWPLFGNPTALDSALENVVRNALRYSHSRIAVSFSVDAQGVTIVVGDDGPGVS
                     PEDREQIFRPFYRTDEARDRESGGTGLGLAIVETAISQHRGWAKADESPLGGLQLTLW
                     LPLYQRR"
     gene            complement(183540..184238)
                     /locus_tag="DDA3937_RS00780"
                     /old_locus_tag="Dda3937_03053"
                     /db_xref="GeneID:9731548"
     CDS             complement(183540..184238)
                     /locus_tag="DDA3937_RS00780"
                     /old_locus_tag="Dda3937_03053"
                     /function="CpxR controls the expression of genes involved
                     in protein folding and degradation"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886595.1"
                     /note="response regulator in two-component regulatory
                     system with CpxA; part of the envelope stress response
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013315868.1"
                     /db_xref="GI:503080984"
                     /db_xref="GeneID:9731548"
                     /translation="MNKILLVDDDRELTSLLRELLEMEGFNVVVAHDGEQALSVLDDS
                     VDLLLLDIMMPKKNGIDTLKEVRQRYQTPVIMLTARGSELDRVLGLELGADDYLPKPF
                     NDRELVARIRAILRRSNWTDQQQAGEASAPTIEVDALRLNPGRQEASFDDEVLDLTGT
                     EFTLLYLLAQRLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERKDGLPWF
                     KTLRGRGYLMVSTA"
     gene            184449..185009
                     /locus_tag="DDA3937_RS00785"
                     /old_locus_tag="Dda3937_03054"
                     /db_xref="GeneID:9731549"
     CDS             184449..185009
                     /locus_tag="DDA3937_RS00785"
                     /old_locus_tag="Dda3937_03054"
                     /function="CpxP periplasmic protein is a possible
                     chaperone which is involved in feedback inhibition of Cpx
                     signal transduction pathway"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stress resistance protein"
                     /protein_id="WP_013315869.1"
                     /db_xref="GI:503080985"
                     /db_xref="GeneID:9731549"
                     /translation="MRGTIITLSFASLLMLVTGTVVATENSLPGENNLSSENKAPELG
                     NCYRDDSAMKREESQQGMFDGVKLTEHQRQQMRDLMRQVRHEQPVYDTNDVEIMHRLV
                     TAEKFDAPAVQAQVARMVQAQIARQVEIARVSNQMYNMLTPEQKSILDQKHEQAMQSV
                     RQQMSTSGSRSQNLELSRQGLDDSTE"
     gene            complement(185220..185708)
                     /locus_tag="DDA3937_RS00790"
                     /db_xref="GeneID:23677379"
     CDS             complement(185220..185708)
                     /locus_tag="DDA3937_RS00790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111512.1"
                     /db_xref="GI:696580333"
                     /db_xref="GeneID:23677379"
                     /translation="MKMNFPFLFLGLMAIIPSQASSLTTDNNEKKLEVGFGKPTYRQT
                     LHYRKLYEKKPFPDAEIFYYDNGIYKIISQGEEHYGVYVMQGNFQDQTYTIRYISLPS
                     EDWGKKTAFHQLTFINGDKEKYFIQNAIVETGEAIAQQNGTFSLEENKISNPITQKWH
                     KN"
     gene            186067..>186549
                     /locus_tag="DDA3937_RS00795"
                     /db_xref="GeneID:23677380"
     CDS             186067..>186549
                     /locus_tag="DDA3937_RS00795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886591.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033112183.1"
                     /db_xref="GI:696581004"
                     /db_xref="GeneID:23677380"
                     /translation="MSTKYIALLTQVGAARLANAIALGKQLEITQMGVGDGGGMLPTP
                     DTTQTKLINEKRRAPLNSLNIDPASANQIIAEQVIPDHEGGFWLREIGLYDADDNLVA
                     VANCPETYKPQMQEGSGRVQTVRMILAVGQTDAVSLKIDPAVVLASRQYVDNMALAKA
                     K"
     gene            187676..188968
                     /locus_tag="DDA3937_RS00800"
                     /old_locus_tag="Dda3937_03057"
                     /db_xref="GeneID:9731552"
     CDS             187676..188968
                     /locus_tag="DDA3937_RS00800"
                     /old_locus_tag="Dda3937_03057"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail protein"
                     /protein_id="WP_013315872.1"
                     /db_xref="GI:503080988"
                     /db_xref="GeneID:9731552"
                     /translation="MGIKYVTLLTRVGEVKLAASISTGKPLQIAQMGVGDGGGTLPTP
                     DATQTKLVNEKRRGAINSLTIDPNNTNQIIAEQVIPENEGGFWLREIGLYDVDGDLIA
                     VGNCPETYKPELKEGSGRVQTVRMILIVSHTDAVMMTFDPTVALASRQYVDDKTLSSL
                     AYTDTNVIEVKSYTDNLLAEHIAAADPHKQYAPIDSPVFVGNPTAPTPPFFDADTSIA
                     TTAFVQRALGNMKSAFGVRENKVLTSDAFGCFIESQIAGITITLPDASLCPGGVIEFN
                     NISNGTVTVSGAGVDILGPNNPSGSKTLKIQSGVNVKFLSTGPQWRAIGGVGIAGAGL
                     NGYQVLPSGIIIQWGVGKTLAAGVINQTFPIVYPNNFFSVVITENNSVGWNYTGVTVY
                     GQSNSTKEMLKGYGAFVRNGGSVEFSSDISYQFIAIGN"
     gene            188977..189354
                     /locus_tag="DDA3937_RS00805"
                     /old_locus_tag="Dda3937_03058"
                     /db_xref="GeneID:9731553"
     CDS             188977..189354
                     /locus_tag="DDA3937_RS00805"
                     /old_locus_tag="Dda3937_03058"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail assembly protein"
                     /protein_id="WP_013315873.1"
                     /db_xref="GI:503080989"
                     /db_xref="GeneID:9731553"
                     /translation="MFYSKSNSGFYSKDVNGANIPDDAVEISDDYYQHLLNEQALGNT
                     IIFDELAKKPIAVTPAPVSETQLAEAARRQRDNLLIASDWTQVPDAPVDQQAWRSYRA
                     ILRQVPEQTGFPHNVEWPVSPGK"
     gene            189606..190790
                     /locus_tag="DDA3937_RS00810"
                     /old_locus_tag="Dda3937_04432"
                     /db_xref="GeneID:9731554"
     CDS             189606..190790
                     /locus_tag="DDA3937_RS00810"
                     /old_locus_tag="Dda3937_04432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail protein"
                     /protein_id="WP_033111513.1"
                     /db_xref="GI:696580334"
                     /db_xref="GeneID:9731554"
                     /translation="MAVKYMALLTHVGATKLANAAALRKVLDITHIGVGDGGGNPTTP
                     DPAQTTLVNEKRRAPLNYLSVDPANPNQIIAEQVIPENEGGFWLREIGLYDADGDLIA
                     VANCPETYKPELKEGSGRVQTVRMILIVSHTDAVALKFDPAVALASRQYVDDKTLSSL
                     AYTDTNVIEVKSYADKLLAEHIAATNPHKQYAPIVSPALTGIPTAPTAVAGTNTTQLA
                     TTAFVAGAIDLLSGKTDNNVKLKLDINDIVGIPLPWPQATAPAGWLKCNGQAFDKNRY
                     PRLAQVYPSGVLPDLRGEFIRGWDDGRGVDTGRAILSAQTGSLIVGDIANNINMATLN
                     NVGEAATKANVGWDTAELTSAKYPSIRVNVVSGQTATDPYPYCGVARPRNLAFNYIVR
                     AA"
     gene            190790..191410
                     /locus_tag="DDA3937_RS00815"
                     /old_locus_tag="Dda3937_04433"
                     /db_xref="GeneID:9731555"
     CDS             190790..191410
                     /locus_tag="DDA3937_RS00815"
                     /old_locus_tag="Dda3937_04433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail assembly protein"
                     /protein_id="WP_033111514.1"
                     /db_xref="GI:696580335"
                     /db_xref="GeneID:9731555"
                     /translation="MTVPTQEACAMLTAEGLASRAGWLRVYHADTVTREYDGYSEEYL
                     MLGTGIPAHSYADGPSQSVAEGRTLRRSSDGLRWELIPDLRGRTVYDTQTRQPQVVSE
                     LGPLSTSLTLLPPANEFDCWNGVQWVTDIVAHQASLAQSARQERDTRRQVAHDRIREL
                     TYAQELEMATEQEIRALKDWKIYLVQLSHIDPTHAPDIDWPIIPTN"
     gene            191715..193073
                     /locus_tag="DDA3937_RS00820"
                     /old_locus_tag="Dda3937_04434"
                     /db_xref="GeneID:9731556"
     CDS             191715..193073
                     /locus_tag="DDA3937_RS00820"
                     /old_locus_tag="Dda3937_04434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail protein"
                     /protein_id="WP_033111515.1"
                     /db_xref="GI:696580336"
                     /db_xref="GeneID:9731556"
                     /translation="MGTKYFTLLTQMGEKKLAAAIAAGKPLELVQMGVGDGNGVLPAP
                     DSVQTRLVNERRRGAINSLTVDPDNASQMIAEQVIPENEGGFWLREIGLYDVDGDLIA
                     VGNCPETYKPELKEGSGRVQTVRMILIVSRTDAVTLKFDPTVALATRRYADTLLADHV
                     AAMNPHKQYAPIESPVFTGNPAAPTPTAGDNSKKLATTEFVAVGLSGKMDRNQNGADI
                     QDPVQFVKNLGLESRFAGRILRIKKITSSQNYQWPDDVSAIDVTICGAGGGGGAAAAS
                     AQNYHSAGSGGGAGGWARSFYRKGDIPALIYLEVGAGGIGGVDATYEPGLGGVTKFGT
                     LMTANGGSRGANGIAIAIGMSVLIGNGGGGNASGGNLVAGFGGSGTPAMFFNSGYESG
                     AGGDSVFSFGVPPIASNAPIGGFDGVDGAGGSGGYTVPAGASAKGGNGGNGVIMIVEY
                     SA"
     gene            193070..193465
                     /locus_tag="DDA3937_RS00825"
                     /old_locus_tag="Dda3937_03863"
                     /db_xref="GeneID:9731557"
     CDS             193070..193465
                     /locus_tag="DDA3937_RS00825"
                     /old_locus_tag="Dda3937_03863"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tail assembly protein"
                     /protein_id="WP_013315877.1"
                     /db_xref="GI:503080993"
                     /db_xref="GeneID:9731557"
                     /translation="MSKIYAVIENGVVINTVVWDSDVEADWKPQNGALIDISSERVGV
                     GYLYSDGVFTPPEKRRDEYIADATLRKTQLLSEAQKAIANWQTDLLLGIISDDDKNRL
                     ARWREYMKQIDAIDVQTAPAINWPIPPAP"
     gene            complement(193462..193926)
                     /locus_tag="DDA3937_RS00830"
                     /old_locus_tag="Dda3937_03864"
                     /db_xref="GeneID:9731558"
     CDS             complement(193462..193926)
                     /locus_tag="DDA3937_RS00830"
                     /old_locus_tag="Dda3937_03864"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="WP_033111516.1"
                     /db_xref="GI:696580337"
                     /db_xref="GeneID:9731558"
                     /translation="MKRRPASRLLILDPEQRVLLFLFHHTRDALAGERYWATPGGAVE
                     SGETFEQAAVRELWEETGIRRQDPGPSLAAQTFNMAMPNGDTVIADERFFVIRVADSA
                     IHTDAWTAHEREVMRDHHWWSRDELLATQDQVYPEQLVEMLWPATGKASTSS"
     gene            194129..194599
                     /locus_tag="DDA3937_RS00835"
                     /old_locus_tag="Dda3937_03865"
                     /db_xref="GeneID:9731559"
     CDS             194129..194599
                     /locus_tag="DDA3937_RS00835"
                     /old_locus_tag="Dda3937_03865"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013315879.1"
                     /db_xref="GI:503080995"
                     /db_xref="GeneID:9731559"
                     /translation="MNTIKSQRLARAWSQEQLAELSALSVRTIQRIENGERASLETLS
                     AIAAAFGVNVTALMEEGSEQAVSGESLAQRIEQARTQVGQESRFWRGLMLFVPVNALL
                     VAINLLVNPQTHWFLWPLLIWGGVLAIRAARVFWLRDRWSRWEQERLQKILRKP"
     gene            194729..195631
                     /gene="fieF"
                     /locus_tag="DDA3937_RS00840"
                     /old_locus_tag="Dda3937_03866"
                     /gene_synonym="yiiP"
                     /db_xref="GeneID:9731560"
     CDS             194729..195631
                     /gene="fieF"
                     /locus_tag="DDA3937_RS00840"
                     /old_locus_tag="Dda3937_03866"
                     /gene_synonym="yiiP"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="4.2.A.4 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Cation Diffusion Facilitator (CDF) Family"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315880.1"
                     /note="member of cation diffusion facilitator family; CDF;
                     membrane-bound; induced by both zinc and iron, but does
                     not induce resistance to zinc; can transport zinc(II) in a
                     proton-dependent manner; instead this protein induces iron
                     resistance; forms dimers; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_013315880.1"
                     /db_xref="GI:503080996"
                     /db_xref="GeneID:9731560"
                     /translation="MNSHYARLVMTAAFLATATALSLFGMKVYAWWYTGSVSLLASLV
                     DSLVDIAASLVNLLVVRYSLQPADTEHTFGHGKAESLAALAQSMFISGSALFLLLTGA
                     QHLITPQPLQGPELGMWITIIALVATGLLVSFQRWVIRKTHSQAVRADMLHYQSDVLM
                     NGAILLSLALSWKGINWADAVFALGIGVYILGSALRMAYEAIQALLDRALPDEERQEI
                     INIVSSWPGVSGAHQLRTRRSGPTRFIQLHLEMADNLPLVESHQIADELEQALLKRFP
                     GSDVIIHQDPVSVVPQEQRGRWVL"
     gene            195878..196840
                     /locus_tag="DDA3937_RS00845"
                     /old_locus_tag="Dda3937_03867"
                     /db_xref="GeneID:9731561"
     CDS             195878..196840
                     /locus_tag="DDA3937_RS00845"
                     /old_locus_tag="Dda3937_03867"
                     /function="1.3.1 metabolism; energy metabolism, carbon;
                     glycolysis"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315881.1"
                     /note="catalyzes the formation of D-fructose
                     1,6-bisphosphate from D-fructose 6-phosphate in
                     glycolysis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="WP_013315881.1"
                     /db_xref="GI:503080997"
                     /db_xref="GeneID:9731561"
                     /translation="MIKKIGVLTSGGDAPGMNAAIRGVVRAGLAENLDVYGIYDGYLG
                     LYEDRMVQLDRYSVSDVINRGGTFLGSARFPAFREEAVRQVCVENMKKRGLDALVVIG
                     GDGSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSS
                     HQRISIVEVMGRHCGDLTLAAAIAGGCEFIVLPEVDFKPEDLVEEIKAGIAKGKKHAI
                     VAITELVCDVDELARYIEQETERETRATVLGHIQRGGSPVAYDRILASRMGAYSIELL
                     QQGYGGRCVGIQNEKLVHHDIIDAIENMKRPFKGDWLNTAKKLF"
     gene            197176..198060
                     /locus_tag="DDA3937_RS00850"
                     /old_locus_tag="Dda3937_03868"
                     /db_xref="GeneID:9731562"
     CDS             197176..198060
                     /locus_tag="DDA3937_RS00850"
                     /old_locus_tag="Dda3937_03868"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-carbamoylputrescine amidase"
                     /protein_id="WP_013315882.1"
                     /db_xref="GI:503080998"
                     /db_xref="GeneID:9731562"
                     /translation="MTKVTVAATQMACTWDLPKNIENAERLVRQAHAQGAQIILIQEL
                     FAAPYFCIDQSPEHYALAQELATSPLIKHFSALAAELEVVLPLSLFERANNAYYNSLV
                     MIDADGSVLDVYRKTHIPNGPAYQEKQFFIPGDTGFKVWQTRYAKVGVGICWDQWFPE
                     TARCLALNGAELIFYPTAIGSEPAYPDIDSQPHWTRVQQGHAAANLVPVIASNRIGTE
                     ASKYIDGLEMTFYGSSFIADQTGALVAQANKTDEAVLVHEFDLDAIAAQRASWGLFRD
                     RRPDMYGVIGTSDGKTWR"
     gene            198064..199164
                     /locus_tag="DDA3937_RS00855"
                     /old_locus_tag="Dda3937_03869"
                     /db_xref="GeneID:9731563"
     CDS             198064..199164
                     /locus_tag="DDA3937_RS00855"
                     /old_locus_tag="Dda3937_03869"
                     /EC_number="3.5.3.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315883.1"
                     /note="catalyzes the formation of carbamoylputrescine from
                     agmatine in the arginine decarboxylase pathway of
                     putrescine biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatine deiminase"
                     /protein_id="WP_033111517.1"
                     /db_xref="GI:696580338"
                     /db_xref="GeneID:9731563"
                     /translation="MSELTTPLQDGFSMPAEWAPHDAVWMLWPYRRDNWRSQGDAIPA
                     QRTFAAVAAAIAQTTPVIMGVPRDQMALAKSVMPAGVTLVEMESDDAWMRDTGPTVVL
                     NDAGERRGVDWQFNAWGGALGGLYEDWRRDEKVAAQVLAYHGDARYAAPLILEGGSIH
                     TDGEGTLLTTAECLLNPNRNPHLNKAQIEQLLRDYLGVSAFIWLEEGVYNDETDGHID
                     NMCCFVRPGEVALHWTDDETDPQYARSQAAYQVLSQAKDAQGRSLKIWKLPAPGPLYA
                     TPEEAAGVTDGNAIERNAGSRLAGSYVNFLISNQQIIYPLLDERTDAEAHALLQQMFP
                     GYLVSGVPAREILLGGGNIHCITQQIPAAKTV"
     gene            complement(199259..200698)
                     /locus_tag="DDA3937_RS00860"
                     /old_locus_tag="Dda3937_03870"
                     /db_xref="GeneID:9731564"
     CDS             complement(199259..200698)
                     /locus_tag="DDA3937_RS00860"
                     /old_locus_tag="Dda3937_03870"
                     /function="1.8.1 metabolism; metabolism of other
                     compounds; phosphorous metabolism"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_013315884.1"
                     /db_xref="GI:503081000"
                     /db_xref="GeneID:9731564"
                     /translation="MTMTRKALIRKTLICKPLLSSLMMTLIAGSALAASADYHRQAQG
                     DITQPGGARRLSADQTEMLKASLNAKTAKNVILLIGDGMGDSEITAARNYALGAGGFF
                     KGIDALPLTGQYTHYSLDKKTRKPDYVTDSAASATAWSSGVKTYNGALGVDVDGKDHK
                     TLIEIAKAAGKATGNVSTAELEDATPAAMVSHVTSRKCYGPEKTSQQCPTNALENGGR
                     GSIAEQLLVTRADVTLGGGAATFKEIAKAGKYQGKSLKEQADALGYHLVTDLDGMNAI
                     TAASQSKPVLGLFADGNMPVRWQGPKASYHGNLDKPVVTCEPNAQRGAGVPTLAQMTD
                     KAIQLLSKNKNGFFLQVEGASIDKQDHAANPCGQFGETVDLDEAVQKALEFARRDGNT
                     LVIVTADHAHSSQIVENGSKAPGLTQALNTKDDAVMTISYGNSEEESQGHTGTQLRIA
                     AYGPHAANVVGLTDQTDLFYTMKNAMGLK"
     gene            complement(200851..201621)
                     /locus_tag="DDA3937_RS00865"
                     /old_locus_tag="Dda3937_03871"
                     /db_xref="GeneID:9731565"
     CDS             complement(200851..201621)
                     /locus_tag="DDA3937_RS00865"
                     /old_locus_tag="Dda3937_03871"
                     /function="1.3.1 metabolism; energy metabolism, carbon;
                     glycolysis"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315885.1"
                     /note="Reversibly isomerizes the ketone sugar
                     dihydroxyacetone phosphate to the aldehyde sugar
                     glyceraldehyde-3-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="WP_013315885.1"
                     /db_xref="GI:503081001"
                     /db_xref="GeneID:9731565"
                     /translation="MRHPLVMGNWKLNGSTSMVHELIAGLRNELSAVTGCGVAIAPPA
                     IYLDQAKHLLAGSRIALGAQNVDVNLAGAFTGETSAAMLKDIGAQYIIIGHSERRTYH
                     HESDEFIAKKFAVLKETGLIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAKAFE
                     NTVIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANA
                     AELFTQPDIDGALVGGASLKADAFAVIVKAAAEAKSQA"
     gene            complement(201763..202359)
                     /locus_tag="DDA3937_RS00870"
                     /old_locus_tag="Dda3937_03872"
                     /db_xref="GeneID:9731566"
     CDS             complement(201763..202359)
                     /locus_tag="DDA3937_RS00870"
                     /old_locus_tag="Dda3937_03872"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111518.1"
                     /db_xref="GI:696580339"
                     /db_xref="GeneID:9731566"
                     /translation="MMKNALLIVCCLSAGLLCTPFARSDGLFQQKPPTAAPYLLSGSP
                     TFDMNIIQFRTRYNLSNPSLPINEYRVIDTGDDSPNLTRAASRINDHLYSSTALEKGT
                     GKIKTMQITWLPKPKDTDQSGRRKQAIGYMAALVRTFMPSLTNEQSLKKIEMLLEKGK
                     GQRFYQQTEGALRYVVADHGEKGLTFAVEPIKLALSDS"
     gene            202504..202929
                     /locus_tag="DDA3937_RS00875"
                     /old_locus_tag="Dda3937_03873"
                     /db_xref="GeneID:9731567"
     CDS             202504..202929
                     /locus_tag="DDA3937_RS00875"
                     /old_locus_tag="Dda3937_03873"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315887.1"
                     /db_xref="GI:503081003"
                     /db_xref="GeneID:9731567"
                     /translation="MTIQQWCFSFRGRVGRRDFWLGMAIVLALMVGLFMLAGTGWLET
                     QNAAFVLVVLMWPLAAILVKRLHDRNKSGWWALLLVVAWMLGNGNWAMLPPLGQWGLG
                     RFLPTLIAVMMLLDCGAFVGTSGANRFGPAAEPLRLRAS"
     gene            complement(202943..203689)
                     /locus_tag="DDA3937_RS00880"
                     /old_locus_tag="Dda3937_03874"
                     /db_xref="GeneID:9731568"
     CDS             complement(202943..203689)
                     /locus_tag="DDA3937_RS00880"
                     /old_locus_tag="Dda3937_03874"
                     /function="5.5.6 cell processes; adaptation to stress;
                     other (mechanical, nutritional, oxidative stress)"
                     /function="1.4.3 metabolism; energy production/transport;
                     electron carrier"
                     /function="1.7.1 metabolism; central intermediary
                     metabolism; unassigned reversible reactions"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin-NADP reductase"
                     /protein_id="WP_013315888.1"
                     /db_xref="GI:503081004"
                     /db_xref="GeneID:9731568"
                     /translation="MAEWVTGKVIQVEHWTENLFSLRLEAPVAPFTAGQFAKLALELG
                     GERVQRAYSYVNAPSDTLLEFYLVNVPDGKLSPHLHRCQPGDEVLVTQEAAGFFVLGE
                     IPDCDTLWMLATGTAIGPYLSILQEGRGLERFKHIVLVHAARFARDLSFLPLMQQLEQ
                     RYDGKLRIQTVVSREEQPGSLTGRVPALIESGALEAAVGLSMDAATSHVMLCGNPQMV
                     RDTQQLLKDTRQMSKHLRRRPGHMTSEHYW"
     gene            complement(203799..204809)
                     /locus_tag="DDA3937_RS00885"
                     /old_locus_tag="Dda3937_03875"
                     /db_xref="GeneID:9731569"
     CDS             complement(203799..204809)
                     /locus_tag="DDA3937_RS00885"
                     /old_locus_tag="Dda3937_03875"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.7.8 metabolism; central intermediary
                     metabolism; gluconeogenesis"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose 1,6-bisphosphatase"
                     /protein_id="WP_013315889.1"
                     /db_xref="GI:503081005"
                     /db_xref="GeneID:9731569"
                     /translation="MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADNAAVQAMRIML
                     NQVDINGQIVIGEGEIDEAPMLYIGEQVGTGRGDAVDIAVDPIEGTRMTAMGQANALA
                     VLAVGEQGTFLHAPDMYMEKLIVGPQAKGAIDLDRPLEDNLKRVAERLGKPLSELTVI
                     TLAKPRHDRVIADMQRLGVKVFAIPDGDVAASILTCMPESEVDVLYGIGGAPEGVISA
                     AVIRALDGDMQGRLLARHQVKEDNAENRRLGEQELARCREMGIEAGKVLMLDDMARND
                     NVIFSATGITKGDLLDGISRRGNIATTETLLIRGKSRTIRRISSTHYLDRKDQALHAF
                     LL"
     gene            complement(204941..206452)
                     /gene="glpK"
                     /locus_tag="DDA3937_RS00890"
                     /old_locus_tag="Dda3937_03876"
                     /db_xref="GeneID:9731570"
     CDS             complement(204941..206452)
                     /gene="glpK"
                     /locus_tag="DDA3937_RS00890"
                     /old_locus_tag="Dda3937_03876"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315890.1"
                     /note="Converts glycerol and ADP to glycerol-3-phosphate
                     and ADP; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="WP_013315890.1"
                     /db_xref="GI:503081006"
                     /db_xref="GeneID:9731570"
                     /translation="MNQEKKYIVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPKA
                     GWVEHDPMEIWASQSSTLVEALAKAGISSDEVAGIGITNQRETAVVWEKDTGKPIYNA
                     IVWQCRRSADICEKLKKDGLEEYIRANTGLVVDPYFSGTKVKWILDHVEGSRERARRG
                     ELLFGTIDTWLIWKMTQGRVHVTDYTNASRTMLFNIHKLDWDERMLEVLDIPRAMLPQ
                     VRPSSEIYGQTNIGGKGGTRIPIAGIAGDQQAALYGQLCVHPGMAKNTYGTGCFLLMN
                     TGTEAVRSRHGLLTTIACGPRGEVNYALEGAVFIGGASIQWLRDELKLIGDAMDSEYF
                     ATKVKDSNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHIIRATLESIAYQTRD
                     VLDAMQADADTRLQSLRVDGGAVANNFLMQFQSDILGTRVERPQVRESTALGAAFLAG
                     LATGFWNDLDEVKSKTAIEREFRPSIETVERNFRYRGWQKAVERARAWEEHDE"
     gene            complement(206480..207331)
                     /locus_tag="DDA3937_RS00895"
                     /old_locus_tag="Dda3937_03877"
                     /db_xref="GeneID:9731571"
     CDS             complement(206480..207331)
                     /locus_tag="DDA3937_RS00895"
                     /old_locus_tag="Dda3937_03877"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="4.S.77 transport; substrate; glycerol"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="4.1.A.8 transport; Channel-type Transporters;
                     alpha-type channels; The Major Intrinsic protein (MIP)
                     Family"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886542.1"
                     /note="involved in the transport of glycerol into the
                     cell; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol uptake facilitator GlpF"
                     /protein_id="WP_013315891.1"
                     /db_xref="GI:503081007"
                     /db_xref="GeneID:9731571"
                     /translation="MSQSELSTLKGQCIAEFLGTGLLIFFGVGCVAALKLAGASLGLW
                     EISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFDGRKVLPYIVSQVAGAFCS
                     AALVYGLYHNLFDNIEQTHNMVRGSVESLDLAGIFSTYPNPHISVLQAFLVETVITAI
                     LMCLILALTDDGNGIPRGPLAPLLIGILIAIIGASMGPLTGFAMNPARDAGPKLFAYF
                     AGWGKIALTGGRDIPYILIPIFGPIVGACLGAFGYRSLIGRNLPCDVCATDTDTDTAA
                     SAQTRKV"
     gene            207918..208160
                     /locus_tag="DDA3937_RS00900"
                     /old_locus_tag="Dda3937_03879"
                     /db_xref="GeneID:9731573"
     CDS             207918..208160
                     /locus_tag="DDA3937_RS00900"
                     /old_locus_tag="Dda3937_03879"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942839.1"
                     /note="interacts with FisZ and is necessary for Z-ring
                     formation; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septal ring assembly protein ZapB"
                     /protein_id="WP_013315893.1"
                     /db_xref="GI:503081009"
                     /db_xref="GeneID:9731573"
                     /translation="MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNTLSQEVESM
                     AGNRDALMRENEQLKQEQLVWQERLRALLGKMEDVQ"
     gene            complement(208226..208711)
                     /locus_tag="DDA3937_RS00905"
                     /old_locus_tag="Dda3937_03880"
                     /db_xref="GeneID:9731574"
     CDS             complement(208226..208711)
                     /locus_tag="DDA3937_RS00905"
                     /old_locus_tag="Dda3937_03880"
                     /function="1.5.3.11 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier;
                     menaquinone, ubiquinone"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855445.1"
                     /note="regulator of RNase E; increases half-life and
                     abundance of RNAs; interacts with RNase E possibly
                     inhibiting catalytic activity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease activity regulator protein RraA"
                     /protein_id="WP_013315894.1"
                     /db_xref="GI:503081010"
                     /db_xref="GeneID:9731574"
                     /translation="MKYDTSELCDIYHEEVNVVEPLFSNFGGRSSFGGKIITVKCFED
                     NGLLFDVLEENGSGRVLLVDGGGSVRRALVNAELARLATQNEWEGIVVYGAVRQVDDL
                     SELDIGIQAMAATPAGAASEGIGETDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDL
                     E"
     gene            complement(208870..209787)
                     /locus_tag="DDA3937_RS00910"
                     /old_locus_tag="Dda3937_03881"
                     /db_xref="GeneID:9731575"
     CDS             complement(208870..209787)
                     /locus_tag="DDA3937_RS00910"
                     /old_locus_tag="Dda3937_03881"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315895.1"
                     /note="catalyzes the formation of dimethylmenaquinone from
                     1,4-dihydroxy-2-naphthoate and octaprenyl diphosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /protein_id="WP_033111519.1"
                     /db_xref="GI:696580340"
                     /db_xref="GeneID:9731575"
                     /translation="MTQLTHSSKTQAWLDSLRPKTLPLAFASIVTGTVIACWHSNFKP
                     GVALLTLITAGLLQILSNLANDYGDAVKGSDKEDRIGPLRGIQTGAISLPELRKALLI
                     TVTLTAISGSALVALACEKPVDIVVFLALGLLAILAAITYTVGNKPYGYIGLGDISVL
                     IFFGWLSVAGSYYLQTGHFDSSVILPATACGLLAVAVLNINNLRDIDSDRENGKNTLA
                     VRLGAHKARRYHMVLLMTAPVCLALFAMLYLHTLAGWLFILALPLLVKQGRYVMRETT
                     AFSMRPMLEKTVKGALLTNLLFAVGVLLS"
     gene            complement(209945..211276)
                     /gene="hslU"
                     /locus_tag="DDA3937_RS00915"
                     /old_locus_tag="Dda3937_03882"
                     /db_xref="GeneID:9731576"
     CDS             complement(209945..211276)
                     /gene="hslU"
                     /locus_tag="DDA3937_RS00915"
                     /old_locus_tag="Dda3937_03882"
                     /function="5.5.2 cell processes; adaptation to stress;
                     temperature extremes"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="2.3.6 information transfer; protein related;
                     turnover, degradation"
                     /function="2.3.4 information transfer; protein related;
                     chaperoning, folding"
                     /function="3.1.3.4 regulation; type of regulation;
                     posttranscriptional; proteases, cleavage of compounds"
                     /function="5.1 cell processes; cell division"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004719530.1"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="WP_013315896.1"
                     /db_xref="GI:503081012"
                     /db_xref="GeneID:9731576"
                     /translation="MSEMTPREIVSELDSYIIGQHKAKRAVAIALRNRWRRMQLEESL
                     RHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRD
                     LTDVAIKMVRQQSMEKNRYRAEELAEERILDVLIPPAKNNWGQPEENHEPSAARQAFR
                     KKLREGSLDDKEIEIELAAAPVGVEIMAPPGMEEMTNQLQSMFQNLAGQKQKNRKIKI
                     REAFKLLVEEEAAKLVNPEELKQQAIEAVEQHGIVFIDEIDKICKRGDTSGPDVSREG
                     VQRDLLPLVEGCTVSTKHGMVKTDHILFIASGAFQVASPSDLIPELQGRLPIRVELQA
                     LTTEDFERILTEPSASLTRQYQALMETEGVNITFLPDGIRRIAEAAWQVNERTENIGA
                     RRLHTVLERLIEDVSYGASEMHGQTVTIDADYVRSHLDELVADEDLSRFIL"
     gene            complement(211286..211816)
                     /locus_tag="DDA3937_RS00920"
                     /old_locus_tag="Dda3937_03883"
                     /db_xref="GeneID:9731577"
     CDS             complement(211286..211816)
                     /locus_tag="DDA3937_RS00920"
                     /old_locus_tag="Dda3937_03883"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114842.1"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="WP_012767897.1"
                     /db_xref="GI:502344031"
                     /db_xref="GeneID:9731577"
                     /translation="MTTIVSVRRNGQVVIGGDGQATLGNTVMKGNVRKVRRLYNDRVI
                     AGFAGGTADAFTLFELFERKLELHQGHLVKAAVELAKDWRTDRMLRRLEALLAVADEN
                     ASLIITGNGDVIQPENDLIAIGSGGPYAQAAARALLENTELSAREIVEKSLGIAGDIC
                     IYTNQFHTIEELASKA"
     gene            complement(211902..212732)
                     /locus_tag="DDA3937_RS00925"
                     /old_locus_tag="Dda3937_03884"
                     /db_xref="GeneID:9731578"
     CDS             complement(211902..212732)
                     /locus_tag="DDA3937_RS00925"
                     /old_locus_tag="Dda3937_03884"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsN"
                     /protein_id="WP_033111520.1"
                     /db_xref="GI:696580341"
                     /db_xref="GeneID:9731578"
                     /translation="MIALAVAVLVTFAGGLYFIAHNKPDESPVLPHQGTKGNGLPPKP
                     EERWRYIKELENRQIGVASPTEPSAGGEIQSTGQLTNEQRQLLEQMQSDMKRQPTTLT
                     EVPYNDQSQMPARSLAAPRPQTVVPIVPNTSTVTPPPAPRTTTTVPANQHHTTQAATP
                     PAQTAQKPVQAEPRKEAAKTETAAKETAKTDSKTENAKPEKEQRWMVQCGSFKTAEPA
                     ESVRAELAFAGVESRIASSGGWHRIMLGPYNSRTVADKMAQKLKGMGQSNCIPLASGG
                     "
     gene            complement(212883..213953)
                     /locus_tag="DDA3937_RS00930"
                     /old_locus_tag="Dda3937_03885"
                     /db_xref="GeneID:9731579"
     CDS             complement(212883..213953)
                     /locus_tag="DDA3937_RS00930"
                     /old_locus_tag="Dda3937_03885"
                     /function="CytR controls the expression of genes involved
                     in nucleoside catabolism and nucleotide transport"
                     /function="In E. carotovora subsp. carotovora EC1, a CytR
                     homolog controls expression of polygalacturonase and
                     flagella secretion genes."
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.4 regulation; genetic unit regulated;
                     global"
                     /function="1.7.33 metabolism; central intermediary
                     metabolism; nucleotide and nucleoside conversions"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.3.2 regulation; genetic unit regulated;
                     regulon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013315898.1"
                     /db_xref="GI:503081014"
                     /db_xref="GeneID:9731579"
                     /translation="MEQKKFIPPATMKDVADQAGVSTATVSRALTNPEKVSATTRQKV
                     EQAALAVGYSAQNLARNLKRHESRTILALVPDICDPFFTEMLRGIEETAAERGYLVLI
                     GDCAHQRKTEKTFLDLITTRQIDGILLLGSQLPFDAGKDERRHLPPMVMANEFAPELD
                     MPTVHIDNLTAAFEAVSYLNQLGHRRIACIAGPEQIPISEYRLQGYIQALRRCGLVID
                     NQYIVRGDFSYDTGSRGLMRLMSHPTPPTAVFCHCDVMALGALTQARKMGLDVPRDLS
                     LVGFDDIAQASHCFPALTTVSQPRYDIGREAMLLLLAQLQQHKVQRGSRLISSQLIIR
                     DSTAAPPLRVTGFKNSGAGQIF"
     gene            complement(214389..216587)
                     /locus_tag="DDA3937_RS00935"
                     /old_locus_tag="Dda3937_03886"
                     /db_xref="GeneID:9731580"
     CDS             complement(214389..216587)
                     /locus_tag="DDA3937_RS00935"
                     /old_locus_tag="Dda3937_03886"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315899.1"
                     /note="binding of PriA to forked DNA starts the assembly
                     of the primosome, also possesses 3'-5' helicase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primosome assembly protein PriA"
                     /protein_id="WP_013315899.1"
                     /db_xref="GI:503081015"
                     /db_xref="GeneID:9731580"
                     /translation="MPVVQVALPVPLTRTFDYRLPQGITPPVPGARVSVPFGNRKMIG
                     IVTALSAGSALPLEQLKPLHDVLDDAPLFQDSLWHILLWAAEYYHYPLGDVLFHALPI
                     LLRQGKPAHSAPLWQWFATEQGRATPVNALKRAPKQQQALAALLQGPLYRHQVAETEL
                     TEAALQALREKGLSELRALPQQVRDWRDDFSLTGERLRLNTEQATAVGAIRSEDDHFA
                     AWLLAGITGSGKTEVYLSVLENILAQGKQALVLVPEIGLTPQTIARFRDRFNAPVEAL
                     HSGLNDGERLSVWLRARQGEAAIVIGTRSALFTPFARLGLIVIDEEHDGSYKQQEGWR
                     YHARDLAVFRARQEDIPIVMGSATPALETLYNVQIGKYRQLRLSKRAGNARLAQQHLL
                     DLKGLPLTTGLSQPLISRIRHHLAADNQVILFLNRRGFAPVVLCHECGWIAECQRCDS
                     YYTLHQHQRMMRCHHCDSQRPIPQQCPQCGSTHLVPVGLGTEQLEQALPALFPEAPIT
                     RIDRDTTSRKGALEQQLAQVRQGGARILIGTQMLAKGHHFPDVTLVALLDVDSSLFSA
                     DFRATERFAQLYTQVSGRAGRAGKAGEVVLQTHHPEHPLLQTLLHQGYDAFASQTLKE
                     RQSVFLPPFTSHVLFRADDHDNQQASLFLQQLRNLLEASPLRDDSLWLMGPVPALQPK
                     RAGRFRWQLLLQHPSRATLQRLIRNSMPLIDTLPQTRKVKWVMDVDPTDN"
     gene            216863..217078
                     /gene="rpmE"
                     /locus_tag="DDA3937_RS00940"
                     /old_locus_tag="Dda3937_04717"
                     /db_xref="GeneID:9731581"
     CDS             216863..217078
                     /gene="rpmE"
                     /locus_tag="DDA3937_RS00940"
                     /old_locus_tag="Dda3937_04717"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315900.1"
                     /note="RpmE; there appears to be two types of ribosomal
                     proteins L31 in bacterial genomes; some contain a CxxC
                     motif while others do not; Bacillus subtilis has both
                     types; the proteins in this cluster have the CXXC motif;
                     RpmE is found in exponentially growing Bacilli while YtiA
                     was found after exponential growth; expression of ytiA is
                     controlled by a zinc-specific transcriptional repressor;
                     RpmE contains one zinc ion and a CxxC motif is responsible
                     for this binding; forms an RNP particle along with
                     proteins L5, L18, and L25 and 5S rRNA; found crosslinked
                     to L2 and L25 and EF-G; may be near the
                     peptidyltransferase site of the 50S ribosome; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="WP_013315900.1"
                     /db_xref="GI:503081016"
                     /db_xref="GeneID:9731581"
                     /translation="MKEGIHPNYVEITATCSCGNVIKTRSTAAHDLNLDVCGACHPFF
                     TGKQRVVDTGGRVERFNKRFSVPGTKK"
     gene            complement(217195..217512)
                     /locus_tag="DDA3937_RS00945"
                     /old_locus_tag="Dda3937_03887"
                     /db_xref="GeneID:9731582"
     CDS             complement(217195..217512)
                     /locus_tag="DDA3937_RS00945"
                     /old_locus_tag="Dda3937_03887"
                     /function="MetJ controls the expression of the genes
                     involved in methionine synthesis"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="1.5.1.9 metabolism; building block
                     biosynthesis; amino acids; methionine"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855437.1"
                     /note="when combined with S-adenosylmethionine represses
                     the expression of the methionine regulon and of proteins
                     involved in S-adenosylmethionine synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013315901.1"
                     /db_xref="GI:503081017"
                     /db_xref="GeneID:9731582"
                     /translation="MAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRR
                     QVNNLRHATNSELLCEAFLHAFTGQPLPNDDDLRKERGDEIPDAAKAIMREMGIDPDT
                     WEY"
     gene            217701..218861
                     /locus_tag="DDA3937_RS00950"
                     /old_locus_tag="Dda3937_03888"
                     /db_xref="GeneID:9731583"
     CDS             217701..218861
                     /locus_tag="DDA3937_RS00950"
                     /old_locus_tag="Dda3937_03888"
                     /function="1.5.1.9 metabolism; building block
                     biosynthesis; amino acids; methionine"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019846445.1"
                     /note="catalyzes the formation of cystathionine from
                     L-cysteine and O-succinyl-L-homoserine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="WP_013315902.1"
                     /db_xref="GI:503081018"
                     /db_xref="GeneID:9731583"
                     /translation="MTRKQATIAVRSGLNNDEQFGCVVPPIHLSSTYNFTGFNEPRAH
                     DYSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAILLVCTVFLRPGDLLVAPHDCYG
                     GSYRLFDSLSKRGAYRVKFVDQGNAADLKAALAEKPKLVLVESPSNPLLRVVDIAAIC
                     QAAREAGAVSVVDNTFLSPALQNPLKLGADLVVHSCTKYLNGHSDVVAGAVIARDPEV
                     VTELAWWANNIGVTGAAFDSYLLLRGVRTLSPRMMIAQKNALQIVEYLRHQPLVKALY
                     HPSLPGNAGHEIARRQQSGFGAMLSFELDGDEDTLRRFLSTLELFTLAESLGGVESLI
                     SHAATMTHAGMAPQARAAAGISETLLRISVGIEDGDDLVADLDRAFQAAAKR"
     gene            218864..221299
                     /gene="metL"
                     /locus_tag="DDA3937_RS00955"
                     /old_locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /db_xref="GeneID:9731584"
     CDS             218864..221299
                     /gene="metL"
                     /locus_tag="DDA3937_RS00955"
                     /old_locus_tag="Dda3937_03889"
                     /gene_synonym="metM"
                     /function="1.5.1.9 metabolism; building block
                     biosynthesis; amino acids; methionine"
                     /function="1.5.1.21 metabolism; building block
                     biosynthesis; amino acids; homoserine"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012767904.1"
                     /note="multifunctional homodimeric enzyme that catalyzes
                     the phosphorylation of aspartate to form
                     aspartyl-4-phosphate as well as conversion of aspartate
                     semialdehyde to homoserine; functions in a number of amino
                     acid biosynthetic pathways; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aspartate kinase II/homoserine
                     dehydrogenase II"
                     /protein_id="WP_013315903.1"
                     /db_xref="GI:503081019"
                     /db_xref="GeneID:9731584"
                     /translation="MSALGIAAAVKGRQLHKFGGSSLADVKCYQRVAGIMADYSQAGD
                     LMVVSAAGSTTNQLISWLNLSQSDRISAHQVQQSLRRYQSELISGLLPAETAAPLINE
                     FIRDLERLAALLDGKLTEAAYAEVVGHGEIWSARLMAAVLNQKNLPAAWLDARTFLRA
                     ERAAQPQVDEGRSWPLLQQLLTQNAGQRLVITGFISSNDAGETVLLGRNGSDYSATQI
                     GALAGVERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHARTLQP
                     VSGSDIDLQLRCSYQPEQGSTRIERVLASGTGAKIVTSHDDVCLIEIGVPAEHDFART
                     HKDVEQLLQKSQIRPLALGVHQDRNLLQLCYTSEVVHSAWQVLEQAALPVSLHLREGL
                     ALVALVGAGVCRNPLHSHRFYQQLRDQPIEFVWQAEDDISLVAVLRVGPTEHLVRGLH
                     HSLFRAEKRIGLVLFGKGNIGSRWLELFAREQSLISARTGFEFTLAGVVDSSRSLLDY
                     EGLDASRVLAFFGDEAQERDDDELFLWMRAHPYDDLVVLDVTASQSVADLYLDFASHG
                     FHVISANKLAGASGGDNYRQIRDAFAKTGRHWLYNATVGAGLPVNYAVRDLRESGDSI
                     LAISGIFSGTLSWLFLQFDGTVPFTELVDQAWQQGLTEPDPRVDLSGQDVMRKLVILA
                     REAGYEIEPNQVRVESLVPAGCENGSVDQFFEDGEPLNQQMLQRLEAANEMGLVLRYV
                     ARFDVNGKARVGVEAVRADHPLAALLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAG
                     AIQSDLNRLAQLL"
     gene            221642..222538
                     /gene="metF"
                     /locus_tag="DDA3937_RS00960"
                     /old_locus_tag="Dda3937_03890"
                     /db_xref="GeneID:9731585"
     CDS             221642..222538
                     /gene="metF"
                     /locus_tag="DDA3937_RS00960"
                     /old_locus_tag="Dda3937_03890"
                     /function="1.7.17 metabolism; central intermediary
                     metabolism; formyl-tetrahydrofolate biosynthesis"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315904.1"
                     /note="MTHFR; catalyzes NADH-linked reduction of
                     5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate
                     using FAD as a cofactor; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="WP_013315904.1"
                     /db_xref="GI:503081020"
                     /db_xref="GeneID:9731585"
                     /translation="MSFFHANHQEALNQNLAELQGRINVSFEFFPPRTSEMEETLWNS
                     IDRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASRDELKAI
                     AQDYWQSGIRHIVALRGDLPPGSGKPEMYASDLVTLLKEVGDFDISVAAYPEVHPEAK
                     SAQADLINLKRKIDAGASRAITQFFFDVESYLRFRDRCVTTGIDVEIVPGILPVSNFK
                     QLQRFATMTNVRVPNWMTAMFEGLDNDPETRKMVGASIAMDMVKILSREGVKDFHFYT
                     LNRSELSYAICHTLGVRPVTAA"
     gene            complement(222718..223449)
                     /locus_tag="DDA3937_RS00965"
                     /old_locus_tag="Dda3937_03891"
                     /db_xref="GeneID:9731586"
     CDS             complement(222718..223449)
                     /locus_tag="DDA3937_RS00965"
                     /old_locus_tag="Dda3937_03891"
                     /function="1.6.15.2 metabolism; macromolecules (cellular
                     constituent) biosynthesis; large molecule carriers;
                     thioredoxin, glutaredoxin"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione amide-dependent peroxidase"
                     /protein_id="WP_013315905.1"
                     /db_xref="GI:503081021"
                     /db_xref="GeneID:9731586"
                     /translation="MFVSQEGKKIPSVTFHTRQGDQWVDVTTAELFNNKTVVVFSLPG
                     AFTPTCSSSHLPRYNELAAVFKQFGVDAVLCVSVNDTFVMNAWKADQDAENITFIPDG
                     NGEFTRAMNMLVEKAELGFGPRSWRYSMLVRHGVVAKMFVEPNKPGDPFEVSDADTML
                     KYLAPHYKVQESVSLFTKPGCPFCAKAKQLLQDRGIQYEEIMLGKDATTVSLRAMTGR
                     STVPQVFMGGRHIGGSEELETVLTT"
     gene            223626..224543
                     /locus_tag="DDA3937_RS00970"
                     /old_locus_tag="Dda3937_03892"
                     /db_xref="GeneID:9731587"
     CDS             223626..224543
                     /locus_tag="DDA3937_RS00970"
                     /old_locus_tag="Dda3937_03892"
                     /function="OxyR activates the expression of a regulon of
                     hydrogen peroxide-inducible genes such as katG, gor, ahpC,
                     ahpF, oxyS (a regulatory RNA), dps, fur and grxA."
                     /function="OxyR activates the expression of a regulon of
                     hydrogen peroxide-inducible genes such as katG, gor, ahpC,
                     ahpF, dps, fur and grxA."
                     /function="An EC16 oxyR mutant is reduced in catalase and
                     glutathione reductase activity and is unable to form
                     colonies on agar plates unless exogenous catalase is
                     added. However, it is not reduced in virulence, suggesting
                     that hydrogen peroxide is not important for"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="3.3.2 regulation; genetic unit regulated;
                     regulon"
                     /function="5.5.6 cell processes; adaptation to stress;
                     other (mechanical, nutritional, oxidative stress)"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315906.1"
                     /note="Activates the expression of a regulon of hydrogen
                     peroxide-inducible genes such as katG, gor, ahpC, ahpF,
                     oxyS, dps, fur and grxA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013315906.1"
                     /db_xref="GI:503081022"
                     /db_xref="GeneID:9731587"
                     /translation="MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELG
                     VMLLERTSRKVLFTQAGLLLVEQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVG
                     PYLLPQIIPMLHRTFPKLEMYLHEAQTHQLLAQLDSGKLDCAILAMVKESEAFIEVPL
                     FDEPMKLAIYQDHPWANRERVAMSDLSGEKLLMLEDGHCLRDQAMGFCFQAGADEDTH
                     FRATSLETLRNMVAAGSGITLLPSLAVPPERVRDGVCYLPCYKPEPKRTIALVYRPGS
                     PLRGRYEQLADSVREHMQLHMEQLSKQSA"
     gene            complement(224627..226033)
                     /locus_tag="DDA3937_RS00975"
                     /old_locus_tag="Dda3937_03893"
                     /db_xref="GeneID:9731588"
     CDS             complement(224627..226033)
                     /locus_tag="DDA3937_RS00975"
                     /old_locus_tag="Dda3937_03893"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019846449.1"
                     /note="catalyzes the conversion of NADPH to NADH; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="soluble pyridine nucleotide transhydrogenase"
                     /protein_id="WP_013315907.1"
                     /db_xref="GI:503081023"
                     /db_xref="GeneID:9731588"
                     /translation="MSIQQQYDYDAIVIGSGPGGEGAAMGLAKQGAKIAVIERHYNVG
                     GGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARVISSSFSDILRHADSVIGQQTRM
                     RQGFYERNHCELFSGEARFIDAHTIAVYYPDDTHDTLTAANIIIATGSRPYHPAGVDF
                     HHPRIYDSDSILDLDYEPKHVIIYGAGVIGCEYASIFRGLNVKVDLINTRDRLLAFLD
                     QEMSDALSYHFWNSGVVIRHNEEFERIEGLDDGVIIHLKSGKKMKADCLLYANGRTGN
                     TETLGLENVGLETDSRGQLKVNSMYQTAQAHIYAVGDVIGYPSLASAAYDQGRIAAQA
                     ITKGDATAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVG
                     MNVGSLKILFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYP
                     TMAEAYRVAALNGLNRLF"
     gene            226234..226872
                     /locus_tag="DDA3937_RS00980"
                     /old_locus_tag="Dda3937_03894"
                     /db_xref="GeneID:9731589"
     CDS             226234..226872
                     /locus_tag="DDA3937_RS00980"
                     /old_locus_tag="Dda3937_03894"
                     /function="FabR regulates fabA and fabB genes involved in
                     unsaturated fatty acid biosynthesis"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315908.1"
                     /note="negatively controls the expression of fabA and
                     fabB, genes involved in the unsaturated fatty acid
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013315908.1"
                     /db_xref="GI:503081024"
                     /db_xref="GeneID:9731589"
                     /translation="MGVRAQQKERTRRSLVEAAFSQLSAERSFASLSLREVAREAGIA
                     PTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIVKSGGSVIRTSVSTFMEFIGN
                     NPNAFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLEVENHIPRSFAEAQAEAMVI
                     IVFSAGAEALDVDIEQRRQLEERLVLQLRMIAKGAYYWYRKEQGKGFVYPEG"
     gene            226887..227261
                     /locus_tag="DDA3937_RS00985"
                     /old_locus_tag="Dda3937_03895"
                     /db_xref="GeneID:9731591"
     CDS             226887..227261
                     /locus_tag="DDA3937_RS00985"
                     /old_locus_tag="Dda3937_03895"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013315910.1"
                     /db_xref="GI:503081026"
                     /db_xref="GeneID:9731591"
                     /translation="MTEQINSEKSTLVLTLVAGLSANGSFVAVFSSIVPFSIFPLIAL
                     VLSVYCLHQRYMHHAMPKGTPLLAAGCFLFGLLLYSAIVRAEYPQIGSNFVPSILCVV
                     LALWLVVKLRTRKPGSGEINTP"
     gene            complement(227274..228377)
                     /locus_tag="DDA3937_RS00990"
                     /old_locus_tag="Dda3937_03896"
                     /db_xref="GeneID:9731592"
     CDS             complement(227274..228377)
                     /locus_tag="DDA3937_RS00990"
                     /old_locus_tag="Dda3937_03896"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016942854.1"
                     /note="catalyzes the formation of 5-methyl-uridine at
                     position 54 in all tRNAs; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (uracil-5-)-methyltransferase"
                     /protein_id="WP_013315911.1"
                     /db_xref="GI:503081027"
                     /db_xref="GeneID:9731592"
                     /translation="MTPEILPIDQYDAQLEEKTGRLGAMMAPFDAPAPTVFRSPVSHY
                     RMRAEFRIWHDGDDLYHIIFDQQTKQRIRVDRFPAASELINRLMPALISALRAEPVLR
                     RKLFQIDYLSTLSGEIVVSLLYHKALDDEWQQCARLLRDQLHAQGFALQLIGRATKTK
                     ICLDRDYVDECLPVAGRQMIYRQVENSFTQPNAMMNIQMLEWALSATQGSTGDLLELY
                     CGNGNFSLALARNFERVLATEIAKPSVAAAQYNIAANQIDNVQIIRMAAEEFTQAMNG
                     VRQFNRLQGIDLAGYRCETIFVDPPRSGLDDDTVKLVQAYPRILYISCNPETLCANLE
                     TLSQTHRISQLALFDQFPYTHHMECGVLLEKRQ"
     misc_binding    228516..228718
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            228786..230657
                     /gene="btuB"
                     /locus_tag="DDA3937_RS00995"
                     /old_locus_tag="Dda3937_03897"
                     /db_xref="GeneID:9731593"
     CDS             228786..230657
                     /gene="btuB"
                     /locus_tag="DDA3937_RS00995"
                     /old_locus_tag="Dda3937_03897"
                     /function="6.1 cell structure; membrane"
                     /function="4.1.B transport; Channel-type Transporters;
                     Beta barrel porins (The Outer Membrane Porin (OMP)
                     Functional Superfamily)"
                     /function="7.4 location of gene products; outer membrane"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /function="4.S.187 transport; substrate; vitamin B12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315912.1"
                     /note="involved in the active translocation of vitamin B12
                     (cyanocobalamin) across the outer membrane to the
                     periplasmic space; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="vitamin B12/cobalamin outer membrane
                     transporter"
                     /protein_id="WP_013315912.1"
                     /db_xref="GI:503081028"
                     /db_xref="GeneID:9731593"
                     /translation="MFTKKTTMLAAMVATAFSGWAQGSDNTQQNSNDAMVVTANRFPQ
                     PISSVLAPTTVVTRDDIDRWQSKSLTDVMRRLPGVDIGQNGGRGQLASVFIRGTESRH
                     ILVLIDGIRMASPGVTGTTDFSQIPMSIIQRIEYIRGARSAVYGSEAIGGVINIITTR
                     TQDGGVLNAGYGSHAYQQYDGSIKQHIGENTAVSLAGGYEGTHGFNVYPGSTIAGDDQ
                     KSGYRSKTFWGMVEHQFTPQLNGFVRNYGYDNLTDYNKIYSDSSSNRRYLSSRSYDTG
                     LQFQQGIYAGQLVASYQTYDDQNYDDAVGRYSNSVTRINQRSLQWGNVFSVGQGSIST
                     GVDWRDERAAAGGASAISESQSRTNTGLYLTTQQRIGQFTLEGAIRGDDNQQYGRHGT
                     WQTAAGWEFIDGYRLTGSYGTAFKAPTFSQIYNTDYNVGNISLKPEESKQWEFGVEGI
                     SGPVNWRASTYRNDINNLIEYDGTSNPASPTYFNVAKAVIKGVEFTASYDTGPVTHHA
                     TLEYLDARNAETQAVLERRAHKKAKYSIDTTVADVDWSLAWIYQGARADKKYNEFPSD
                     PVKLGGYSTWDLSAAYPVTSHLTVRARIANLFDKNYETVYGYRTAGREYYLTGSYSF"
     gene            230602..231474
                     /locus_tag="DDA3937_RS01000"
                     /old_locus_tag="Dda3937_03898"
                     /db_xref="GeneID:9731594"
     CDS             230602..231474
                     /locus_tag="DDA3937_RS01000"
                     /old_locus_tag="Dda3937_03898"
                     /function="1.5.1.1 metabolism; building block
                     biosynthesis; amino acids; glutamate"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315913.1"
                     /note="converts L-glutamate to D-glutamate, a component of
                     peptidoglycan; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="WP_013315913.1"
                     /db_xref="GI:503081029"
                     /db_xref="GeneID:9731594"
                     /translation="MATELQGENTISPEAIVSDLPARPTVLVFDSGVGGLSVYDEVRK
                     LLPDLHYIYTFDNEAFPYGEKPEQFIIERVVSIVDAVEKQHPLSLVIIACNTASTISL
                     PALRARFNFPVVGVVPAVKPAAKLTRNGVVGLLATRATVQRPYTHELISRFANDCQIL
                     LLGSAELVEWGEAKLQGETVPEEVLRKILKPWLKLPEPPDTVVLGCTHFPLLSEELQQ
                     VLPDGTRLVDSGTAIARRTAWLIEHLDNPKLSTERNLAYCLSITPKVAALSPVLRRYG
                     FSALERLTLLPADE"
     gene            231818..233366
                     /locus_tag="DDA3937_RS01005"
                     /old_locus_tag="Dda3937_04663"
                     /db_xref="GeneID:9731595"
     rRNA            231818..233366
                     /locus_tag="DDA3937_RS01005"
                     /old_locus_tag="Dda3937_04663"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:9731595"
     gene            233448..233523
                     /locus_tag="DDA3937_RS01010"
                     /old_locus_tag="Dda3937_04672"
                     /db_xref="GeneID:9731596"
     tRNA            233448..233523
                     /locus_tag="DDA3937_RS01010"
                     /old_locus_tag="Dda3937_04672"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:233482..233484,aa:Glu,seq:ttc)
                     /db_xref="GeneID:9731596"
     gene            233709..236643
                     /locus_tag="DDA3937_RS01015"
                     /old_locus_tag="Dda3937_04664"
                     /db_xref="GeneID:9731597"
     rRNA            233709..236643
                     /locus_tag="DDA3937_RS01015"
                     /old_locus_tag="Dda3937_04664"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:9731597"
     gene            236734..236849
                     /locus_tag="DDA3937_RS01020"
                     /old_locus_tag="Dda3937_04226"
                     /db_xref="GeneID:9731598"
     rRNA            236734..236849
                     /locus_tag="DDA3937_RS01020"
                     /old_locus_tag="Dda3937_04226"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="GeneID:9731598"
     gene            237119..238156
                     /gene="murB"
                     /locus_tag="DDA3937_RS01025"
                     /old_locus_tag="Dda3937_04216"
                     /db_xref="GeneID:9731599"
     CDS             237119..238156
                     /gene="murB"
                     /locus_tag="DDA3937_RS01025"
                     /old_locus_tag="Dda3937_04216"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315914.1"
                     /note="catalyzes the reduction of UDP-N-acetylglucosamine
                     enolpyruvate to form UDP-N-acetylmuramate in peptidoglycan
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="WP_013315914.1"
                     /db_xref="GI:503081030"
                     /db_xref="GeneID:9731599"
                     /translation="MTNSVTSLKSFNSFSLPVFATEVATIADSSALLSAWQRAHQGKL
                     PVLILGGGSNVLFLDDFHGIILINRLKGIEIKENASEWMLHVGAGENWHYLVEYTLER
                     QIAGLENLALIPGCVGSAPIQNIGAYGVELKKVCAYVDMLNLRTGETVRLSAEECQFG
                     YRDSVFKHEYQDGFAIIAVGLHLSKEWKPVLEYGDLTRLDHTVVTAKQIFDAVCQMRR
                     SKLPDPEVMGNAGSFFKNPVIPAAMAEHILASYPNVPHYPQPNGEVKLAAGWLIDQCG
                     LKGYQIGQAAVHDKQALVLVNKGEATSRDVVNLARYVRNQVAEKFEVWLEPEVRFISA
                     QGEVNALEVLA"
     gene            238153..239112
                     /locus_tag="DDA3937_RS01030"
                     /old_locus_tag="Dda3937_04217"
                     /db_xref="GeneID:9731600"
     CDS             238153..239112
                     /locus_tag="DDA3937_RS01030"
                     /old_locus_tag="Dda3937_04217"
                     /function="BirA controls the expression of genes involved
                     in biotin biosynthesis"
                     /function="1.5.3.1 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; biotin"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019846591.1"
                     /note="catalyzes the formation of biotinyl-5'-AMP, also
                     acts as a transcriptional repressor of the biotin operon;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional biotin--[acetyl-CoA-carboxylase]
                     synthetase/biotin operon repressor"
                     /protein_id="WP_013315915.1"
                     /db_xref="GI:503081031"
                     /db_xref="GeneID:9731600"
                     /translation="MKDYTVPLKLISILSDGEFYSGEYLGELMGMSRAAINKHIQTIR
                     EWGLDVFTVTGKGYALSAPIQLLDADKIRSHIQSGNIAVLPVIDSTNQYLLDRLDSVS
                     SGDACIAEYQNAGRGRRGRTWFSPFGSNLYLSLYWRLEQGPAAAVGVSLVIGIVMAEV
                     LHHLGADGVRVKWPNDLYLNDKKLAGILVELNGRTGDAAHLVIGAGINLRMNSSGSDV
                     INQGWINLQEAGIDIDRNMLAVKLITELRTALVIYEQQGLAPFISRWNDLDNFYNRAV
                     KLIVGNREITGIDKGIDSQGALLLEQDGGIQSYIGGEISLRGW"
     gene            complement(239136..240086)
                     /locus_tag="DDA3937_RS01035"
                     /old_locus_tag="Dda3937_04218"
                     /db_xref="GeneID:9731601"
     CDS             complement(239136..240086)
                     /locus_tag="DDA3937_RS01035"
                     /old_locus_tag="Dda3937_04218"
                     /function="1.5.3.5 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; Coenzyme
                     A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012882956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="WP_013315916.1"
                     /db_xref="GI:503081032"
                     /db_xref="GeneID:9731601"
                     /translation="MTNKAQSFATPYLQFDRQQWAHLRDSVPLTLTEDEIIKLKGINE
                     DLSLDEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQKIPYIIGIAGSVAVGKS
                     TTARVLQALLSRWPEHRKVELITTDGFLHPNKVLQQRNLMKKKGFPQSYDMHSLVKFV
                     SEIKSGVPWVTAPTYSHLTYDIVPDCNKVIEQPDILILEGLNVLQSGMDYPHDPHRVF
                     VSDFVDFSIYVDAPEELLKSWYINRFLKFRQGAFTNPDSYFHNYAKLAEVEAVNIASQ
                     LWNEINGLNLKQNILPTRGRASLIMTKSANHAVECVRLRK"
     gene            complement(240302..240850)
                     /locus_tag="DDA3937_RS01040"
                     /db_xref="GeneID:23677381"
     CDS             complement(240302..240850)
                     /locus_tag="DDA3937_RS01040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_033111521.1"
                     /db_xref="GI:696580342"
                     /db_xref="GeneID:23677381"
                     /translation="MKIVLLNVATLPVYRYELASLLVNAVAKGASVGYHSPLTHEEAE
                     SYFHSLRPSVAEGERLLWIARDDNGVIGSIQLELCQKSNGQNRAEVQKLLVHSSMRRQ
                     GIGKRLLSTLEQAALQHRRGLIYLDTQAGSPAEHFYRAQGYRYLGELPDYASSPDGYY
                     YPTAIYYKRLFAVNRVERALAS"
     gene            241227..241302
                     /locus_tag="DDA3937_RS01045"
                     /old_locus_tag="Dda3937_04227"
                     /db_xref="GeneID:9731604"
     tRNA            241227..241302
                     /locus_tag="DDA3937_RS01045"
                     /old_locus_tag="Dda3937_04227"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:241260..241262,aa:Thr,seq:tgt)
                     /db_xref="GeneID:9731604"
     gene            241320..241404
                     /locus_tag="DDA3937_RS01050"
                     /old_locus_tag="Dda3937_04228"
                     /db_xref="GeneID:9731605"
     tRNA            241320..241404
                     /locus_tag="DDA3937_RS01050"
                     /old_locus_tag="Dda3937_04228"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:241354..241356,aa:Tyr,seq:gta)
                     /db_xref="GeneID:9731605"
     gene            241708..241782
                     /locus_tag="DDA3937_RS01055"
                     /old_locus_tag="Dda3937_04229"
                     /db_xref="GeneID:9731606"
     tRNA            241708..241782
                     /locus_tag="DDA3937_RS01055"
                     /old_locus_tag="Dda3937_04229"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:241741..241743,aa:Gly,seq:tcc)
                     /db_xref="GeneID:9731606"
     gene            241792..241867
                     /locus_tag="DDA3937_RS01060"
                     /old_locus_tag="Dda3937_04230"
                     /db_xref="GeneID:9731607"
     tRNA            241792..241867
                     /locus_tag="DDA3937_RS01060"
                     /old_locus_tag="Dda3937_04230"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:241825..241827,aa:Thr,seq:ggt)
                     /db_xref="GeneID:9731607"
     gene            241974..243158
                     /gene="tuf"
                     /locus_tag="DDA3937_RS01065"
                     /old_locus_tag="Dda3937_00214"
                     /db_xref="GeneID:9731608"
     CDS             241974..243158
                     /gene="tuf"
                     /locus_tag="DDA3937_RS01065"
                     /old_locus_tag="Dda3937_00214"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="5.5.1 cell processes; adaptation to stress;
                     osmotic pressure"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1CN86.2"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_013315919.1"
                     /db_xref="GI:503081035"
                     /db_xref="GeneID:9731608"
                     /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGQA
                     RAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQ
                     YDFPGDDTPVIRGSALKALEGEAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDV
                     FSISGRGTVVTGRVERGIVKVGEEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVG
                     VLLRGTKRDEVERGQVLAKPGSIKPHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNIKMVVNLIAPIAMDDGLRFAIREGGRTVGAGVVAKV
                     IA"
     gene            243393..243776
                     /gene="secE"
                     /locus_tag="DDA3937_RS01070"
                     /old_locus_tag="Dda3937_00215"
                     /db_xref="GeneID:9731609"
     CDS             243393..243776
                     /gene="secE"
                     /locus_tag="DDA3937_RS01070"
                     /old_locus_tag="Dda3937_00215"
                     /function="2.3.5 information transfer; protein related;
                     export, signal peptide cleavage"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.3.A.5 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The Type II (General) Secretory Pathway
                     (IISP) Family"
                     /function="6.1 cell structure; membrane"
                     /function="4.S.160 transport; substrate; protein"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007665874.1"
                     /note="forms a complex with SecY and SecG; SecYEG forms a
                     putative protein-conducting channel to which secA binds
                     and translocates targeted polypeptides across the
                     cytoplasmic membrane, a process driven by ATP and a
                     proton-motive force; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_013315920.1"
                     /db_xref="GI:503081036"
                     /db_xref="GeneID:9731609"
                     /translation="MSANTEAQESGRGLEALKWLVVAVLLIAAIVGNYYYREFSLPLR
                     ALAVVVLIAAAGGVALLTTKGKATVLFAREARTEVRKVIWPTRQETLHTTLIVAAVTA
                     VMSLILWGLDGILVRLVSFITGLRF"
     gene            243778..244323
                     /gene="nusG"
                     /locus_tag="DDA3937_RS01075"
                     /old_locus_tag="Dda3937_00216"
                     /db_xref="GeneID:9731610"
     CDS             243778..244323
                     /gene="nusG"
                     /locus_tag="DDA3937_RS01075"
                     /old_locus_tag="Dda3937_00216"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004953928.1"
                     /note="Modulates Rho-dependent transcription termination;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination factor
                     NusG"
                     /protein_id="WP_013315921.1"
                     /db_xref="GI:503081037"
                     /db_xref="GeneID:9731610"
                     /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHSMEDHFGEVMV
                     PTEEVVEIRGGQRRKSERKFFPGYVLVQMVMDDASWHLVRSVPRVMGFIGGTSDRPAP
                     ISDKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKV
                     SVSIFGRATPVELDFGQVEKG"
     gene            244472..244900
                     /locus_tag="DDA3937_RS01080"
                     /old_locus_tag="Dda3937_00217"
                     /db_xref="GeneID:9731611"
     CDS             244472..244900
                     /locus_tag="DDA3937_RS01080"
                     /old_locus_tag="Dda3937_00217"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006121495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_013315922.1"
                     /db_xref="GI:503081038"
                     /db_xref="GeneID:9731611"
                     /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNA
                     KTESLEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVT
                     HAQVLEIAQTKAADMTGADVEAMARSIAGTARSMGLVVED"
     gene            244904..245608
                     /locus_tag="DDA3937_RS01085"
                     /old_locus_tag="Dda3937_00218"
                     /db_xref="GeneID:9731612"
     CDS             244904..245608
                     /locus_tag="DDA3937_RS01085"
                     /old_locus_tag="Dda3937_00218"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="3.1.3.1 regulation; type of regulation;
                     posttranscriptional; translation attenuation and
                     efficiency"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_013315923.1"
                     /db_xref="GI:503081039"
                     /db_xref="GeneID:9731612"
                     /translation="MAKLTKRMRVIREKVDVTKQYDVNEAVALLKELATAKFVESVDV
                     AVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLAD
                     QIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQ
                     IRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPAQAKGVYIKKISLSTTM
                     GAGVAIDQSGLNAVAN"
     gene            245953..246450
                     /gene="rplJ"
                     /locus_tag="DDA3937_RS01090"
                     /old_locus_tag="Dda3937_00219"
                     /db_xref="GeneID:9731613"
     CDS             245953..246450
                     /gene="rplJ"
                     /locus_tag="DDA3937_RS01090"
                     /old_locus_tag="Dda3937_00219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016505810.1"
                     /note="binds the two ribosomal protein L7/L12 dimers and
                     anchors them to the large ribosomal subunit; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_012882962.1"
                     /db_xref="GI:502646628"
                     /db_xref="GeneID:9731613"
                     /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKA
                     GREAGVYMRVVRNTLLRRVVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKA
                     NAKFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRD
                     QKEAA"
     gene            246517..246885
                     /gene="rplL"
                     /locus_tag="DDA3937_RS01095"
                     /old_locus_tag="Dda3937_04437"
                     /db_xref="GeneID:9731614"
     CDS             246517..246885
                     /gene="rplL"
                     /locus_tag="DDA3937_RS01095"
                     /old_locus_tag="Dda3937_04437"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A7MQP6.1"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_013315924.1"
                     /db_xref="GI:503081040"
                     /db_xref="GeneID:9731614"
                     /translation="MSITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVASA
                     GPAEAAEEKTEFDVILKAVGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEAVSK
                     DDAEALKKSLEEAGAEVEVK"
     gene            247206..251234
                     /gene="rpoB"
                     /locus_tag="DDA3937_RS01100"
                     /old_locus_tag="Dda3937_00220"
                     /db_xref="GeneID:9731615"
     CDS             247206..251234
                     /gene="rpoB"
                     /locus_tag="DDA3937_RS01100"
                     /old_locus_tag="Dda3937_00220"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004870488.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; beta subunit
                     is part of the catalytic core which binds with a sigma
                     factor to produce the holoenzyme; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_013315925.1"
                     /db_xref="GI:503081041"
                     /db_xref="GeneID:9731615"
                     /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPE
                     GQYGLEAAFRSVFPISSYSGNSELQYVSYRLGEPVFDVQECQIRGVTFSAPLRVKLRL
                     VIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSD
                     KGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALSYSTE
                     EILDLFFDKVVYEIHNNKLQMELVPERLRGETASFDIEADGKVYVEKGRRITARHIRQ
                     LEKDGIERIEVPVEYIAGKVLAKDYVDESTGEVIAMANMELSLDLLAKLSQAGHKRLD
                     TLFTNDLDHGPYMSETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAETLFENLFFSE
                     DRYDLSAVGRMKFNRSLLREEIEGSGILSKADIIDVMKKLIDIRNGKGEVDDIDHLGN
                     RRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGS
                     SQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEG
                     PNIGLINSLSVYAQTNEYGFLETPYRRVRDGVVTDEIHYLSAIEEGNYVIAQANTNLD
                     DEGHFIEELVTCRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMG
                     ANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKRGGTVQYVDASRIVIKVNEDE
                     MYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERGDVLADGPSTDLGELALGQ
                     NMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPN
                     VGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
                     DSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLF
                     ARIHYVLVAGGVEADKLDKLPRERWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLE
                     AKRRKITQGDDLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYD
                     ENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQ
                     RAYDLGNDVRQKVDLNTFSDEEVLRLAENLKKGMPIATPVFDGAKENEIKELLKLGDL
                     PTSGQIRLFDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGK
                     AQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMP
                     ESFNVLLKEIRSLGINIELEEE"
     gene            251342..255565
                     /locus_tag="DDA3937_RS01105"
                     /old_locus_tag="Dda3937_00221"
                     /db_xref="GeneID:9731616"
     CDS             251342..255565
                     /locus_tag="DDA3937_RS01105"
                     /old_locus_tag="Dda3937_00221"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009092657.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates. Subunit beta'
                     binds to sigma factor allowing it to bind to the -10
                     region of the promoter; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_013315926.1"
                     /db_xref="GI:503081042"
                     /db_xref="GeneID:9731616"
                     /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERM
                     GHIELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQIL
                     TEEQYLDALEEFGDEFDAKMGAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLT
                     KRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLAT
                     TIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTRDCVNAKGEGMVLTGPKEAERIYRAGLASLHARVKVRITEHQKNAQGEWTQK
                     ISLIDTTVGRAILWMIVPKGLPYSIVNQALGKKAISKMLNTCYRVLGLKPTVIFADQI
                     MYTGFAYAARSGSSVGIDDMVIPAKKVEIISEAEAEVAEIQEQFQSGLVTAGERYNKV
                     IDIWAAANERVAKAMMENLSTETVINRNGEEEKQVSFNSIFMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRERVLGRVTAEDVLKPGTADI
                     LVPRNTLLNEKWCDLLEENSVDAVKVRSVVGCETDFGVCAKCYGRDLARGHIINKGEA
                     IGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSLKLTNAKFVKNVAGK
                     LVITSRNTELKLIDEFGRTKESYKVPYGAVMGKGDGSEVNGGDTVANWDPHTMPVITE
                     VGGSIRFTDMIDGQTITRQTDELTGLSSIVVLDSAERTGGGKDLRPALKIVDANGDDV
                     LIPGTDMPAQYFLPGKAIVQLEDGSQIGAGDTLARIPQESGGTKDITGGLPRVADLFE
                     ARRPKEPAILAEISGVVSFGKETKGKRRLVITPVDGSEPYEEMIPKWRQLNVFEGERV
                     ERGDVISDGPESPHDILRLRGVHAVTRYIVNEVQEVYRLQGVKINDKHIEVIVRQMLR
                     KGTIVNPGSSEFLEGEQVEMSRIKIANRQLETDGKITATYSRDLLGITKASLATESFI
                     SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRQAGEV
                     PAVAQVSADEASANLAELLNAGFGSSDDE"
     gene            255743..256000
                     /locus_tag="DDA3937_RS01110"
                     /old_locus_tag="Dda3937_04438"
                     /db_xref="GeneID:9731617"
     CDS             255743..256000
                     /locus_tag="DDA3937_RS01110"
                     /old_locus_tag="Dda3937_04438"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315927.1"
                     /db_xref="GI:503081043"
                     /db_xref="GeneID:9731617"
                     /translation="MIRSALMAKLTRWAVAGDVKKRFQRFMIRFALMAKLTRWAVAGD
                     VKKRFQRFMIRSALMAELTRWAVAGDVKKRFQRFFSGGEKT"
     gene            256044..257141
                     /locus_tag="DDA3937_RS01115"
                     /old_locus_tag="Dda3937_00222"
                     /db_xref="GeneID:9731618"
     CDS             256044..257141
                     /locus_tag="DDA3937_RS01115"
                     /old_locus_tag="Dda3937_00222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111522.1"
                     /db_xref="GI:696580343"
                     /db_xref="GeneID:9731618"
                     /translation="MRFTTTLSGIILVLLSGSAFSAGEMPSGYPTPVQKVFRHWQITC
                     NNLNDCDIRNNDPYLRVTLKREAGAQGKISLDFDLADKRQALYLDGVRFPLSQPAWQT
                     DEEEGAFYVHTDQLDVIQQFVMAAKNAKRLSLSEHGGSQGNNQEESISLNGLNAALLL
                     ADERQGRLNNLSALLQVGNGEVAQVPPVPVGQEINPAYTQPPPLTNAKILINGVISAK
                     KNLLEEEDCGLSKEARQLSEAEPLTNELALVMLNCGMGAYQSSSMLFVTPRNNPQAAQ
                     LLELPRPIRPADSREEKIRWFTEADYDPESGMLYHSAKGRGIADCGESAQWVFDGKTF
                     QLVAYNYQPECNGGQPGDWPSVWAMPGYPTE"
     gene            258160..259596
                     /locus_tag="DDA3937_RS01120"
                     /old_locus_tag="Dda3937_00224"
                     /db_xref="GeneID:9731621"
     CDS             258160..259596
                     /locus_tag="DDA3937_RS01120"
                     /old_locus_tag="Dda3937_00224"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013315931.1"
                     /db_xref="GI:503081047"
                     /db_xref="GeneID:9731621"
                     /translation="MTRYQHLATLLAQRIEQGLYRGGERLPSVRMLSQEHGVSISTVQ
                     QAYYLLEQQQLIVPLPRSGYFVRSRKAEPPIPAMSKPVQRPVEVKKWSAVLELVNARL
                     DPGVISLGSSSPDLTQSTLKPLWKQLQRIGQKQMAASFVYDNLAGVPLLREQIARLMV
                     DSGCQLSADDIVVTTGCTEALAVAVRAVAHPGDIIAVESPVFHGILQILCGLDIKVIE
                     IPTDFTTGINLEALELALDQWPIKAVITVPHCNNPLGFIMPMQRKRALLTLAQRYDIA
                     IIEDDVYGELAYEYPRPVTLKSMDIDGRVLLCSSFSKTLAPGLRVGWVVPGRYLDRAL
                     HMKYTSTGSSTVCTQLAVAEFIQQGHYQPHVRRMRGIYQRNLEMFTCWVRRYFPETIC
                     VSRPKGGFVLWVEMPESFDGVQLRQQLRENKIHIAEGSLFSASGKYRHGLRMSCAMPM
                     TPEIEQVVATIGAAVERALAAGMHETTA"
     gene            complement(259697..260464)
                     /locus_tag="DDA3937_RS01125"
                     /old_locus_tag="Dda3937_00225"
                     /db_xref="GeneID:9731622"
     CDS             complement(259697..260464)
                     /locus_tag="DDA3937_RS01125"
                     /old_locus_tag="Dda3937_00225"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012882970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, molybdopterin-binding protein"
                     /protein_id="WP_013315932.1"
                     /db_xref="GI:503081048"
                     /db_xref="GeneID:9731622"
                     /translation="MSDKSPRRAPLLLEPDQKKRLVNLERRLMLRSGLTLGAVAMLTG
                     CNMQDGDSVDKVLWAMSRWNDRVQAWLFNGQRLAPSYRRDQITQPFPFNAYYPEYNVP
                     EIYLDSYRLEVAGKVEKKGVWTLEQLRQLPQETQITRLICIEGWSAVGQWRGIPLRHF
                     LQHIGADLTARYVGFKCADRYYSSIDMATALHPQTILALEFGDQALPADYGYPLRLRV
                     PTKLGFKNAKHVAALFVSDTNPGGYWEDQGYNWFSGI"
     gene            complement(260457..261059)
                     /locus_tag="DDA3937_RS01130"
                     /old_locus_tag="Dda3937_00226"
                     /db_xref="GeneID:9731623"
     CDS             complement(260457..261059)
                     /locus_tag="DDA3937_RS01130"
                     /old_locus_tag="Dda3937_00226"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="1.6.15.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; large molecule carriers;
                     cytochromes"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin reductase"
                     /protein_id="WP_013315933.1"
                     /db_xref="GI:503081049"
                     /db_xref="GeneID:9731623"
                     /translation="MPTSRRPVHPWPVRLTHWLNLLAMIGMFMSGWEIYNASPLFDFH
                     FPHAMTLGGWLGGAISWHLAVMWLLVGNGLLYVLWSLCSGHWRQRWLPLTPASLWRDI
                     RLALTFRLRHESYQYNAIQKLMYFGVITLGVLLVLSGLAIWKPVQLQGLVTVLGGFAI
                     ARYVHFFAMAGIGLFVVIHVLMVLIVPRTLWAMLTGGKHE"
     gene            complement(261086..261709)
                     /locus_tag="DDA3937_RS01135"
                     /old_locus_tag="Dda3937_00227"
                     /db_xref="GeneID:9731624"
     CDS             complement(261086..261709)
                     /locus_tag="DDA3937_RS01135"
                     /old_locus_tag="Dda3937_00227"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315934.1"
                     /db_xref="GI:503081050"
                     /db_xref="GeneID:9731624"
                     /translation="MIRHRLTGLLFSSLLLCSQWSFAADAPAKPQPPVRGTISAISNT
                     QLQLTDRKGQKIDVKLTDQTRVMSVAQANPDTIKPDSFIGTAAIPQPDGTLKALEVHV
                     FDASLRGAGEGFRPWESADGKSGTMTNGTVGKLVNSNGRTLTVTYNGGQKTVVVPDDV
                     PIVSISPGDRSLLKPGAHIVLFSKLDEQGERVAVAISAGKDGTVPPM"
     gene            261875..262546
                     /locus_tag="DDA3937_RS01140"
                     /old_locus_tag="Dda3937_00228"
                     /db_xref="GeneID:9731625"
     CDS             261875..262546
                     /locus_tag="DDA3937_RS01140"
                     /old_locus_tag="Dda3937_00228"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315935.1"
                     /note="response regulator in two-component regulatory
                     system with CusS; regulates the copper efflux system;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013315935.1"
                     /db_xref="GI:503081051"
                     /db_xref="GeneID:9731625"
                     /translation="MRILVIEDDAGTGDYLKKGLTEAGYAVDLARNGTDGLFNALEHG
                     YDAIILDVMLPGLNGWQIIEMLRKKSDVPVLFLTARDQLHDRIHGLELGADDYLIKPF
                     SFTELVLRMRTLLRRGAVREADHYVVADLQLDVLRRKATRQDTAIPLTNKEFMLLHLL
                     VRREGEVLSRTLIASQVWDMNFDSDTNVVDVAVKRLRAKIDKPFDVKLIHTVRGIGYV
                     CEPRS"
     gene            262543..264006
                     /locus_tag="DDA3937_RS01145"
                     /old_locus_tag="Dda3937_00229"
                     /db_xref="GeneID:9731626"
     CDS             262543..264006
                     /locus_tag="DDA3937_RS01145"
                     /old_locus_tag="Dda3937_00229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_033111523.1"
                     /db_xref="GI:696580344"
                     /db_xref="GeneID:9731626"
                     /translation="MKLWLQRWRASSLTLRCSLLFALTTALVVSSVGGYLYGVLSQEM
                     YRRSDVQVTGRVEYYRRLLGRNFTLPMLTANTGMFENMLGSEQDVLLFSLPGQKPLIS
                     VNPARIVLPDIAPIAVDMPLQTDAVHGSLTEQGVPLRAIAAQVRLNDGQMLQITAAHV
                     MFSEQKMLEHYLWRVMGAVAIAFVLIGGLGYLALRRGLLPLWRMTAQASAIAPNTLST
                     RISDADAPQEMRQLIRAFNAMLDRLNEGYLRLTQFSADLAHEIRTPIGALMGHCQVAL
                     YQPRSVEEYETLLSDNIAELERMSRMVENILFLARASHEQPVLSRVSVEVATELHRVA
                     DYFEMLAEERGIELLCEGHARLAVDALLFQRALSNLVANAVRYAKADSPVRLSVAVFT
                     EQVVVEVVNLGPVLPPSQLEQLFDRFYRADATRSASSDSSGLGLSIVRAIMTLHGGEV
                     IARCDPLDETIGRITFRLIFPASRDDHTLLAKSPLSR"
     gene            complement(264020..265183)
                     /gene="thiH"
                     /locus_tag="DDA3937_RS01150"
                     /old_locus_tag="Dda3937_00230"
                     /db_xref="GeneID:9731627"
     CDS             complement(264020..265183)
                     /gene="thiH"
                     /locus_tag="DDA3937_RS01150"
                     /old_locus_tag="Dda3937_00230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848177.1"
                     /note="in Escherichia coli this enzyme functions in
                     thiamine biosynthesis along with thiFSGI and iscS; with
                     ThiFSG catalyzes the formation of thiazole phosphate from
                     tyrosine, cysteine and 1-deoxy-D-xylulose-5-phosphate;
                     forms a complex with ThiG; contains an iron-sulfur center;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiH"
                     /protein_id="WP_042318713.1"
                     /db_xref="GI:754962790"
                     /db_xref="GeneID:9731627"
                     /translation="MDSQTIDGKHQPPSFERHWQQLEWHDLTLRINSKTDADVERALC
                     ADRLTREDMMALLSPAAGRWLEPLAQRAQQLTRQRFGNTVSFYVPLYLSNLCANDCTY
                     CGFSMSNHLKRKTLDEQEILRECEAIKALGFDHLLLVTGEHQRKVGMDYFRQMLPLIR
                     PQFSSLMMEVQPLSQAEYAELKTLGLDGVMVYQETYHPATYARHHLRGHKQDFAWRLA
                     TPDRLGRAGIDKIGLGALIGLSDSWRTDCYMVAEHLLYLQQTYWQSRYSVSFPRLRPC
                     AGGIEPASLMDEAQLMQVICAFRLLAPDVELSLSTRESPFFRDHMIPIAINNVSAFSK
                     TQPGGYADDHPELEQFTPHDNRRPQAVADALTRAGLQPVWKDWDGYLGRPVTG"
     gene            complement(265273..266052)
                     /locus_tag="DDA3937_RS01155"
                     /old_locus_tag="Dda3937_00231"
                     /db_xref="GeneID:9731628"
     CDS             complement(265273..266052)
                     /locus_tag="DDA3937_RS01155"
                     /old_locus_tag="Dda3937_00231"
                     /function="1.5.3.8 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; thiamin"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole synthase"
                     /protein_id="WP_013315938.1"
                     /db_xref="GI:503081054"
                     /db_xref="GeneID:9731628"
                     /translation="MLKIADITFTSRLLTGTGKFSSAKLMQDALHASGSQLVTLAMKR
                     VDLKSGSDAILAPLRELGVHLLPNTSGAKTAEEAVFAARLAREALGTHWVKLEIHPDM
                     KYLLPDPVETLKAAEQLVKDGFVVLPYCGADPVLCKRLEDAGCAAVMPLGAPIGSNQG
                     LQTRDFLRIIIEQARVPVVVDAGIGAPSHAAEAIELGADAVLVNTAIAVARDPVQMAH
                     AFRLAVDAGAIARQAGLGNRQRIASATSPLTGFLQHTEVAS"
     gene            complement(266054..266254)
                     /locus_tag="DDA3937_RS01160"
                     /old_locus_tag="Dda3937_00232"
                     /db_xref="GeneID:9731629"
     CDS             complement(266054..266254)
                     /locus_tag="DDA3937_RS01160"
                     /old_locus_tag="Dda3937_00232"
                     /function="1.5.3.8 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; thiamin"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur carrier protein ThiS"
                     /protein_id="WP_013315939.1"
                     /db_xref="GI:503081055"
                     /db_xref="GeneID:9731629"
                     /translation="MKIRLNDDVIELQDGLTVAQLLGQLERLQPGTALAINQTIIPRD
                     VWTQHALRDGDDILLFQAIAGG"
     gene            complement(266251..267000)
                     /locus_tag="DDA3937_RS01165"
                     /old_locus_tag="Dda3937_00233"
                     /db_xref="GeneID:9731630"
     CDS             complement(266251..267000)
                     /locus_tag="DDA3937_RS01165"
                     /old_locus_tag="Dda3937_00233"
                     /function="1.5.3.8 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; thiamin"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein MoeB"
                     /protein_id="WP_013315940.1"
                     /db_xref="GI:503081056"
                     /db_xref="GeneID:9731630"
                     /translation="MLDDQAFMRYSRQLLLEDIGQEGQQKLAAARVLLVGMGGLGSPA
                     ALYLAAAGVGTLLLADHDTLHISNLQRQILYRNADLSHPKAVLARHALEAVNPLVKTV
                     ALTTRLEGQPLEKAVAQADLVLDCCDNMTTRHAVNAACVAAQKPLISASAVGFSGQLL
                     VLTPPYTHGCYACLYPDASEPQRNCRTAGVLGPVVGVMGTLQALEAIKLLCGLPSPLD
                     GKLRLFDARQHQWSTLQLTRSPACPVCGGLA"
     gene            complement(267002..267637)
                     /locus_tag="DDA3937_RS01170"
                     /old_locus_tag="Dda3937_00234"
                     /db_xref="GeneID:9731631"
     CDS             complement(267002..267637)
                     /locus_tag="DDA3937_RS01170"
                     /old_locus_tag="Dda3937_00234"
                     /function="1.5.3.8 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; thiamin"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315941.1"
                     /note="catalyzes the formation of thiamine monophosphate
                     from 4-methyl-5-(beta-hydroxyethyl)-thiazole monophosphate
                     and 4-amino-5-hydroxymethyl pyrimidine pyrophosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="WP_013315941.1"
                     /db_xref="GI:503081057"
                     /db_xref="GeneID:9731631"
                     /translation="MNGAFPATDARLGLYPVVDSVEWIERLLGAGVHTIQLRIKDQPA
                     DQAEPDIIRSIALGRRYQARLFINDYWQLAVKHQAYGVHLGQEDLDTADLDAIRAAGL
                     RLGVSTHDDAELARAVAIKPSYIALGHIFPTQTKAMPSAPQGLVELARHIRALDGRFP
                     TVAIGGISIDRVPAVLETGVGSIAVVSAITQAADWRAATATLLRLTEGREA"
     gene            complement(267637..269604)
                     /locus_tag="DDA3937_RS01175"
                     /old_locus_tag="Dda3937_00235"
                     /db_xref="GeneID:9731632"
     CDS             complement(267637..269604)
                     /locus_tag="DDA3937_RS01175"
                     /old_locus_tag="Dda3937_00235"
                     /function="1.5.3.8 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; thiamin"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315942.1"
                     /note="catalyzes the formation of
                     4-amino-2-methyl-5-phosphomethylpyrimidine from
                     5-amino-1-(5-phospho-D-ribosyl)imidazole and
                     S-adenosyl-L-methionine in thiamine biosynthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine synthase ThiC"
                     /protein_id="WP_013315942.1"
                     /db_xref="GI:503081058"
                     /db_xref="GeneID:9731632"
                     /translation="MSTEPTQSTEQNVSGEKKSSGRREQRAAAQQFIDTLRGSTFPNS
                     QRIYLTGSQPDIRVPMREIQLSPTLLGGSRDNPRYEANEAVPVYDTAGPYGDPAITPD
                     VHRGLGKLRADWITGRDDTEALPKASSGFTQQRLADIGLDHLRFEHLPQPKRAKAGRR
                     VTQLHYARQGIITPEMEFIAIRENMGRERVRGEVLRQQHPGHSFGALLPDNITPEFVR
                     QEVAAGRAIIPANINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWATRW
                     GADTVMDLSTGRYIHETREWILRNSPVPIGTVPIYQALEKVNGIAENLTWELFRDTLL
                     EQAEQGVDYFTIHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFRD
                     ICDICSAYDVALSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPG
                     HVPMQMIRRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLC
                     YVTPKEHLGLPNKNDVKQGLIAYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQ
                     FNLALDPETARAYHDETLPQESGKVAHFCSMCGPKFCSMKITQEVRDYAARQGAQAQP
                     VDVGMAQMSAEFRARGSELYHTATSLPQEER"
     gene            complement(269940..270389)
                     /locus_tag="DDA3937_RS01180"
                     /old_locus_tag="Dda3937_00236"
                     /db_xref="GeneID:9731633"
     CDS             complement(269940..270389)
                     /locus_tag="DDA3937_RS01180"
                     /old_locus_tag="Dda3937_00236"
                     /function="3.1.2.1 regulation; type of regulation;
                     transcriptional level; sigma factors, anti-sigmafactors"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.3.3 regulation; genetic unit regulated;
                     stimulon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848171.1"
                     /note="binds specifically to the major sigma factor sigma
                     70; active in stationary phase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-RNA polymerase sigma 70 factor"
                     /protein_id="WP_013315943.1"
                     /db_xref="GI:503081059"
                     /db_xref="GeneID:9731633"
                     /translation="MLKQLQRLTENVGGNYALIDQWLLARKHLLLAYYHLLSIQTGKI
                     PEARTLDEFCHHLVDYLSVGHFHVYERMLQENIMRNDRKLTQASHFDVALRSNTQQIM
                     DIYDSHLAFFIDPVDSQEFRQTLSGVGEALAMRFTLEDSLIRLMFDH"
     gene            270493..271266
                     /gene="nudC"
                     /locus_tag="DDA3937_RS01185"
                     /old_locus_tag="Dda3937_00237"
                     /db_xref="GeneID:9731634"
     CDS             270493..271266
                     /gene="nudC"
                     /locus_tag="DDA3937_RS01185"
                     /old_locus_tag="Dda3937_00237"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315944.1"
                     /note="can catalyze hydrolysis of broad range of
                     dinucleotide pyrophosphates but prefers reduced form of
                     NADH; requires divalent metal ions such as magnesium and
                     manganese and produces two mononucleoside 5'-phosphates;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH pyrophosphatase"
                     /protein_id="WP_013315944.1"
                     /db_xref="GI:503081060"
                     /db_xref="GeneID:9731634"
                     /translation="MEVTLKGEESGWWVVYHHHQIWLPQGELPQGTAAQWQLQRQSAR
                     QVGEWQGEPVWLVLQDKTSDMGSVRQLLGQDAGLFQLAGRAVQLAEFYRSHRFCGYCG
                     HEMSASTTELACLCLHCKERYYPQIAPCVIVAIRRHDKILLAQHLRHKGNMYTTLAGF
                     VEVGETLEQAVAREVMEESNIRVRNLRYVSSQPWPFPHSLMMAFMADYDGGEVKPDPS
                     ELRDADWFRYDRLPELPPPGTVARRLIEDTVVLCREADC"
     gene            271322..272395
                     /gene="hemE"
                     /locus_tag="DDA3937_RS01190"
                     /old_locus_tag="Dda3937_00238"
                     /db_xref="GeneID:9731635"
     CDS             271322..272395
                     /gene="hemE"
                     /locus_tag="DDA3937_RS01190"
                     /old_locus_tag="Dda3937_00238"
                     /function="1.5.3.12 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; heme,
                     porphyrine"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315945.1"
                     /note="catalyzes the formation of coproporphyrinogen from
                     uroporphyrinogen III; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="WP_013315945.1"
                     /db_xref="GI:503081061"
                     /db_xref="GeneID:9731635"
                     /translation="MTDLKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYRATRSQAG
                     DFMSLCKNAELACEVTLQPLRRYNLDAAILFSDILTVPDAMGLGLYFEAGEGPRFTSP
                     VTCHADVEKLPVPDPEQELGYVMNAVRTIRRNLAGAVPLIGFSGSPWTLATYMVEGGS
                     SKAFTVIKKMMFAEPRTLHLLLDKLADSVTLYLNAQIRAGAQAVMIFDTWGGALSGAD
                     YREFSLHYMHKIVDGLLRENDGRRVPVTLFTKGGGQWLEAMADTGCDALGLDWTTDIA
                     DARRRVGDRVALQGNMDPSMLYAPPARIEQEVATILAGFGAGNGHVFNLGHGIHQDVP
                     PEHAGAFVEAVHRLSAPYHQDLA"
     gene            272395..273069
                     /locus_tag="DDA3937_RS01195"
                     /old_locus_tag="Dda3937_00239"
                     /db_xref="GeneID:9731636"
     CDS             272395..273069
                     /locus_tag="DDA3937_RS01195"
                     /old_locus_tag="Dda3937_00239"
                     /function="1.2.2 metabolism; macromolecule degradation;
                     DNA"
                     /function="2.1.5 information transfer; DNA related; DNA
                     degradation"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315946.1"
                     /note="Selectively cleaves double-stranded DNA at the
                     second phosphodiester bond 3' to a deoxyinosine leaving
                     behind the intact lesion on the nicked DNA; cleaves DNA
                     containing urea residues, AP sites, base mismatches,
                     insertion/deletion mismatches, flaps, and pseudo-Y
                     structures; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease VIII"
                     /protein_id="WP_013315946.1"
                     /db_xref="GI:503081062"
                     /db_xref="GeneID:9731636"
                     /translation="MDMQALREEQRDKAVQVIRHDDVPFEQPTLIAGADVGFEQDGAV
                     TRAALAVLTYPSLQLVEYQIARIPTIMPYIPGFLSFREYPALLAAWEQLQHRPDLLFV
                     DGHGVSHPRRLGVASHFGLLVNVPTIGVAKRRLCGQFAPLEDAVGSRQPLLDKDEQIG
                     WVWRSKARCNPLFVSTGHRIGVDSALQWVMRCMNGYRLPEPTRWADAVASNRPAFQRW
                     QRQAGL"
     gene            273161..273751
                     /locus_tag="DDA3937_RS01200"
                     /old_locus_tag="Dda3937_00240"
                     /db_xref="GeneID:9731637"
     CDS             273161..273751
                     /locus_tag="DDA3937_RS01200"
                     /old_locus_tag="Dda3937_00240"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012882984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315947.1"
                     /db_xref="GI:503081063"
                     /db_xref="GeneID:9731637"
                     /translation="MLRNPIHLRLEKLTSWQHVTFMACLCERMYPNYHEFCQQTGFGD
                     AQLYRRMLDLVWETLVVKDAKVNFDSQLEKLEDAIPAADDYDIYGVYPAIDACVALSE
                     LLHSRLSGETLEHAITISEMSIRTVAMLEMTQAGREMTDEELKVVPAVEEEWDIQWEI
                     FRLLADCEERDVELIKGLRADLRESGISNIGINLYQ"
     gene            273939..274211
                     /locus_tag="DDA3937_RS01205"
                     /old_locus_tag="Dda3937_00241"
                     /db_xref="GeneID:9731638"
     CDS             273939..274211
                     /locus_tag="DDA3937_RS01205"
                     /old_locus_tag="Dda3937_00241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013200312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012882985.1"
                     /db_xref="GI:502646651"
                     /db_xref="GeneID:9731638"
                     /translation="MNKTQLIDVIADKADLSKTQAKAALEATLAAITESLKEGDAVQL
                     VGFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
     gene            274300..274926
                     /locus_tag="DDA3937_RS01210"
                     /old_locus_tag="Dda3937_00242"
                     /db_xref="GeneID:9731639"
     CDS             274300..274926
                     /locus_tag="DDA3937_RS01210"
                     /old_locus_tag="Dda3937_00242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111524.1"
                     /db_xref="GI:696580345"
                     /db_xref="GeneID:9731639"
                     /translation="MVCWLSACSSSTPSPAVYASGYLADSGVVRLWRKDDAPQHLTTL
                     VTALSPLQGQDARITRYRFQQGVLREVQQTYSASAREEVRLRFDQAGTVSYMQRQLPD
                     RRESLSEDEIALFQFDARRLLELSDSLRAGKVSLMQGRWNAGQVITCDGQTVRPDLDR
                     ASLAWIAQRAERATGPLSVAWLVSPEGTQLLQVAEADFCRWVPTVEAW"
     gene            complement(275011..276300)
                     /locus_tag="DDA3937_RS01215"
                     /old_locus_tag="Dda3937_00243"
                     /db_xref="GeneID:9731640"
     CDS             complement(275011..276300)
                     /locus_tag="DDA3937_RS01215"
                     /old_locus_tag="Dda3937_00243"
                     /function="1.5.2.1 metabolism; building block
                     biosynthesis; nucleotide; purine biosynthesis"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315949.1"
                     /note="catalyzes the formation of
                     N(1)-(5-phospho-D-ribosyl)glycinamide from
                     5-phospho-D-ribosylamine and glycine in purine
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="WP_013315949.1"
                     /db_xref="GI:503081065"
                     /db_xref="GeneID:9731640"
                     /translation="MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEPALE
                     NVNIAATDIPALLDFARQNTIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLE
                     GSKAFTKDFLARQHIPTAEYQNFTEIEPALAYIRRKGAPIVIKADGLAAGKGVIVAMT
                     LEEAENAATDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGEHVLPMATSQDHKRV
                     GDKDTGPNTGGMGAYSPAPVVTDEVHQRVMDQIIWPTVRGMAAEGNVYTGFLYAGLMI
                     SADGQPKVIEFNCRFGDPETQPIMLRLKSDLVELCLAACDGKLDEKTSDWDARPSLGV
                     VLAAGGYPADYRNGDVISGLPTQDATDGKVFHAGTRLNGDDVVTNGGRVLCVTALGHS
                     VAEAQQRAYELAKPISWEGSFCRSDIGYRAIAREQKI"
     gene            complement(276316..277905)
                     /gene="purH"
                     /locus_tag="DDA3937_RS01220"
                     /old_locus_tag="Dda3937_00244"
                     /db_xref="GeneID:9731641"
     CDS             complement(276316..277905)
                     /gene="purH"
                     /locus_tag="DDA3937_RS01220"
                     /old_locus_tag="Dda3937_00244"
                     /function="1.5.2.1 metabolism; building block
                     biosynthesis; nucleotide; purine biosynthesis"
                     /function="1.7.33 metabolism; central intermediary
                     metabolism; nucleotide and nucleoside conversions"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004155018.1"
                     /note="involved in de novo purine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine biosynthesis protein purH"
                     /protein_id="WP_013315950.1"
                     /db_xref="GI:503081066"
                     /db_xref="GeneID:9731641"
                     /translation="MQQRRPIRRALLSVSDKAGIVEFAQALSQRGIDLLSTGGTARLL
                     ADAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDAIMTQHNIQPIDMVV
                     VNLYPFAQTVAKADCTLEDAVENIDIGGPTMVRSAAKNHNDVAIVVKSSDYTAIITEM
                     DANEGSLTYETRFDLAIKAFEHTAAYDSMIANYFGSKVPAYHGDTTQPSGHFPRTLNL
                     NFIKKQDMRYGENSHQQAAFYIEEKVAEASVATAQQLQGKALSYNNIADTDAALECVK
                     EFVEPACVIVKHANPCGVAIGDSILDAYERAYKTDPTSAFGGIIAFNRELDEATAQAI
                     ISRQFVEVIIAPSASEAALKVTAAKQNVRVLTCGQWQQRVSGLDFKRVNGGLLVQDRD
                     LGMVEAAQLRVVTERQPTEAELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSR
                     VYSAKIAGIKAGDEGLEVKGSVMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEV
                     IAAANEHGIAMLFTDMRHFRH"
     gene            278503..280051
                     /locus_tag="DDA3937_RS01225"
                     /old_locus_tag="Dda3937_04665"
                     /db_xref="GeneID:9731643"
     rRNA            278503..280051
                     /locus_tag="DDA3937_RS01225"
                     /old_locus_tag="Dda3937_04665"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:9731643"
     gene            280117..280193
                     /locus_tag="DDA3937_RS01230"
                     /old_locus_tag="Dda3937_04247"
                     /db_xref="GeneID:9731644"
     tRNA            280117..280193
                     /locus_tag="DDA3937_RS01230"
                     /old_locus_tag="Dda3937_04247"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:280151..280153,aa:Ile,seq:gat)
                     /db_xref="GeneID:9731644"
     gene            280298..280373
                     /locus_tag="DDA3937_RS01235"
                     /old_locus_tag="Dda3937_04248"
                     /db_xref="GeneID:9731645"
     tRNA            280298..280373
                     /locus_tag="DDA3937_RS01235"
                     /old_locus_tag="Dda3937_04248"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:280331..280333,aa:Ala,seq:tgc)
                     /db_xref="GeneID:9731645"
     gene            280533..283467
                     /locus_tag="DDA3937_RS01240"
                     /old_locus_tag="Dda3937_04222"
                     /db_xref="GeneID:9731646"
     rRNA            280533..283467
                     /locus_tag="DDA3937_RS01240"
                     /old_locus_tag="Dda3937_04222"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:9731646"
     gene            283558..283673
                     /locus_tag="DDA3937_RS01245"
                     /old_locus_tag="Dda3937_04223"
                     /db_xref="GeneID:9731647"
     rRNA            283558..283673
                     /locus_tag="DDA3937_RS01245"
                     /old_locus_tag="Dda3937_04223"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="GeneID:9731647"
     gene            complement(283931..284167)
                     /locus_tag="DDA3937_RS01250"
                     /old_locus_tag="Dda3937_04441"
                     /db_xref="GeneID:9731648"
     CDS             complement(283931..284167)
                     /locus_tag="DDA3937_RS01250"
                     /old_locus_tag="Dda3937_04441"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014728259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobB"
                     /protein_id="WP_013315952.1"
                     /db_xref="GI:503081068"
                     /db_xref="GeneID:9731648"
                     /translation="MHWDQHAKDFKHEPVDKILLYRHGPGGDIAALIDADTLAVATDT
                     ALTLALPCLDLNQPAQIAVFIRDWLRRRTGAAGD"
     gene            complement(284244..285005)
                     /locus_tag="DDA3937_RS01255"
                     /old_locus_tag="Dda3937_01575"
                     /db_xref="GeneID:9731649"
     CDS             complement(284244..285005)
                     /locus_tag="DDA3937_RS01255"
                     /old_locus_tag="Dda3937_01575"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="4.S.12 transport; substrate; amino acid"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter ATP-binding protein"
                     /protein_id="WP_013315953.1"
                     /db_xref="GI:503081069"
                     /db_xref="GeneID:9731649"
                     /translation="MNQDTLTSSSDYMITLENVNKWYGQFHVLKNINLQVKQGERIVL
                     CGPSGSGKSTTIRCINHLEEHQQGRIVVDGIELNHDSRNIEKIRTEVGMVFQHFNLFP
                     HLTVLQNCTLAPSWVRNMPKKEAEELAMHYLERVRIAAHAHKYPGQLSGGQQQRVAIA
                     RSLCMKPKIMLFDEPTSALDPEMVKEVLDTMLGLAEDGMTMLCVTHEMGFARTVANRV
                     IFMDQGEIVEQAPPDIFFSRPRSERTQTFLAQILH"
     gene            complement(285014..286108)
                     /locus_tag="DDA3937_RS01260"
                     /old_locus_tag="Dda3937_01576"
                     /db_xref="GeneID:9731650"
     CDS             complement(285014..286108)
                     /locus_tag="DDA3937_RS01260"
                     /old_locus_tag="Dda3937_01576"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.12 transport; substrate; amino acid"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_013315954.1"
                     /db_xref="GI:503081070"
                     /db_xref="GeneID:9731650"
                     /translation="MTMITHTPSNPTPINRAIVWARRNLFSSITNSVLTLACLWLLWT
                     LIPPLLNWAILKANWIGSTRADCTSDGACWVFIHARFEQFMYGLYPREELWRINFALV
                     LALISILPMFWRNLPHRGRYIAVWCVIYPLIAWWLLFGGFGGLTRVETRQWGGLTLTI
                     IIAAIGIAGALPLGILLALGRRSNMPVLRALCVIFIEFWRGVPLITVLFMSSVMLPLF
                     LTEGTNIDKLLRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAQSLALGYWRMQGLV
                     ILPQALKMVIPGLVNTIIALFKDTSLVIIIGLFDLFSSIQQATVDPAWLGMSTEGYVF
                     AAILYWIFCFSMSRYSQHLEKRFDTGRKSH"
     gene            complement(286118..287296)
                     /locus_tag="DDA3937_RS01265"
                     /old_locus_tag="Dda3937_01577"
                     /db_xref="GeneID:9731651"
     CDS             complement(286118..287296)
                     /locus_tag="DDA3937_RS01265"
                     /old_locus_tag="Dda3937_01577"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.12 transport; substrate; amino acid"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012882991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_013315955.1"
                     /db_xref="GI:503081071"
                     /db_xref="GeneID:9731651"
                     /translation="MLQRPTVKGDLSLTNPAVRAWLYQILAVVIVVVTVGYLLHNTVT
                     NLAQRGITSGFAFLNNSADFGIVQHLIDYEQGDTYARVFVVGLLNTLLVSAICIVCAS
                     LLGFIVGLARLSDNWLLRKLSTIYIETFRNIPPLLQIFFWYFAVLRNLPGPRQAVNAL
                     DTFFLSNRGLYIPAAEFGPGALPSILALIIALVVGAMIFRRNKRYHALTGQQRRSWPI
                     PLAVLVVLLGLSHLIFGRALHWDFPVLKGFNFSGGMVLIPELAALALALSVYTSSFIA
                     EIIRSGIQSVSYGQHEAALSLGLPKPVTLRKVILPQALRVIIPPLTSQYLNVVKNSSL
                     AAAIGYPDMVSLFAGTVLNQTGQAIETIAITMSVYLIISLLISLLMNIYNRKIALIER
                     "
     gene            complement(287369..288394)
                     /locus_tag="DDA3937_RS01270"
                     /old_locus_tag="Dda3937_01578"
                     /db_xref="GeneID:9731652"
     CDS             complement(287369..288394)
                     /locus_tag="DDA3937_RS01270"
                     /old_locus_tag="Dda3937_01578"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="4.S.12 transport; substrate; amino acid"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013315956.1"
                     /db_xref="GI:503081072"
                     /db_xref="GeneID:9731652"
                     /translation="MKKVIMSTLVASASLFAFINQAHAGATLDAIQKKGFVQCGISDG
                     LPGFSYADANGKYSGIDVDVCRGVAAAIFGDANKVKFTPLTAKERFTALQSGEVDLLS
                     RNTTWTSSRDGGMGLLFTGVTYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELN
                     VADYFKTHNMKYTPVTFDRSDESAKALDSGRCDTLASDQSQLYALRIKLGKPADFVVL
                     PEVISKEPLGPVVRRGDEDWYAIVRWTLFAMLNAEEMGITSQNVDQMAAKPTTPDMSH
                     LLGKEGNYGKDLKLPADWAYKIVKQVGNYGEVFERNVGQGSELKIKRGLNELWNKGGI
                     QYAPAIR"
     gene            complement(288691..289386)
                     /locus_tag="DDA3937_RS01275"
                     /old_locus_tag="Dda3937_01579"
                     /db_xref="GeneID:9731653"
     CDS             complement(288691..289386)
                     /locus_tag="DDA3937_RS01275"
                     /old_locus_tag="Dda3937_01579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111525.1"
                     /db_xref="GI:696580346"
                     /db_xref="GeneID:9731653"
                     /translation="MKQIVRIALIGDYTPTVTAHQAIPPALDLAARQLDLTTQYQWID
                     SELLSPASQLDAFDAVWCVPASPYRHDDNILQAIRFARETHIPFLGTCGGCQYALLEY
                     ARHVLSWHDANNAEVTQEGRAVISPLQCEMVEKQGDIRLSPDSRIGRAYGRDAIAEGY
                     RCRYGINEAFRDAFTTAGVRVSGVDDNGDIRAVELTDHPFFVGTLFQPERAALKQIAP
                     PLAIALLEAASVR"
     gene            complement(289501..290166)
                     /locus_tag="DDA3937_RS01280"
                     /old_locus_tag="Dda3937_01580"
                     /db_xref="GeneID:9731654"
     CDS             complement(289501..290166)
                     /locus_tag="DDA3937_RS01280"
                     /old_locus_tag="Dda3937_01580"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.12 transport; substrate; amino acid"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine ABC transporter permease"
                     /protein_id="WP_013315958.1"
                     /db_xref="GI:503081074"
                     /db_xref="GeneID:9731654"
                     /translation="MPSWLQLMADSFWSLLSAGLTFTVPLAILSFVLGLMIGVLVALL
                     RLYGPTPLKKICDFYVWMIRGTPLLVQLFLIFYGLPNAGITLDAFPAALIGFSLNVGA
                     YSSEIVRGAILSVPKGQWNAAYSLGMSGAQAIRWVIVPQSVFVSLPPLANTFISLVKD
                     TSLAAVITVPEMFLAAQRIVSVTYEPLILYIEAALIYLLFSTVLSKLQTRLEKYYQRH
                     IVH"
     gene            complement(290192..290962)
                     /locus_tag="DDA3937_RS01285"
                     /old_locus_tag="Dda3937_01581"
                     /db_xref="GeneID:9731655"
     CDS             complement(290192..290962)
                     /locus_tag="DDA3937_RS01285"
                     /old_locus_tag="Dda3937_01581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_033111526.1"
                     /db_xref="GI:696580347"
                     /db_xref="GeneID:9731655"
                     /translation="MKKSRLALLTGALLVTSALAQAQDDLSAIKAAGVIKFGTEGTYA
                     PYTYHDASGKLVGFDVDVGRAVAEKLGVKAEFVEGRWDGLIAGVDAKRYDAVINQVGV
                     TKERRAKYDFTKPYIDAKSVLIVRGDNTGIKSFNDLKGHKSAQSLTSNYSKLATSYGA
                     EIVPTDGFNQSLELVLSGRAEATLNDNLSFLDFKKHKPDANVKVVATAESGDPSAILV
                     RKNQPQLVDALNNALDQIKADGTYKTISVRYFGQDVSK"
     gene            291208..292350
                     /locus_tag="DDA3937_RS01290"
                     /old_locus_tag="Dda3937_01582"
                     /db_xref="GeneID:9731656"
     CDS             291208..292350
                     /locus_tag="DDA3937_RS01290"
                     /old_locus_tag="Dda3937_01582"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_013315960.1"
                     /db_xref="GI:503081076"
                     /db_xref="GeneID:9731656"
                     /translation="MKLRLASYNVENLFHRTAILNLPDPQQSSELLEKVRQLQTLLDA
                     DKYDDALKDRVFTLTSNLQPYVDLRVDGGSLGSWKNEAGKTGFRINKSCQGRGDWLGE
                     LVFRAEAFGDQQRKNTGLVIKALNADILCAVEVENMAVLRDFNQQILADRAFAQYVMI
                     DSPNDPRGIDVACLTRHRITQLRTHIFDVSESFKPLFSRDCLEVTIDVGLPQPVHVLC
                     NHFKSQNGRNDDERERAAKRRRAQAERVAEIVRGYNLQQEYVVVMGDLNEDVANPWHS
                     LAPLFSVPDLHPAIDPSLPETARYTYYFSGGKAGERLNQLDYIFISTPLHQAKVTCGI
                     ERRGIYNIDKITAKEGAEPVTPFPTVTSWDTAASDHAAVWVELDIR"
     gene            292556..293398
                     /locus_tag="DDA3937_RS01295"
                     /old_locus_tag="Dda3937_01583"
                     /db_xref="GeneID:9731657"
     CDS             292556..293398
                     /locus_tag="DDA3937_RS01295"
                     /old_locus_tag="Dda3937_01583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_033112185.1"
                     /db_xref="GI:696581006"
                     /db_xref="GeneID:9731657"
                     /translation="MSQRIWLITGVSTGFGRELTQQLLAKGDRVVGTVRNLASVQPLM
                     DQWPETFHPEILDVTDTDAIAGVVERTFKRFGRIDVAISNAGYGLFGAAEELSDRQIE
                     QMIATNLLGSIQFIRGVIPIMRQQGGGRIIQISSYGGQVAFPGNSLYHATKWGIEGFV
                     ESVAQEVAPFGIGMTLVEPGGARTEFRYGSAQVAALMPVYDATPAHAFLRMLDPANGL
                     APGDPARMATRIIESVDRQPAPLRMVLGSQALQGMIDVLRERLRDFEQQVELAASTDF
                     PPGT"
     gene            complement(293476..294369)
                     /locus_tag="DDA3937_RS01300"
                     /old_locus_tag="Dda3937_01584"
                     /db_xref="GeneID:9731658"
     CDS             complement(293476..294369)
                     /locus_tag="DDA3937_RS01300"
                     /old_locus_tag="Dda3937_01584"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013315962.1"
                     /db_xref="GI:503081078"
                     /db_xref="GeneID:9731658"
                     /translation="MLKENFSDLISFRMVAQEKSFTRAAAKLGISQSALSHAMRSLEE
                     RLGIRLLTRTTRSVSLTEAGERLLGNISPSLNELEFALEDLGEMRDKPAGNIRLTAGE
                     HAVNFVLWPVLKPFLSQHPDIHLEITVDNTLTDIVNERFDAGVRLGEQVAKDMIAVRI
                     GPDMRMAVVGSPAYFANHTAPDTPQSLQQHRCINMRLPTLGGLFAWEFSRDGREIRVR
                     VDGQLTFNNLQHRIDAALSGLGLAYVPEDTIRQAVADGRLIQVLESWCEPFPGYYLYY
                     PSRKQHTAAFSLFIDALRYRG"
     gene            294682..295077
                     /locus_tag="DDA3937_RS01305"
                     /old_locus_tag="Dda3937_01585"
                     /db_xref="GeneID:9731659"
     CDS             294682..295077
                     /locus_tag="DDA3937_RS01305"
                     /old_locus_tag="Dda3937_01585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="germin"
                     /protein_id="WP_033111527.1"
                     /db_xref="GI:696580348"
                     /db_xref="GeneID:9731659"
                     /translation="MKIIRNGSQPSRPGPEAWFTGHVRIDAPFQATEPARVGGAIVTF
                     EPGARTAWHTHPLGQTLIVVQGRGWVQEWGKEIHEMNPGDIVWIPEGVKHWHGATAET
                     AMTHIAIAESLDGSAVEWMEHVSDEQYPK"
     gene            295104..295301
                     /locus_tag="DDA3937_RS01310"
                     /old_locus_tag="Dda3937_01586"
                     /db_xref="GeneID:9731660"
     CDS             295104..295301
                     /locus_tag="DDA3937_RS01310"
                     /old_locus_tag="Dda3937_01586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017491885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111528.1"
                     /db_xref="GI:696580349"
                     /db_xref="GeneID:9731660"
                     /translation="MMPGAVESELVRSITDPNMAAGVKSFYDDYAISAESFARVVAFA
                     IRLPEDVDINDVLFRPTRLEL"
     gene            295332..296384
                     /locus_tag="DDA3937_RS01315"
                     /old_locus_tag="Dda3937_01587"
                     /db_xref="GeneID:9731661"
     CDS             295332..296384
                     /locus_tag="DDA3937_RS01315"
                     /old_locus_tag="Dda3937_01587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyacid dehydrogenase"
                     /protein_id="WP_033111529.1"
                     /db_xref="GI:696580350"
                     /db_xref="GeneID:9731661"
                     /translation="MTMKVLGYAAQSSAAPLAPFHFTRRTPRPDDVVVEILYCGVCHS
                     DLHQARNDWGFSHYPLVPGHEIIGRVTAVGAGVTKFKPDDLVGIGCMVDSCRECQPCK
                     QGLEQYCDEGNVQTYNGVDRHDHLPTYGGYSQQIVASQDFVLRIPASMDLKSAAPLLC
                     AGITTWSPLRHWNVGKGSKVAVVGLGGLGHMAIKLAHALGAEVTLFTRSPGKEADARR
                     LGADRIVLSTAASQMETVKGQFDLIIDTVPYEHDINPYMPTLTVDGTLVFVGLLGDIN
                     PMLNTVSMILGRRSVAGSCIGGIAETQEMLDFCGEHGITSDVEMIDIQNINAAYERML
                     KSDVKYRFVIDMASLA"
     gene            296712..297932
                     /locus_tag="DDA3937_RS01320"
                     /old_locus_tag="Dda3937_01588"
                     /db_xref="GeneID:9731662"
     CDS             296712..297932
                     /locus_tag="DDA3937_RS01320"
                     /old_locus_tag="Dda3937_01588"
                     /function="8.1.4 extrachromosomal; prophage genes and
                     phage related functions; Integration, recombination"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_013315966.1"
                     /db_xref="GI:503081082"
                     /db_xref="GeneID:9731662"
                     /translation="MAGGTNKLSDTSLRKMMGRESPGDSFYADGDGLSVKVSKIGVMT
                     WYFTFRVGGRSAAPQRIKLGNYPDLSLKAAREKREQCRAWLAEGKNPRHQLSIATQES
                     LKPITVKEALEYWIREYATHKRANVNKHIEQLKKHIYPYIGDYPLSMCETRHWLECFS
                     RVRSEAPVAAGYLLQMCKQALKFCRVHRYADSNALSDLTIDDVGSKQNKRDRVHSRQE
                     LADIWRESTGQKFKPYYASLLHLLVVFGCRTQELRFSLISEWDLDDWVWTVPREHSKG
                     GEKILRPIPEAIRPFVVALCNQHKDSGLLLGEIKSSEAVSQWGRGIYKRLGHSEPWTL
                     HDLRRTFSTTLNNMGIAPHVVEQLLGHTLGGVMAVYNRSQYLPEKLDALNKWMERLEL
                     ISSEHSNVTIFKVK"
     gene            297932..298669
                     /locus_tag="DDA3937_RS01325"
                     /old_locus_tag="Dda3937_01589"
                     /db_xref="GeneID:9731663"
     CDS             297932..298669
                     /locus_tag="DDA3937_RS01325"
                     /old_locus_tag="Dda3937_01589"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001553506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315967.1"
                     /db_xref="GI:503081083"
                     /db_xref="GeneID:9731663"
                     /translation="MSVKKPERLYYPLHEAAEKLECSIKDIIHYGAIGALCISVYMFN
                     NKGDNQSDIFYLDALKFKVDDDLPSHFLGDKYLIADIHFNHSPYGWCASFLKGFFYIN
                     AVSLTLAEFEINSGSIKIDKLSTAKNALDSIDIYFMNDEGLYELPISRLCVMAEEIDN
                     INQAVKINAFINQEKESDKTVAKKEVLIKSLLRLIPDFYDVDIEAMPVKKIKELLEVT
                     AAQKGIDFPKTDLGTWSKYLERGRHKK"
     gene            298760..298984
                     /locus_tag="DDA3937_RS01330"
                     /old_locus_tag="Dda3937_01590"
                     /db_xref="GeneID:9731664"
     CDS             298760..298984
                     /locus_tag="DDA3937_RS01330"
                     /old_locus_tag="Dda3937_01590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_033111530.1"
                     /db_xref="GI:696580351"
                     /db_xref="GeneID:9731664"
                     /translation="MNHLKQSKQTTERLIREGECRQLTGLCRTTRYLMEKKGKFPSRR
                     KLGGRSVGWMLSEILEWQHQQPKVIFEKAA"
     gene            complement(299096..299290)
                     /locus_tag="DDA3937_RS01335"
                     /db_xref="GeneID:23677382"
     CDS             complement(299096..299290)
                     /locus_tag="DDA3937_RS01335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014913823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111531.1"
                     /db_xref="GI:696580352"
                     /db_xref="GeneID:23677382"
                     /translation="MATGSVNNKSQQLNARFPHDVVAELENSLEIGETKAQFIVTAVK
                     GEIKRRQRKQSRQDKQPDAE"
     gene            299480..299701
                     /locus_tag="DDA3937_RS01340"
                     /old_locus_tag="Dda3937_04443"
                     /db_xref="GeneID:9731666"
     CDS             299480..299701
                     /locus_tag="DDA3937_RS01340"
                     /old_locus_tag="Dda3937_04443"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315970.1"
                     /db_xref="GI:503081086"
                     /db_xref="GeneID:9731666"
                     /translation="MADKQSTQTHAKFTRAAHITHAEEAVTQVVYAMSIIRLIAAQDV
                     GGPVVENSLDAVIEILEKAETELVEVCRG"
     gene            299694..299909
                     /locus_tag="DDA3937_RS01345"
                     /old_locus_tag="Dda3937_01591"
                     /db_xref="GeneID:9731667"
     CDS             299694..299909
                     /locus_tag="DDA3937_RS01345"
                     /old_locus_tag="Dda3937_01591"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315971.1"
                     /db_xref="GI:503081087"
                     /db_xref="GeneID:9731667"
                     /translation="MDKPIPLDLAAYRAGLNSSLFEVIISKAAEENVSGQLADLIAIA
                     CDLNEEIRDVLAKAVEKRGVIVHGVER"
     gene            299906..301675
                     /locus_tag="DDA3937_RS01350"
                     /old_locus_tag="Dda3937_01592"
                     /db_xref="GeneID:9731668"
     CDS             299906..301675
                     /locus_tag="DDA3937_RS01350"
                     /old_locus_tag="Dda3937_01592"
                     /function="8.1.2 extrachromosomal; prophage genes and
                     phage related functions; Replication"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_013315972.1"
                     /db_xref="GI:503081088"
                     /db_xref="GeneID:9731668"
                     /translation="MKTAPNVKRLPRDKGTEAVIFAGSNAWDAAKRYQAGNNNGDDIP
                     PIVLDHAQLNDLANLNIVDKGRKYARVYQAGLVDQAKMSLIAKKLAAAGVTEAKLYSE
                     TGELLEDWKGYFERLTTEPPETSAGMVLTDLSRMGASQRGEVLRAHYGGALAVHGDSD
                     TVHHYNSVVWVPVADKELQREMAQIFIDADIAYSQNAIKSAVETMKLSLPVMGVTARN
                     LIGFSNGVFDTRSGQFRCHIKEDWLLIASELPFSAPAEGETLATHAPSFWKWLSRSVG
                     NNKRKADRVLAALFMVLANRYDWQLFLEVTGPGGSGKSVFAEICTMLAGKANTVSASM
                     KALEDPRDRALVVGYSLIIMPDMTRYAGDGAGIKAITGGDKVSIDPKHKAPYSTRIPA
                     VVLAVNNNAMTFSDRSGGISRRRVIFNFSEVVPENERDPMLAEKIEGELAVIIRHLLT
                     RFAKQDEAKRLLHEQQKSEEAMAIKREGDSLVDFCGYLMASVLCDGMFIGNAEIVPFS
                     PRRYLYHAYLAYMRANGLNKPVSLTRFGTDMPGAMAEYGKEYQKRKTKLGLRSNVTLN
                     EDSEDWMPQCDAPQGSQNKEEKK"
     gene            302076..302255
                     /locus_tag="DDA3937_RS01355"
                     /db_xref="GeneID:23677383"
     CDS             302076..302255
                     /locus_tag="DDA3937_RS01355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003846266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111532.1"
                     /db_xref="GI:696580353"
                     /db_xref="GeneID:23677383"
                     /translation="MSSKKKAMAVHIDAETMKKIEEYQAFVKENHPEMPVPTIGQIVR
                     SGVNYWHRHTLGAWL"
     gene            302252..304177
                     /locus_tag="DDA3937_RS01360"
                     /old_locus_tag="Dda3937_01593"
                     /db_xref="GeneID:9731669"
     CDS             302252..304177
                     /locus_tag="DDA3937_RS01360"
                     /old_locus_tag="Dda3937_01593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_033111533.1"
                     /db_xref="GI:696580354"
                     /db_xref="GeneID:9731669"
                     /translation="MKCWYTIKAASDSASATILIYEEIGAWGITAQKFSEDLKALGDI
                     SHITLNIHSPGGDVFDGIAIYNLLSKHPAKITVHIDGLAASMASVIAMAGDRIVMPEN
                     ALMMIHKPWGISGGNANDMRDYAELLDKVEHVLIPAYARKTGKSAEELAAMLEEETWM
                     DGRECVAQGFADELLPAVSAMARIESKRIEDFEHMPDNIKGMITQPKGSTGATVPEKD
                     RINGIKDMFAMFGGKHDSLKIQCLEDVGCTPDMAKERLMKELGRGATPSGKFIPENSA
                     HIYVDNGNITGDGIRNGLFARLGYAPAERGNPYAMMSLFDMAKASLADRGVGISGFGN
                     RSQIVNLAFTHSSSDFSHILAAGAEKSVLTGWQNSGETFQQWTKTGSLSNFHEAKRVG
                     INGFSQLDKVPEGAEYKYVTTGDSGVPIALATYGNIFSVTRQAIINDDLSQLTTIPQA
                     MGRAAARTVGNLVYLLLTTNTAFTDGKALFHADHGNLIAKSLDMDGLNEARKAMRLQE
                     DANGDPINIIPAFILVPAALEGAANRAVLSSSSLFPVDGSGTQNQNPGIINVVKDMAQ
                     IVVDPRLDKANNKQWYVASAQGTDTIEVAYLDGVDTPYLEQQEGFTVDGIAWKVRIDA
                     GVAALDYRGLVKSNGTA"
     gene            304641..307235
                     /locus_tag="DDA3937_RS01365"
                     /old_locus_tag="Dda3937_01594"
                     /db_xref="GeneID:9731670"
     CDS             304641..307235
                     /locus_tag="DDA3937_RS01365"
                     /old_locus_tag="Dda3937_01594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000079422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042318715.1"
                     /db_xref="GI:754962792"
                     /db_xref="GeneID:9731670"
                     /translation="MVSHLDAGRIDAGQFERFNGMLSQSRQQILKMTAAANDLPAALS
                     KQELAAQKAGISIGQYRMAMRSLPAQMTDVVTQLAGGQNPFLIMIQQGGQVKDMFGGF
                     RPMFTGLASAISPTFLAIGATAGAVTALGIAAYKGQQYLSDFNKSLVLTGGQSGQTAN
                     SLLFNAEAIANSGRSFGGAAESLNALVKAGANLGVNYKDVAASIASLSKTAGASVDDL
                     AGTFGKITMDPEKGLAAMAEKYGNVTLRQLDYIKSLQDSGKYTEALSYANKIASDGFQ
                     EMARSVQDNMGYLERAAASVGGAFSSMWDKMLDVGKSKSLQAQLADATEQFYNLDKSL
                     KASSAQGQQRMGLEQAREQARQLVAQLTDQLHAEQRKGDEQQRQATLQKSALTNQQHF
                     QALADAGLTKEQQRTDEYLRLNRYIEERKKLNQALSQEEIAQIKKGIEERYKDPKQRE
                     YKAPAGDTEQEKALAELTALESQLRVLQQHSSLNDTISQQRKDLWLTESKFAVLDDAS
                     QNRKLTKQEQSLLANKDQIVALAQQKALLGDEIVAQERLNKLNDTALKYATQMSEKGA
                     ALTAGSTISDRLAQQQRAMAQLRIGWQNAGGQLSDAGYQKELEAAQAYYAKEDALRND
                     WLAGAKRGWAEFEDSATNVYSSVQESATSALNGLSDSLTSLVTTGSANIKQFGTSMLK
                     MIASVINKLIVTYALQQALGWISASASASTSTATASASANSSFSGGAYSNLGFADGGY
                     ANLGGFTGIGNKHEPAGIVHRGEFVFTKEATRRIGVGNLYNMMHGFADGGFAGGVAPN
                     TPLASGGGLQITNNVTIQNDGSVSSSTSGNDQVSKATLRLLDDFCQKNIVKALTPGGS
                     IWNAMKSR"
     gene            complement(307385..307681)
                     /gene="fis"
                     /locus_tag="DDA3937_RS01370"
                     /old_locus_tag="Dda3937_01595"
                     /db_xref="GeneID:9731671"
     CDS             complement(307385..307681)
                     /gene="fis"
                     /locus_tag="DDA3937_RS01370"
                     /old_locus_tag="Dda3937_01595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001465625.1"
                     /note="Stimulates excision of phage lambda; affects Mu
                     development; acts as an activator of rRNA and iRNA
                     transcription; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_012883002.1"
                     /db_xref="GI:502646669"
                     /db_xref="GeneID:9731671"
                     /translation="MFEQRVNSDVLTVSTVNSQAQVTQKPLRDSVKQALKNYFAQLNG
                     QDVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN"
     gene            complement(307705..308670)
                     /locus_tag="DDA3937_RS01375"
                     /old_locus_tag="Dda3937_01596"
                     /db_xref="GeneID:9731672"
     CDS             complement(307705..308670)
                     /locus_tag="DDA3937_RS01375"
                     /old_locus_tag="Dda3937_01596"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52539.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase B"
                     /protein_id="WP_013315975.1"
                     /db_xref="GI:503081091"
                     /db_xref="GeneID:9731672"
                     /translation="MRIGQFQLPNRLIAAPMAGVSDRPFRALCYAMGAGMTVSEMLSS
                     NPEVWRSDKSRLRMVHSDEPGIRAVQIAGGDPDEMAAAARINAENGAQVIDINMGCPA
                     KKVNRKMAGSALLQYPELVKQILIAVVKAVDVPVTLKIRTGWAPEHRNCAEIAKLAED
                     CGIQALTVHGRTRACLFNGEAEYDSIRTVKQSVSIPIIANGDITDPRKARAVLDYTGA
                     DALMIGRAAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLIGHIRELHDFYGPGKGF
                     RIARKHVSWYLQEHAPNDQFRRTFNAIEDASEQLEALKAYFENLA"
     gene            complement(309023..309910)
                     /gene="prmA"
                     /locus_tag="DDA3937_RS01380"
                     /old_locus_tag="Dda3937_01597"
                     /db_xref="GeneID:9731673"
     CDS             complement(309023..309910)
                     /gene="prmA"
                     /locus_tag="DDA3937_RS01380"
                     /old_locus_tag="Dda3937_01597"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848149.1"
                     /note="methylates ribosomal protein L11 at multiple amino
                     acid positions; mutations of these genes in Escherichia
                     coli or Thermus thermophilus has no apparent phenotype;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L11 methyltransferase"
                     /protein_id="WP_013315976.1"
                     /db_xref="GI:503081092"
                     /db_xref="GeneID:9731673"
                     /translation="MPWIQLKINTSGAHAEQLGDALSESGAVSVTFQDTHDTPVFEPL
                     PGETRLWGDTDVIGLYDAETDMAEVIAMLEQEPLLGVGFRHKIEQLEDKDWEREWMEN
                     FHPMQFGKRLWICPSWREVPDPSAVNVMLDPGLAFGTGTHPTTSLCLQWLDGLDLDGK
                     TVIDFGCGSGILAIAALKLGAAHAIGIDIDPQAIQASRDNAQRNGVSERLELYLPKDQ
                     PKDLSADVVVANILAGPLRELAPLIGVLPKNGGHLGLSGILASQAQSVAEAYEDRFQL
                     DPVAEKEEWCRITGIRKPV"
     gene            complement(309925..311376)
                     /gene="panF"
                     /locus_tag="DDA3937_RS01385"
                     /old_locus_tag="Dda3937_01598"
                     /db_xref="GeneID:9731674"
     CDS             complement(309925..311376)
                     /gene="panF"
                     /locus_tag="DDA3937_RS01385"
                     /old_locus_tag="Dda3937_01598"
                     /function="4.2.A.21 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Solute:Sodium Symporter (SSS) Family"
                     /function="1.5.3.5 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; Coenzyme
                     A"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.138 transport; substrate; Na+/pantothenate"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943128.1"
                     /note="mediates high affinitiy panthothenate transport
                     which is stimulated by the presence of sodium ions; member
                     of SSS family of sodium/solute symporters; the imported
                     panthothenate is phosphorylated by panthothenate kinase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:pantothenate symporter"
                     /protein_id="WP_013315977.1"
                     /db_xref="GI:503081093"
                     /db_xref="GeneID:9731674"
                     /translation="MQSDVILPLIAYLLLVFGLSVYAWRRRQQGNFLTEYFIGNRSMG
                     GFVLAMTLIGTYVSASSFIGGPGAAYKYGLGWVLLSMIQVPTMLLSLSILGKKFAILA
                     RRYNAITLNDMLYARYGSRLLVWFASLSLLVAFIGAMAVQFIGGARLLETVAHVPYNV
                     GLLIFGITIALYTAFGGFRASVLNDALQGIVMLIGTLLLLAGVIYAAGGLPAAVGKLA
                     QINPALVDPHGSNQILSAPFMASFWVLVCFGVIGLPNTAVRCISYRDSKALHRGILIG
                     TLVISVLMLGMHLAGALGRAILPNLTIPDQVLPELMLTVLPPLAAGIFLAAPTAAIMS
                     NINAHLLQASATIVKDLYLSVYPQKISNERYIRHLSSFTTLLLGLLVLLASWRPPEMI
                     IWLNLLAFGGLEAVFLWPLVLGLYWERANAAGALCSMFSGAVSYTLLASFNVQLAGFH
                     PIVPSLLLSLVAFILGNRFGRQPAPAVVASSSL"
     gene            complement(311366..311608)
                     /locus_tag="DDA3937_RS01390"
                     /old_locus_tag="Dda3937_01599"
                     /db_xref="GeneID:9731675"
     CDS             complement(311366..311608)
                     /locus_tag="DDA3937_RS01390"
                     /old_locus_tag="Dda3937_01599"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013315978.1"
                     /db_xref="GI:503081094"
                     /db_xref="GeneID:9731675"
                     /translation="MDKRFIQAHREARWSLILTLAYLVAWTLFAYLPDNRPGLTGLPH
                     WFELACLALPLLFIGLCWLMVRVVFRDVSLEDHDAE"
     gene            complement(311802..313145)
                     /locus_tag="DDA3937_RS01395"
                     /old_locus_tag="Dda3937_01600"
                     /db_xref="GeneID:9731676"
     CDS             complement(311802..313145)
                     /locus_tag="DDA3937_RS01395"
                     /old_locus_tag="Dda3937_01600"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855338.1"
                     /note="an AccC homodimer forms the biotin carboxylase
                     subunit of the acetyl CoA carboxylase, an enzyme that
                     catalyzes the formation of malonyl-CoA, which in turn
                     controls the rate of fatty acid metabolism; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxylase
                     subunit"
                     /protein_id="WP_013315979.1"
                     /db_xref="GI:503081095"
                     /db_xref="GeneID:9731676"
                     /translation="MLDKIVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLL
                     ADETVCIGPAPSPKSYLNIPAIISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIF
                     IGPRADTIRLMGDKVSAISAMKKAGVPCVPGSDGPLGDDMDKNRAIGKRIGYPVIIKA
                     SGGGGGRGMRVVRSEKELEQSIAMTRAEAKAAFNNDMVYMEKYLENPRHVEIQVLADG
                     QGNAIYLAERDCSMQRRHQKVVEEAPAPGITADLRRYIGERCAKACVDINYRGAGTFE
                     FLFENGEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGQPLSIKQEEVKVRGHA
                     VECRINAEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPHYDSMIGKLITYG
                     ESRDIAISRMKNALAELIIDGIKTNVELQMRIMSDENFQHGGTNIHYLEKKLGLQ"
     gene            complement(313157..313582)
                     /locus_tag="DDA3937_RS01400"
                     /old_locus_tag="Dda3937_04028"
                     /db_xref="GeneID:9731677"
     CDS             complement(313157..313582)
                     /locus_tag="DDA3937_RS01400"
                     /old_locus_tag="Dda3937_04028"
                     /function="1.6.15.3 metabolism; macromolecules (cellular
                     constituent) biosynthesis; large molecule carriers; biotin
                     carboxyl carrier protein"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315980.1"
                     /note="composes the biotin carboxyl carrier protein
                     subunit of the acetyl-CoA carboxylase complex, the enzyme
                     that catalyzes the carboxylation of acetyl-CoA to
                     malonyl-CoA, which in turn controls the rate of fatty acid
                     metabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein"
                     /protein_id="WP_013315980.1"
                     /db_xref="GI:503081096"
                     /db_xref="GeneID:9731677"
                     /translation="MDIRKIKKLIELVEESGIAELEISEGEESVRISRAPAPGSYPIM
                     QQAYAPMPQFAPAAAPAAISGHVVRSPMVGTFYRTPSPDAKAFVEVGQQVKVGDTLCI
                     VEAMKMMNQIEADKAGVVKAILVESGQPVEFDEPLVVIE"
     gene            complement(313618..314070)
                     /locus_tag="DDA3937_RS01405"
                     /old_locus_tag="Dda3937_04029"
                     /db_xref="GeneID:9731678"
     CDS             complement(313618..314070)
                     /locus_tag="DDA3937_RS01405"
                     /old_locus_tag="Dda3937_04029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="WP_029456545.1"
                     /db_xref="GI:657652103"
                     /db_xref="GeneID:9731678"
                     /translation="MADKFHILLLNGPNLNLLGTREPDKYGHTTLAEIVSRLEQDAAA
                     LNVQLSHLQSNAEHELIDRIHQARGNTDFILINPAAFTHTSVALRDALLAVAIPFIEI
                     HLTNVYAREPFRHHSYLSDVSAGVICGLGADGYHYGLQTAVKRLSTSN"
     gene            complement(314309..314908)
                     /locus_tag="DDA3937_RS01410"
                     /old_locus_tag="Dda3937_04030"
                     /db_xref="GeneID:9731679"
     CDS             complement(314309..314908)
                     /locus_tag="DDA3937_RS01410"
                     /old_locus_tag="Dda3937_04030"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315982.1"
                     /note="in Escherichia coli this inner membrane protein was
                     found to anchor the periplasmic catalytic oxidoreductase
                     YedY; sulfite oxidase activity not demonstrated; contains
                     heme; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite oxidase subunit YedZ"
                     /protein_id="WP_013315982.1"
                     /db_xref="GI:503081098"
                     /db_xref="GeneID:9731679"
                     /translation="MRLTARHITALKVVLHLAAFLPLAWLVLAVNQGAFSADPAKDIQ
                     HFTGRMALKLLLATLMVTPLARYGKQPLLIRCRRLLGLWCFAWASLHLLSYTLLELGV
                     NHLDLLGKEIFLRPYLTLGMASWLILLALTLTSTQSAQRKLGARWQKLHNLIYLVAIL
                     APVHYLWSVKSLSPLPIIYASFAVILLLFRYKKLRQWRR"
     gene            complement(314975..315976)
                     /locus_tag="DDA3937_RS01415"
                     /old_locus_tag="Dda3937_04444"
                     /db_xref="GeneID:9731680"
     CDS             complement(314975..315976)
                     /locus_tag="DDA3937_RS01415"
                     /old_locus_tag="Dda3937_04444"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315983.1"
                     /note="in Escherichia coli this periplasmic enzyme was
                     found to encode the periplasmic catalytic subunit of an
                     oxidoreductase; requires inner membrane anchor protein
                     YedZ; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TMAO/DMSO reductase"
                     /protein_id="WP_013315983.1"
                     /db_xref="GI:503081099"
                     /db_xref="GeneID:9731680"
                     /translation="MSRHRKLTDADVTPESLFHQRRTVLKALGLTAATLSLSSGARAD
                     LLNWFQGKQAPVAPPGKPLAFSQPPQWRPELALTPEDKVTGYNNFYEFGLDKADPAAN
                     AGGLKTEGWKVRIDGEVAKPITLDIDDIRRRFALEERIYRFRCVEAWSMVIPWVGFEL
                     SQLIKLAEPTSDARYVAFQTLYDPAQMPGQKDSFVGGGLDYPYVEGLRMDEAMHPLTL
                     LAVGVYGKTLPPQNGAPIRLVTPWKYGFKNIKSIVHIRLTRQPPPSTWNLSAPNEYGF
                     YANVNPNVDHPRWSQASERVIGAGGLLNVQRQPTLMFNGYADQVAALYQGLDLRANF"
     gene            complement(316196..317182)
                     /locus_tag="DDA3937_RS01420"
                     /old_locus_tag="Dda3937_00660"
                     /db_xref="GeneID:9731681"
     CDS             complement(316196..317182)
                     /locus_tag="DDA3937_RS01420"
                     /old_locus_tag="Dda3937_00660"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_013315984.1"
                     /db_xref="GI:503081100"
                     /db_xref="GeneID:9731681"
                     /translation="MRALVLRQQNGLTLADVNTLEPSQLPDGDVTVDVDWSGINYKDA
                     LAITGKGKIIRQFPMVPGIDFAGTVRHSDHPDFKAGQPVVLTGWGVGENHWGGLAEQA
                     RVRADWLVPLPQGLTPRQAMIIGTAGFTAMLCVMALEEGGVTPASGEIVVSGASGGVG
                     STAVALLHALGYQVTAISGRADNSAYLQQLGAHQVLDRKEFAVAGRPLEKQRWAGAID
                     TVGDQVLATLLTQMHYGATVAACGLAGGVSLPATVMPFILRNVRLQGVDSVMTPRARR
                     EEAWRRLAALLPAAFYEQVTQEITLEQVPTTAAALLENRVTGRTLVRVGTAD"
     gene            317346..319292
                     /locus_tag="DDA3937_RS01425"
                     /old_locus_tag="Dda3937_00661"
                     /db_xref="GeneID:9731682"
     CDS             317346..319292
                     /locus_tag="DDA3937_RS01425"
                     /old_locus_tag="Dda3937_00661"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848140.1"
                     /note="regulates the degradation of the small RNAs CsrB
                     and CsrC; may function to targate RNase E to specific RNA
                     molecules; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="WP_013315985.1"
                     /db_xref="GI:503081101"
                     /db_xref="GeneID:9731682"
                     /translation="MGLTVRISILMTMLTTLAVVLMLVSSIFSFVCYSQQRMEHQLRA
                     VAASIDQALLVQPPDSIQFWLPAVMKAAGIVELEIRDGHESLYLLRLPEMLSDGADRA
                     LLYRHTRLSLLHHTDVKVNVTYVDPLFGTPRYLKSTLSIVLVILVIAVTVFHGVRWLR
                     RQMAGQEQLERRARRILAGERDTVMHGSVHEWPATASGALDQLLLDLAEAREARSRVD
                     TLIRSFAAQDAQTGLNNRLFFENQLATQLEDPEDVGTHGVVMMIRLPDFDTLQETHGY
                     GGVLEEYRNTLINLLSTFVLRYPAALLARYYHSDFTVLLPHRTLKEADSIASQLVKAI
                     DILPVTPLIDREDILHIGISAYHGGQTTEQVMESVEDATRNAVLQGGNGWCVYDRRVP
                     EKGRGSVKWRTLLEHTLLRGGPRLYQKPAITRDGEVHHREMFSRIYDGTQELLEAEYM
                     PLVRQLGLTSGYDRQLINRVIALTVSWQDSVLAFPITVDSLLQRPFLRWLRETLLQCP
                     KRQRERLLFELAEADVCQYIGRLRPILAMITGLGCRLAVTQAGLTLVSTAYIKSLQVE
                     VIKLHPGLVRSLDKRPENQLFVSSLTEACKGTHAQVFAAGVRTREEWQTLLDKGVCGG
                     QGDLFAASEPVSNTLKKYSPRTYV"
     gene            319607..320650
                     /locus_tag="DDA3937_RS01430"
                     /old_locus_tag="Dda3937_00662"
                     /db_xref="GeneID:9731684"
     CDS             319607..320650
                     /locus_tag="DDA3937_RS01430"
                     /old_locus_tag="Dda3937_00662"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P0A9X4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein Mbl"
                     /protein_id="WP_012883014.1"
                     /db_xref="GI:502646681"
                     /db_xref="GeneID:9731684"
                     /translation="MFKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQD
                     RAGSPKSVAAVGHEAKQMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNS
                     FMRPSPRVLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATG
                     SMVVDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERI
                     KHEIGSAYPGDEVREIEVRGRNLAEGVPRGFNLNSNEILEALQEPLTGIVSAVMVALE
                     QCPPELASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALE
                     MIDMHGGDLFSEE"
     gene            320754..321890
                     /locus_tag="DDA3937_RS01435"
                     /old_locus_tag="Dda3937_00663"
                     /db_xref="GeneID:9731685"
     CDS             320754..321890
                     /locus_tag="DDA3937_RS01435"
                     /old_locus_tag="Dda3937_00663"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315987.1"
                     /note="in some organisms this protein is a transmembrane
                     protein while in others it is periplasmic; involved in
                     some organisms with other components of the MreBCD complex
                     and with penicillin binding proteins in the periplasm or
                     cell wall; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreC"
                     /protein_id="WP_013315987.1"
                     /db_xref="GI:503081103"
                     /db_xref="GeneID:9731685"
                     /translation="MKPIFSRGPSLQLRLFLAVIIAIVIIFADSRLGTFVKIRTYMDT
                     AVSPFYFLANGPRAMLDNLSANLTSREQLERENTALRQELLLKNSDLLLLGQFRQENA
                     RLRELLGSPLRQEEQKMVTQVLSSGSDPYSDQVVIDKGNVNGVYEGQPVISDKGVVGQ
                     VVAVGQFTSRVLLICDASHALPIQVLRNDIRVIAAGNGCTEDLQLEHLPNNTDIRVGD
                     VLVTSGLGGRFPEGYPVAVVSSVKVDTQRAYTVIQARPTAELQRLRYLLLMWGVDSNS
                     RTALPPDDVHRVANERLMQMMPHVLPSPEEMGPPAPANTQAPDFVGPPAPPAKTTPVK
                     TNSAAPSKPANATSPRNATTPAANPAAPSQQRATPAPGASGGSR"
     gene            321887..322375
                     /locus_tag="DDA3937_RS01440"
                     /old_locus_tag="Dda3937_00664"
                     /db_xref="GeneID:9731686"
     CDS             321887..322375
                     /locus_tag="DDA3937_RS01440"
                     /old_locus_tag="Dda3937_00664"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.1 cell structure; membrane"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883016.1"
                     /note="part of cell wall structural complex MreBCD;
                     transmembrane component; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreD"
                     /protein_id="WP_013315988.1"
                     /db_xref="GI:503081104"
                     /db_xref="GeneID:9731686"
                     /translation="MNSYRRHGHWIIWLSFLVAMVLQIMPWPDDLYMYRPSWLTLILI
                     YWVMALPHRVNVGTGFVLGMITDLILGSTLGVRALGLSIIAYLVAFKFQLFRNMALWQ
                     QALIVMLLSLVLDLLVFWAEFLVINVSLRPEIFWNSVVDGVLWPWLFLLMRKIRRQFA
                     VQ"
     gene            322400..322993
                     /locus_tag="DDA3937_RS01445"
                     /old_locus_tag="Dda3937_00665"
                     /db_xref="GeneID:9731687"
     CDS             322400..322993
                     /locus_tag="DDA3937_RS01445"
                     /old_locus_tag="Dda3937_00665"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="5.1 cell processes; cell division"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315989.1"
                     /note="Maf; overexpression in Bacillus subtilis inhibits
                     septation in the dividing cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Maf"
                     /protein_id="WP_013315989.1"
                     /db_xref="GI:503081105"
                     /db_xref="GeneID:9731687"
                     /translation="MTDLYLASASPRRRELLTLLELSFDILKIDVAEQRQPDETPEQY
                     VSRLARDKAAAGVAVAPEDLPVLGADTIVVLNGQVLEKPRDEDDAARILRALSGQRHQ
                     VMTALALADRRESVSARVVTEVQFRTLSDDEITRYIASGEPMDKAGAYGIQGKGGCFV
                     KSIFGSYHAVVGLPLVETLELFTHFSARRKARGTHDR"
     gene            322983..324452
                     /locus_tag="DDA3937_RS01450"
                     /old_locus_tag="Dda3937_00666"
                     /db_xref="GeneID:9731688"
     CDS             322983..324452
                     /locus_tag="DDA3937_RS01450"
                     /old_locus_tag="Dda3937_00666"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /function="5.1 cell processes; cell division"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006818051.1"
                     /note="involved in the processing of the 5'end of 16S
                     rRNA; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease G"
                     /protein_id="WP_013315990.1"
                     /db_xref="GI:503081106"
                     /db_xref="GeneID:9731688"
                     /translation="MTAELLVNITPSETRVAYIDGGILQEIHIEREARRGIVGNIYKG
                     RVSRVLPGMQAAFVDIGLDKAAFLHASDIMPHTECVAGDEQKNFHVRDIAELVRQGQD
                     LMVQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESEAERERLKKTVAD
                     YCDEQGGFIIRTAAEGVGEEELSQDAAFLKRLWTKVMERKKRNQTKCKLYGELALAHR
                     ILRDFAGASLDRIRVDSKLTYDSLLEFTAEYIPEMTSKLEHYSGKQPIFDLYDVENEI
                     QRALDRKVELKSGGYLIIDQTEAMTTIDINTGAFVGHRNLDETIFNTNIEATQAIARQ
                     LRLRNLGGIIIIDFIDMGNEEHRRRVLHSLEQALSKDRVKTGISGFSQLGLVEMTRKR
                     TRESIEHVLCSECPTCHGRGSVKTVETVCYEIMREIVRVHHAYDSDRFLVYASPAVGD
                     ALKSDESHALAEVEIFVGKQVKVQIEPLYSQEQFDVVMM"
     gene            324563..328399
                     /locus_tag="DDA3937_RS01455"
                     /old_locus_tag="Dda3937_00667"
                     /db_xref="GeneID:9731689"
     CDS             324563..328399
                     /locus_tag="DDA3937_RS01455"
                     /old_locus_tag="Dda3937_00667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033112187.1"
                     /db_xref="GI:696581008"
                     /db_xref="GeneID:9731689"
                     /translation="MKRLPGIAAATGAILIVLAALLVSGLRMVLPTLDTFRPQVVAWA
                     QSVTGLPMEVESLSGSWETFGPTLDITNLRIHHPDAEWQSERISVALDVWQSLLHLKW
                     KFRDLTFYHLQVDIKTPIDPDRQRSRTWEPDQLGSLFLRQFDHFDLRNSRIRFLTPAG
                     TQAELQIPQLTWLNGKNRHRAEGQISLSSFNGQHGVVQLRMDLRDEQGWLNNGVVYLQ
                     ADNIDMKPWLGRWIRNNTGLESANFSLAAWLQVREGDMYGGDLLLSQGDASWRDGDTL
                     HRLGINGMTLHASRYQNGWQLDVPALNLSTDGVDWPKGQLSALWLPADTQLLGPDRLA
                     ELRIRGRHLALERLGPLLPLLSTATPELKTRWQALQPQGQLTALALDIPLQQPEQTRF
                     QANWQDVGWKNWQLLPGANHVSGEAAGSLARGRVRVNLAQSTLPYQDMFRAPLDIRQA
                     DATLDWRSDSQGWELWGQGLDVRSRSLWANGDFRYRHPAQGEPRLDILAGIRLGDAAD
                     AWRYYPEPFMGKDLVNYLTGAIKSGQVDNATLVFAGNPAQFPFEHQEGQFQVWVPLEK
                     SRFEFQPGWPALDNLNISLNFLNNGLWMSAPHVMLGDAEGRNVNAVIPDYSKETLLID
                     GDISGSGKEVSDYFDQTPLKISLGGALTQIQIGGEVQGNLHLDIPLNGGLVKASGDVA
                     LNNNHLFIKPLDVSLQSVSGAFHYDNGNLSSQTLQGRWLEQPLTFNFSTQEQEKAFLV
                     NVGLQGNWAASRLPELPKPVAAALNGNANWQSTVQVTLPHQGPSSYDVTVQGDLKEVS
                     SHLPSPLNKAGGAALGLQVSAKGDERGFSLTGSLGKSQSFNSQWLLKDNKVMLTRAAW
                     QEGAKPPPLPDDSSLTLALPPLDGERWLALLPGVRNAVSAQAGASRFQWPDRVTLTTP
                     ELKILGQQWHDLMFTSRSQNGGSEITAAGREIDGRLLIPTSGLWRGDVRYLYYNPQWQ
                     GDDATNPAALAEKKSPLNDPSIRFEDWPALQFDCRECWLMGQNVGQVKGTLQPEPNKL
                     VLANGLVDNGKAKLTLDGSWQESGEGTRTAIKGQLSGGSLSDNADWLGLATPLRAGAF
                     KIDYDLYWHGSPWAPHIPSLSGILKTDIGKGEIVNVGTGQAGQLLRLVSFDALLRKLQ
                     FDFSDTFGKGFYFDSVRSTAWIKDGVLHTDNLLVDGLEADIAMKGDIDLVKRELSMEA
                     VVAPEISATVGVATAFAVNPVIGAAVFAASKVLAPLWSKISLIRYHISGSVDQPKIQE
                     VVREPQKAKAAEAAGQ"
     gene            328446..329891
                     /gene="tldD"
                     /locus_tag="DDA3937_RS01460"
                     /old_locus_tag="Dda3937_00668"
                     /db_xref="GeneID:9731690"
     CDS             328446..329891
                     /gene="tldD"
                     /locus_tag="DDA3937_RS01460"
                     /old_locus_tag="Dda3937_00668"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114764.1"
                     /note="responsible for the proteolytic maturation of the
                     E. coli pMccB17 plasmid-encoded microcin B17, an exported
                     protein that targets the essential topoisomerase II DNA
                     gyrase; degrades the E. coli plasmid F-encoded CcdA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease TldD"
                     /protein_id="WP_013315992.1"
                     /db_xref="GI:503081108"
                     /db_xref="GeneID:9731690"
                     /translation="MSLTFVSEQLLTANKLSHQDLQSVLGTLSERRIDYADLYFQSSY
                     HESWVLEDRIIKDGSYHIDQGVGIRAINGEKTGFAYADQITLNALQQSAQAARSIVRE
                     QGNGAVKTLGEVPHRGLYPQANPLDSLTREEKIALLQRVDATARAADARVQEVTASLT
                     GVYELILVAATDGTLAADVRPLVRLSVSVLVEEDGRRERGSSGGGARTGYDYFWQQAD
                     GEVRAEAWAKEAVRMALVNLSAVAAPAGSMPVVLGAGWPGVLLHEAVGHGLEGDFNRR
                     GTSVFSGQVGKLVASELCTVVDDGTLEGRRGSLAVDDEGVPGQYNVLIENGILKGYMQ
                     DKLNARLMGVAPTGNGRRESYAHLPMPRMTNTYMLAGKSTPEEIIASVDYGLYAPNFG
                     GGQVDITSGKFVFSTSEAYLIENGRVTKPVKGATLIGSGIEAMQQISMVGNDLALDRG
                     VGVCGKEGQSLPVGVGQPTLKLDNITVGGTA"
     gene            complement(329980..330924)
                     /locus_tag="DDA3937_RS01465"
                     /old_locus_tag="Dda3937_00669"
                     /db_xref="GeneID:9731691"
     CDS             complement(329980..330924)
                     /locus_tag="DDA3937_RS01465"
                     /old_locus_tag="Dda3937_00669"
                     /function="In enterohemorrhagic E. coli, QseA controls the
                     Ler regulator that regulates other genes within the locus
                     of enterocyte effacement (LEE)"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315993.1"
                     /note="for aaeXAB operon; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013315993.1"
                     /db_xref="GI:503081109"
                     /db_xref="GeneID:9731691"
                     /translation="MERLKSMSVFARVVEFGSFTAAARQLQMSVSAVSQTVTRLEDEL
                     QVKLLNRSTRSIGLTEAGRIYYHGCRRMLHEAQEVHEQLYAFNNTPIGTLRIGSSSTM
                     AQNVLANMTTDMLKEYPGLSVNLVCGIPAPDLIADGLDIVIRVGALQDSSLYSTRLGS
                     MPMVVCAARSYLTQHGSPEKPADVSNISWLEYSVRPDSEFELIAPEGITTRLTPQGRF
                     VTNDPVTLIRWLKNGAGIAYVPLMWVFEEIKRGEIEILFPRYHSDPRPVYALYTRRDN
                     LPLKVQVCINYLTEYFNKVALIYQGYRQEHSQAEPPQK"
     gene            331263..331466
                     /locus_tag="DDA3937_RS01470"
                     /old_locus_tag="Dda3937_00670"
                     /db_xref="GeneID:9731692"
     CDS             331263..331466
                     /locus_tag="DDA3937_RS01470"
                     /old_locus_tag="Dda3937_00670"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315994.1"
                     /note="membrane protein AaeX; the gene is a member of the
                     aaeXAB operon; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein FixA"
                     /protein_id="WP_013315994.1"
                     /db_xref="GI:503081110"
                     /db_xref="GeneID:9731692"
                     /translation="MNSLPVMVLFGLSFPPVFFVLLITLALFFICIRLLHPTGIYDRV
                     WHPALFNTALFVCLFYLLFRFGL"
     gene            331489..332421
                     /locus_tag="DDA3937_RS01475"
                     /old_locus_tag="Dda3937_00671"
                     /db_xref="GeneID:9731693"
     CDS             331489..332421
                     /locus_tag="DDA3937_RS01475"
                     /old_locus_tag="Dda3937_00671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315995.1"
                     /note="with AaeB forms an efflux pump whose substrates are
                     p-hydroxybenzoic acid, 6-hydroxy-2-naphthoic and
                     2-hydroxycinnamate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="p-hydroxybenzoic acid efflux subunit AaeA"
                     /protein_id="WP_033111534.1"
                     /db_xref="GI:696580355"
                     /db_xref="GeneID:9731693"
                     /translation="MKVMIKKFSRMAITLLLVLLAAVALVRVWSFYTESPWTRDARFS
                     ADVVAIAPDVSGLLTDVNVQDNQPVKQGDVLFVIDQPRYQQALEQAQADVAYYQALAD
                     EKKRESARRQRLGVQAMSREEIEQSGNALQTTLHQLAKAQAELELAKLDLARTVVRAP
                     ADGWITNLHVHAGEYITRGATAVALVKKDSFYLLAYMEETKLAGVRPGYRVEITPLGS
                     NQILFGAVDSIAAGVTNSSSSADTKGLATVDSNLEWVRLAQRVPVKIRLEQQWGDLYP
                     AGTTATVVVTGEHTRNTKPMSPLLQLLHRLREFG"
     gene            332435..334384
                     /locus_tag="DDA3937_RS01480"
                     /old_locus_tag="Dda3937_00672"
                     /db_xref="GeneID:9731694"
     CDS             332435..334384
                     /locus_tag="DDA3937_RS01480"
                     /old_locus_tag="Dda3937_00672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315996.1"
                     /note="with AaeA forms an efflux pump whose substrates are
                     p-hydroxybenzoic acid 6-hydroxy-2-naphthoic and
                     2-hydroxycinnamate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="p-hydroxybenzoic acid efflux subunit AaeB"
                     /protein_id="WP_033112188.1"
                     /db_xref="GI:696581009"
                     /db_xref="GeneID:9731694"
                     /translation="MNSPAFLRLRFAFKLSTAIVLSLVLGFHLQLETPRWATLTAAIV
                     AAGPAFAAGGDPFSGAIRHRGMLRVIGTFIGCIGALVIIIATVRAPVVMLMLCCLWAG
                     VCVWISSLVKVENAYVFALAGYTALIIIVTSQSAPLRIPQFAVERCSEIVLGIVCAIL
                     ADLLFSPRSIKQDIDRAVNELLVGQYQLLQRCVNGMTKEELDAAWNGLVRKTHAINGM
                     RSVLMMESSRWQGANRRIKTLLTQSWIMITQACETRLTLQDHPDAVKGAIAMMLEQPA
                     DTPAEMRRRLRQLRHLAAAHSRSLPPTLVSWLAAAARYQLLAKGVRTNVRISQSEAAL
                     LDADVPVKASSAETHHAMINGVRTGIATALGCLFWLLTGWTSGSVCMVMIAVVTSLAM
                     RLPNPLMAAKDFLVGTLVALPLGAVLFMMVLPSTQQSLLLLCLSLGGVAFVIGIEVQK
                     RRLGSLGALASTINILVLDNPMTFNLAQFLDNAIGQIIGCFLALIVILLIRDNTRDRT
                     GRTLLNRFVFGAVSALSTRPARRRENHLPALYQHLFLLLNLFPGEIGKYRLALSLIMM
                     HQRLRTLELPVSPSLSAFHRQMRATAEQVIDATRDRSHHFSRLLAQMDEYQHLLRDHQ
                     VSDDAIDAVGRLTALLHRHKHALGD"
     gene            complement(334391..334891)
                     /locus_tag="DDA3937_RS01485"
                     /old_locus_tag="Dda3937_00673"
                     /db_xref="GeneID:9731695"
     CDS             complement(334391..334891)
                     /locus_tag="DDA3937_RS01485"
                     /old_locus_tag="Dda3937_00673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111535.1"
                     /db_xref="GI:696580356"
                     /db_xref="GeneID:9731695"
                     /translation="MTTLFMYYVGGRAQGANIELHDVQFAAVEHPQDGFPLLKANWFG
                     DKSQVHVDSYTPCHWADGYDITLSRQPFQGREKLWFINMGGYLPHDPAEVHQFGLFVA
                     TDAEQAKQRAKAVLLTEVFQQHKDDLRDVDDCLPLTLLDRWHIHLTANPTGRVMPPQW
                     QGYHPL"
     gene            335008..335634
                     /locus_tag="DDA3937_RS01490"
                     /old_locus_tag="Dda3937_00674"
                     /db_xref="GeneID:9731696"
     CDS             335008..335634
                     /locus_tag="DDA3937_RS01490"
                     /old_locus_tag="Dda3937_00674"
                     /function="4.2.A.76 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Resistance to homoserine/Threonine (RhtB) Family"
                     /function="4.S.12 transport; substrate; amino acid"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter"
                     /protein_id="WP_013315998.1"
                     /db_xref="GI:503081114"
                     /db_xref="GeneID:9731696"
                     /translation="MTLHLWLVYVGVITALIAVPGPSALLSMTHGLRYGQRRALATVL
                     GGATGSLVLMTASALGLGAILAASATAFLVLKVVGAAYLIWLGISAWRTRESTLTPSV
                     EVEAIAPGLLKLYHRGFMVGVSNPKDILFFAALFPNFIDTGAPQAMQFALLALTWVVL
                     DCSIMFSYACMGNRVSALFAHPRRLRLFNRATGTLFIFAGSALVASTK"
     gene            complement(336038..336586)
                     /locus_tag="DDA3937_RS01495"
                     /old_locus_tag="Dda3937_00675"
                     /db_xref="GeneID:9731697"
     CDS             complement(336038..336586)
                     /locus_tag="DDA3937_RS01495"
                     /old_locus_tag="Dda3937_00675"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013315999.1"
                     /db_xref="GI:503081115"
                     /db_xref="GeneID:9731697"
                     /translation="MNKHPEDWQDDVPDASQDDDDEEIIWVSKSEIKRDAEALKALGT
                     ELVELGKNALERIPLDEDLRAAIELAQRITKEGRRRQLQLIGKMLRARDPEPIQTALD
                     KLRNRHNQQVSLFHKLEQLRDRLIAEGDGAVPDILALYPQADRQQLRSLVRNAQKEKA
                     ANKPPKSARLIFQYLRELAEAE"
     gene            336777..338117
                     /gene="pmbA"
                     /locus_tag="DDA3937_RS01500"
                     /old_locus_tag="Dda3937_00676"
                     /gene_synonym="tldE"
                     /db_xref="GeneID:9731698"
     CDS             336777..338117
                     /gene="pmbA"
                     /locus_tag="DDA3937_RS01500"
                     /old_locus_tag="Dda3937_00676"
                     /gene_synonym="tldE"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883028.1"
                     /note="protease involved in proteolytic processing of the
                     antibiotic Microcin B17 and in sensitivity to the DNA
                     gyrase inhibitor LetD; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase PmbA"
                     /protein_id="WP_033111536.1"
                     /db_xref="GI:696580357"
                     /db_xref="GeneID:9731698"
                     /translation="MTIITQVAEQRKVLEQAVSQALELARAGSDAAEVAVTKTTGISV
                     SSRYGEVENVEFNSDGALGITVYYQQRKGSASSTDMSPDAIARTVQAALDIARYTSVD
                     PCSGPADKDLLAFEAPDLDLFHPAELDADRGIELAAAAEQAALKADKRITNTEGGSFN
                     SHYGIKVFGNSHGMLQSYCSSRHSMSVSVIAEHNGDMERDYAYTIGRALGDLDSPAWV
                     GEECARRTLARLSPRKLATMEAPVMFSSEVATGLFGHLVGAISGGSVYRKSTFLLDSL
                     GKQILPEWLTIQELPHLRKGLASTPFDSEGVRTEQRDIVKEGVLQTWLLTTYAGRKLG
                     MKSTGHAGGIHNWRIAGRGLDFDGMLKEMGTGLLVTSLMGQGVSAVTGDYSRGAAGFW
                     VENGEIQYPVSEITIAGNLKDMLRNMVTIGDDIETRSNIQCGSVLLPSMKIAGV"
     gene            complement(338184..338594)
                     /locus_tag="DDA3937_RS01505"
                     /old_locus_tag="Dda3937_00677"
                     /db_xref="GeneID:9731699"
     CDS             complement(338184..338594)
                     /locus_tag="DDA3937_RS01505"
                     /old_locus_tag="Dda3937_00677"
                     /function="1.7.33 metabolism; central intermediary
                     metabolism; nucleotide and nucleoside conversions"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943108.1"
                     /note="Regulates the synthesis of nucleoside triphosphates
                     for nucleic acid synthesis, CTP for lipid synthesis, and
                     GTP for protein elongation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase regulator"
                     /protein_id="WP_013316001.1"
                     /db_xref="GI:503081117"
                     /db_xref="GeneID:9731699"
                     /translation="MDKPHLTISELDAERLDALLEQPAFADTEVAQALSEELDRADIV
                     QPVEIPGDVVTMNSRVRFRDLLTTEEHIRTLVYPAGLKDSREQISVMAPLGAALLGMH
                     VGNSIAWPLPNGEETRIEVMELLYQPEAAGEYHR"
     gene            complement(338775..339047)
                     /locus_tag="DDA3937_RS01510"
                     /old_locus_tag="Dda3937_00678"
                     /db_xref="GeneID:9731700"
     CDS             complement(338775..339047)
                     /locus_tag="DDA3937_RS01510"
                     /old_locus_tag="Dda3937_00678"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="4.8.A.8 transport; Group Translocators;
                     Accessory Factors Involved in Transport; The
                     Phosphotransferase System HPr (HPr) Family"
                     /function="4.S.173 transport; substrate; sugar"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohistidinoprotein-hexose
                     phosphotransferase"
                     /protein_id="WP_013316002.1"
                     /db_xref="GI:503081118"
                     /db_xref="GeneID:9731700"
                     /translation="MTVRQTVEVKNRLGMHARPAMKLFELVQSFDSAVLLRNESGTEA
                     DASSVIAMLMLDSAKGRHIEVEVTGSDEEQALAAVIQLFEAGFDED"
     gene            complement(339044..339898)
                     /locus_tag="DDA3937_RS01515"
                     /old_locus_tag="Dda3937_00679"
                     /db_xref="GeneID:9731701"
     CDS             complement(339044..339898)
                     /locus_tag="DDA3937_RS01515"
                     /old_locus_tag="Dda3937_00679"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2VGV3.1"
                     /note="glucosamine-6-phosphate regulated; inactivates the
                     glmS upregulator glmZ; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glmZ(sRNA)-inactivating NTPase"
                     /protein_id="WP_013316003.1"
                     /db_xref="GI:503081119"
                     /db_xref="GeneID:9731701"
                     /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPELAHTL
                     AERNISAAVSIDVRNLPETPEVLEHALTRLPQSFSPQLLFLDADRNTLIRRYSDTRRL
                     HPLSSKNLSLESAIDEENDLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKREREL
                     TMVFESFGYKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNF
                     IYQTRSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYIAEQLADYFRSRGKNVQSRH
                     RTLEKRKS"
     gene            complement(340047..340535)
                     /locus_tag="DDA3937_RS01520"
                     /old_locus_tag="Dda3937_00680"
                     /db_xref="GeneID:9731702"
     CDS             complement(340047..340535)
                     /locus_tag="DDA3937_RS01520"
                     /old_locus_tag="Dda3937_00680"
                     /function="4.S.173 transport; substrate; sugar"
                     /function="4.4.A.2 transport; Group Translocators;
                     Phosphotransferase Systems (PEP-dependent PTS); The PTS
                     Fructose-Mannitol (Fru) Family"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.1.4 metabolism; carbon utilization; amines"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316004.1"
                     /note="involved in nitrogen metabolism; protein IIA is
                     phosphorylated by enzyme I(Ntr); Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="WP_013316004.1"
                     /db_xref="GI:503081120"
                     /db_xref="GeneID:9731702"
                     /translation="MNNEPVMQLSAVLRKECTRSAVHCQSKKRALEIISELAARQLNL
                     PPQMVFEAILTRERMGSTGIGNGIAIPHGKLEDENTLGAVGVFIQLEQPIAFDAIDNQ
                     PVDLLFALLVPTEQCKTHLHTLSLVAKRLADKTVCKRLRAAQSDDELYQIMTEADLSD
                     QP"
     gene            complement(340629..340916)
                     /locus_tag="DDA3937_RS01525"
                     /old_locus_tag="Dda3937_00681"
                     /db_xref="GeneID:9731703"
     CDS             complement(340629..340916)
                     /locus_tag="DDA3937_RS01525"
                     /old_locus_tag="Dda3937_00681"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.1 regulation; type of regulation;
                     transcriptional level; sigma factors, anti-sigmafactors"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008815220.1"
                     /note="YhbH; resting ribosome-binding protein involved in
                     ribosome stabilization and preservation in stationary
                     phase; binds specifically 100S ribosomes (an inactive
                     ribosome product of a 70S ribosome dimerization); seems to
                     be involved in modulation of the sigma(54) (RpoN) activity
                     for quorum sensing; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome hibernation promoting factor HPF"
                     /protein_id="WP_013316005.1"
                     /db_xref="GI:503081121"
                     /db_xref="GeneID:9731703"
                     /translation="MQLNITGHHVEITDALREFVNLKFAKLEQYFDRINQVYVVLKVE
                     KILHIADATIHVNGGELHATSEADDMYAAIDLLIDKLARQLNKHKDKLKQH"
     gene            complement(340941..342374)
                     /locus_tag="DDA3937_RS01530"
                     /old_locus_tag="Dda3937_00682"
                     /db_xref="GeneID:9731704"
     CDS             complement(340941..342374)
                     /locus_tag="DDA3937_RS01530"
                     /old_locus_tag="Dda3937_00682"
                     /function="1.8.3 metabolism; metabolism of other
                     compounds; nitrogen metabolism"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.1 regulation; type of regulation;
                     transcriptional level; sigma factors, anti-sigmafactors"
                     /function="3.3.3 regulation; genetic unit regulated;
                     stimulon"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848121.1"
                     /note="sigma factors are initiation factors that promote
                     the attachment of RNA polymerase to specific initiation
                     sites and are then released; sigma 54 factor is
                     responsible for the expression of enzymes involved in
                     nitrogen assimilation and metabolism; the rhizobia often
                     have 2 copies of this sigma factor; in Rhizobium etli
                     RpoN1 shown to be involved in the assimilation of several
                     nitrogen and carbon sources during free-living aerobic
                     growth and RpoN2 is involved in symbiotic nitrogen
                     fixation; in Bradyrhizobium both RpoN1 and N2 are
                     functional in free-living and symbiotic conditions, rpoN1
                     gene was regulated in response to oxygen; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase factor sigma-54"
                     /protein_id="WP_013316006.1"
                     /db_xref="GI:503081122"
                     /db_xref="GeneID:9731704"
                     /translation="MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQEIQLALESN
                     PLLEQADIHDEVETQESSDSETLDTREALEQKDMPDELPLDAAWDEIYTAGTPSGTST
                     DYRDEELPVYQGETTQTLQDYLMWQVELTPFSDTDSAIATSIVDAVDNTGYLTVSLDD
                     IRDSIGNDDVTLEEVEAVLKRVQRFDPVGVAARDLRECLLVQLSQFDNGIPRLAEARL
                     IVSEYLDLLANHDFRTLIRTSRLKEEVLKEALALIQSLDPRPGQSINTGESEYVIPDV
                     LVRKIQGHWAVELNTDSVPRLQINQQYAALGSSARNDSDGQFIRSHLQEARWLIKSLE
                     SRNDTLLKVTRCIVEQQQAFFEHGEEFMKPMVLADIAQAVDMHESTISRVTTQKFLHS
                     PRGIFELKYFFSSHVNTDNGGEASSTAIRALVRKLIAAENPAKPLSDSKLTSLLSEQG
                     IIVARRTVAKYRESLSIPPSNQRKQLV"
     gene            complement(342422..343147)
                     /locus_tag="DDA3937_RS01535"
                     /old_locus_tag="Dda3937_00683"
                     /db_xref="GeneID:9731705"
     CDS             complement(342422..343147)
                     /locus_tag="DDA3937_RS01535"
                     /old_locus_tag="Dda3937_00683"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013577257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_013316007.1"
                     /db_xref="GI:503081123"
                     /db_xref="GeneID:9731705"
                     /translation="MATLIAENLAKAYKGRKVVENVSLNVNSGEIVGLLGPNGAGKTT
                     TFYMVVGIVPRDEGRIVIDDEDISLLPLHDRARRGIGYLPQEASIFRRLSVYDNLMAV
                     LEIRKDLTREQQQDRAHELMEEFHIVHLRDSLGQSLSGGERRRVEIARALAANPKFIL
                     LDEPFAGVDPISVIDIKKIIEHLRDSGLGVLITDHNVRETLDVCERAYIVSQGQLIAH
                     GSPMDILANEQVKRVYLGEGFRL"
     gene            complement(343163..343741)
                     /locus_tag="DDA3937_RS01540"
                     /old_locus_tag="Dda3937_00684"
                     /db_xref="GeneID:9731706"
     CDS             complement(343163..343741)
                     /locus_tag="DDA3937_RS01540"
                     /old_locus_tag="Dda3937_00684"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316008.1"
                     /note="LptA; periplasmic binding protein part of a
                     putative ABC superfamily of uptake transporters; interacts
                     with LptB protein, the ATP binding component of the uptake
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_013316008.1"
                     /db_xref="GI:503081124"
                     /db_xref="GeneID:9731706"
                     /translation="MKSNQKINVLHSILIASSLFAVSVPALALTGDTDQPIHITSDQQ
                     ALDMQGNVVTFTGNVIVTQGSIKAQADKVVVTRPNGQQGHEVIEGYGNPATFYQMQDN
                     GKPVKGHSQKMRYEMDKQLVILTGDAYLEQLDSNVKGDRITYLVQQQQMEAFSDKGKR
                     VTTVLVPTQLQDKGTQNGAKPSGNTGKPTKQQ"
     gene            complement(343719..344288)
                     /locus_tag="DDA3937_RS01545"
                     /old_locus_tag="Dda3937_00685"
                     /db_xref="GeneID:9731707"
     CDS             complement(343719..344288)
                     /locus_tag="DDA3937_RS01545"
                     /old_locus_tag="Dda3937_00685"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_013316009.1"
                     /db_xref="GI:503081125"
                     /db_xref="GeneID:9731707"
                     /translation="MSKTKRWLTLLLALIALVLIGLNLTNQRAGNGPTEVQNNDPAYT
                     MQQNITVVYDPTGKLSYKLVAEKAEHYNADQVSWFTQPVATMFNEQTVATWSVRADRA
                     KLTKDRMLYLYGHVEVNSLTNDSQLERIKTDNAQINLVTQDVTSDDEVTLYGVNFTSN
                     GLKMRGNLRSKTAELIDKVKSYYEIQPKN"
     gene            complement(344285..344851)
                     /locus_tag="DDA3937_RS01550"
                     /old_locus_tag="Dda3937_00686"
                     /db_xref="GeneID:9731708"
     CDS             complement(344285..344851)
                     /locus_tag="DDA3937_RS01550"
                     /old_locus_tag="Dda3937_00686"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883038.1"
                     /note="forms homotetramers; catalyzes hydrolysis of KDO
                     8-P to KDO and inorganic phosphate; functions in
                     lipopolysaccharide biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonate 8-phosphate
                     phosphatase"
                     /protein_id="WP_013316010.1"
                     /db_xref="GI:503081126"
                     /db_xref="GeneID:9731708"
                     /translation="MSEIRPQTDTCYGPVDTQVMQRARDIRLLICDVDGVLSDGLIYM
                     GNQGEELKAFNVRDGYGIRCLLTSDVDVAIITGRSSQLLVDRCQTLGIRHLYQGQSDK
                     LLAFRELLDTLSLTASQVAYIGDDLIDWPVMAETGLSVAVADAHPLLLPNAHYVTRIA
                     GGRGAVREICDLILLAQGKLDFAKGLSI"
     gene            complement(344901..345887)
                     /locus_tag="DDA3937_RS01555"
                     /old_locus_tag="Dda3937_00687"
                     /db_xref="GeneID:9731709"
     CDS             complement(344901..345887)
                     /locus_tag="DDA3937_RS01555"
                     /old_locus_tag="Dda3937_00687"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /function="6.7 cell structure; capsule (M and K antigens)"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009114750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-arabinose 5-phosphate isomerase"
                     /protein_id="WP_013316011.1"
                     /db_xref="GI:503081127"
                     /db_xref="GeneID:9731709"
                     /translation="MSHFELQPGFDFQTAGRQVLSIERDSLAQLDQYIDDNFSRACEK
                     MFYCHGKVVVMGMGKSGHIGCKMAATFASTGTPAFFVHPGEASHGDLGMITAQDIVIA
                     ISNSGESHEILALIPVLKRLQVCLICMTGNPESTMAKAADIHLCVHVSQEACPLGLAP
                     TSSTTATLVMGDALAVALLQARGFTAEDFALSHPGGALGRKLLLRINDIMHTGDEIPR
                     VGRDASLRDALLEITRKNLGMTVICGPDDRIEGIFTDGDLRRVFDMNIDLNSAGIADV
                     MTRGGIRVTPQTLAVDALNLMQSRHITSLLVAEDDRLRGIVHMHDMLRAGVV"
     gene            complement(345918..346880)
                     /locus_tag="DDA3937_RS01560"
                     /old_locus_tag="Dda3937_00688"
                     /db_xref="GeneID:9731710"
     CDS             complement(345918..346880)
                     /locus_tag="DDA3937_RS01560"
                     /old_locus_tag="Dda3937_00688"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.2.A.19 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Ca2+:Cation Antiporter (CaCA) Family"
                     /function="6.1 cell structure; membrane"
                     /function="4.S.133 transport; substrate; Na+/Ca+"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:calcium antiporter"
                     /protein_id="WP_013316012.1"
                     /db_xref="GI:503081128"
                     /db_xref="GeneID:9731710"
                     /translation="MLFATVLLIVGLVLLVYGADRLVYGAAVLARTFGVPPMIIGMTI
                     VGMGTSLPELMVSVTAALNHQTDMAVGNVLGSNIANILLILGSAVLIRPLTFHSPLLR
                     QELPPMLVVTLLCGVLLHDSFLSRLDGVILLLTAGGCIVLMLRMARAAQNRGDDSLTR
                     EQMAELPRENNQTVALLWLLIGLIILPMSARIVIDNATVIANYFNISELTIGLTVLAV
                     GTSLPELATAIVGTLKKEDDIALGNLIGSNIFNIVIVLGVPALLSPGAVNPLAFARDY
                     WVMLGVSALLTVLCLRQKRRIGQGAGALLLCAFIAYLSMLFLFS"
     gene            347162..347971
                     /locus_tag="DDA3937_RS01565"
                     /old_locus_tag="Dda3937_00689"
                     /db_xref="GeneID:9731711"
     CDS             347162..347971
                     /locus_tag="DDA3937_RS01565"
                     /old_locus_tag="Dda3937_00689"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316013.1"
                     /note="ABC transporter maintaining outer membrane lipid
                     asymmetry; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="organic solvent ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_013316013.1"
                     /db_xref="GI:503081129"
                     /db_xref="GeneID:9731711"
                     /translation="MNHENLVEIRGLSFRRGNRPIFSDVSLNVPKQKITAIMGPSGIG
                     KTTLLRLIGGQLQPDSGEIWFDGENIPTLSRSRLYETRKKMSMLFQSGALFTDLNVFD
                     NVAWPLREHTQLPEPLLHSTVMMKLEAVGLRGAAELMPSELSGGMARRAALARAIALD
                     PQLIMFDEPFVGQDPITMGVLVKLIDELNHALGVTCIVVSHDVPEVLSIADYAYIIAD
                     QRVVAEGSPAELQQNGDPRVRQFLDGIADGPVPFRYPAGDYQRGLLGLGSK"
     gene            347975..348757
                     /locus_tag="DDA3937_RS01570"
                     /old_locus_tag="Dda3937_00690"
                     /db_xref="GeneID:9731712"
     CDS             347975..348757
                     /locus_tag="DDA3937_RS01570"
                     /old_locus_tag="Dda3937_00690"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013316014.1"
                     /db_xref="GI:503081130"
                     /db_xref="GeneID:9731712"
                     /translation="MLLQALASLGRVGIQVCAAFGRAGLMLFNALVGKPEPAKQWPLL
                     RKQLYSVGVQSLLIIMVSGVFIGMVLGLQGYLVLTTYSAEASLGMMVALSLLRELGPV
                     VTALLFAGRAGSALTAEIGLMKTTEQLSSMEMMAVDPLRRVVAPRFWAGVISMPLLTV
                     IFVAVGIWGGALVGVDWKGIDSGFFWSAMQNAVEWRKDLLNCVIKSLVFAITVTWIAL
                     FNGYDAIPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFGK"
     gene            348762..349385
                     /locus_tag="DDA3937_RS01575"
                     /old_locus_tag="Dda3937_00691"
                     /db_xref="GeneID:9731713"
     CDS             348762..349385
                     /locus_tag="DDA3937_RS01575"
                     /old_locus_tag="Dda3937_00691"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="organic solvent ABC transporter"
                     /protein_id="WP_013316015.1"
                     /db_xref="GI:503081131"
                     /db_xref="GeneID:9731713"
                     /translation="MQTKKHEIWVGVFMLIALCAIVFLCLKVADLKSLGQQQTYRLYA
                     TFDNIGGLKARSPVKIGGVVIGRVADISLDTKTYLPRVAIDIDKRYDHIPDTSSLAIR
                     TSGLLGEQYLALNMGFEDEDMGTSILKDGGTIQDTKSAMVLEDLIGQFLYKSGGSNTD
                     NASQNNASHDTVSPNNANPSHAKPVETKPAENSGEAAKPESGAKPAQ"
     gene            349403..350056
                     /locus_tag="DDA3937_RS01580"
                     /old_locus_tag="Dda3937_00692"
                     /db_xref="GeneID:9731714"
     CDS             349403..350056
                     /locus_tag="DDA3937_RS01580"
                     /old_locus_tag="Dda3937_00692"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="4.3.A.1 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The ATP-binding Cassette (ABC) Superfamily +
                     ABC-type Uptake Permeases"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316016.1"
                     /note="involved in maintaining outer membrane lipid
                     asymmetry; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="organic solvent ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_013316016.1"
                     /db_xref="GI:503081132"
                     /db_xref="GeneID:9731714"
                     /translation="MLKRLLMVALLVVAPLVSAADQTTPQIDQTNPYSLMNEAANKTF
                     NRLKNEQWPIKQDPNYLRTVVRKELLPYVQVKYAGALVLGQYYKNATPDQREAYFKAF
                     EAYLEQAYGQALASYHGQTYEIASEQPVGNAEIVSIRVTITDNGGRPPIRLDFQWRKN
                     TKTGYWQAYDMIAEGVSMITTKQNEWASTLRQSGVDGLTKQLQAAAQQPISLGQKNG"
     gene            350049..350351
                     /locus_tag="DDA3937_RS01585"
                     /old_locus_tag="Dda3937_00693"
                     /db_xref="GeneID:9731715"
     CDS             350049..350351
                     /locus_tag="DDA3937_RS01585"
                     /old_locus_tag="Dda3937_00693"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma B factor antagonist"
                     /protein_id="WP_013316017.1"
                     /db_xref="GI:503081133"
                     /db_xref="GeneID:9731715"
                     /translation="MADALRWRQDDGALRLEGDLDRNTLLPLWQQREALLNDSSVLDV
                     GQVARVDSSGLALLVHFYHQQEQRGKPLAIIGASDRLRTLIQLYNLSEIIPVRPAD"
     gene            350484..350738
                     /locus_tag="DDA3937_RS01590"
                     /old_locus_tag="Dda3937_00694"
                     /db_xref="GeneID:9731716"
     CDS             350484..350738
                     /locus_tag="DDA3937_RS01590"
                     /old_locus_tag="Dda3937_00694"
                     /function="5.1 cell processes; cell division"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316018.1"
                     /db_xref="GI:503081134"
                     /db_xref="GeneID:9731716"
                     /translation="MENNEIKDVLMSALALQEVHVSGDGSHFQVIVIGELFKGMSRVK
                     QQQTVYAPLMEYIADNRIHALSIKAYTPEEWQRDRKLSGL"
     gene            350796..352058
                     /locus_tag="DDA3937_RS01595"
                     /old_locus_tag="Dda3937_00695"
                     /db_xref="GeneID:9731717"
     CDS             350796..352058
                     /locus_tag="DDA3937_RS01595"
                     /old_locus_tag="Dda3937_00695"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="WP_013316019.1"
                     /db_xref="GI:503081135"
                     /db_xref="GeneID:9731717"
                     /translation="MDKFRVQGPTRLAGEVTISGAKNAALPILFAALLAEEPVEIQNV
                     PKLRDIDTTMKLLSQLGARVERNGSVHVDASTVNVFCAPYDLVKTMRASIWALGPLVA
                     RFGQGQVSLPGGCAIGARPVDLHINGLEQLGAHITLEEGYVKATVDGRLKGAHIVMDK
                     VSVGATVTIMSAATLAVGKTIIENAAREPEIVDTANFLNTLGAKISGAGSDKIVIEGV
                     ERLGGGVYRVLPDRIETGTFLVAAAVSGGKVMCRHTRPDTLDAVLSKLREAGADIEIG
                     EDWISLDMHGRRPKAVNVRTAPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMH
                     IPELIRMGAQAEIESNTVICHGVGHLSGAQVMATDLRASASLVLAGCIAEGTTLVDRI
                     YHIDRGYERIEDKLRALGANIERVSAND"
     gene            complement(352117..353217)
                     /locus_tag="DDA3937_RS01600"
                     /old_locus_tag="Dda3937_00696"
                     /db_xref="GeneID:9731718"
     CDS             complement(352117..353217)
                     /locus_tag="DDA3937_RS01600"
                     /old_locus_tag="Dda3937_00696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine endoprotease"
                     /protein_id="WP_042318717.1"
                     /db_xref="GI:754962794"
                     /db_xref="GeneID:9731718"
                     /translation="MLRSNLLYTPKTLMLTKLLRSALFGVIVAGILLLAIPALRSNQG
                     LLKSGGDNSQETPVSYYQGVRRAAPAVVNVYNQANDPTAKNELNIRTLGSGVIMNNKG
                     YILTNKHVISNAEQIVVTLQDGRIFEALLVGSDSLTDLAVLKIEGANLPEIPINPKRV
                     FHVGDVVMAIGNPYNLGQTVTQGIVSATGRVGLSSSGRQNFLQTDASINRGNSGGALV
                     NTLGELVGINTLSFDKSNDGGTPEGIGFAIPVALATKIMNKLIRDGRVIRGYIGISGA
                     QRERLGNQVTGLERLQGIVVNQVETGGPADKAGIKEGDLLLEVNNKPARSVIETMDQV
                     AEIRPGSVIPVVIFRDNQEIKLDMTIQEYPSD"
     gene            complement(353267..354637)
                     /locus_tag="DDA3937_RS01605"
                     /old_locus_tag="Dda3937_00697"
                     /db_xref="GeneID:9731719"
     CDS             complement(353267..354637)
                     /locus_tag="DDA3937_RS01605"
                     /old_locus_tag="Dda3937_00697"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="2.3.6 information transfer; protein related;
                     turnover, degradation"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010296670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine endoprotease"
                     /protein_id="WP_013316021.1"
                     /db_xref="GI:503081137"
                     /db_xref="GeneID:9731719"
                     /translation="MKKTSLLYSALALGIGLSLSSLPPANAALPAVVEGQALPSLAPM
                     LEKVLPAVVSVHVEGTQVQRQRIPEEFKFFFGPNTPSEKQNSRPFEGLGSGVIINAEK
                     GYVLTNNHVVNNADKIQVQLNDGREYDAKLIGRDEQTDIALLQLNDAKNLTEVKMADS
                     DQLRVGDFAVAVGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGNSGGA
                     LVNLRGELIGINTAILAPSGGNVGIGFAIPSNMAQNLTQQLVEFGEVKRGLLGIKGSE
                     MTSEIAKAFKVDAQRGAFVSEVIPKSAAAKAGIKAGDVLVSLDGKPISSFAELRAKIG
                     TTAPGKTVRIGLLRDGKQQEVAVVLDNSANVTTNADTLSPALQGATLNNGQLKDGSKG
                     VTIDNVAKDSAAAKVGLQKGDIIVGVNRERVENITQLRKILEAKPSVLALNIVRGDES
                     IYLLLR"
     gene            complement(354874..355278)
                     /locus_tag="DDA3937_RS01610"
                     /note="cytochrome D ubiquinol oxidase subunit III;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23677384"
     gene            355489..356619
                     /locus_tag="DDA3937_RS01615"
                     /old_locus_tag="Dda3937_04446"
                     /db_xref="GeneID:9731721"
     CDS             355489..356619
                     /locus_tag="DDA3937_RS01615"
                     /old_locus_tag="Dda3937_04446"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316022.1"
                     /db_xref="GI:503081138"
                     /db_xref="GeneID:9731721"
                     /translation="MQRTTPLALYQQALAAQTYQPDEVQHQTVVRLNAIHQTLTEQVW
                     APAESSAPGLMAKWRTWLGQKEKSPSPVQGLYMWGGVGRGKTWLMDLFFHSLPSERKL
                     RLHFHRFMLRVHEELNQLQGQENPLEKVADGFKAQTDILCFDEFFVSDITDAMLLAEL
                     LRALFSRGIALVATSNIPPDELYRNGLQRARFLPAIELIKQHCGVLNVDAGIDYRLRT
                     LTQAHLYLTPSNADTDAEMQAMFRCLSGRDFSQPGPVLEINHRPLTTLSAGDGVLAVD
                     FATLCLEARSQNDYIALSRLYHTVLLHHVPVMEVKDENAARRFLALVDEFYERRVKLI
                     MSAQATMFEIYQGEHLKFEYQRCLSRLQEMQSEEYLRQPHLP"
     gene            complement(356675..357562)
                     /locus_tag="DDA3937_RS01620"
                     /old_locus_tag="Dda3937_00700"
                     /db_xref="GeneID:9731722"
     CDS             complement(356675..357562)
                     /locus_tag="DDA3937_RS01620"
                     /old_locus_tag="Dda3937_00700"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase"
                     /protein_id="WP_013316023.1"
                     /db_xref="GI:503081139"
                     /db_xref="GeneID:9731722"
                     /translation="MTRLTAKDFQPELLELYDYYAHGKLTKREFLERAARYAAGGLTA
                     MTILSLMSPNYALAQQVEFTDPAIIPEYITYPSPNGHGSVRGYLVRPAKTNSPVPAVV
                     VVHENRGLNPYIEDVARRLAKEGFIALAPDGLSSVGGYPGNDDKGRELQQQIDPTKLM
                     NDFFAAVEFLMKHKDATGKVGITGFCYGGGVANAAAVAYPELAAAVPFYGRQPKPEDV
                     SRIKAPLLLHYAERDDNINAGWPAYESALKAASKTYEAYIYPGTNHGFHNDSTPRYDK
                     AAADLAWNRTLAWFRRYLA"
     gene            358037..358465
                     /locus_tag="DDA3937_RS01625"
                     /old_locus_tag="Dda3937_00701"
                     /db_xref="GeneID:9731724"
     CDS             358037..358465
                     /locus_tag="DDA3937_RS01625"
                     /old_locus_tag="Dda3937_00701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000847558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="WP_012883052.1"
                     /db_xref="GI:502646720"
                     /db_xref="GeneID:9731724"
                     /translation="MKTFTAKPETVKRDWYVVDASGKTLGRLATELARRLRGKHKAEY
                     TPHVDTGDYIIVLNAEKVAVTGNKRSDKMYYHHTGHIGGIKEATFEEMIARRPERVIE
                     IAVKGMLPKGPLGRAMYRKLKVYAGNEHNHAAQQPQVLDI"
     gene            358481..358873
                     /locus_tag="DDA3937_RS01630"
                     /old_locus_tag="Dda3937_00702"
                     /db_xref="GeneID:9731725"
     CDS             358481..358873
                     /locus_tag="DDA3937_RS01630"
                     /old_locus_tag="Dda3937_00702"
                     /function="2.3.8 information transfer; protein related;
                     ribosomal proteins"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="6.6 cell structure; ribosome"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002437466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="WP_013316025.1"
                     /db_xref="GI:503081141"
                     /db_xref="GeneID:9731725"
                     /translation="MAENQYYGTGRRKSSAARVFIKPGSGNIVINQRTLEQYFGRETA
                     RMVVRQPLELVDMVGKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAG
                     FVTRDARQVERKKVGLRKARRRPQFSKR"
     gene            359171..359797
                     /locus_tag="DDA3937_RS01635"
                     /old_locus_tag="Dda3937_00703"
                     /db_xref="GeneID:9731726"
     CDS             359171..359797
                     /locus_tag="DDA3937_RS01635"
                     /old_locus_tag="Dda3937_00703"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010397588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013316026.1"
                     /db_xref="GI:503081142"
                     /db_xref="GeneID:9731726"
                     /translation="MQARTLSVDRICVAAAAHFAEHGYDAASLNEIAKAVNIKKASLY
                     SHFASKNALFMTVFDDTLQIETAFAQQCFNDEAPDALPGSHYFSCLAKRYADSVYLRF
                     LLRTGYLAPAALYDQISLGYEKYLEQLQDAFINKLHSGHDTRLLPADDVEQLGQAYLG
                     IVDSLHVKLVYTAEPDLSLRLTAMRRLLSDTLQCAILSSRQSREQHHV"
     gene            359790..361043
                     /locus_tag="DDA3937_RS01640"
                     /old_locus_tag="Dda3937_00704"
                     /db_xref="GeneID:9731727"
     CDS             359790..361043
                     /locus_tag="DDA3937_RS01640"
                     /old_locus_tag="Dda3937_00704"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="4 transport"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter CflA"
                     /protein_id="WP_013316027.1"
                     /db_xref="GI:503081143"
                     /db_xref="GeneID:9731727"
                     /translation="MSERYEHSAAAMTYSLILLLALLTALDAMAIDMYLPAMPALAMD
                     FGASSGKVQQTLSVFLVGLALGQGICGPLLDRYGRRIPLLAGLVIFIGGSVMAALSSS
                     IEWLMLARFLQALGASAGLVAPRAIVADLYSVAESARIFSLLMQVMMIAPILAPLLGG
                     YLLAHGEWRLVFWVLAGLGGAGLIWGIRTIPESLSEEKRLASRAGNLSPGNIVRAYVR
                     QLGYGVFMAYTLAGGVIFGSLFVYISSSSFVFTQSFGLTPAQFSYIFAANAVSLVIGG
                     QISTTLLRRRVGEQRIMMFGIVIHILAGLVLSVLILSGWIGLWGYLLLLATAIGALGL
                     VFGNLTALTMAYAGRQAGVASALMGMLQYLIAALVGYCASQVLQGPVVLPVVIVLCGV
                     VAMLLCIMASHMAQAAFSTCYDDRE"
     gene            361274..361915
                     /gene="sspA"
                     /locus_tag="DDA3937_RS01645"
                     /old_locus_tag="Dda3937_00705"
                     /db_xref="GeneID:9731728"
     CDS             361274..361915
                     /gene="sspA"
                     /locus_tag="DDA3937_RS01645"
                     /old_locus_tag="Dda3937_00705"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="3.3.3 regulation; genetic unit regulated;
                     stimulon"
                     /function="5.5.3 cell processes; adaptation to stress;
                     starvation response"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316028.1"
                     /note="transcriptional activator; required for activation
                     of bacteriophage P1 late promoter; induced by starvation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stringent starvation protein A"
                     /protein_id="WP_013316028.1"
                     /db_xref="GI:503081144"
                     /db_xref="GeneID:9731728"
                     /translation="MAVAANKRSVMTLFSGPSDIFSHQVRIVLAEKGVSVEIEQVDMD
                     NLPQDLIDLNPYGSVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGNSRLM
                     MHRIEQDWYSLMKTVLNGNTQDAEAARKQLREELLAIAPVFNEAPYFMSEEFSLVDCY
                     LAPLLWRLPLLGIELSGSGAKELKGYMTRVFERDAFLASLTEAEREIRLQSRG"
     gene            361920..362417
                     /locus_tag="DDA3937_RS01650"
                     /old_locus_tag="Dda3937_00706"
                     /db_xref="GeneID:9731729"
     CDS             361920..362417
                     /locus_tag="DDA3937_RS01650"
                     /old_locus_tag="Dda3937_00706"
                     /function="5.5.3 cell processes; adaptation to stress;
                     starvation response"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_013316029.1"
                     /db_xref="GI:503081145"
                     /db_xref="GeneID:9731729"
                     /translation="MTLSQLSPRRPYLLRAFYDWLLDNQLTPHLVVDVTVPGVQVPME
                     FARDGQIVLNIAPRAVGNLELADDSVRFNARFGGVPREVFVPMASVMAIYARENGAGT
                     MFEPEPAYEIVEEFGEQPQAEEESKPTLMSVVDNESPSSQDEQPDDEPPQPPRGGRPS
                     LRVVK"
     gene            362550..362960
                     /locus_tag="DDA3937_RS01655"
                     /old_locus_tag="Dda3937_00707"
                     /db_xref="GeneID:9731730"
     CDS             362550..362960
                     /locus_tag="DDA3937_RS01655"
                     /old_locus_tag="Dda3937_00707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde-activating protein"
                     /protein_id="WP_033111537.1"
                     /db_xref="GI:696580358"
                     /db_xref="GeneID:9731730"
                     /translation="MKTSQGRCLCGAVTITVPESCTHDVYVCHCGMCRTWGGGPLMAI
                     ETQHGVTLEGEEHVGRYRSSDWAERAFCRTCGTHLFYRLFEPEIYSISAGLFPNIPKQ
                     LVSQVYIDNKPDYYDFLQQTPTMTEQDIIDLYKK"
     gene            complement(363034..364452)
                     /locus_tag="DDA3937_RS01660"
                     /old_locus_tag="Dda3937_00708"
                     /db_xref="GeneID:9731731"
     CDS             complement(363034..364452)
                     /locus_tag="DDA3937_RS01660"
                     /old_locus_tag="Dda3937_00708"
                     /function="1.5.1.1 metabolism; building block
                     biosynthesis; amino acids; glutamate"
                     /function="1.8.3 metabolism; metabolism of other
                     compounds; nitrogen metabolism"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017494264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase subunit beta"
                     /protein_id="WP_013316031.1"
                     /db_xref="GI:503081147"
                     /db_xref="GeneID:9731731"
                     /translation="MSQNVYQFIDLQRVDPPKKPLKIRKIEFVEIYEPFSESQSKAQA
                     DRCLACGNPYCEWKCPVHNYIPNWLKLANEGRIIEAAELSHQTNSLPEVCGRVCPQDR
                     LCEGSCTLNDEFGAVTIGNIERYINDKAIEMGWRPDVSSVQPTGKRVAIIGAGPAGLA
                     CADVLTRSGVKAVVYDRHPEIGGLLTFGIPAFKLEKEVMTKRREIFTEMGIEFQLNTE
                     VGKDIQLSDLLTEYDAVFLGVGTYQSMRGGLENEDAPGVYDALPFLIANTKHLMGFET
                     GEQEPYTSMQGKRVVVLGGGDTAMDCVRTSIRQGATHVTCAYRRDEENMPGSKREVKN
                     AREEGVEFRFNLQPLSIEINGSGKVCGVRMVRTELGAPDANGRRRPEAVEGSEHVLEA
                     DAVIMAFGFRPHKMAWLAEHGVDLDTQGRIIAPEQSDSAFQTSNPKIFAGGDAVRGSD
                     LVVTAIAEGRKAADGIMNYLEV"
     gene            complement(364462..368922)
                     /gene="gltB"
                     /locus_tag="DDA3937_RS01665"
                     /old_locus_tag="Dda3937_00709"
                     /db_xref="GeneID:9731732"
     CDS             complement(364462..368922)
                     /gene="gltB"
                     /locus_tag="DDA3937_RS01665"
                     /old_locus_tag="Dda3937_00709"
                     /function="1.5.1.1 metabolism; building block
                     biosynthesis; amino acids; glutamate"
                     /function="1.8.3 metabolism; metabolism of other
                     compounds; nitrogen metabolism"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005975510.1"
                     /note="catalyzes the formation of glutamate from glutamine
                     and alpha-ketoglutarate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase subunit alpha"
                     /protein_id="WP_013316032.1"
                     /db_xref="GI:503081148"
                     /db_xref="GeneID:9731732"
                     /translation="MLYDASHERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGA
                     ILADGKTGDGCGLLLQKPDRFFRLVAEEHGWRLANNYAVGMLFLSRDEEKARATRRIV
                     EEELQNETLSVLGWREVPTNPDVLGEIALSSLPRIEQIFVNAPAGWRPRDMERRLFMA
                     RRRIEKRVQDKDFYVCSLSNLVNIYKGLCMPADLPRFYLDLADLRLESAICLFHQRFS
                     TNTVPRWRLAQPFRYLAHNGEINTITGNRQWARARAYKFKTPLIPDLLDAAPFVDESG
                     SDSMSLDNMLELFLAGGMDIVRAMRLLVPPAWQNNPNMDPELRAFFDFNSMHMEPWDG
                     PAGLVLSDGRYAACNLDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEKGRVGP
                     GELMVIDTRTGRILHSTETDDDLKSRHPYKEWMEKNVKRLVPFEELPDDQVGSRELDD
                     ALLETYQKQFGYSNEELDQVIRVLGENGQEATGSMGDDTPFAVLSSRPRIIYDYFRQQ
                     FAQVTNPPIDPLRESHVMSLATCIGREMNVFCEAEGQAHRLSFKSPILLYSDFIQLIN
                     QDPEHYRAEKLDITFDPKQRSLQDTVEKLCDEAEYKVRAGAVLLVLTDRGIAQDRLPV
                     PAPMAVGAIQARLVEKSLRCDANIIVETASARDPHHFAVLLGFGATAVYPYLAYETLA
                     RLVDNHTIDKPYRNVMQNYRNGINKGLYKIMSKMGISTIASYRCSKLFEAVGLHNDVA
                     SRCFQGVVSRIGGASFSDFEQDLQNLSKRAWLKRQKLEQGGLLKFVYDGEYHAYNPDV
                     VKTLQTAVHSGDYQDYQQYAKLVNERPASMLRDLLALQPQEGAAIPLEQVEPDTELFK
                     RFDTAAMSIGALSPEAHESLAEAMNSLGGFSNSGEGGEDPARYGTNKVSRIKQVASGR
                     FGVTPAYLVNADVIQIKVAQGAKPGEGGQLPGDKVTPYIARLRYSVPGVTLISPPPHH
                     DIYSIEDLAQLIFDLKQVNPKAMISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGT
                     GASPLSSVKYAGCPWELGLVETQQALVANGLRHKIRLQVDGGLKTGLDIVKAAILGAE
                     SFGFGTGPMVALGCKYLRICHLNNCATGVATQDDKLRRDHYHGLPERVVNYFTFIARE
                     TRELMAELGISRLVDLIGRTDLLVELDGITAKQNKLDLSPMLHTVAPQPGKALYCTEG
                     NPSFDKGLLNKELIAQAQAHVDARQSKTLYFDIRNTDRSVGATLSGVIAAKHGDQGLA
                     SDPIKAHFTGTAGQSFGVWNAGGVELTLTGDANDYVGKGMAGGVISVRPPVGSAFRSH
                     EASIIGNTCLYGATGGKLFAAGRAGERFAVRNSGAITVVEGIGDNGCEYMTGGIVCIL
                     GRTGVNFGAGMTGGFAYVLDEDGEFRKRVNPELVEVLEVENLAIHEEHLRGLITEHVQ
                     HTGSQRGEEILANWPVWASKFALVKPKSSDVKALLGHRSRSAAELRVQAQ"
     gene            369641..370570
                     /locus_tag="DDA3937_RS01670"
                     /old_locus_tag="Dda3937_00711"
                     /db_xref="GeneID:9731734"
     CDS             369641..370570
                     /locus_tag="DDA3937_RS01670"
                     /old_locus_tag="Dda3937_00711"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316034.1"
                     /db_xref="GI:503081150"
                     /db_xref="GeneID:9731734"
                     /translation="MQLQKLINMFGGDLQRRYGEKIHKLTLHGGFSCPNRDGTLGRGG
                     CTFCNVASFADEQMQQRSIAEQLAAQAGKVNRARRYLAYFQAYTSTYAEVQVLASMYR
                     QALTQADMVGLCVGTRPDCVPDTVLDLLADYHAQGYEVWLELGLQSAHDRTLRRINRG
                     HDFACYRQTAQRARARGLKVCSHLIVGLPGESEEHCLSTLRQVVEAGVDGIKLHPLHI
                     VTGSVMAKAWGAGRLPELPLARYVSIAGEMIRHTPPEIVYHRISASARRPTLLAPLWC
                     ENRWTGMVGVHDYLQQHGAQGSALGLPFHYSTN"
     gene            370664..373003
                     /locus_tag="DDA3937_RS01675"
                     /note="aerobic respiration control sensor protein ArcB;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23677385"
     gene            373240..373893
                     /locus_tag="DDA3937_RS01680"
                     /old_locus_tag="Dda3937_00714"
                     /db_xref="GeneID:9731737"
     CDS             373240..373893
                     /locus_tag="DDA3937_RS01680"
                     /old_locus_tag="Dda3937_00714"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenoid biosynthesis protein"
                     /protein_id="WP_013316035.1"
                     /db_xref="GI:503081151"
                     /db_xref="GeneID:9731737"
                     /translation="MKKVGVVLSGCGVYDGSEIHEVVLTLLAIDRAGAEAVCFAPDKQ
                     QLHVINHLTGEVTGEKRNVLAESARIARGKIQPLSSADPQQLDALIVPGGFGAAKNLS
                     DFATRGADCEIDNELKILTREIHKKNKPIGFICIAPAMLPKLLDTSVQLTIGNDEGTA
                     QAIEAMGGVHVTCPVDDIVVDVAHKVVTTPAYMLANSIGEAASGIEKLVTRVLELAE"
     gene            373890..374639
                     /gene="mtgA"
                     /locus_tag="DDA3937_RS01685"
                     /old_locus_tag="Dda3937_00715"
                     /db_xref="GeneID:9731738"
     CDS             373890..374639
                     /gene="mtgA"
                     /locus_tag="DDA3937_RS01685"
                     /old_locus_tag="Dda3937_00715"
                     /function="1.6.7 metabolism; macromolecules (cellular
                     constituent) biosynthesis; peptidoglycan (murein)"
                     /function="6.2 cell structure; peptidoglycan (murein)"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883062.1"
                     /note="glycosyltransferase; polymerizes glycan strands in
                     the peptidoglycan; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan transglycosylase"
                     /protein_id="WP_013316036.1"
                     /db_xref="GI:503081152"
                     /db_xref="GeneID:9731738"
                     /translation="MRSAGLFGKGRLGRLAVCVRRWVLRIFIGVVAMWLAAILLFAFL
                     PVPFSAVMIDRQLSAWLSGDFAYVAHSDWVSMDEIAAVAPLAVIAAEDQKFPQHWGFD
                     FDAISAALRHNERHENRIRGASTLSQQTVKNLLLWDGRSWVRKGLEAGLTAVVELVWT
                     KRRILTVYLNIAEFGPGIFGIEAASRQFFNKPASRLTASEAAMLAAVLPNPIRYRASK
                     PSGYVMRRQQWILRQMSQIGGENFLEANRLY"
     gene            374733..376034
                     /locus_tag="DDA3937_RS01690"
                     /old_locus_tag="Dda3937_00716"
                     /db_xref="GeneID:9731739"
     CDS             374733..376034
                     /locus_tag="DDA3937_RS01690"
                     /old_locus_tag="Dda3937_00716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alginate lyase"
                     /protein_id="WP_033111539.1"
                     /db_xref="GI:696580360"
                     /db_xref="GeneID:9731739"
                     /translation="MRYGLVFLMTLSLWGLEVSAAAVSVKNDNSAYVFLQADKLAQVK
                     QQLRNQSAPPQMQLAYQQLLRAADSDMKKTDLSVTQKLSMPPGGNRHDYLSLAAYWWP
                     DPQRKDGLPWVRHDGKVNPATKGEETDAIRLATFTDRVQVLALAWYFSDRPEYAAKAA
                     SMIRTWFITPDTRMNPNLNYAQAIPGRNDGRGAGVLDGRFFATRIVDALVILRQAPGW
                     SVSDEQQMRQWMTDYLQWLLSSHNGKQEAAAKNNHGSWYTVQVAGIAAYLGQPETVKA
                     MAALQRQKLDHQLAADGSQPEELARTRSFHYSGFNLQAVSMMAAVAGKYGDNLWLYRT
                     PNGSSLLSALDFMTPYLDESRPWPYKTMGREGSPLIPLMMQAEQAIGSPRYQAAIRQA
                     GFAPLLTGASEGKKDAEVSVDTRRRIWLLSPPSSTGNTPTP"
     gene            complement(376127..376702)
                     /locus_tag="DDA3937_RS01695"
                     /old_locus_tag="Dda3937_00717"
                     /db_xref="GeneID:9731740"
     CDS             complement(376127..376702)
                     /locus_tag="DDA3937_RS01695"
                     /old_locus_tag="Dda3937_00717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein"
                     /protein_id="WP_013316038.1"
                     /db_xref="GI:503081154"
                     /db_xref="GeneID:9731740"
                     /translation="MRIYSCIAVLSACLMLQGCIGAVAIGSAAVATKSATDPRTVGTQ
                     VDDGTLEVRVSNALSKDTQLSKEARISVTAYQGKVLLTGQAPSTELASRAKQIAMGVE
                     GTTEVYNEIRKGTPISLGTASMDTWITTKVRSQLLASDTVKSSNVKVTTENGEVFLLG
                     LVTRREGTSAAQIASKVGGVKHVTTAFSYLD"
     gene            complement(376713..377303)
                     /locus_tag="DDA3937_RS01700"
                     /old_locus_tag="Dda3937_00718"
                     /db_xref="GeneID:9731741"
     CDS             complement(376713..377303)
                     /locus_tag="DDA3937_RS01700"
                     /old_locus_tag="Dda3937_00718"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DAD4.1"
                     /note="Required for the timely initiation of chromosomal
                     replication via direct interactions with the dnaA
                     initiator protein; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DnaA initiator-associating protein DiaA"
                     /protein_id="WP_013316039.1"
                     /db_xref="GI:503081155"
                     /db_xref="GeneID:9731741"
                     /translation="MLERIKVCFTESIQTQIAAAEALPDAISRAALAMVQSLLNGNKI
                     LCCGNGTSAANAQHFAASMINRFETERPSLPAIALNADNVVLTAIANDRLHEEVYAKQ
                     VRALGQAGDVLLAISTRGNSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQQDVE
                     IRIPSHRSARIQEMHMLTVNCLCDLIDNTLFPHQND"
     gene            complement(377341..377736)
                     /locus_tag="DDA3937_RS01705"
                     /db_xref="GeneID:23677386"
     CDS             complement(377341..377736)
                     /locus_tag="DDA3937_RS01705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033112189.1"
                     /db_xref="GI:696581010"
                     /db_xref="GeneID:23677386"
                     /translation="MAAVPSGTTGARLLNRRITGGRYEQLARRHLERAGLIFVAANVT
                     VRGGELDLIMRDGGTWVFVEVRYRRNSDFGGAVASITRQKQQSLLRAAAVWLSRQGAS
                     FDSTDCRFDVLAVTGSQVEWLPNAFGQSE"
     gene            complement(377694..379745)
                     /locus_tag="DDA3937_RS01710"
                     /old_locus_tag="Dda3937_00720"
                     /db_xref="GeneID:9731743"
     CDS             complement(377694..379745)
                     /locus_tag="DDA3937_RS01710"
                     /old_locus_tag="Dda3937_00720"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein activator LpoA"
                     /protein_id="WP_013316041.1"
                     /db_xref="GI:503081157"
                     /db_xref="GeneID:9731743"
                     /translation="MLPLNSVRTHAGRLVPVMLAALFLAGCPSQAPQGTATQQHIEGK
                     AGASSDYYLQQMQQSGDDSKADWQLLAIHALIQEGKLPQANGQLNALPSQLNDKQRQE
                     QRLLLAELAVAQNDLNAANSTLAQLDVKSLSPQQQERYYQTQIKAAQDRPSLMLIRAY
                     IGQEPLLQGDAHQRNIDQTWAALTRLTQQDMGSMVINVDENTLQGWLDLLNLWQTKAQ
                     VPSDLQAAIEDWKRRYPRHPAAKQLPSQLGGTPPAAAAQPGDNAPAGGNAIALLLPLN
                     GQAQVFANAIQQGFSAARSGQVSLAMPVQTAQSASTAATTASPAAPATTTPDMIGTSP
                     TAPTTSSAPSTTATAVPALTTAAAGTIPVKVYDTSNQALANVIAQAQKDGATTIVGPL
                     LKNEVEQLPGLNPTLNVLALNQPEHIQPNPNICYFALSPEDEAADAAQFIHKQGKQHP
                     LILAPRGNLGDRVVAAFAKSWQQQAGGVVLQQRTGGVYDLKQALNSGAGIPLNGQPVI
                     TAASAPQPSTTVGGLTIPNQAPPIATATSDGNVDAVYIIATPDELTLLKPMIDMRNKG
                     ALRPALYASSRSYQAGLGPDFRFEMEGLQFSDIPLLTGASPALMQQISTQFRNDYSLV
                     RLFAMGMDAWKLASNFSQLHQPGNSLSGATGVLSTSPDCVVNRKLTWLQFRQGQLVPA
                     S"
     gene            379805..380674
                     /locus_tag="DDA3937_RS01715"
                     /old_locus_tag="Dda3937_00721"
                     /db_xref="GeneID:9731744"
     CDS             379805..380674
                     /locus_tag="DDA3937_RS01715"
                     /old_locus_tag="Dda3937_00721"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_013316042.1"
                     /db_xref="GI:503081158"
                     /db_xref="GeneID:9731744"
                     /translation="MNQDQQAQISASTLYIVPTPIGNLADITQRALAVLQQVDLIAAE
                     DTRHTGLLLQHFAINARLFALHDHNEQQKAEQLLARLQQGMSIALVSDAGTPLINDPG
                     YHLVRRCREAGVRVMPLPGPCAAITALSAAGLPSDRFCYEGFLPAKTKARKDTLRDLL
                     EEPRTLIFYESTHRLLDSLQDMVDVWGPERYVVLARELTKTWESLYGAPVAELLAWVQ
                     DDDNRRKGEMVLIVEGHRPDEEALSAAALRTLQLLRAELPLKKAAALAAEIHGVKKNA
                     LYRYGLEQEDGHA"
     gene            380717..381097
                     /locus_tag="DDA3937_RS21635"
                     /db_xref="GeneID:23677573"
     ncRNA           380717..381097
                     /locus_tag="DDA3937_RS21635"
                     /ncRNA_class="RNase_P_RNA"
                     /product="bacterial RNase P"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="GeneID:23677573"
     gene            381360..382169
                     /locus_tag="DDA3937_RS01720"
                     /old_locus_tag="Dda3937_00722"
                     /db_xref="GeneID:9731746"
     CDS             381360..382169
                     /locus_tag="DDA3937_RS01720"
                     /old_locus_tag="Dda3937_00722"
                     /function="1.5.1 metabolism; building block biosynthesis;
                     amino acids"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316043.1"
                     /note="catalyzes the conversion of shikimate to
                     3-dehydroshikimate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="WP_013316043.1"
                     /db_xref="GI:503081159"
                     /db_xref="GeneID:9731746"
                     /translation="MLNKDTKLCISLSGRPSNIGTRFHNYLYQKLDLDFIYKAFTTSD
                     IEHAVKGVRALGIRGCSVSMPFKESCIPFIDTLSDSAKAIDSVNTIVNENGHLTAYNT
                     DYIAVKYLINQNLKDKTMHVLIKGSGGMAKAVIAAFRDSDFRQVTILARNEERGLSLA
                     NKYGFQWCRDAAGIKADILVNVTPVGMAGGEEQNQLAFTEDQIRIASHIFDVVAFPAE
                     TPLIQLARKGDKPVITGAQVIALQALEQFALYTGIRPSEALMQEASVYSRS"
     gene            382348..383136
                     /locus_tag="DDA3937_RS01725"
                     /old_locus_tag="Dda3937_00723"
                     /db_xref="GeneID:9731747"
     CDS             382348..383136
                     /locus_tag="DDA3937_RS01725"
                     /old_locus_tag="Dda3937_00723"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316044.1"
                     /note="seems to be involved in biofilm formation; in
                     asymptomatic bacteriuria E. coli strains 83972 and VR50,
                     the ygiD gene is upregulated during biofilm formation in
                     urine; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LigB family dioxygenase"
                     /protein_id="WP_013316044.1"
                     /db_xref="GI:503081160"
                     /db_xref="GeneID:9731747"
                     /translation="MSTSRMPALFLGHGSPMNALDENDYTLAWRKLGETLPRPKAIVA
                     VSAHWYTRGTAVTAMDKPRTIHDFGGFPQALFDTQYPAPGAPDVAKRVQDVLAPVSVY
                     ADHQEWGLDHGTWGVLIKVYPEADIPVVQLSVDGTKPPAYHYELGRKLAALRDEGIMI
                     VASGNVVHNLRMIKWNGDGAPYGWATSFNDFVRSNLAWQGDAAEHPLVNFMQHNDAAL
                     SNPTPDHFLPLLYVLGSWDGQEPVSTPTDGIVMGSLSMMSVQVG"
     gene            complement(383261..384421)
                     /locus_tag="DDA3937_RS01730"
                     /old_locus_tag="Dda3937_00724"
                     /db_xref="GeneID:9731748"
     CDS             complement(383261..384421)
                     /locus_tag="DDA3937_RS01730"
                     /old_locus_tag="Dda3937_00724"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316045.1"
                     /db_xref="GI:503081161"
                     /db_xref="GeneID:9731748"
                     /translation="MKRIAINERPNWQEKAAEYGFRFHTMYGEPYWCEDAYYQFTLAQ
                     IEELEDATAELNQMCLQVVDKVVNSEALLTKFRIPRHTWDFVRSSWLSRQPALYARLD
                     LAYDGKNPAKLLENNADTPTSLYESAFFQWIWLEDQINAGRLPQHADQYNSLQEQLIE
                     RFEYLRTHHGFGNMHFTCCRDTDEDRGTVQYLQDCAQEAGVPSQFLYIDEIGLGDRGQ
                     FTDLQDNTIGNLFKLYPWEFMLRETFSTKLADAGVRWLEPGWKSVVSNKALLPMLWQM
                     FPNHPNLLPAYFTEDNPPAMSDYVVKPLFSREGANIRIYRQGQQVAAVDGPYGEEGSI
                     VQQFHPLPRFNDSYTLIGSWLVGDNPCGIGLREDRELITQDLSRLYPHIILD"
     gene            complement(384433..385194)
                     /locus_tag="DDA3937_RS01735"
                     /old_locus_tag="Dda3937_00725"
                     /db_xref="GeneID:9731749"
     CDS             complement(384433..385194)
                     /locus_tag="DDA3937_RS01735"
                     /old_locus_tag="Dda3937_00725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111540.1"
                     /db_xref="GI:696580361"
                     /db_xref="GeneID:9731749"
                     /translation="MKRTSNINHARFRKRWGYRIAPIALAVGAVFILSGCEKTDETVS
                     LYQNADDCSRANPAMKDQCTTTYNNARKEAERTAPKYATREECVAAFGESQCTQSATT
                     STTASAAAPQQSGSFWMPLMAGFMMGKLMGGNNFAQQPVFRPNTPNNPANGSYVDASG
                     KNYGSATGRTITVPKDAMTPKPTSSVRPSSITTTRGGFGDSVNKLNSTPAANMTGNQD
                     RDRAATSTSSSSSSATGSSTRQTGSSTPIRRSFGG"
     gene            complement(385387..386799)
                     /locus_tag="DDA3937_RS01740"
                     /old_locus_tag="Dda3937_00726"
                     /db_xref="GeneID:9731750"
     CDS             complement(385387..386799)
                     /locus_tag="DDA3937_RS01740"
                     /old_locus_tag="Dda3937_00726"
                     /function="tolC is involved in resistance to antimicrobial
                     plant chemicals and is essential for phytopathogenesis"
                     /function="7.4 location of gene products; outer membrane"
                     /function="6.1 cell structure; membrane"
                     /function="5.1 cell processes; cell division"
                     /function="4.1.B.17 transport; Channel-type Transporters;
                     Beta barrel porins (The Outer Membrane Porin (OMP)
                     Functional Superfamily); The Outer Membrane Factor (OMF)
                     Family"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane channel protein"
                     /protein_id="WP_013316047.1"
                     /db_xref="GI:503081163"
                     /db_xref="GeneID:9731750"
                     /translation="MKKLLPLLISLGLGGFSAVSQAEDLLQVYQQAKTTNPDLRSAAA
                     NRDAAFEKINEARSSLLPQLGLGADYTYTSGYRDRRDINSNATSASLQLTQSIFNMSL
                     WRALTLQEKQAGIQDVSYQTSQQTLLLNTATAYFNVLRAIDSLSYVSAQKQSIYRELD
                     QTTQRFNVGLVAITDVQNARAQYDSVLASEVTARNNLDNAMETLRQVTGQFYPQLAGL
                     NIDRFSPQKPDAVNGLLKEAENRNLSLLSARLSQDLAREQIRSAESGHLPTLNLTAST
                     GVTNTDYSGSRAVGDNFNNTYVGQNQVGLSFSLPIYSGGGTSSRVKQAQHSFVASSES
                     MESAHRSVIQTLRSAHNNISASISSVNAYKQAVISAQSSLDAMEAGYQVGTRTIVDVL
                     DATTTLYNAKQQLSGARYDYLINQLNLKQALGTLNEDDLRTLNAMLGKPVSTSAAIGD
                     DVPAPATTPAAAKTAAKAKP"
     gene            387203..387838
                     /gene="nudF"
                     /locus_tag="DDA3937_RS01745"
                     /old_locus_tag="Dda3937_04303"
                     /db_xref="GeneID:9731751"
     CDS             387203..387838
                     /gene="nudF"
                     /locus_tag="DDA3937_RS01745"
                     /old_locus_tag="Dda3937_04303"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.1 metabolism; carbon utilization"
                     /function="1.7.8 metabolism; central intermediary
                     metabolism; gluconeogenesis"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883073.1"
                     /note="ADP-sugar pyrophosphatase; catalyzes the formation
                     of D-ribose 5-phosphate from ADP-ribose; can also act on
                     ADP-mannose and ADP-glucose; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribose pyrophosphatase"
                     /protein_id="WP_013316048.1"
                     /db_xref="GI:503081164"
                     /db_xref="GeneID:9731751"
                     /translation="MASSGTHPGTFTKDDVEIIARETLYKGFFSLQRYRFRHRLFNGG
                     MSGEVSREILERGHAVVLLPYDPVRDEVVLIEQIRIAAYDTSTSPWLFELVAGMIEPG
                     ESLEEVARREAQEEAGLMVQRCRPALSYLASPGGTSERLAIWVGEVDAGAAGGIHGLA
                     EEHEDIRVHVVSREQSYQWVEQGIIDNAASVIALQWLALHHETLKKDWVDG"
     gene            387835..388260
                     /locus_tag="DDA3937_RS01750"
                     /old_locus_tag="Dda3937_04304"
                     /db_xref="GeneID:9731752"
     CDS             387835..388260
                     /locus_tag="DDA3937_RS01750"
                     /old_locus_tag="Dda3937_04304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_033111541.1"
                     /db_xref="GI:696580362"
                     /db_xref="GeneID:9731752"
                     /translation="MMKRYVPDFPEMMRLSEINFAQLRRLLPRNEEAGAAVVYQVHNA
                     SYRLTILESTRYTALVEIQQIAPSVSYWSLPTLVVRLYYDAMVAEVCSSQQIFRFKAR
                     YDYPNKKLHQRDEKHQINQFLADWLRYCLACGSMSVPVC"
     gene            388465..389292
                     /locus_tag="DDA3937_RS01755"
                     /old_locus_tag="Dda3937_01249"
                     /db_xref="GeneID:9731753"
     CDS             388465..389292
                     /locus_tag="DDA3937_RS01755"
                     /old_locus_tag="Dda3937_01249"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="3.1.3.4 regulation; type of regulation;
                     posttranscriptional; proteases, cleavage of compounds"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3',5'-cyclic-nucleotide phosphodiesterase"
                     /protein_id="WP_013316050.1"
                     /db_xref="GI:503081166"
                     /db_xref="GeneID:9731753"
                     /translation="MESLLTLPVARGARIRILQITDTHLFAGERETLLGVDTYRSYQA
                     VLDAIAAQQCDFDLITATGDLAQDHTQEAYTRFADGIRRFNAPCVWLPGNHDFQPAMV
                     DVLARSGIAPSKHVLLGEHWQVILLDSQVFGVPHGELSEYQLEWLERSLQSQPERYTL
                     LMLHHHPLPSGCTWLDQHSLRNAHSLDALLARFPRVRTVLCGHIHQEMDLDWNGRRLL
                     ATPSTCVQFKPHCTSFTIDNVAPGWRYLELLPDGVLETQVCRLEGNEFLPDMDSDGY"
     gene            389292..389873
                     /locus_tag="DDA3937_RS01760"
                     /old_locus_tag="Dda3937_01250"
                     /db_xref="GeneID:9731754"
     CDS             389292..389873
                     /locus_tag="DDA3937_RS01760"
                     /old_locus_tag="Dda3937_01250"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316051.1"
                     /note="Displays esterase activity toward palmitoyl-CoA and
                     pNP-butyrate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_013316051.1"
                     /db_xref="GI:503081168"
                     /db_xref="GeneID:9731754"
                     /translation="MPTLLYLHGFNSSPLSAKATALQQWLAQHHPHIDMLVPQLPPYP
                     ADAAEMVEQLVMERAGRPLGLVGSSMGGYYATWLSQRFRLPAVVVNPAVRPYELLLDF
                     LGDQQNPYTGEQYVLESRHIYDLKVMQVDPLESPDLLWCLLQTGDEVLDYRQAVAYYT
                     ACRQTVESGGNHAFVGFEHYFAPIIDFLGLTAD"
     gene            390060..391955
                     /locus_tag="DDA3937_RS01765"
                     /old_locus_tag="Dda3937_01251"
                     /db_xref="GeneID:9731755"
     CDS             390060..391955
                     /locus_tag="DDA3937_RS01765"
                     /old_locus_tag="Dda3937_01251"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="3.1.1.1 regulation; type of regulation; DNA
                     structure level; DNA bending, supercoiling, inversion"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943068.1"
                     /note="decatenates newly replicated chromosomal DNA and
                     relaxes positive and negative DNA supercoiling; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit B"
                     /protein_id="WP_013316052.1"
                     /db_xref="GI:503081169"
                     /db_xref="GeneID:9731755"
                     /translation="MTQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNS
                     VDEALAGHARRIDVILHPDQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFS
                     NKNYQFSGGLHGVGISVVNALSTRVEVTVRRDGQVYDIAFENGDKVQDLTVTGTCGRR
                     NTGTRVHFWPDASFFDSPRFSVLSLTHLLKAKAVLCPGVEIVFKDGVNDTEQRWCYQG
                     GLSDYLCEAVNGLPTLPEKPFIGTIPGDTEAVEWALLWLPEGGELLTESYVNLIPTLQ
                     GGTHVNGLRQGLLDAMREFCEFRNILPRGVKLSAEDIWERCAYVLSLKMQDPQFAGQT
                     KERLSSRQSAAFVSGVVKDAFSLWLNQNVQAAEQLAEMAISSAQRRMRAAKKVVRKKL
                     TSGPALPGKLADCTSQDLSKTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWE
                     VSSDEVLASQEVHDISVAIGIDPDSDDLSQLRYGKVCILADADSDGLHIATLLCALFV
                     RHFRALVQGGHVHVAMPPLYRIDLGKEVYYALDEEEKAGILEQLKRKKGKPNVQRFKG
                     LGEMNPMQLRETTLDPNTRRLVQLTINEQDIEQTLATMDMLLAKKRAEDRRNWLQEKG
                     DKAELDV"
     gene            391968..392864
                     /locus_tag="DDA3937_RS01770"
                     /old_locus_tag="Dda3937_01252"
                     /db_xref="GeneID:9731756"
     CDS             391968..392864
                     /locus_tag="DDA3937_RS01770"
                     /old_locus_tag="Dda3937_01252"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcripitonal regulator"
                     /protein_id="WP_013316053.1"
                     /db_xref="GI:503081170"
                     /db_xref="GeneID:9731756"
                     /translation="MKVTLEEMQAFVVVVDCGSVTAAAGQLGQTTSGISRALGRLESK
                     LGMTLLHRTTRRLALSEEGQIFLQHARDVLQTVELAEEQIALRRRKPSGRLRINAAAS
                     FMQHVIVPLIPEFRRRYPCISLELNTDDVIIDLLEQHTDVAIRIGELRDSSIHARPLG
                     ATRLRILASPEYLSRHGTPLGVEALAGHTLLGFTQSESLNLWPLRSAFGDYYPIVPTI
                     AASNGEMLRQLALRGEGIVRLSDFMTRDDVAAGRLVQILADDTLEMRLPVNAVFYRNT
                     ALASRIVSFLDFLSEKMAQHPL"
     gene            complement(392915..393496)
                     /locus_tag="DDA3937_RS01775"
                     /old_locus_tag="Dda3937_01253"
                     /db_xref="GeneID:9731757"
     CDS             complement(392915..393496)
                     /locus_tag="DDA3937_RS01775"
                     /old_locus_tag="Dda3937_01253"
                     /function="1.4.1 metabolism; energy production/transport;
                     electron donor"
                     /function="5.6.4 cell processes; protection; drug
                     resistance/sensitivity"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843593.1"
                     /note="involved in drug resistance; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH quinone reductase MdaB"
                     /protein_id="WP_013316054.1"
                     /db_xref="GI:503081171"
                     /db_xref="GeneID:9731757"
                     /translation="MHNVLIINAGKSFGHSKGELNRTLTDVAASFLRDKGRHVRITTV
                     DEGYDIEQEVQNFLWADAVIYQMPGWWMGAPWILKKYIDDVFTAGHGSLYASDGRTRA
                     DASKKYGSGGLLQGKHYLLSLTWNAPLEAFTDPDQFFHGVGVDGVYLPFHKANQFIGL
                     SSLPTFICNDVIKQPDVEQDIARYRAHLDQVFA"
     gene            393774..396050
                     /locus_tag="DDA3937_RS01780"
                     /old_locus_tag="Dda3937_01254"
                     /db_xref="GeneID:9731758"
     CDS             393774..396050
                     /locus_tag="DDA3937_RS01780"
                     /old_locus_tag="Dda3937_01254"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="2.1.2 information transfer; DNA related; DNA
                     restriction/modification"
                     /function="2.1.4 information transfer; DNA related; DNA
                     repair"
                     /function="3.1.1.1 regulation; type of regulation; DNA
                     structure level; DNA bending, supercoiling, inversion"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848078.1"
                     /note="decatenates newly replicated chromosomal DNA and
                     relaxes positive and negative DNA supercoiling; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="WP_013316055.1"
                     /db_xref="GI:503081172"
                     /db_xref="GeneID:9731758"
                     /translation="MSDMTHDGAERLALHTFTENAYLNYSMYVIMDRALPFIGDGLKP
                     VQRRIVYAMSELGLSASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYP
                     LVDGQGNWGAPDDPKSFAAMRYTESRLSKYAEVLLGELGQGTVDYVPNFDGTMQEPKM
                     LPARLPNILLNGTTGIAVGMATDIPPHNVREVAAAAVALIDEPDTQLDALLRYVQGPD
                     FPTEAEIITPRDEIRKMYESGRGSVRMRAVWKKEDGSVVITALPHQVSGARVLEQIAS
                     QMRAKKLPMIDDLRDESDHENPTRLVLVPRSNRIDLDLVMNHLFATTDLEKSYRINMN
                     MIGLDGRPSVKGLREILTEWLAFRRDTVRRRLNFRLDKVLKRLHILEGLLIAFLNIDE
                     VIHIIRNEDEPKPVLMAKFGLSDTQAEAILELKLRHLAKLEEMKIRGEQDDLAKERDQ
                     IQALLASERKMNSLLKKEIQEDAKAYGDERRSPLHERGEAKAMSEHDLSPSEPVTIVL
                     SEMGWVRSAKGHDIDPSGLSYKAGDAYRAAARGKSNQPVVFMDSTGRSYALDPLTLPS
                     ARGQGEPLTGKLTLPPGATIEQVLMAADNQRLLLASDAGYGFICTFADLVARNRVGKA
                     VLTLPDNAHVLPPLELQRDDDLLLTVTAAGRMLLFPVADLPELSKGKGNKIVSIPAAQ
                     LASGDDRILWLLAIAPHSSVTLYAGKRKYSLRPEELQKYQASRGCKGTALPRGLQRVD
                     RIEVDAPAGIASAGSSEE"
     gene            396291..397028
                     /locus_tag="DDA3937_RS01785"
                     /old_locus_tag="Dda3937_01255"
                     /db_xref="GeneID:9731759"
     CDS             396291..397028
                     /locus_tag="DDA3937_RS01785"
                     /old_locus_tag="Dda3937_01255"
                     /function="1.6.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; phospholipid"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843595.1"
                     /note="catalyzes the formation of 1,2-diacyl-sn-glycerol
                     3-phosphate from 1-acyl-sn-glycerol 3-phosphate using
                     either acyl-CoA or acyl-ACP; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_013316056.1"
                     /db_xref="GI:503081173"
                     /db_xref="GeneID:9731759"
                     /translation="MLFILRFLVVIVYSVVLCLAGLIYCLFTPKDPRHVSRFGRLFGR
                     LSVVFGLKVEVRRPEASRVEGNCIYIANHQNNYDMVTASNVVVPGTVTVGKKSLVWIP
                     FFGPLYWLAGNLLIDRDNRAKAHGTISQVVKHIKERNISVWMFPEGTRSRGRGLMPFK
                     TGAFHAAIAAGVPVVPICVSTTHKKVKLNRWNNGHVIIELLPPIDCSAYGKEQVRELA
                     AYCHDLMAAKIAQLDAEVAQREAAEKR"
     gene            397116..398534
                     /locus_tag="DDA3937_RS01790"
                     /old_locus_tag="Dda3937_01256"
                     /db_xref="GeneID:9731760"
     CDS             397116..398534
                     /locus_tag="DDA3937_RS01790"
                     /old_locus_tag="Dda3937_01256"
                     /function="5.1 cell processes; cell division"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:E0SI60.1"
                     /note="septal ring component that protects the divisome
                     from stress; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsI"
                     /protein_id="WP_013316057.1"
                     /db_xref="GI:503081174"
                     /db_xref="GeneID:9731760"
                     /translation="MSLSRRQFIQASGIALCAGAMPLTARADGGKNPLPVPPLLESRR
                     GQPVFLTMQRAHWSFSGERKNPVWGFNGRYLGPTVRVFSNDDVKLIYSNRLNEPVSMT
                     VSGLQVPGSLMGGAGRMIQPNMDWSPVLPVRQAAATCWYHANTPNRMAPHVYNGLAGL
                     WLVEDSLSKSLPIPNHYGVDDFPLIIQDKRLDNFGAPLYNPPSSGGFMGDTLLVNGAR
                     NPYVEVSRGWVRLRLLNASNARRYVMRMSDGRPLHLIANDQGFLPAPMALNQMSLAPG
                     ERREVLVDMSQGNEATLTAGESASIMQRLRGLFEPSNILVSSAILTLRPTGLLPLVTN
                     TLPMRLLADNIIDGAVSRTREFRLGDSLPGINGAMWDVNRVDVQTQVGRYERWIVHAD
                     QPQPFHVQGAAFLVRSVNGGLTPPEDSGWKDTVWVENDVELLVYFGQFSTPQFPFLYY
                     SHTLEMADRGSIAQLVAQASNG"
     gene            complement(398594..399439)
                     /gene="dkgA"
                     /locus_tag="DDA3937_RS01795"
                     /old_locus_tag="Dda3937_01257"
                     /db_xref="GeneID:9731761"
     CDS             complement(398594..399439)
                     /gene="dkgA"
                     /locus_tag="DDA3937_RS01795"
                     /old_locus_tag="Dda3937_01257"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943062.1"
                     /note="methylglyoxal reductase/beta-keto ester reductase;
                     catalyzes the reduction of 2,5-diketo-D-gluconic acid to
                     2-keto-L-gulonic acid; also catalyzes the reduction of
                     methylglyoxal, ethyl-2-methylacetoacetate and
                     ethyl-acetoacetate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-diketo-D-gluconic acid reductase"
                     /protein_id="WP_013316058.1"
                     /db_xref="GI:503081175"
                     /db_xref="GeneID:9731761"
                     /translation="MTMQPLVKLADGNIMPQLGLGVWQASNEQAAAAVTEALNIGYRA
                     IDTAAIYKNETGVGKALQQTDIPRSDIFITTKLWNSDQAHPRQALEESLRKLQLEYVD
                     LYLIHWPLPEQNTYVEAWRGLLNLKEQGLAKSVGVCNFNPHHLQRLKEETGVMPVINQ
                     IELHPLFQQRMLNTWNTTHHIQTESWSPLAQGGEGVFDHPVIHALAKKYGKTPAQIVI
                     RWHLDCGLVVIPKSVTPARIRENFEVFDFRLEKEELSEVATLDCGKRLGPDPDQPRTD
                     APRKD"
     gene            complement(399627..400790)
                     /locus_tag="DDA3937_RS01800"
                     /old_locus_tag="Dda3937_01258"
                     /db_xref="GeneID:9731762"
     CDS             complement(399627..400790)
                     /locus_tag="DDA3937_RS01800"
                     /old_locus_tag="Dda3937_01258"
                     /function="1.7.1 metabolism; central intermediary
                     metabolism; unassigned reversible reactions"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde oxidoreductase"
                     /protein_id="WP_013316059.1"
                     /db_xref="GI:503081176"
                     /db_xref="GeneID:9731762"
                     /translation="MQNFTLHTPTKILFGEGQIASLADQIPADARILITYGGGSIKKN
                     GVFDQVINALKGRNVLEFSGIEPNPTYETLMKAVEIVRKEKIDFLLAVGGGSVADGTK
                     FIAAAAHYTAADDPWHILQTWGAQIETATPLGVVLTLPATGSESNSGAVITRKSSGDK
                     QAFMNPLVCPRFAVLDPVVTYTLPERQIANGVVDAFVHTVEQYLTYPANAKVQDRFAE
                     GLLLTLIEEGPRALKEQHNYDVRANVMWSATMALNGLIGAGVPQDWSTHMLGHEITAM
                     HGLDHAQTLAIVLPAMLNERRVQKREKLLQYAERVWNLRDGSEDQRIDAAIAATRAFF
                     EQMGVPTRLSDYQLDGSSIPAMVAKLEEHGMTALGEHHDITLDISRRVYEAAR"
     gene            401257..402168
                     /locus_tag="DDA3937_RS01805"
                     /old_locus_tag="Dda3937_01259"
                     /db_xref="GeneID:9731763"
     CDS             401257..402168
                     /locus_tag="DDA3937_RS01805"
                     /old_locus_tag="Dda3937_01259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_033111542.1"
                     /db_xref="GI:696580363"
                     /db_xref="GeneID:9731763"
                     /translation="MQNLSSRQRLVNLAMLYAAGNGVSQTPIPQVKVIYIDRHGARAP
                     VLYDPCIVIMFQGHKVGYLGDKVFQYDPDNYLLMTVPLPFECESFASPENPLVGISIR
                     VDIPILQDLLIEMGDDGCGEKRRSDTAGINSVPLDEAILCATERLLEAMANARDARVL
                     GPWMVREILYHVLCGPCGDSLQALMNRYSHFSQIARALRYIENYYADNLNVERLAAEV
                     NMSVSAFHHNFKAVTNTSPVQYLKSYRLHKARLLMVHDGLKANVASMQVGYESPSQFS
                     REFKRFFGVTPGDEVARLRGSGVVESS"
     gene            complement(402262..402921)
                     /locus_tag="DDA3937_RS01810"
                     /old_locus_tag="Dda3937_01260"
                     /db_xref="GeneID:9731764"
     CDS             complement(402262..402921)
                     /locus_tag="DDA3937_RS01810"
                     /old_locus_tag="Dda3937_01260"
                     /function="7.3 location of gene products; inner membrane"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013316061.1"
                     /db_xref="GI:503081178"
                     /db_xref="GeneID:9731764"
                     /translation="MSVVHEIIQALWRQDFSALADPHVVWVIYGVLFTTLFLENGLLP
                     ASFLPGDSLLLLTGAMISKGVMSFIPTMVLLTVAASLGCWLSYLQGRWLGDTRLVKKW
                     LHQLPAHYHQRTHNLFHQHGLAALLVGRFLAFVRTLLPTIAGVSGLSSTRFQIFNWLS
                     GFLWVTGIVTLGYALSHIPLVKRYEDQVMTALCILPLVLLFSGLVGMLLVLWRKRRAM
                     A"
     gene            complement(403106..404299)
                     /locus_tag="DDA3937_RS01815"
                     /old_locus_tag="Dda3937_01261"
                     /db_xref="GeneID:9731765"
     CDS             complement(403106..404299)
                     /locus_tag="DDA3937_RS01815"
                     /old_locus_tag="Dda3937_01261"
                     /function="1.5.1.9 metabolism; building block
                     biosynthesis; amino acids; methionine"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.5.1.12 metabolism; building block
                     biosynthesis; amino acids; cysteine"
                     /function="1.8.2 metabolism; metabolism of other
                     compounds; sulfur metabolism"
                     /function="1.8.3 metabolism; metabolism of other
                     compounds; nitrogen metabolism"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316062.1"
                     /note="catalyzes the formation of L-homocysteine from
                     cystathionine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-lyase"
                     /protein_id="WP_013316062.1"
                     /db_xref="GI:503081179"
                     /db_xref="GeneID:9731765"
                     /translation="MTSKKIATALVAAGRSKRVTQGAVNPVIQRASSLVFDSVQDKKH
                     ATINRAKGALFYGRRGTLTHFAFQDAMTELEGGAGCALYPCGAAAIANAIVSFVSAGD
                     HLLVTGSAYEPTQDFCNKVLSKMNISTTFFDPMIGGDIASLIQPNTRVVFLESPGSIT
                     MEVQDVPAIVAAVRRVNPDIVIMIDNTWAAGVLFRPLDLGVDISIQAGTKYIVGHSDA
                     MIGTAVANARCWDQLREQSYLMGQMADADSAYMASRGLRTLGVRLQQHQENGLRVARW
                     LAERPEVAIVNHPALPGCKGHEYFVRDFSGSNGLFSFVLKDKLSREQLAHYLDHFSHF
                     RMAYSWGGFESLILANQPEELAAIRPAGGVDFTGTLVRLHIGLEDCDDLIADLETGFR
                     RLREM"
     gene            404781..405500
                     /locus_tag="DDA3937_RS01820"
                     /db_xref="GeneID:23677387"
     CDS             404781..405500
                     /locus_tag="DDA3937_RS01820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010280258.1"
                     /note="membrane spanning protein in TonB-ExbB-ExbD
                     complex; involved in the tonB-independent energy-dependent
                     transport iron-siderophore complexes and vitamin B12 into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbB"
                     /protein_id="WP_033112190.1"
                     /db_xref="GI:696581011"
                     /db_xref="GeneID:23677387"
                     /translation="MSTDLSVWGMYQHADVVVKTVMIGLLLASVVTWAIFFGKSTSLM
                     GAKKRIRREYQALEDARTLDDALDISGVFKPGSVSLQLLADARNEQELSERSDDNNGI
                     KERTAFRFERRVAATGRQMGRGTGYLATVGAIAPFIGLFGTVWGIMNSFIGIAQSQTT
                     NLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARWTAGYKAMVGDVAAQILLLQSRD
                     LDIAASAGNASSSPAQKLRVG"
     gene            405505..405924
                     /locus_tag="DDA3937_RS01825"
                     /old_locus_tag="Dda3937_01263"
                     /db_xref="GeneID:9731768"
     CDS             405505..405924
                     /locus_tag="DDA3937_RS01825"
                     /old_locus_tag="Dda3937_01263"
                     /function="4.2.C.1 transport; Electrochemical potential
                     driven transporters; Ion-gradient-driven energizers; TonB
                     Family of Auxiliary proteins for Energization of
                     OMR-mediated Transport"
                     /function="5.5.7 cell processes; adaptation to stress; Fe
                     aquisition"
                     /function="4.S.51 transport; substrate; enterochelin"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.53 transport; substrate; Fe"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316065.1"
                     /note="membrane spanning protein in TonB-ExbB-ExbD
                     complex; involved in the tonB-independent energy-dependent
                     transport iron-siderophore complexes and vitamin B12 into
                     the cell; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_013316065.1"
                     /db_xref="GI:503081182"
                     /db_xref="GeneID:9731768"
                     /translation="MAMHLNDGQSENGEMHDINVTPFIDVMLVLLIIFMVAAPLATVD
                     VRVNLPASSATPQPRPEKPVFLTVKADKQLYLGDDAITEATLAQALEAKTLGNKDTTI
                     FFQADKSVDYETLMRVMDSLRETGYLKIGLMGAEKAR"
     gene            complement(406055..406705)
                     /locus_tag="DDA3937_RS01830"
                     /old_locus_tag="Dda3937_01264"
                     /db_xref="GeneID:9731769"
     CDS             complement(406055..406705)
                     /locus_tag="DDA3937_RS01830"
                     /old_locus_tag="Dda3937_01264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fluoroquinolone resistance protein"
                     /protein_id="WP_033111543.1"
                     /db_xref="GI:696580364"
                     /db_xref="GeneID:9731769"
                     /translation="MNAQTFTEQKFSADRFTQQLVENCKFHNCDFAGCDLTDTQFLNC
                     QFFDQESQMGCNFYRATLKDASFKNCDLSLCNFRSVKALGIEIRDCRAQGADFRDASF
                     MNRITARTWFCSAYITKSNLSYANLSGVILEKCELWENRWTGANVNGASFVGSDLSGG
                     EFNAFDWRSADVTQCDLINAELGELDVRSTNLEGVKLDSHQINTLMERLGIIVIEQ"
     gene            complement(406834..407853)
                     /locus_tag="DDA3937_RS01835"
                     /old_locus_tag="Dda3937_01265"
                     /db_xref="GeneID:9731770"
     CDS             complement(406834..407853)
                     /locus_tag="DDA3937_RS01835"
                     /old_locus_tag="Dda3937_01265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose operon repressor"
                     /protein_id="WP_033112191.1"
                     /db_xref="GI:696581012"
                     /db_xref="GeneID:9731770"
                     /translation="MKQTKRVTISDIARLAGVSKSTASLVLNGRSKEFRVSDETRDRV
                     LALAQQQRYQPSIHARSLRSSRSNTLGLVVPEMTNYGFAMISRELECLCREAGLQLLI
                     ACTDENASQEMMAVNSLIQRQVDGLIVASSMLSDVEYQKINQQLPVLQFDRVIGESNL
                     PMVVSEAVESTAALVENIARRHPDEFYFIGGQPRISPTRDRLAGFQLGLERAGVECRP
                     EWIIHGNYHSSAGYEMFAQLCARLGRPPKALFTAACGLLEGVLRYLNQHNLMDCDMRL
                     CSFDDHYLFDCLPMKIDTVAQDCETLARNSFEMINALIEGQPLTESRVYVPTRPHWRH
                     PDSRA"
     gene            complement(407903..409315)
                     /locus_tag="DDA3937_RS01840"
                     /old_locus_tag="Dda3937_01266"
                     /db_xref="GeneID:9731771"
     CDS             complement(407903..409315)
                     /locus_tag="DDA3937_RS01840"
                     /old_locus_tag="Dda3937_01266"
                     /function="has sucrose hydrolase activity"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family 32"
                     /protein_id="WP_013316068.1"
                     /db_xref="GI:503081185"
                     /db_xref="GeneID:9731771"
                     /translation="MKEIHLLKRMAYALMSGPSRQTYDPHRPQWHLSPLVGLLNDPNG
                     FVQHKGRYHLFYQWNPQACAHGAKFWGHWSSADLVHWRHEPVALVPAESYESHGCYSG
                     SAVVDNDALALIYTGNVKYDDGSRTAYQCLARANGDGEFDKTGPVLSLPEGYTGHVRD
                     PKVWRHQDNWYMVLGAQDMDLQGKVLLYRSSDLLQWHALGEIAGSRLNGLGDFGYMWE
                     CPDLFALENHDVLICCPQGLPAEEERYLNTHQSGYFIGSLDYDSGRFTHQAFHELDLG
                     FEFYAPQTTQSEDGRRLLFGWMGVPDQNEFFQPTIVHGWIHTMTCPRELTLRDDRIYQ
                     QPVRELQSLRHLEHLWQGVADYAPALPASSAELVLDTQGEFQLNFAGVMVLCWDGERL
                     TLSRRNRRTNESEHRYWHDGPLHHLQILCDRSSVEIFINHGQAVMSSRYFPTSDAMVS
                     FSGSGRITLQHWLLAPCVIE"
     gene            complement(409315..410685)
                     /locus_tag="DDA3937_RS01845"
                     /old_locus_tag="Dda3937_01267"
                     /db_xref="GeneID:9731772"
     CDS             complement(409315..410685)
                     /locus_tag="DDA3937_RS01845"
                     /old_locus_tag="Dda3937_01267"
                     /function="4.4.A.1 transport; Group Translocators;
                     Phosphotransferase Systems (PEP-dependent PTS); The PTS
                     Glucose-Glucoside (Glc) Family"
                     /function="1.7.9 metabolism; central intermediary
                     metabolism; glucose metabolism"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.S.172 transport; substrate; sucrose"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883093.1"
                     /note="phosphoenolpyruvate-dependent sugar
                     phosphotransferase system; catalyzes the phosphorylation
                     of incoming sugar substrates concomitant with their
                     translocation across the cell membrane; IIB is
                     phosphorylated by IIA and then transfers the phosphoryl
                     group to the sugar; IIC forms the translocation channel;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter"
                     /protein_id="WP_013316069.1"
                     /db_xref="GI:503081186"
                     /db_xref="GeneID:9731772"
                     /translation="MDIHATAASLIPLLGGRENIASAAHCATRLRLVLNDDSLADKTA
                     IENVEGVKGCFQNAGQMQIIFGSGLVNKVYAEFIKAAGISEASTSEAATLAAQKLNPL
                     QRLARLLSNIFVPIIPAIVASGLLMGLLGMIKTYGWVDAGSAIFVMLDMFSSAAFIIL
                     PILIGFTAAREFGGNPYLGATLGGILTHPALTNAWGVAGGFKTMHLFGLEFAMIGYQG
                     TVFPVLLAVWFMSLVEKRLRKVVPNALDIIVTPFLTVIISGFVAMLVIGPAGRMLGDG
                     ISLVLSTLITHAGWLAGLLFGGLYSAIVITGVHHSFHAIEAGLLGNPSIGVNFLLPIW
                     AMANVAQGGACLAVYFKTRDAKIRAIAVPSSLSCLLGITEAAIFGINLRFIKPFLAGL
                     AGGALGGAWVVANHVNMTAVGLTGIPGLAIVQAGSMLNYLLGMLIAFGAAFLISLLLK
                     YKTDNA"
     gene            complement(410767..412380)
                     /locus_tag="DDA3937_RS01850"
                     /old_locus_tag="Dda3937_01268"
                     /db_xref="GeneID:9731773"
     CDS             complement(410767..412380)
                     /locus_tag="DDA3937_RS01850"
                     /old_locus_tag="Dda3937_01268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_033112192.1"
                     /db_xref="GI:696581013"
                     /db_xref="GeneID:9731773"
                     /translation="MKPGYLAAAVGLALCTSQALAAPSDSIEARLNALEQRLLQAEQR
                     LLQAEARADAAEKQAKQLAARTAQVEQKTQQVEQTTQQVAQQTQQVAARATQNEQQTQ
                     QVALKTDALTNKRSVADGFEFHGYARSGLAIHDSVTSSKANIGPSMTPAGETGGHVGR
                     LGNEDDTYLELKLEHRTKLDNGATTRFKVMMADGQRSYNDWTASTSDLNVREAFVELG
                     SLPTFTGAFKDTTLWAGKRFDRDNFDIHWIDSDVVFLAGTGGGIYDVKPVDGWKSNLS
                     IYGRSLGEITSLDKEIQNYIVTSNNFVGPFQFMLSGLRARNNDIKENTGSNNANNVTN
                     TNAGDSGYHALAAWHGDSFYGLRDGTAKVALLYGHGLGGEVKSIGSDGNLTQNANTWR
                     LATYGTTALNKTWSFAPAILAQSSKDRYVQGDDYRWVTFNARFIQEITENFALAYEGS
                     YQYMNLDPQGYLSRNQVSGGFYKLTFAPTFKVGDISNLLSRPELRIFASYMDWDKRLD
                     NYASDDAFGSTGFKAGGEWTFGVQMETWF"
     gene            complement(412577..413500)
                     /locus_tag="DDA3937_RS01855"
                     /old_locus_tag="Dda3937_01269"
                     /db_xref="GeneID:9731774"
     CDS             complement(412577..413500)
                     /locus_tag="DDA3937_RS01855"
                     /old_locus_tag="Dda3937_01269"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoimidazole riboside kinase"
                     /protein_id="WP_013316071.1"
                     /db_xref="GI:503081188"
                     /db_xref="GeneID:9731774"
                     /translation="MSHKVWVMGDAVVDLIPEGEERYLKCPGGAPANVAVGVARLGGH
                     SGFIGRVGEDAFGHFLRDVLAREQVDIRHMQPDAEHRTSTVVVSLDAQGERTFTFMVR
                     PSADLFLQPSDLPAFQRSEWLHLCSIALSREPSRSTALEAIQRIRAAQGWVSFDPNIR
                     ADLWRSEQELRTSLDQVLALADVVKLSEEEFLFLSGSEDIRQGSANLMARYPIKRLLI
                     TQGGDGVWLHDGHQLRHFLAHRVTPVDTTGAGDAFVAGMLAALAGYDSLYQIDDWHSV
                     LTQAQRCGALATTAKGAMTALPFAHQLTTAS"
     gene            414296..415804
                     /locus_tag="DDA3937_RS01860"
                     /old_locus_tag="Dda3937_01270"
                     /db_xref="GeneID:9731775"
     CDS             414296..415804
                     /locus_tag="DDA3937_RS01860"
                     /old_locus_tag="Dda3937_01270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005973741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cse1"
                     /protein_id="WP_013316072.1"
                     /db_xref="GI:503081189"
                     /db_xref="GeneID:9731775"
                     /translation="MFSLIDTPWLPVVGADGHRTRISPRQLVNDDIIDLACPRPDLQG
                     AAWQLLIGLLQTAYSPPDDDAWEDIWHGGLGKGWAKALTPLAPALWFGAKAKKPAFMQ
                     YGVGPAGKVRPIADLLVNAAGEQPLTFNRQHVLTHGPVEAICPHCAVLALYARQSHAP
                     SGRRSVHAAAPAMKTLLTLQDHRQPLWRKLWANVIPGVHGHCVSEVFPWLASSGIHDE
                     AVTPESIAPLQSFWEMPLRIELDFAHTQTGHCELCGEASEHLLTHFRGDVRAARHEHR
                     EHPLTPYRQSVQDGSLLPVAGQLQGLAYREWPGLVLGEQGGEYHTLPARAVQLNHQRD
                     PLRCKVGLWCFGYDLAEGKGGWYEHHIPTWGEVTPAILDYLPLAVQMADDAHSLLCQS
                     VQAAGVGADKHCCTIDVTFWQETEQFFKRLYDAIAGGMSVAEALKAWQNQLYLYLIGT
                     FDRLTFGNPDLRCDLNLAVEARSNMVNRFCSQKTAVQIEKMQPQETLAAANS"
     gene            416190..416642
                     /locus_tag="DDA3937_RS01865"
                     /old_locus_tag="Dda3937_01271"
                     /db_xref="GeneID:9731777"
     CDS             416190..416642
                     /locus_tag="DDA3937_RS01865"
                     /old_locus_tag="Dda3937_01271"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316074.1"
                     /db_xref="GI:503081191"
                     /db_xref="GeneID:9731777"
                     /translation="MEAENTLGVISRYLKKLHVLTLCVSDDDDLWCANCFYVFDDEQI
                     AFYLMTEPDTRHGEIMRRCPQVAGTVNGQPKSVLLIKGVQFLGEISRLTGDEETQARS
                     RYNVRFPIARSSGAPIWKLSLNEMKMTDNALGFGKKHLWRRDTVAEPM"
     gene            complement(416751..417215)
                     /locus_tag="DDA3937_RS01870"
                     /old_locus_tag="Dda3937_01272"
                     /db_xref="GeneID:9731778"
     CDS             complement(416751..417215)
                     /locus_tag="DDA3937_RS01870"
                     /old_locus_tag="Dda3937_01272"
                     /function="1.7.33 metabolism; central intermediary
                     metabolism; nucleotide and nucleoside conversions"
                     /function="2.3.3 information transfer; protein related;
                     posttranslational modification"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855236.1"
                     /note="activates anaerobic ribonucleoside-triphosphate
                     reductase under anaerobic conditions; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleotide reductase-activating
                     protein"
                     /protein_id="WP_013316075.1"
                     /db_xref="GI:503081192"
                     /db_xref="GeneID:9731778"
                     /translation="MNYHQYYPVDVVNGPGTRCTLFVAGCEHQCPGCYNQSTWRVNSG
                     HPFTQEMEDRIIADLQNTDIPLQGLSLSGGDPLHPQNVPEVLRLVKRVHDECPGKNIW
                     MWTGYRLDELTPEQREVVDLINVLVDGRFVQEQRDLTLMWRGSRNQVIHHLR"
     gene            complement(417315..419453)
                     /locus_tag="DDA3937_RS01875"
                     /old_locus_tag="Dda3937_01273"
                     /db_xref="GeneID:9731779"
     CDS             complement(417315..419453)
                     /locus_tag="DDA3937_RS01875"
                     /old_locus_tag="Dda3937_01273"
                     /function="1.7.15 metabolism; central intermediary
                     metabolism; 2'-deoxyribonucleotide metabolism"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004093802.1"
                     /note="Catalyzes the reduction of nucleoside
                     5'-triphosphates to 2'-deoxynucleoside 5'-triphosphates;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside triphosphate reductase"
                     /protein_id="WP_013316076.1"
                     /db_xref="GI:503081193"
                     /db_xref="GeneID:9731779"
                     /translation="MKPVVIKRDGCQVPFDENRINDAVIKAAKAAGVDDADYCATVAG
                     AVAQQMQGKTRVDIREIQNVVENLLMSGKYKQLARTYIEYRHDRDVARERQGRLNQEI
                     RGLVEQSNVALLNENANKDSKVIPTQRDLLAGIVAKHYAKQHILPRDVVLAHERGEIH
                     YHDLDYSPFFPMFNCMLIDLNGMLTQGFKMGNAEIEPPKSISTATAVTAQIIAQVASH
                     IYGGTTINRIDEILAPFVTASHEKHCAVAREWHIPDADGYALSRTEKECYDAFQSLEY
                     EVNTLHTANGQTPFVTFGFGLGTSWQSRLIQQSILRNRIAGLGKNHKTAVFPKLVFAI
                     RDGVNHKPGDANYDIKQLALECASKRMYPDILNYDQVVEVTGSFKTPMGCRSFLGIYE
                     ENGEQIHDGRNNLGVISLNLPRIALEAHGDEARFWQLLDQRLLLAKKALMTRIARLEN
                     VKARVAPILYMEGACGVRLKADDNIAEIFKNGRASISLGYIGVHETINALFSNQVHVF
                     DDETLRQKAVAIVARLKAATESWKEETGYGFSLYSTPSENLCDRFCRLDTAEFGVVPG
                     VTEKGYYTNSFHLDVEKKVNPYQKIDFEAPYPPLANGGFICYGEYPNLQHNLRALEDV
                     WDYSYTRVPYYGTNTPIDECYECGFNGEFDCTSKGFTCPQCGNHDSSRVSVTRRVCGY
                     LGSPDARPFNAGKQEEVKRRVKHLASGQLG"
     gene            419848..420756
                     /locus_tag="DDA3937_RS01880"
                     /old_locus_tag="Dda3937_01274"
                     /db_xref="GeneID:9731780"
     CDS             419848..420756
                     /locus_tag="DDA3937_RS01880"
                     /old_locus_tag="Dda3937_01274"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /function="1.5.1.9 metabolism; building block
                     biosynthesis; amino acids; methionine"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homocysteine S-methyltransferase"
                     /protein_id="WP_013316077.1"
                     /db_xref="GI:503081194"
                     /db_xref="GeneID:9731780"
                     /translation="MADNVLILDGGMGRELARIGAPFRQPEWSALALMESPQHVRQVH
                     DSYIAAGAQVITTNSYAVVPFHISDAVFNARGQALATLAGQLARQAADAAAHPVRVAG
                     SLPPVLGSYRPDLFNAAAATPILKTLIDALNPYVDVWLAETQSSLAEVALVRELLAND
                     ARELWLSFTLQDELDADGHARLRSGETVAAAAQAAIQLRAANLLFNCSRPEVMAPAVA
                     QASATLKAQSAAIGVGVYANAFEPEDNQRGANEGLSRLRTDTHPEGYLQWSQEWVAQG
                     ASLVGGCCGIGPEHIARLAQAFHRQG"
     gene            420830..422371
                     /locus_tag="DDA3937_RS01885"
                     /old_locus_tag="Dda3937_01275"
                     /db_xref="GeneID:9731781"
     CDS             420830..422371
                     /locus_tag="DDA3937_RS01885"
                     /old_locus_tag="Dda3937_01275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_033111544.1"
                     /db_xref="GI:696580365"
                     /db_xref="GeneID:9731781"
                     /translation="MNRRHFIKSACALSVAAAATGWPLSAAWGADAAEKPKKGGHLIV
                     GVDNASSTDRLDPAFWFETYMYFVGSQLFNNLLELDEKGELAPSLAESWDSKDGGRTW
                     VLHIRKGVQFHDGRTLGAKDVIYSLNHHRGEKSSSSVKGYLDPVIAMDATGSHEVTIR
                     LSEPNVEFVALLSDVHFAITAENESFDKGIGTGAFILESFQPGVRTLVKRNPNHWNSE
                     RGHVDSVETLAMNDSTARVAALVSGSAHIINRVNPRIVGRIQNMPTLQLLRSRDSQIF
                     TFPGLGNVAPFNNEDGRLALKYAIDRQQIIDTVLGGYASVANDNPIFPSNRYFAKDIP
                     QRPYDPEKAKWHWQKAGFSGPLTLSVADAGFPGAVDAGQLYQASAQKAGIPLNVERVP
                     DDAFWDNVWMKKPFVSSNWSVRPTADALLSLVFTSQAPWNESAWKDAGFDQLVQAARG
                     EVNEDKRRQIYHDIQVMLVDKGSEIIPLYADALDACSNKVKGLSAIPGFPLSGNRAAE
                     KVWLA"
     gene            422460..423404
                     /locus_tag="DDA3937_RS01890"
                     /old_locus_tag="Dda3937_01276"
                     /db_xref="GeneID:9731782"
     CDS             422460..423404
                     /locus_tag="DDA3937_RS01890"
                     /old_locus_tag="Dda3937_01276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_042318034.1"
                     /db_xref="GI:754962110"
                     /db_xref="GeneID:9731782"
                     /translation="MLILRRLLAGVAMIAVVSVLIFAGIQLLPGNAATAILGQTATPE
                     AVRALNAQLGLDQPAVSRYLSWLWGVLGGDFGQSFTSRQSIAPVLAYRLENTLFLAGC
                     TAVIAVPLALLIGFLSVRYQGSWLDRLLNLFTRVAVALPEFFSGYLLILIFSITLFWL
                     PSNSNVSDNMPLGAHLTAIALPCMTLVLAVLGHMSNMTRAALIGAQNAAYVDTALLKG
                     MSPSAILLRHVLPNAWGPIINVIVLNLAYLMVGVVIVESVFVYPGLGQYMVDSISKRD
                     MPVIQGCALVLATIYILLNLLADVVSLMANPRLRHARR"
     gene            423432..424247
                     /locus_tag="DDA3937_RS01895"
                     /old_locus_tag="Dda3937_01277"
                     /db_xref="GeneID:9731783"
     CDS             423432..424247
                     /locus_tag="DDA3937_RS01895"
                     /old_locus_tag="Dda3937_01277"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013316080.1"
                     /db_xref="GI:503081197"
                     /db_xref="GeneID:9731783"
                     /translation="MPAVKPSVVLGLLGLSLFIGVALLAPWIAPYSADKVVGGAWLGP
                     MPQAWLGTDNIGRDLFSRLIWGTRTSLVVTALAALLAFVLGTGLGFLAGVCGGWVDQL
                     ISRVNDVLMAIPTLILALVVLAMLPKSTVIIILVLGVLEATRVLRVSRALAVDIATQE
                     FIEVARLRGESMGWILWREILPNARNTLVAEFALRFIFILLFLSALSFLGLGIQPPTA
                     DWGGLARDNKDGILFGVWAALVPGAAIALLAVSLNVVADWLLSRDGRNWRRPS"
     gene            424244..425851
                     /locus_tag="DDA3937_RS01900"
                     /old_locus_tag="Dda3937_01278"
                     /db_xref="GeneID:9731784"
     CDS             424244..425851
                     /locus_tag="DDA3937_RS01900"
                     /old_locus_tag="Dda3937_01278"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_013316081.1"
                     /db_xref="GI:503081198"
                     /db_xref="GeneID:9731784"
                     /translation="MSELLRVERLCVTAGGRALVQDIDFTLNKGEVLGLIGESGAGKS
                     TIGQAILGHCRHGMRIESGHIWFQNDDKNSDLAALSERQLRRVRGTRIAYVAQSASAS
                     FNPAQRIGEQVIETAVRHGVLSRQQAIARAIELFTQLSLPEPQTFFQRYPHQVSGGQL
                     QRAMIAMAMCAGPDLIIFDEPTTALDVTTQLGVLNAIDEIIRLTGVAALYISHDLAVV
                     AQISHRIMVLRHGRQVEIGDTASLLDNPTETYTRELLQARGESKVPQPTTDDILLDIR
                     HLGARYQQQPVLQDVSLQLARGRTLAVIGESGSGKSTLGRTLCGLLAPAGGEIRLNGD
                     ALPPKLAQRNRAQLQSIQMIHQHPDTALNPRLPVGVQIERAMVCLTQLDATARRLRVS
                     DLLHQVGLPAEMAQRYPTALSGGQKQRVCIARALAAQPSLIVCDEPTSALDPLVARDV
                     LALLRLIQQETGVAYLFITHDLHVVREVADTVAVLRHGHIVRQGPVTEALSPPLDDYT
                     QQLLLAVPEMRCDWLRDVMARERSALS"
     gene            426358..428049
                     /locus_tag="DDA3937_RS01905"
                     /old_locus_tag="Dda3937_01279"
                     /db_xref="GeneID:9731785"
     CDS             426358..428049
                     /locus_tag="DDA3937_RS01905"
                     /old_locus_tag="Dda3937_01279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan 2-monooxygenase"
                     /protein_id="WP_033111545.1"
                     /db_xref="GI:696580366"
                     /db_xref="GeneID:9731785"
                     /translation="MSNDASFLANSVPCVDLLYDYAPFLQCSEAEGRIGYFPPGIPTP
                     RVAIIGAGISGLVAATELLRAGVKDITLFEARDRRIGGRVWSQTFDPRYPHLIAEMGA
                     MRFPSSETCLFYYLNKLDIATTTSFPDPGVVDTELHYRGVRHIWSAGDPPPSLFSRVH
                     EGWVALLNEGYLHNGVPLVAPRDITAMLKSHCFDKARKAWQAWLDAFRDYSFYSALVT
                     MFTSNTPPGGVPWRRPDDFELFGSLGIGSGGFLPVYQAGFTEILRLVINGYEDDQRLI
                     IGGISTLAERLVSQKIGDTRLSEHICFNEVKRIYKEDGEIKLVSGKGQTHTFDRVIVT
                     SSTRTMQIVHCLTGDETFLEHDISRAVKETHLTGSSKLFMLTRNKFWLNDSLPVTIQS
                     DGFIRGVYCLDYEPDNPDGPGVVLLSYTWEDDAHKLLSIPDKKQRCQYLVDDLAKINP
                     EFARHLIPADGDYERYVLHHDWLVDPYSAGAFKLNYPGEDVYSQRLFFQFKNANTPEK
                     DTGLYLAGCGCSFTGGWIEGAMQTALNSACAVIRSSGGALLVGNPLDDMHSAYCY"
     gene            428150..429490
                     /locus_tag="DDA3937_RS01910"
                     /old_locus_tag="Dda3937_01280"
                     /db_xref="GeneID:9731786"
     CDS             428150..429490
                     /locus_tag="DDA3937_RS01910"
                     /old_locus_tag="Dda3937_01280"
                     /function="1.5.1.15 metabolism; building block
                     biosynthesis; amino acids; tryptophan"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="indoleacetamide hydrolase"
                     /protein_id="WP_013316083.1"
                     /db_xref="GI:503081200"
                     /db_xref="GeneID:9731786"
                     /translation="MYSEYTLESLCSDLRRGIVSAADIRQQALNAEAQQRHLNCFIRI
                     DDAEEQFEKVKDVHKGGPLYGIPVSFKDNICVAGLPVTVGTQGMADCIATHDAAIVRK
                     LKSLGAVVAGKNNMNELCFGVTSCEPYWGAVENPSAPGYSIGGSSSGCAAAVAAGIVP
                     VAIGTDTGGSARIPASFCGITGFRPTSGHWSSSGIIPVSHTKDSPGLITRTASDAHFL
                     YTHLSSDDVSPTEQGHFPCRIGLPLSMWSELDDDVMTHCRYAINQLILAGFECVDVDD
                     AAVFSLNQTITFTLPIYEFFIDFPRTLLSLGWENRIATVFDNISDKNVHKIIQEHLVG
                     GRISPADYVSVVRNIGRLRLDMDTLFSTYGVDMLVYPTVPRQVPHLSQTGRPELFAEL
                     IRNTDLASNAAMPSITLPVAPEGALPVGLSFDALRGRDRYLLGMATRIETIIKP"
     gene            complement(431010..431396)
                     /locus_tag="DDA3937_RS01915"
                     /old_locus_tag="Dda3937_01282"
                     /db_xref="GeneID:9731788"
     CDS             complement(431010..431396)
                     /locus_tag="DDA3937_RS01915"
                     /old_locus_tag="Dda3937_01282"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855227.1"
                     /note="has endoribonuclease activity on mRNA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="WP_013316085.1"
                     /db_xref="GI:503081202"
                     /db_xref="GeneID:9731788"
                     /translation="MSRIISTEQAPAAIGPYVQGVDLGSMIITSGQIPVDPKTGLVPD
                     DVTAQARQSLENVKAIVEAAGLKVSNIVKTTVFVKDLNDFATVNAAYEAFFTEHNAPF
                     PARSCVEVARLPKDVKIEIEAIAVRG"
     gene            complement(431509..431973)
                     /locus_tag="DDA3937_RS01920"
                     /old_locus_tag="Dda3937_01283"
                     /db_xref="GeneID:9731789"
     CDS             complement(431509..431973)
                     /locus_tag="DDA3937_RS01920"
                     /old_locus_tag="Dda3937_01283"
                     /function="1.5.2.2 metabolism; building block
                     biosynthesis; nucleotide; pyrimidine biosynthesis"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316086.1"
                     /note="involved in the allosteric regulation of aspartate
                     carbamoyltransferase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase regulatory
                     subunit"
                     /protein_id="WP_013316086.1"
                     /db_xref="GI:503081203"
                     /db_xref="GeneID:9731789"
                     /translation="MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTATDQRITI
                     GLNLPSNHLGRKDLIKIENIFLTEEQANQLAMYAPQATVNQIDNYEVVRKLHPQLPSH
                     IEGVLTCPNSNCISRSEPVSSSFGVKQRGDDVQLKCKYCEKEFERQAVLNSY"
     gene            complement(431990..432925)
                     /locus_tag="DDA3937_RS01925"
                     /old_locus_tag="Dda3937_01284"
                     /db_xref="GeneID:9731790"
     CDS             complement(431990..432925)
                     /locus_tag="DDA3937_RS01925"
                     /old_locus_tag="Dda3937_01284"
                     /function="1.5.2.2 metabolism; building block
                     biosynthesis; nucleotide; pyrimidine biosynthesis"
                     /function="1.5.2.4 metabolism; building block
                     biosynthesis; nucleotide; pyrimidine ribonucleotide
                     biosynthesis"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q6DA73.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase catalytic
                     subunit"
                     /protein_id="WP_013316087.1"
                     /db_xref="GI:503081204"
                     /db_xref="GeneID:9731790"
                     /translation="MVNPLYKRHIISINDLSRDDLELTLKVAASLKAHPQPELLKHKV
                     IASCFFEASTRTRLSFETAIHRLGASVVGFADSNNTSLGKKGETLADTISVISNYVDA
                     IVMRHPQEGAARLATEFSGGVPVFNAGDGANQHPSQTLLDLFTIQETQGRLNNINIAM
                     VGDLKYGRTVHSLTQALAKFDGNRFYFISPDALAMPDYILNMLQEKNIPYSLHTSIEE
                     VVPQLDILYMTRVQKERLDPSEYINIKSQFILRAADLGSARDNLKVLHPLPRIDEITT
                     DVDSTPYAYYFQQAGNGIYARQALLALVLNSELVL"
     gene            433337..433804
                     /locus_tag="DDA3937_RS01930"
                     /old_locus_tag="Dda3937_04450"
                     /db_xref="GeneID:9731792"
     CDS             433337..433804
                     /locus_tag="DDA3937_RS01930"
                     /old_locus_tag="Dda3937_04450"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316089.1"
                     /db_xref="GI:503081206"
                     /db_xref="GeneID:9731792"
                     /translation="MIIGNVDHLELVPYLPAKLREAIEYVKQHINADTPLGKHDIDGN
                     KVFVLVSNDSTEPFEKRRAEYHAKYLDIQIVLNGTEGMTFSNLPAGKPDVDWLADKDI
                     AFLPAGEQEKQVILQTGDFVVFFPGEVHKPLCAVGEPAHVRKAVVKIDATLVL"
     gene            434025..435461
                     /locus_tag="DDA3937_RS01935"
                     /old_locus_tag="Dda3937_01286"
                     /db_xref="GeneID:9731794"
     CDS             434025..435461
                     /locus_tag="DDA3937_RS01935"
                     /old_locus_tag="Dda3937_01286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aryl-phospho-beta-D-glucosidase"
                     /protein_id="WP_033111546.1"
                     /db_xref="GI:696580367"
                     /db_xref="GeneID:9731794"
                     /translation="MSQLPAGFLWGGAVAAHQLEGGWNEGGKGISVVDVLTAGAHGKL
                     RRITDGVIPGESYPNHEAIDFYHRYKDDIALFAEMGFKCFRTSIAWTRIFPNGDEAEP
                     CEAGLKFYDDLIDELLKHGIEPVLTLSHFEMPLHLVQQYDGWMSRKTLDCFVHFAATV
                     IARYQHKVKYWMTFNEINNQKNVSAEIFGWMCSGVKFPQKAKPEEAMYQAVHHQFVAS
                     ALIVKKAHDINPDIKVGCMCAFLPYYPYSCHPEDVMLAAQAMHDRFYFTDVQVRGHYP
                     AYARREWALKGYQIHMEPEDERILREGKADYIGFSYYMSNVVKHDVQNRIDASMDGSS
                     EHSIPNPHLKASDWGWQIDPTGLRYALTTLYERYEVPLFIVENGLGAVDKPDANGMCQ
                     DDYRIDYLRSHIDAMKAAVWEDGVDLMGYTPWGCIDLVSFTTGEMAKRYGFIHVDKHD
                     DGTGTLARTPKKSFHWYQRVIASNGEEL"
     gene            complement(435556..436572)
                     /locus_tag="DDA3937_RS01940"
                     /old_locus_tag="Dda3937_01287"
                     /db_xref="GeneID:9731795"
     CDS             complement(435556..436572)
                     /locus_tag="DDA3937_RS01940"
                     /old_locus_tag="Dda3937_01287"
                     /function="1.5.1.3 metabolism; building block
                     biosynthesis; amino acids; arginine"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848046.1"
                     /note="catalyzes the formation of ornithine and
                     carbamylphosphate from citrulline in the arginine
                     catabolic pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="WP_013316092.1"
                     /db_xref="GI:503081209"
                     /db_xref="GeneID:9731795"
                     /translation="MNPFYKRHFLRLMDFTPAEISSLLTLAATLKTNKKNGAEIRHLQ
                     GKNIALIFEKDSTRTRCSFEVAAYDQGAQVTYLGPSGSQIGHKESMKDTARVLGRMYD
                     GIQYRGYGQVLVETLAEFSGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKSLSGMALA
                     YVGDTRNNMGNSMLEAAAITGLDLRLIAPKACWPDAGLVAECQAAAAKTGGSITLTED
                     VAAGVNGVDFIYTDVWVSMGEAKEVWQQRIDLLRPYQVNAAMIAATGNPQVKFLHCLP
                     AFHDDQTTLGKQMAEQYGLHNGMEVTNDVFESAHSIVFDQAENRMHTIKAVMVATLSH
                     SVEI"
     gene            436735..437163
                     /locus_tag="DDA3937_RS01945"
                     /old_locus_tag="Dda3937_01288"
                     /db_xref="GeneID:9731796"
     CDS             436735..437163
                     /locus_tag="DDA3937_RS01945"
                     /old_locus_tag="Dda3937_01288"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNase E inhibitor protein"
                     /protein_id="WP_013316093.1"
                     /db_xref="GI:503081210"
                     /db_xref="GeneID:9731796"
                     /translation="MANRELLEEQREETRLIIEELLEDGSDPDALYTIEHHFSAEKFE
                     DLEKVAVDAFKLGYEVTDAEEMEMEDGVMLMCCDAISELALNAELIDQQVEQLLALAE
                     RHGVNYDGWGTYFEDPDGEDEDEFEEDEDFYDEDDDGKRH"
     gene            complement(437238..437741)
                     /locus_tag="DDA3937_RS01950"
                     /old_locus_tag="Dda3937_01289"
                     /db_xref="GeneID:9731797"
     CDS             complement(437238..437741)
                     /locus_tag="DDA3937_RS01950"
                     /old_locus_tag="Dda3937_01289"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_013316094.1"
                     /db_xref="GI:503081211"
                     /db_xref="GeneID:9731797"
                     /translation="MTISASTPLLTRPITAADNAAIASVIRRVSAEFGLTADKGYTVS
                     DPDLDQLFELYCRPASAYWVVECNGEVVGGGGLAPLSGGESDICELQKMYFLPLARGQ
                     GIARQLAELALTFGREQGFRRCYLETTAHLTSAIHLYEKLGFEHIPHAMGSTGHVDCE
                     VRMLKTL"
     gene            438067..438654
                     /locus_tag="DDA3937_RS01955"
                     /old_locus_tag="Dda3937_01290"
                     /db_xref="GeneID:9731799"
     CDS             438067..438654
                     /locus_tag="DDA3937_RS01955"
                     /old_locus_tag="Dda3937_01290"
                     /function="3.1.2.5 regulation; type of regulation;
                     transcriptional level; action unknown"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013316096.1"
                     /db_xref="GI:503081213"
                     /db_xref="GeneID:9731799"
                     /translation="MEPSISETDRLSETDRRLAGRLAALRRERGWSLDELAQNSGISR
                     ATLSRLERMESSPTAALLGRLCAVYGCTMSCLLAEVETQLPQKLSAAQQPVWIDPETG
                     FVRRSISPPSAGFRAEMIHGELPAGARIDYSAPPLAGLEHHLYVLEGQLVMALEGVAH
                     TLGPQDSLRYRLYGASGFHNPGPDPVRYLIAICTP"
     gene            438694..439176
                     /locus_tag="DDA3937_RS01960"
                     /old_locus_tag="Dda3937_01291"
                     /db_xref="GeneID:9731800"
     CDS             438694..439176
                     /locus_tag="DDA3937_RS01960"
                     /old_locus_tag="Dda3937_01291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone acetyltransferase"
                     /protein_id="WP_033112194.1"
                     /db_xref="GI:696581015"
                     /db_xref="GeneID:9731800"
                     /translation="MTNTSPRAPLVIREDDLTGEATRALVALHLAGMHDNSPPEQVFA
                     LDLSGLQAPDITFWSVWRGEQIAGIGALKMLPDGSGELKSMRTHPQCLRQGVAACLLV
                     HILAEARRRGLRRLSLETGSGPAFEPALALYRKHGFVNGEAFAEYTASEFNQFLHLPL
                     "
     gene            439460..440527
                     /locus_tag="DDA3937_RS01965"
                     /old_locus_tag="Dda3937_01292"
                     /db_xref="GeneID:9731801"
     CDS             439460..440527
                     /locus_tag="DDA3937_RS01965"
                     /old_locus_tag="Dda3937_01292"
                     /function="1.5.1.9 metabolism; building block
                     biosynthesis; amino acids; methionine"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316098.1"
                     /db_xref="GI:503081215"
                     /db_xref="GeneID:9731801"
                     /translation="MVNRLLSGLAGLIFLLVLSPFSTAQTLQPQEGNWAAPEFRFHTG
                     ETVNNLRIHYYTLGDSKKPAILLLHGTNQPIGALLAAGFGGELFGPGQPLDTSKYFII
                     IPESIGSGKSAKPSDGLRTKFPQYNYDDMVLAQYRLLTEGLGITHLRLVMGYSMGGMH
                     TWMWGEKYPDMMDALVPMASQPNELSGRNWMLRRMLIETIKRDPAWKNGDYTTQPPSL
                     QTANIMFSIATTGGTLAYQSKAPTRAQADKLVDERLAAPVTSDANDFIYIWNSSADYN
                     ASPELARIKAPLLVINSADDERNPVETGILESELKKVKHAELFLIPASKETSGHATMM
                     SAKFYKNKLGEFLAAVPPHNK"
     gene            440669..442288
                     /locus_tag="DDA3937_RS01970"
                     /old_locus_tag="Dda3937_01293"
                     /db_xref="GeneID:9731802"
     CDS             440669..442288
                     /locus_tag="DDA3937_RS01970"
                     /old_locus_tag="Dda3937_01293"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_013316099.1"
                     /db_xref="GI:503081216"
                     /db_xref="GeneID:9731802"
                     /translation="MFRKIKIRTTLSIMVFSLAVLSLIVGVLGLVAVQSGNKSFAHVD
                     NVVLPGLVALNESSELLLRARLDLRLYESLMGKGDKDAATVALKRARGKIDDAGKKWQ
                     EYLTYPQFEQEKIISSDMAAKRDTLMNEFINPAFIALEAGNLDDYRQRAGKSTTLYAD
                     FDGAAKKLVQYKRQSIDEAYSDSNARVSRMQMILSVVIVCALVLAALAWSILTNLVVK
                     PLNQAITVFDRIAEGDLRAKIDIRGNNEIAQLFGAVQHMRDGLENMVRAVRNGTDAIS
                     VGVEEIASGNIDLSSRTEQQAASLDETAASMEQILSTVGNNEDNTRKANDLAKKASDS
                     ASRGGSVVTEVVDTMRSIQQSSARISDIVGVIDGIAFQTNLLALNAAVEAARAGEQGK
                     GFAVVASEVRTLAQRSATAAKEIGTMIDNSLNRIEKGAGLVEVAGKTMDEILSDVRKV
                     VDIMGEIMLSSGEQSRGISQINIAINQMDGVTQQNASLVAEVATAASSLQAQVTHLQQ
                     SIASFRLDSETQPMLTGGLNAQPRVALVGAR"
     gene            complement(442369..443154)
                     /locus_tag="DDA3937_RS01975"
                     /old_locus_tag="Dda3937_01294"
                     /db_xref="GeneID:9731803"
     CDS             complement(442369..443154)
                     /locus_tag="DDA3937_RS01975"
                     /old_locus_tag="Dda3937_01294"
                     /function="8.3.1 extrachromosomal; transposon related;
                     transposases"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_013316100.1"
                     /db_xref="GI:503081217"
                     /db_xref="GeneID:9731803"
                     /translation="MSRSTWYHNISAMKRTDKHAGLKARIGDIYHHHKGRYGYRRITL
                     SLRKEGIAVNHKTVQRLMVELSLRSLIRVKKYRSWKGETGKAAPNILNRNFCASKSNE
                     KWVTDVTEFSLQGKKLYLSPVLDLFNREIISYSLSERPVMDMVNTMLSDALSVLSPEE
                     SPLLHSDQGWQYRMAGYQEKLKAKGVVQSMSRKGNCLDNAVIENFFGTLKSECFYPGQ
                     FCSIEELKPAIQDYIHYYNNERISLKLKGLSPVEYRTQALKAA"
     gene            complement(443208..443729)
                     /locus_tag="DDA3937_RS01980"
                     /old_locus_tag="Dda3937_01295"
                     /db_xref="GeneID:9731804"
     CDS             complement(443208..443729)
                     /locus_tag="DDA3937_RS01980"
                     /old_locus_tag="Dda3937_01295"
                     /function="8.3 extrachromosomal; transposon related"
                     /function="8.3.1 extrachromosomal; transposon related;
                     transposases"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013316101.1"
                     /db_xref="GI:503081218"
                     /db_xref="GeneID:9731804"
                     /translation="MATPKYSLELRLSVVNHFLSGRDGTRRTAEIFGVERTSVRRWVR
                     AFQLHGIDGITWKNDSHSADFRLIVVQAVLNEELSMREAAARFNISNETVVRRWVSVY
                     NDAGPEVLRNMKRGRPREMTRKTTPPPVDAVLEQLSPEELRAELRYLRAENAYLKKLK
                     ALVQSEKDGKKPK"
     gene            complement(443874..446732)
                     /locus_tag="DDA3937_RS01985"
                     /old_locus_tag="Dda3937_01296"
                     /db_xref="GeneID:9731805"
     CDS             complement(443874..446732)
                     /locus_tag="DDA3937_RS01985"
                     /old_locus_tag="Dda3937_01296"
                     /function="2.3.1 information transfer; protein related;
                     amino acid -activation"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valyl-tRNA synthetase"
                     /protein_id="WP_013316102.1"
                     /db_xref="GI:503081219"
                     /db_xref="GeneID:9731805"
                     /translation="MEKTYNPHDIEQPLYEHWEKQGYFKPHGDTSQESFSIMIPPPNV
                     TGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAEEGKTR
                     HDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDDGLSNAVKEVFVRL
                     YKEDLIYRGKRLVNWDPKLRTAISDLEVENRDVKGSMWHLRYPLADGAKTADGNDYLV
                     VATTRPETVLGDTGVAVNPEDPRYKDLIGKFLILPLVGRRIPIVGDEHADMEKGTGCV
                     KITPAHDFNDYEVGKRHQLPMINILTFDGDIRQEAEVFSTNGEASTAYSSDIPEAFRG
                     LERFAARKAIVAAFDELGLLEEIKAHDLTVPYGDRGGVVIEPMLTDQWYVRAGVLAKP
                     AVEAVEDGRIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDDNGKVYVGRD
                     EAEVRRDNNLSADVALHQDEDVLDTWFSSGLWTFSTLGWPEQTPELKAFHPSSVMVSG
                     FDIIFFWIARMIMLTMHFIKDEDGKPQVPFHTVYMTGLIRDEEGQKMSKSKGNVIDPL
                     DMVDGISLEALLEKRTGNMMQPQLAEKIRKRTEKQFPNGIEPHGTDALRFTLAALAST
                     GRDINWDMKRLEGYRNFCNKLWNASRFVLMNTEDQDCGFTGGGEKVLSLADRWILAEF
                     NRTVKTYREALDGYRFDLAANVLYEFTWNQFCDWYLELTKPVMTGGSDAELRGTRHTL
                     VTVLEALLRLAHPIIPFITETIWQRVKVLKGVTDDTIMLQPFPAFDATLEDEQAFNDL
                     EWIKQAIVAVRNIRAEMNIAPSKPLTLLLRDASADATRRVQDNLGFIQTLARLESITL
                     LPAGDKGPVSVTKLVDGAELLIPMAGLIDKVAELDRLAKEVAKLELEISRIDSKLSNE
                     GFVARAPEAVVAKEREKRDGYAVAKTKLLEQQATIAAL"
     gene            complement(446746..447195)
                     /locus_tag="DDA3937_RS01990"
                     /old_locus_tag="Dda3937_01297"
                     /db_xref="GeneID:9731806"
     CDS             complement(446746..447195)
                     /locus_tag="DDA3937_RS01990"
                     /old_locus_tag="Dda3937_01297"
                     /function="2.1.1 information transfer; DNA related; DNA
                     replication"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316103.1"
                     /note="binds to single-strand binding (SSB) protein and
                     acts as a bridge between the DnaX clamp loader complex and
                     the SSB; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit chi"
                     /protein_id="WP_013316103.1"
                     /db_xref="GI:503081220"
                     /db_xref="GeneID:9731806"
                     /translation="MKNATFYLIDHDRPSGELNACEALACSLAAARWRAGQRVLIACE
                     DEQQALRLDEALWQREPHEFVPHNLAGEGPRQGAPVELAWPQKRGNAPRDLLISLQPQ
                     FADFATAFHEVIDFVPYEESLKQLARDRYKAYRSVGFQLTTATPPTH"
     gene            complement(447308..448816)
                     /locus_tag="DDA3937_RS01995"
                     /old_locus_tag="Dda3937_01298"
                     /db_xref="GeneID:9731807"
     CDS             complement(447308..448816)
                     /locus_tag="DDA3937_RS01995"
                     /old_locus_tag="Dda3937_01298"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="2.1.3 information transfer; DNA related; DNA
                     recombination"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843639.1"
                     /note="catalyzes the removal of N-terminal amino acids
                     preferably from various peptides; a cyteinylglycinase,
                     transcription regulator and site-specific recombination
                     factor; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multifunctional aminopeptidase A"
                     /protein_id="WP_013316104.1"
                     /db_xref="GI:503081221"
                     /db_xref="GeneID:9731807"
                     /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYIS
                     ALLRRGELEGKVGQSLLLHHVPNILSERILLIGCGKERELDERQYKQVIQKTINALNE
                     TGSMEAVCFLTELHVKGRNTYWKVRQAVETAKETLYTFDQLKTNKVELRRPLRKMVFN
                     VPTRRELTSGERAIQHGLAIASGIKAAKDLGNMPPNICNAAYLASQARQLADGYSQVT
                     TRVIGEQQMKELGMNAYLAVGQGSQNESLMSVIEYKGDPDNNSKPIVLVGKGLTFDAG
                     GISIKPADSMDEMKYDMCGAASVYGVMRVAAELALPLNIIGILAGCENMVDGRSYRPG
                     DILTTMSGQTVEVLNTDAEGRLVLCDTLTYVERFEPDVVIDVATLTGACVIALGHHLT
                     GLMSNHNPLAHELLGASEQAGDRAWRLPLGDEYQEQLDSNFADMANIGGRPGGAITAA
                     CFLSRFTRKYSWAHLDIAGTAWRSGKAKGATGRPVALLSQFLLNRAGLNDAE"
     gene            449100..450218
                     /locus_tag="DDA3937_RS02000"
                     /old_locus_tag="Dda3937_01299"
                     /db_xref="GeneID:9731808"
     CDS             449100..450218
                     /locus_tag="DDA3937_RS02000"
                     /old_locus_tag="Dda3937_01299"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316105.1"
                     /note="with LptBGC is involved in lipopolysaccharide
                     export; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide ABC transporter permease
                     LptF"
                     /protein_id="WP_013316105.1"
                     /db_xref="GI:503081222"
                     /db_xref="GeneID:9731808"
                     /translation="MIIIRYLVRETFKSQVAILFILLLIFFCQKLVRILGAAVDGDIP
                     TNLVLSLLGLGVPAMAQLILPLSLFLGLLMTFGRLYAESEITVMHACGLSKGVLLKAA
                     LLLSLLTASFAAANVLWLSPWSSRHQDEVLAEARANPGMASLAEGQFQQTQDGNSVLF
                     VGKANGSDFERVFLAQLHPRENTRPSVVVADRGTVTARGDGSQVVTLSKGTRYEGTAM
                     LRDFRITDFIDYQAIIGYQPVALDPNNVDQMDMQTLWRSSDIAARAEFHWRLTLILSV
                     LVMAIMVVPLSVVNPRQGRVLSMLPAMLLYLVFFLLQSSLRSNAGKGKLDPLVWMWLT
                     NLGYFALAIALNLWDSLPARKIRASLKSANGQKTKGAA"
     gene            450220..451290
                     /locus_tag="DDA3937_RS02005"
                     /old_locus_tag="Dda3937_01300"
                     /db_xref="GeneID:9731809"
     CDS             450220..451290
                     /locus_tag="DDA3937_RS02005"
                     /old_locus_tag="Dda3937_01300"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883141.1"
                     /note="with LptABCF is involved in the transport of
                     lipopolysaccharides; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide ABC transporter permease"
                     /protein_id="WP_013316106.1"
                     /db_xref="GI:503081223"
                     /db_xref="GeneID:9731809"
                     /translation="MFRVLDRYIGKTIFNTIMMTLFMLVSLSGIIKFVDQLRKVGQGG
                     YSVMGAGLYTLLSVPKDIEIFFPMAALLGALLGLGTLATRSELVVMQASGFTRLQIAA
                     AVMKTAIPLVLLTMAIGEWMAPAGEQMARNYRSQMMYGGSMLSTQGGLWAKDGNDFVY
                     IQRVAGENELAGVNIYHFDKQSKLLSIRYAASALYENGTWKLSQVEESDLRDSKQIGG
                     SQTVSGEWKTNLTPDKLGVVALDPDALSIRGLFDYINYLHQSGQEASRYQLNMWSKLF
                     APLSVAVMMLMALSFIFGPLRSVPAGVRIVIGISFGFLFYVLDQIFGPLSLVYHIPPV
                     LGASLPSALFLFISIMLLLKRR"
     gene            451654..451738
                     /locus_tag="DDA3937_RS02010"
                     /old_locus_tag="Dda3937_04246"
                     /db_xref="GeneID:9731810"
     tRNA            451654..451738
                     /locus_tag="DDA3937_RS02010"
                     /old_locus_tag="Dda3937_04246"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:451688..451690,aa:Leu,seq:caa)
                     /db_xref="GeneID:9731810"
     gene            451957..453219
                     /locus_tag="DDA3937_RS02015"
                     /old_locus_tag="Dda3937_01301"
                     /db_xref="GeneID:9731811"
     CDS             451957..453219
                     /locus_tag="DDA3937_RS02015"
                     /old_locus_tag="Dda3937_01301"
                     /function="8.1.4 extrachromosomal; prophage genes and
                     phage related functions; Integration, recombination"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_013316107.1"
                     /db_xref="GI:503081224"
                     /db_xref="GeneID:9731811"
                     /translation="MKLNARQVETAKPKEKTYKMADGGGLYLEITPRGSKYWRMKYRR
                     PDDKKEDRLAFGVWPTVTLADARAKRDEAKKLLVQGIDPKAEQKEAQAETAGAYTFET
                     IARQWHASNKRWGDYHRARVMRYLELYIFPHIGTADIRKLKTSHLLAPIKAVDASGKH
                     DVAQRLQQRVTAIMRYAVQNDYIDSNPASDMSGALTTTKARHYPALPPERLHEFLSRL
                     AAYRGRQMTRIAVELTLLTFVRSSELRFAQWHEFDFDKAYWRVPAQREAIKGVRYSYR
                     GMKMKEEHIVPLSRQAVALLEQLKAISGDNKCLFPGDHDPEKVMSENTVNNALRAMGY
                     DTQTEVCGHGFRTMARGALGESGLWSDDAIERQLSHSERNNVRAAYTHTSEYLDERRL
                     MVQWWADYLEVLKREYITSYDFAKMSGK"
     gene            complement(453448..456006)
                     /locus_tag="DDA3937_RS02020"
                     /old_locus_tag="Dda3937_01302"
                     /db_xref="GeneID:9731812"
     CDS             complement(453448..456006)
                     /locus_tag="DDA3937_RS02020"
                     /old_locus_tag="Dda3937_01302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_033111547.1"
                     /db_xref="GI:696580368"
                     /db_xref="GeneID:9731812"
                     /translation="MSTLAHEIISQIRNKFEFKSDLGFLFSHSFLKKNDKNIFVNRHS
                     EEDNAPTEIFKRLIESAYLFSQSESDEDKNLAQSIAYHLNTITDDDFLKKMSENLLRI
                     LGNLPGANYLQKENRDLPESFYSYFKRRFIEKENTIKISNKELILTDFQKKVWDSLHT
                     NKSQAISAPTSAGKSFLVVEMIINKIISGEINFVVYVAPTRALVNEITEKFINKTLEY
                     HNKIRVTSIPTVNDGFHKQIFVLTQERLQVLLDHQYHKIDMVVIDEAQSISDEIRGMI
                     LQDGLDRISVQNPHAKYVFIAPGAVGFDDLADIIGIDKLHIEKTNYSPVVQNKIIVKV
                     DPAKENNLKLSLLDNSNILPIGEITSKRGFANENTRLAAVALELGKNEGSLVYGTGAA
                     DAEDVAKQISSGLLPIKNDNDLQELSKFIKKHVHKDYSLANHVLRGVGYHYGKMPSLL
                     RETLEKNFIKNKLKFLVCTTTLFQGVNLPAKNVFIDTPTRGNRGEKLDPASLWNFAGR
                     AGRLGYSFSGNVYLIDYDDWETKPLDSKIDFQITSSFKKVVTDDFDKILERLNKDNHS
                     GVSQYTNVDAAVGLLISRAAKGDLHNFLTRSFRSITEKSKINSIEIATRNSLESITIP
                     HNILSLNWTVDPFGQERLYNRFIQKIKEGKADELIPRHPSGDVYANYVGVFSRINKYI
                     INNNTAKFSNYLTSMALNWMRGKSLPEIIDLSIKKKKEKGGNKPVNVDRTVREVFDFI
                     EDNLRFKYVQLGKAYVDLLRQALVDNNLSHKSEEIYDFPLSLELGVASIAGQAFIELG
                     LSRISASYLENIIPNSNPTINMAKDWLKNNDYETLDLPLTIFRELEDKGLLNSD"
     gene            complement(455987..457027)
                     /locus_tag="DDA3937_RS02025"
                     /old_locus_tag="Dda3937_01303"
                     /db_xref="GeneID:9731813"
     CDS             complement(455987..457027)
                     /locus_tag="DDA3937_RS02025"
                     /old_locus_tag="Dda3937_01303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111548.1"
                     /db_xref="GI:696580369"
                     /db_xref="GeneID:9731813"
                     /translation="MKSVDANSLHKIYKPVYGLEHIIILAQESLPTAPFKVNLLCLGF
                     KEDMPKDKELAETLFLELVHYCIPHPVIEKRKKQALDEGKDEARLYSELLREARSLFM
                     KYKLESAIKKKSGETEEKFEQRVRNANSRYGEVGELISYCIAIHFLKASQLVSKMALK
                     TSSEMPVFGLDGIHATIDADGTLTVFYLESKITREFDSGSEQFSKSVSGFEIDRNGRR
                     NEYRIIQDLSNLESLEGEERSKAINYFNPYSSQSSNVRERFIGIIAYSEKNYSNKLPI
                     NDEAPLSIHFEHFKNGYTSSYQEKINTLTSDLTKAGATLQKCRAYIFALPDVDNFKLD
                     FAKELSGEHFSA"
     gene            458532..459413
                     /locus_tag="DDA3937_RS02030"
                     /old_locus_tag="Dda3937_01304"
                     /db_xref="GeneID:9731814"
     CDS             458532..459413
                     /locus_tag="DDA3937_RS02030"
                     /old_locus_tag="Dda3937_01304"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013316110.1"
                     /db_xref="GI:503081227"
                     /db_xref="GeneID:9731814"
                     /translation="MTKLSREMKTWAKQAGGSHKTVHDRLRIVERLCRHLLALNIQVR
                     SVQHVKARHIESYVAARRSQGMALRTLHNEMSALRGVLRLAGRGKLVDDPRLSNQALG
                     LGGASRAGTKYAIPDARYQSVLESARREDAGLACALQLARLLGLRSQEAVQCCASLKR
                     WEQQLTRQADRLTVVFGTKGGRPRETRVLDSAAVLAAVREALVIADNRNGKLIDKPDL
                     KTAMNFWRARTTRLGLTGPHSPHSLRYAWAQDAMRFYLADGFSRQEARALVSMDLGHG
                     DGRGRYVERVYTRQEEA"
     gene            459416..459616
                     /locus_tag="DDA3937_RS02035"
                     /old_locus_tag="Dda3937_01305"
                     /db_xref="GeneID:9731815"
     CDS             459416..459616
                     /locus_tag="DDA3937_RS02035"
                     /old_locus_tag="Dda3937_01305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012886376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_026357784.1"
                     /db_xref="GI:648666037"
                     /db_xref="GeneID:9731815"
                     /translation="MSNLTLLRLPDVMKKTSLKKSWIYYLIDRGEFPQPVKLGARSVA
                     WVESEINDWIAERIRQRAEGRK"
     gene            459613..460152
                     /locus_tag="DDA3937_RS02040"
                     /old_locus_tag="Dda3937_01306"
                     /db_xref="GeneID:9731816"
     CDS             459613..460152
                     /locus_tag="DDA3937_RS02040"
                     /old_locus_tag="Dda3937_01306"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316111.1"
                     /db_xref="GI:503081228"
                     /db_xref="GeneID:9731816"
                     /translation="MSHSTFLLAGKLGYTARATAKSVAGIGVPTITTVSKKHVHHVAC
                     FFIDSACAHLSMVAQAGAPKGAPEPVVAGYANPVWATTHGIGVSGGGCFLLTTEAALW
                     LRPLAIPACNLSPLLWRCAMYNPTPLLLEEIADHCRVLAYAIIELENPVAKELLMFIL
                     WERLNLLNDALDAEGPDNE"
     gene            460145..462190
                     /locus_tag="DDA3937_RS02045"
                     /old_locus_tag="Dda3937_01307"
                     /db_xref="GeneID:9731817"
     CDS             460145..462190
                     /locus_tag="DDA3937_RS02045"
                     /old_locus_tag="Dda3937_01307"
                     /function="1 metabolism"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_013316112.1"
                     /db_xref="GI:503081229"
                     /db_xref="GeneID:9731817"
                     /translation="MSKFVSESVAQSRHRWPSILAALDIYFPAGGQHGPCPVCGGKDR
                     FRFDDKRGRGTWFCNHCGHGDGLDLVARVRRCDIAEAARVVKALASSASETPPAREKT
                     VDPRPLAERIKALMAAASTGESPYLKARGLMIPAMLLTAAQAMTIGRVRFGEGSLLLP
                     MFRTSGELAGAQLITPGGEKRLYPGTQLKGAFIPVNHGPEPSKLIITEGYATALTLQQ
                     CSSCHVVAAVSANNLLNVAQVFRARYPHCCLILAGDNDIHPDGAANTCKLMAEKAALA
                     VDGWVSLPPTDTACDWDDFRQRHGMEATKAAFRRQLTQPAVISPAPLPDAGQSPVAVF
                     SSALPLRKGSEGFDTRQDYLIKGYLPSGAVASAYGASGSYKSFLAVSWACHIATGKPW
                     ANRPVTQGAVIYVVGEGGIGVPRRIRAWEETLNDRSPIDALYRVDCPVFPASPDSVEQ
                     VIKAAHDVQAASGMAVRLIILDTLARCFGGSDENAAKDMGAFIQGCDYIKAATQATVL
                     IIHHSGKDQDKGARGSSAFRAALDVEFNVRREADGQALILTCTKMKDAEEPPRRAYDL
                     TAVNLYVDDDGEPVTSLVLRDEGRDVRDDLTDADPALSGITRLTDNHVALWEAIRSRT
                     ASGDGCTRALVRDDMRAMGFDVSKKFTRWLDKLVRDDLIALDGENIVPLSKRGNVGE"
     gene            complement(462414..462680)
                     /locus_tag="DDA3937_RS02050"
                     /old_locus_tag="Dda3937_01308"
                     /db_xref="GeneID:9731819"
     CDS             complement(462414..462680)
                     /locus_tag="DDA3937_RS02050"
                     /old_locus_tag="Dda3937_01308"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015848023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013316114.1"
                     /db_xref="GI:503081231"
                     /db_xref="GeneID:9731819"
                     /translation="MTTYNDWHQADIIAGLRKKGTTLAALSRSAGLSSSTLANVLVRP
                     WPKGEWLVATALDKHPAEIWPSRYFDETGTLIDRKRRIRQERGK"
     gene            complement(463135..463536)
                     /locus_tag="DDA3937_RS02055"
                     /old_locus_tag="Dda3937_01310"
                     /db_xref="GeneID:9731821"
     CDS             complement(463135..463536)
                     /locus_tag="DDA3937_RS02055"
                     /old_locus_tag="Dda3937_01310"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316116.1"
                     /db_xref="GI:503081233"
                     /db_xref="GeneID:9731821"
                     /translation="MKNLIKFSLILSTSLIAIPAFSASFSNVEICKAAISMEFAKEPK
                     IMKTKVNGDLINLQYHRPSDNSLWKYQCKMIEGSRVLWRSAGSDSEPNYIGRWRDNPN
                     DALITYTEENGVLKMTNSQAGEQTFKHADLK"
     gene            complement(463565..464044)
                     /locus_tag="DDA3937_RS02060"
                     /old_locus_tag="Dda3937_01311"
                     /db_xref="GeneID:9731822"
     CDS             complement(463565..464044)
                     /locus_tag="DDA3937_RS02060"
                     /old_locus_tag="Dda3937_01311"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_013316117.1"
                     /db_xref="GI:503081234"
                     /db_xref="GeneID:9731822"
                     /translation="MGITAPELLLPQHAVVDFHCSEPSLNEWLKRKALKNQTLGASRT
                     FVVCEAGTQRVVGFYALASGSIQRQVAPGAFRRNMPDPIPVLVLGRLAVDERYQRMGI
                     GAGLLKDAVLRSRNVAQQVGNKALLVHALSDEAKAFYQYWGFVPSEIQEHTLLLSLW"
     gene            complement(464035..464307)
                     /locus_tag="DDA3937_RS02065"
                     /old_locus_tag="Dda3937_01312"
                     /db_xref="GeneID:9731823"
     CDS             complement(464035..464307)
                     /locus_tag="DDA3937_RS02065"
                     /old_locus_tag="Dda3937_01312"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000801915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316118.1"
                     /db_xref="GI:503081235"
                     /db_xref="GeneID:9731823"
                     /translation="MRTEPKEMPINIRAKASQRELIDVAAKLLSKSRTEFILDAACRE
                     AEDVLLDQRLFLVNDEQYDAFIQVLESPVTDNPRVNALLNRKSPWE"
     gene            complement(464868..465581)
                     /locus_tag="DDA3937_RS02070"
                     /old_locus_tag="Dda3937_01313"
                     /db_xref="GeneID:9731824"
     CDS             complement(464868..465581)
                     /locus_tag="DDA3937_RS02070"
                     /old_locus_tag="Dda3937_01313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_033112195.1"
                     /db_xref="GI:696581016"
                     /db_xref="GeneID:9731824"
                     /translation="MVINTPFTDGYDNAFLLDTMMGPNAMRITEEMATMLPISPGMRI
                     LDLGCGKGISSILLAKKYDVTVFAADLWISPTENAERFASLGVDSKIFPLLVDATKEI
                     PFAHEYFDMIISVDAWQYFGSNDGMLTKLLPFVKKGGLIAVAVPGFIQDYSEGNLPEV
                     VKPFWTPDWYFYSCNWWKALWEKESGIEITLVREMDSCQQAWDDFMECSLVQEMMVPI
                     MEAGAGEYFNIIQIVGRKV"
     gene            complement(465598..465855)
                     /locus_tag="DDA3937_RS02075"
                     /old_locus_tag="Dda3937_01314"
                     /db_xref="GeneID:9731825"
     CDS             complement(465598..465855)
                     /locus_tag="DDA3937_RS02075"
                     /old_locus_tag="Dda3937_01314"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004711421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316120.1"
                     /db_xref="GI:503081237"
                     /db_xref="GeneID:9731825"
                     /translation="MNLSRQEQRTLHVLAKGGRIAHIRDASGHITSVECYSREGLLLS
                     DCTLAVFKKLKTKKLIKSINGQPYRINTTGLNTVRAQPDNR"
     gene            complement(466300..466638)
                     /locus_tag="DDA3937_RS02080"
                     /old_locus_tag="Dda3937_01315"
                     /db_xref="GeneID:9731826"
     CDS             complement(466300..466638)
                     /locus_tag="DDA3937_RS02080"
                     /old_locus_tag="Dda3937_01315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111549.1"
                     /db_xref="GI:696580370"
                     /db_xref="GeneID:9731826"
                     /translation="MTDTRATPTDSSITIFRDLIASLPFYQLDDAQLCDLGAIAAESV
                     SGLCHGLSELGDRLQNGADIGPEQRRHLGASLNAAAHLIPALLEICEQAERCTRTVPH
                     VGELIPRYVI"
     gene            467110..467913
                     /locus_tag="DDA3937_RS02085"
                     /old_locus_tag="Dda3937_01316"
                     /db_xref="GeneID:9731828"
     CDS             467110..467913
                     /locus_tag="DDA3937_RS02085"
                     /old_locus_tag="Dda3937_01316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111550.1"
                     /db_xref="GI:696580371"
                     /db_xref="GeneID:9731828"
                     /translation="MKGYHLKEQHRRKSWVRDTNTDAEAALLNYLPELLNMLKLTMPV
                     PPSVITRDIEGETFFDILYRCDFNARQNIHQIEKIFSVKEEFTPEWVPGADLALPVIA
                     QEDHVLPDKHYLLLGLDLFAAVEQGDICISPHGWGDNHLTGKDMSASEFLELKPRPAC
                     LYAGVLHGHAGQPLSPPQLLGWLELMRQAYGYPSSTVVLLAPVAESSGFAGWFGLYQR
                     NGVIGKAPQWQSLSVLAKDVHFWEAMKETGLAHNVYASGMGANSAYQGN"
     gene            complement(468107..468589)
                     /locus_tag="DDA3937_RS02090"
                     /old_locus_tag="Dda3937_01317"
                     /db_xref="GeneID:9731829"
     CDS             complement(468107..468589)
                     /locus_tag="DDA3937_RS02090"
                     /old_locus_tag="Dda3937_01317"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.5 regulation; type of regulation;
                     transcriptional level; action unknown"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_013316124.1"
                     /db_xref="GI:503081241"
                     /db_xref="GeneID:9731829"
                     /translation="MKLNLTDIKILTLLQKDARITNQTLAEQIGMSPSPCWRKVRKLE
                     EEDVIQSYRAVLDRRKIGLGVMVFVRVTIDSHSEAQARKFEQEVTDLEDVVACYSMGG
                     DADFLLQVVSRDLDSYAEFAMSVIRRLPGIKEMQSMFVLKEIKPFATFPIKKPLKTPQ
                     "
     gene            468753..469127
                     /locus_tag="DDA3937_RS02095"
                     /old_locus_tag="Dda3937_01318"
                     /db_xref="GeneID:9731830"
     CDS             468753..469127
                     /locus_tag="DDA3937_RS02095"
                     /old_locus_tag="Dda3937_01318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stress responsive protein"
                     /protein_id="WP_033111551.1"
                     /db_xref="GI:696580372"
                     /db_xref="GeneID:9731830"
                     /translation="MILHIVLFTFKNPYNWSSPAALEAEEITRSHPLHISEIRGWGCG
                     RNITDRAVAADFVVLGMFDTQQDVAAYLVHSNHQVGVEKWKAIAEWNVVDIDLNSDLS
                     HTYGLLRSLGMAGNNCLEVVGD"
     gene            469130..469552
                     /locus_tag="DDA3937_RS02100"
                     /old_locus_tag="Dda3937_01319"
                     /db_xref="GeneID:9731831"
     CDS             469130..469552
                     /locus_tag="DDA3937_RS02100"
                     /old_locus_tag="Dda3937_01319"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316126.1"
                     /db_xref="GI:503081243"
                     /db_xref="GeneID:9731831"
                     /translation="MKFDAASHKCTIVIDKDLGAGLSINAASVIGISFGRTVENLVGP
                     DMQSQDAVNYPGVIYAPLPVLLAPGGYVQELLRHAENDEEVYAMPFSALAQSCRTYDE
                     YGERISAVSSDNIELVAIGLIGPKKKITRLTGNLPLFK"
     gene            <470085..470440
                     /locus_tag="DDA3937_RS02105"
                     /note="bacilysin biosynthesis protein BacA; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /db_xref="GeneID:23677388"
     gene            470489..471115
                     /locus_tag="DDA3937_RS02110"
                     /old_locus_tag="Dda3937_01322"
                     /db_xref="GeneID:9731834"
     CDS             470489..471115
                     /locus_tag="DDA3937_RS02110"
                     /old_locus_tag="Dda3937_01322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="WP_033111552.1"
                     /db_xref="GI:696580373"
                     /db_xref="GeneID:9731834"
                     /translation="MLEPAQILAYITALGLAAAIPGPGMTALVARSVSGGAITGFTML
                     AGLIIGDLIYLSFAVFGLAVVAHSYGALFTLISWGAAVYLGWLSWQFWSHNPEAIAID
                     QRISRRELASAWFSGLTITLGNPKTIAFYLALLPLVITLDTVSLQTWALMLVPLTISV
                     LLAVGAVFILGALRIRHLLASTRAQLWLFRSAAMIMLAASLGMVWKTL"
     gene            complement(471186..471812)
                     /locus_tag="DDA3937_RS02115"
                     /old_locus_tag="Dda3937_01323"
                     /db_xref="GeneID:9731835"
     CDS             complement(471186..471812)
                     /locus_tag="DDA3937_RS02115"
                     /old_locus_tag="Dda3937_01323"
                     /function="4.2.A.75 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The L-lysine exporter (LysE) Family"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="WP_013316130.1"
                     /db_xref="GI:503081247"
                     /db_xref="GeneID:9731835"
                     /translation="MPLPIFITGFMTSAGLIAAIGAQNSFVLRQGMRREHVFWVSSVC
                     FLCDMALMTLGVLGLGKIINDSKPAITTLTLAGVLFLLWYGYNALKSAWRGNNQLTLT
                     TQGDGLRRRRTVIGACLAVSLLNPHVYLDTVAIIGGISSGIAPDLKLFYLAGSISASF
                     IWFYTIGYTAAACSRYFANPLTWRVIDTLIGGYMIFMAFQLCRFLYQV"
     gene            complement(471990..472766)
                     /locus_tag="DDA3937_RS02120"
                     /old_locus_tag="Dda3937_01324"
                     /db_xref="GeneID:9731836"
     CDS             complement(471990..472766)
                     /locus_tag="DDA3937_RS02120"
                     /old_locus_tag="Dda3937_01324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_013316131.1"
                     /db_xref="GI:503081248"
                     /db_xref="GeneID:9731836"
                     /translation="MAASTLWTRDQLLVAFTLYSQLPFGKLHSRNPEIIHYAKLIGRT
                     PSALAMKLVNIASLDPVIIDSGRTGLSQASKADRELWQELEQDPEAFEQQCQQAIAAL
                     AAPDATPLHAQEESAPDYCGHECLTATKARVGQQQFRKRVLNAYDERCCITGLEEPIL
                     LIASHIRPWKDIAEHRLDPSNGLCLSALHDKAFDQGLIGFNDHLELLLSPRIKVLTSA
                     IVQSQFEQYEGKPLHLPKAEKYAPKLAHIQHHRENIFSKH"
     gene            473037..474374
                     /locus_tag="DDA3937_RS02125"
                     /old_locus_tag="Dda3937_01325"
                     /db_xref="GeneID:9731837"
     CDS             473037..474374
                     /locus_tag="DDA3937_RS02125"
                     /old_locus_tag="Dda3937_01325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015847970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug MFS transporter"
                     /protein_id="WP_042318043.1"
                     /db_xref="GI:754962119"
                     /db_xref="GeneID:9731837"
                     /translation="MPARIGAIFAIAFGIAMAVLDGALVNVALPTIAADFNTSPASSI
                     WIVNAYQLAITMTLLSLSSLGDIVGYRRVYLVGLVLFTLMSVVCALADSLPTLTLARI
                     LQGLAAAALMSVNTALIRLIYPRDKLGRGMAINSLVVAVSTAAGPTVAAGILGVASWQ
                     WLFAINIPFGIVALLLGWRFLPRNDGVRAQRFDAPSALLNALTFGLFFIALGGFAHGQ
                     NLWLVLGELALTLLVGGYFFRRQLTQSYPLLPVDLLRIPVFALSMGTSISSFCAQMLA
                     MVSLPFYFQSALGMNEIETGLLLTPWPLAIMAVAPLAGRWLERVNAGVLCTIGLSLFA
                     LGLFSLAWLPASPGYLDICLRMVLCGIGFGLFQSPNNHTIISAAPRHRSGGASGMLGT
                     ARLVGQTAGAALVALMFNLFGELGTHAALMTAGTFATLAAIVSGQRISRLKTD"
     gene            complement(474337..475821)
                     /locus_tag="DDA3937_RS02130"
                     /old_locus_tag="Dda3937_01326"
                     /db_xref="GeneID:9731838"
     CDS             complement(474337..475821)
                     /locus_tag="DDA3937_RS02130"
                     /old_locus_tag="Dda3937_01326"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.5 regulation; type of regulation;
                     transcriptional level; action unknown"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_013316133.1"
                     /db_xref="GI:503081250"
                     /db_xref="GeneID:9731838"
                     /translation="MDFLTRPFSPRPSAPLNQQLYQRIQDAIATGQLHPGERVPSVRS
                     LASELNLARGTVEAAYQRLTSEGYLLPRGPAGTIVSPGLTNLTPGHASASPPPSRPQP
                     EPQNPAILPFQLGLPALDAFPRKTWNRLAGQRLRTLGGDALAYPDPQGCLPLRRAIAA
                     YLGISRGIACSEQQVFITAGYHCSLDLICRSLFTPGDLGWYEDPGYPFARRFLLHAGM
                     QLAPVPVDEAGIDVAAGEQYAGHARFAVVTPTHQSPLGVALSLPRRLALLAWAARRGA
                     WIIEDDYDSEFRYHGRPLPALKSLDSDERVIYTGTFSKVFFPGLRLAYLVVPQTQIPT
                     FQQTAQILHSNGFTLAQATAADFMERGYFARHIRKMRALYARRRGYLQDALTTLAGDK
                     LQLHASAGGMHLLARLPPGGSLDVDIATEAISAGLSIQALSQWRQRPDSTGGLLMGFT
                     NLVSAEQAHQLTQRLCALPSFQHLLSVDGNNLTSPFSAAKSADR"
     gene            475928..476377
                     /locus_tag="DDA3937_RS02135"
                     /old_locus_tag="Dda3937_01327"
                     /db_xref="GeneID:9731839"
     CDS             475928..476377
                     /locus_tag="DDA3937_RS02135"
                     /old_locus_tag="Dda3937_01327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="WP_033111553.1"
                     /db_xref="GI:696580374"
                     /db_xref="GeneID:9731839"
                     /translation="MADIHLAWASSQTEQLACFSLMQALRPHLTDGEQFVRQVQRQAQ
                     HGYRLLAAWQEGMAIGLAGYRLQENLVYGRFLYVDDLVCQADVRGQGIGDRLMQAMYQ
                     EAARERCAHLVLDSALSNVLAHRFYFRQGLLARALRFSAPIHCGEVL"
     gene            476374..476805
                     /locus_tag="DDA3937_RS02140"
                     /old_locus_tag="Dda3937_01328"
                     /db_xref="GeneID:9731840"
     CDS             476374..476805
                     /locus_tag="DDA3937_RS02140"
                     /old_locus_tag="Dda3937_01328"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkylhydroperoxidase"
                     /protein_id="WP_013316135.1"
                     /db_xref="GI:503081252"
                     /db_xref="GeneID:9731840"
                     /translation="MNALRLPYATLSPEAYQGLLMTKKALEKSTLGLELIELVYLRIS
                     QINGCAFCLKMHAGWLRGAGVSNEKLDSLAGWRVCTLFSPREQAALAWTESLADVALT
                     HAPDEHFTPLREHFTETEIADLCFAIALMSAFNRLAIGARQ"
     gene            complement(477142..477768)
                     /locus_tag="DDA3937_RS02145"
                     /old_locus_tag="Dda3937_01330"
                     /db_xref="GeneID:9731842"
     CDS             complement(477142..477768)
                     /locus_tag="DDA3937_RS02145"
                     /old_locus_tag="Dda3937_01330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111554.1"
                     /db_xref="GI:696580375"
                     /db_xref="GeneID:9731842"
                     /translation="MVNVYVEGGGDTNSLRAECRRGFAEFLKKAGLTGTMPRIIACGS
                     RRDAYNSFCIAIRQGTPAMLLVDSEEPVIAVAQQNADPNQWQPWLHLRQRQGDGWEKP
                     AGSDDQQCHLMTQCMESWLIADSITLASFFGQGFRTSLLPQGNVERIAKRQVYDMLEN
                     ATRSTTKGRYGKGAHSFTLLALIDPAKVQQASPWAQRFITQLRSRMSS"
     gene            complement(477762..478922)
                     /locus_tag="DDA3937_RS02150"
                     /old_locus_tag="Dda3937_01331"
                     /db_xref="GeneID:9731843"
     CDS             complement(477762..478922)
                     /locus_tag="DDA3937_RS02150"
                     /old_locus_tag="Dda3937_01331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein SMC"
                     /protein_id="WP_033111555.1"
                     /db_xref="GI:696580376"
                     /db_xref="GeneID:9731843"
                     /translation="MIKSIQLTNFLSFGASTQPIELKALNVIVGPNGSGKSNLLEAIE
                     LLRNAPDKLITPIRDGGGVSDWLWKGGQGKPTATLNAVFTNPKGPQSLRYQLSFTEVA
                     QRFEMVDERIENEHPADGHPEPYFYYHFNNARPTLNVKNKKRALQLEDIDLEKSILAQ
                     RRDPDQYPEITYLAQELARIRLYREWSFGRYTPPRQPQKADLPNDHLESTSTNLGLVL
                     NRLRRDPLVKQRLLKALQALYDGIDDYDVQIEGGTVQVFFHEGRFTIPATRLSDGTLR
                     YLCLLAVLCHPNPPPLICLEEPELGLHPDVLPTLGALLKEASNRTQLIVTTHSDVLVD
                     AMSDQPDAVLVAEKTLEGTTMTRLDAENLKPWLENYRLGQLWTRGDIGGTRW"
     gene            complement(479045..479836)
                     /locus_tag="DDA3937_RS02155"
                     /old_locus_tag="Dda3937_01332"
                     /db_xref="GeneID:9731844"
     CDS             complement(479045..479836)
                     /locus_tag="DDA3937_RS02155"
                     /old_locus_tag="Dda3937_01332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR faimly transcriptional regulator"
                     /protein_id="WP_033111556.1"
                     /db_xref="GI:696580377"
                     /db_xref="GeneID:9731844"
                     /translation="MKSKSEQLADMQQRREKILEMVREDGTVTVKMLTETFGLTEATI
                     RTDLRELQKEGYVQRYYGGATLVTGKQNTGAMLLERQINLEEKDAIGRLAAAQIENGD
                     TVIFDSGTTTTAMVEHMADIHRLSVITTAVNIALKLGGEPGINILLTGGTFKFPTLST
                     SGEKAASFFENVLAEKLFLATAAISPRMGLSFPSETDIKVKSAMIRSAKTVYVVADSS
                     KIGKVSMFALPCDWSNIHYLITDAGISQEAVSAFEALGVTVMVAG"
     gene            480179..480982
                     /locus_tag="DDA3937_RS02160"
                     /old_locus_tag="Dda3937_01333"
                     /db_xref="GeneID:9731845"
     CDS             480179..480982
                     /locus_tag="DDA3937_RS02160"
                     /old_locus_tag="Dda3937_01333"
                     /function="1.3.2 metabolism; energy metabolism, carbon;
                     pentose phosphate shunt, oxidative branch"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_013316140.1"
                     /db_xref="GI:503081257"
                     /db_xref="GeneID:9731845"
                     /translation="MDVQTIRQTARQARRYVLQMNHRAGKGHTGADLSEVDIICTLFM
                     AVMDRSQARPNQDRFILSKGHGAGGLYCSAAAMGLLDPAILDQFMGDDTLLAGHPIHQ
                     KLPDLVEINSGALGHGLSIGVGLALGNRLAGRSHRRVFVLMGDGELAEGSNWEAAMAA
                     SKFRLDNLIAIVDRNRLQLAGKTEDIMPLEPLEDKWRAFGFDVHHCDGHDPQAIIHAV
                     EAPSVGKPRVILANTEKGHGISFMANVPAWHHAVPNDEQLAQGLAELED"
     gene            480985..481905
                     /locus_tag="DDA3937_RS02165"
                     /old_locus_tag="Dda3937_01334"
                     /db_xref="GeneID:9731846"
     CDS             480985..481905
                     /locus_tag="DDA3937_RS02165"
                     /old_locus_tag="Dda3937_01334"
                     /function="1.5.3 metabolism; building block biosynthesis;
                     cofactor, small molecule carrier"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_013316141.1"
                     /db_xref="GI:503081258"
                     /db_xref="GeneID:9731846"
                     /translation="MQDLRDAVVAALLEEQNAGANLCVVVADSTSTSKIAPFEKAFPE
                     RVVNVGIAEQNMVGMATGLSLSGPTVFTANAAPFLLARSNEQVKNDVCYTDANVKMLG
                     LNAGFAYGPLGATHHCMNDIAIARSFGNLQIFAPADAVQASAIVRYAIRHRGPVYIRM
                     DSDKVPVLHEADWSLTPGKPEVVQQGSDVVVFCLGTMVHEALAAATDATIVSLPSLWP
                     LDEMSLLKIISEHQYVISMEEHVLSGGLGSIIGELLHKHHARQRFTALGVPPYEFTHS
                     SSRSALRRQFHIDAAGLRLTLEQLALRTIA"
     gene            481919..482722
                     /locus_tag="DDA3937_RS02170"
                     /old_locus_tag="Dda3937_01335"
                     /db_xref="GeneID:9731847"
     CDS             481919..482722
                     /locus_tag="DDA3937_RS02170"
                     /old_locus_tag="Dda3937_01335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_033111557.1"
                     /db_xref="GI:696580378"
                     /db_xref="GeneID:9731847"
                     /translation="MSHDNEYDVNLRYGVDTDLSLSDKVAVVTGGLGGIAMASNEMLL
                     AKGARLALLYPAFERDKAAQAAERFDPTRVLLVECDVTTPAEVERAFAAVEAHYGRID
                     ILINCAGYVMLQPVLETDFDEWQKQIAVNLTGPFLCSQAAARHMVAAGHGGKIINIAS
                     QAASIAIDNHVAYTSAKAGLLGMTKVMAKELAPHRINVNTLSPTVVLTPMGEKAWRGE
                     KGEAMKKLIPLGRFAYTDEIAAAVLFFASNGSDMITGADLMIDGGFTIW"
     gene            482815..483750
                     /locus_tag="DDA3937_RS02175"
                     /old_locus_tag="Dda3937_01336"
                     /db_xref="GeneID:9731848"
     CDS             482815..483750
                     /locus_tag="DDA3937_RS02175"
                     /old_locus_tag="Dda3937_01336"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020079381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013316143.1"
                     /db_xref="GI:503081260"
                     /db_xref="GeneID:9731848"
                     /translation="MKLRSMLLTAAITSALSLTAHAAEKGTIMILVNSLDNPYYASEA
                     KGADKKAQELGYNTTVLSHGEDVKKQSELIDAAIGKKVQGIVLDNADSTASVAAIKKA
                     KSAGIPVVLINREIPVDDVALVQITHNNFQAGSDVANVFVGKMGEKGKYAELTCSLAD
                     NNCVTRSKSFHQVLDQYPEMTSVARQDAKGTLLDGKRIMDSILQAHPDVKGVICGNGP
                     VALGAIAALKAAGRNDVVVVGIDGSNDERDAVKEGSLKATVMLQAQAIAAQGVTDLDN
                     YLRKGEKPAKQRVMFRGILITPENANKVQDFNFKS"
     gene            483794..484426
                     /locus_tag="DDA3937_RS02180"
                     /old_locus_tag="Dda3937_01337"
                     /db_xref="GeneID:9731849"
     CDS             483794..484426
                     /locus_tag="DDA3937_RS02180"
                     /old_locus_tag="Dda3937_01337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316144.1"
                     /db_xref="GI:503081261"
                     /db_xref="GeneID:9731849"
                     /translation="MSKRSRPLWLALAVLGLGGCRIVSQQELADLKHPPNPHMANLGD
                     TWRQHIVPQVVREARPVAALMKDVQASSDMDAACKQFGYRSQQENPCVFTVRVTGTVV
                     SIDTASRNGKMVVRDDSAGNVTVQLGPTIRGTDLRDAYRGASYQDFNDQVLYGDFGRA
                     INQQALAMIQAAHPKTGERLDVVGVFSSWDIPQAVPDITPAQITRDDKGG"
     gene            484477..486036
                     /locus_tag="DDA3937_RS02185"
                     /old_locus_tag="Dda3937_01338"
                     /db_xref="GeneID:9731850"
     CDS             484477..486036
                     /locus_tag="DDA3937_RS02185"
                     /old_locus_tag="Dda3937_01338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_042318721.1"
                     /db_xref="GI:754962799"
                     /db_xref="GeneID:9731850"
                     /translation="MVTTAPPTPTPAADAGAAPEVIIETRNLSRVYPGVTALDEVNYR
                     VYRNKVNVLIGENGAGKSTMMKMLAGVETPSSGQILLDGKPVTLGSTHQAERQGISII
                     FQELNLFPNMNVMDNIFIANEFFQRGVINETFQYALAKTLLERLELDIDPYTPLGELG
                     IGHQQLVEIARALSKDTRVLIMDEPTSALSQSEVKVLFGVIEQLKRRGVTIIYISHRL
                     EELMEIGDHITIFRDGRFICEREVRHASVPWIIEQMVGDKKKHFDYQPAPQGDTVLTV
                     AGLTALHPSGGYRLHDVSFNLRKGEVVGIYGLLGAGRTELFKGLIGLMPCQQGSVQLN
                     DDCLDGLGFRQRLEKGIALVPEDRQGEGMVQLMSVRANMTLSAFSLRGFWRAWAWLRE
                     PDEAKQVDEMVRQLAVKVSDDELPITSLSGGNQQKVVLGKALMTRPQVVLLDEPTRGI
                     DVGAKTDVYHLIGRMAQQGLSVMFSSSELDEVMALADRILVMADGRITADLPRSQVTR
                     EILISASTPHD"
     gene            486053..487120
                     /locus_tag="DDA3937_RS02190"
                     /old_locus_tag="Dda3937_01339"
                     /db_xref="GeneID:9731851"
     CDS             486053..487120
                     /locus_tag="DDA3937_RS02190"
                     /old_locus_tag="Dda3937_01339"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="7.3 location of gene products; inner membrane"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013316146.1"
                     /db_xref="GI:503081263"
                     /db_xref="GeneID:9731851"
                     /translation="MSQKYTLYMYLLKARTFIALLIVVVFFSLMVPNFLTPSNLLIMT
                     QHVAITGLLAIGMTLVILTGGIDLSVGAVAGICGMVAGALLTNGIPLWGGNVLFLNVP
                     EVILTVAVLGMAIGLVNGVVITRLVVAPFICTLGMMYVARGVALLFNDGSTYANLNGM
                     PALGNTGFAFLGSGTLLGIYLPIWLMLAFLLLGLYLTRKTPLGRYIYAIGGNESAARL
                     AGVPIVNVKIFVYAFSGLCAALVGLVVASQLQTAHPMTGNMFEMDAIGATVLGGTALA
                     GGRGRVSGSIIGAFVIVFLADGMVMMGVSDFWQMVIKGVVIVTAVVIDQFQQRLQNKV
                     VTMRRHEKKQAVNPLSEVSHV"
     gene            487113..488624
                     /locus_tag="DDA3937_RS02195"
                     /old_locus_tag="Dda3937_01340"
                     /db_xref="GeneID:9731852"
     CDS             487113..488624
                     /locus_tag="DDA3937_RS02195"
                     /old_locus_tag="Dda3937_01340"
                     /function="1.7.6 metabolism; central intermediary
                     metabolism; glycerol metabolism"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_013316147.1"
                     /db_xref="GI:503081264"
                     /db_xref="GeneID:9731852"
                     /translation="MSRDLIVALDEGTSNVKAVAIDAGGRVLARASRPLGLITPRAGW
                     VEQDGEALLAGSFAVVREVMEQVGAERVAALAVSNQRETAIGWQRDTGRPLSAALSWQ
                     CSRSAPFCEQLRRDQQEAAIRAATGLPVAPLFSGSKMRWLLDNTPDGHARAARGEICL
                     GTIDAWLLWHLTGGRQFRCDLSNAARTQLLNLHRLQWDDAMLALFGIPRAALPELMPS
                     AGEFGVTCGVPGVADGIPILAMAGDSHAALYGHGLGRLGGVKATYGTGSSVMAPLGAP
                     DTRITTLATTVAWHDGERAVYALEGNIPHTGDGVAWMLQATGLNRLPEAELAGALQTL
                     PAGIDSTDGVYFVPALTGAGAPWWNDRARGVMCGLSRGSGQAHLVRAALEAIAYQIAD
                     VVAAMRQHPDFHLDRLMVDGGPTRNAWLMQFQADLLGCPVARSTTTELSALGAGLLAR
                     RVLGSLDDEQLARLLPTHDSWLPDDARHQRYQANWQGWQAAVRRTLWQADLNG"
     gene            488635..489432
                     /locus_tag="DDA3937_RS02200"
                     /old_locus_tag="Dda3937_01341"
                     /db_xref="GeneID:9731853"
     CDS             488635..489432
                     /locus_tag="DDA3937_RS02200"
                     /old_locus_tag="Dda3937_01341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_033111559.1"
                     /db_xref="GI:696580380"
                     /db_xref="GeneID:9731853"
                     /translation="MQRDFYDKTVVITGACRGIGAGIAERFARDGANLVMVSNSERVM
                     STAQEIQHRYGADVLPLVADVTEEAQVQDVYQQAAARFGPIDVSVQNAGVITIDYFDR
                     MPKADFERVLAVNTTGVWLCCREAAKYMVKQQRGCLINTSSGQGRQGFIYTPHYAASK
                     MGVIGITQSLAQELAPWNITVNAFCPGIIDSEMWDYNDRVWGEILSTDDKRYGKGELM
                     AEWVQGIPLKRAGKPEDVAGLVAFLASDDARYITGQTINVDGGLIMS"
     gene            complement(489535..490194)
                     /locus_tag="DDA3937_RS02205"
                     /old_locus_tag="Dda3937_01342"
                     /db_xref="GeneID:9731854"
     CDS             complement(489535..490194)
                     /locus_tag="DDA3937_RS02205"
                     /old_locus_tag="Dda3937_01342"
                     /function="5.6.3 cell processes; protection; cell killing"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-1Aa cytolytic delta-endotoxin"
                     /protein_id="WP_013316149.1"
                     /db_xref="GI:503081266"
                     /db_xref="GeneID:9731854"
                     /translation="MYITDDLHPTIYNSPIVLNVTPAPAMLRGYALQAEQDQSLHFKT
                     LFSVDAKYIPQSFAISRVFQNALTSSLSFDTPKAINVANAAGLTIEQVINSHIASDSP
                     EKTIAQVSDHIDSVIGGSLSASLKNQIIDTIKTGFLNLHRNSESAWIFWSKESGSSTS
                     YSYNLLFAIQQNQKLIAIPLGMLVNVDVSEEKVLFITISSHAYYAVNLDGLKVSQPLS
                     G"
     gene            complement(490266..490877)
                     /locus_tag="DDA3937_RS02210"
                     /old_locus_tag="Dda3937_01343"
                     /db_xref="GeneID:9731855"
     CDS             complement(490266..490877)
                     /locus_tag="DDA3937_RS02210"
                     /old_locus_tag="Dda3937_01343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-1Ba cytolytic delta-endotoxin"
                     /protein_id="WP_013316150.1"
                     /db_xref="GI:503081267"
                     /db_xref="GeneID:9731855"
                     /translation="MSIEIYPDDGNTLPYQVFLNLENEHYYAQAIQLAQLFAHEVDDN
                     GQLDLAKALKKAQAQPDLAIIATNNMTLKKSFSTLSALTTTLSEQLKIEGVLGISQDT
                     YIQNILSHAFCDLETQKDKPWFHINAQPDAGHSVTSYSYSLFIVSQGEETGAMMAAGP
                     LIITVTPNTAISDIFNTKDWRLTLQKEEITIGVKGFQVVTPLG"
     gene            complement(490991..491590)
                     /locus_tag="DDA3937_RS02215"
                     /old_locus_tag="Dda3937_01344"
                     /db_xref="GeneID:9731856"
     CDS             complement(490991..491590)
                     /locus_tag="DDA3937_RS02215"
                     /old_locus_tag="Dda3937_01344"
                     /function="5.6.3 cell processes; protection; cell killing"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-2Aa cytolytic delta-endotoxin"
                     /protein_id="WP_013316151.1"
                     /db_xref="GI:503081268"
                     /db_xref="GeneID:9731856"
                     /translation="MNNIALNPTNTADESKNFSVTLNVDLKNVDQAMNMASIFNEACL
                     PQEGINFEKALSLAKSHDTLAVVGTHTVKGNSNVSQVWVAIDQLQNLIRMVQGAATEN
                     WMAFGIAAKAFIDLNAQKNGNYFTIFSEQSNTLHYQYNMFDVTQNETTGSVMVGQLTS
                     VEITITKASANVLALVAGSSITQKMNFKSMVIVEALTAE"
     gene            complement(491661..492296)
                     /locus_tag="DDA3937_RS02220"
                     /old_locus_tag="Dda3937_01345"
                     /db_xref="GeneID:9731857"
     CDS             complement(491661..492296)
                     /locus_tag="DDA3937_RS02220"
                     /old_locus_tag="Dda3937_01345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Delta-endotoxin CytB"
                     /protein_id="WP_022631961.1"
                     /db_xref="GI:550645806"
                     /db_xref="GeneID:9731857"
                     /translation="MKFDNIVVLNSNEILAKDSNLDLNFNTLFQMPTKYVGQAIAMSR
                     VFQDAINGDDLEFNFDKAIGLVKQHPEMAIIGTINQSIVKQNNQVSAMVDDVMKLLDT
                     VVGVVLDKESPTYKKFANTIEQGFTNLDAQKESKWIFWNKESESKTTYTYNILFAIAN
                     QDTGSVMAAAPIGLTITVDVDKQQVLWITTKDKHNYSVNVKSITVVEALKS"
     gene            492891..494423
                     /locus_tag="DDA3937_RS02225"
                     /old_locus_tag="Dda3937_01346"
                     /db_xref="GeneID:9731858"
     CDS             492891..494423
                     /locus_tag="DDA3937_RS02225"
                     /old_locus_tag="Dda3937_01346"
                     /function="4.3.A.1.p transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, periplasmic binding component"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013316153.1"
                     /db_xref="GI:503081270"
                     /db_xref="GeneID:9731858"
                     /translation="MTHQLARQIYQYLLMALLLGGTTYSYAGKQNDTLVYASDSEVEN
                     VSPYHNNMREGVILAHLAWDTLIYRDPKTGEYKGELATDWKWESPVVLLLHLRKGVTF
                     HNGDSFSADDVVYTFQSIAGPNTASVIPQSVDWIDHAEKVDDYTVRLHLKKPFPAALE
                     YLSGPTPIYPAKYFQQVKLEGFSKAPVGTGPYKIVKVTPGQGVSMVKNPDYFKDSPIG
                     QPKIGKLQFVVIRDPEARVAQLMTGQVDWIWRVASDQVDSLSAMPNIAVKSGETMRVG
                     FLELNTNASGPEGAPFKDLRVRQAINYAINRQAMVDNLVRGGSKPVYSACFRTQTACD
                     ASQVIQYPYDPAKAKQLLAEAGYANGFDTDLWAYRERDYAEAIIGDLRKVGIRARLHF
                     VQYPVMASALASGQAPLAFSTWGSFSINDATAFVTPYFGGKGSDIWKDPQVIAELAKA
                     DEVVEPQQRAALYAALLGRISAQAYMAPLFSYSTHYAFTSDLNFQDWPDELPRFAEAS
                     WK"
     gene            494470..495387
                     /locus_tag="DDA3937_RS02230"
                     /old_locus_tag="Dda3937_01347"
                     /db_xref="GeneID:9731859"
     CDS             494470..495387
                     /locus_tag="DDA3937_RS02230"
                     /old_locus_tag="Dda3937_01347"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013316154.1"
                     /db_xref="GI:503081271"
                     /db_xref="GeneID:9731859"
                     /translation="MVKYVFHRLLVALAVLFTVAAVSFSLLHLSGDLATAIAGPDATA
                     ETIAQIRVQNGLDKPLLTQFSSWMWSALQLDFGRSFYFENTVMELVGQRMPVTLKLGG
                     VSLLLALVLAIPLGVLAAVFRDTWVDRLAMLVSVIGQAMPNFWFALVLILIFAVGLKW
                     LPVAGNASWQNFVLPAVALGYYAMPSLMRLTRSGMLDVLGSDYIRTARAKGLSAFKVV
                     VKHGLRNAIIPVVALATVELGFMLGGSVVIESVFSLQGLGQLAWDSISRNDFPVVQAI
                     VLIIAVFYIGLTFLADVLNAALDPRLRSK"
     gene            495427..496323
                     /locus_tag="DDA3937_RS02235"
                     /old_locus_tag="Dda3937_01348"
                     /db_xref="GeneID:9731860"
     CDS             495427..496323
                     /locus_tag="DDA3937_RS02235"
                     /old_locus_tag="Dda3937_01348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_042318722.1"
                     /db_xref="GI:754962800"
                     /db_xref="GeneID:9731860"
                     /translation="MMKPAPQPGLLPEPGPWRRWRRKVLGHHGMTLGLVILGTIILLA
                     VLAPFISPHDPYAQEVSRRLIPPVWHDKGSWEHLLGTDKLGRDYFSRLLFGARVSLTI
                     GLVSVMLAGTIGISLGVLAGYFGGRVDAAVSYLLTVRLSMPVILVALALASLVGGSVK
                     VVIMLLGLLLWDRFLIVSRTVTRQLREAEFIAAAQTLGASSLFIMLREILPNLLGPLT
                     VVATLEIAHAVLLEATLSFLGLGVQPPMPSWGLMVAEGKAYMFFQPWVIVIPGVVLAL
                     MVLSINLVGDGLRDVTALDGRN"
     gene            496350..497399
                     /locus_tag="DDA3937_RS02240"
                     /old_locus_tag="Dda3937_01349"
                     /db_xref="GeneID:9731861"
     CDS             496350..497399
                     /locus_tag="DDA3937_RS02240"
                     /old_locus_tag="Dda3937_01349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_033111561.1"
                     /db_xref="GI:696580382"
                     /db_xref="GeneID:9731861"
                     /translation="MHTTIETTVRANPSAGGPSEGQAEIVLEVKNLRVDLATPRGTLH
                     AVRGIDFSVRRGEMLCLVGESGCGKSMTSLALMDLLPRNAVRRADTLRFRDTDLLSLR
                     PRERTALRGSQMAMIFQEPMTSLNPSFTLGDQLCETLLAHRKVSKAEARERAVYLMDR
                     VGIPMAAERLRQYPHQLSGGLRQRIMIAMALMCGPELIIADEPTTALDVTIQAQILRM
                     LRELQQEFGTAVIFITHDLGVVARIADRVAVMYAGQVVETAPVMELFHQPCHPYTRGL
                     LECIPVAGRTVPGEPLHAIPGVVPSLIGPQHGCAFRNRCSQCRDRCAQDTPYVSVTDQ
                     HAVRCVEALMAEEPV"
     gene            497396..498259
                     /locus_tag="DDA3937_RS02245"
                     /old_locus_tag="Dda3937_01350"
                     /db_xref="GeneID:9731862"
     CDS             497396..498259
                     /locus_tag="DDA3937_RS02245"
                     /old_locus_tag="Dda3937_01350"
                     /function="4.3.A.1.a transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily ATP binding cytoplasmic component"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013316157.1"
                     /db_xref="GI:503081274"
                     /db_xref="GeneID:9731862"
                     /translation="MSQMTEERGRPLPHIPGNDDIALELCALSRVFRLNRGLFSRPGE
                     IRAVDNVSLRIRRGETLGLVGESGCGKSTLAKMLLGLLPPTSGNVLIEGREIDAGDRR
                     ELASRIQPIFQDPYSSLNPRRTVADIVEVALRLHNIGTPTQRKQRVREMLDVVGMPER
                     THGQYPGQLSGGQRQRVAIARALILQPEILICDEPTSALDVSVQAQILNLLLTLKKEF
                     GLTYLFISHNLSVVEYLVDHVAVMRKGTIVEQGTREQVFGAPQHPYTRALLASVLTPE
                     PGLGIPDIGVA"
     gene            498300..499718
                     /locus_tag="DDA3937_RS02250"
                     /old_locus_tag="Dda3937_01351"
                     /db_xref="GeneID:9731863"
     CDS             498300..499718
                     /locus_tag="DDA3937_RS02250"
                     /old_locus_tag="Dda3937_01351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111562.1"
                     /db_xref="GI:696580383"
                     /db_xref="GeneID:9731863"
                     /translation="MTREEMMQAAATYFESGAFRDALARRVACQTESQNADRAPALMG
                     YLTDEMIPQLNQMGFECQVVPNPVAERGPFLLARRIEPDAALTVLTYGHGDVVMGDAS
                     RWRSGLSPWTLTPDGNRWYGRGTADNKGQHTINLAALALVLNARGGRLGYNVKLILEM
                     GEECGSPGLEAVCQQYRDWLAADLFIASDGPRVSADRPTLFLGSRGVFNFGLQLTLRD
                     GAHHSGNWGGLLSNPGIRLAHAIGCLVDANGRILVSELLPPPLSASIRRALSDLELGG
                     APGDPAIDPHWGEPGLNAAEKVYGWNTLDVLAFVTGNPDKPEHAIPSSARAQCHMRYV
                     PGSDVENFAEHIRRRLDACGFEDVAIVKPDNCFEATRIDPDDPWVRWGVDSIERSVGK
                     PAAVLPNFGGGLPNACFLRTLGLPTLWVPHSYPACCQHAPNEHLLADVAREALQIMSG
                     LFWDLAEEGYGVKKLREQHVIV"
     gene            500096..501028
                     /locus_tag="DDA3937_RS02255"
                     /old_locus_tag="Dda3937_04305"
                     /db_xref="GeneID:9731864"
     CDS             500096..501028
                     /locus_tag="DDA3937_RS02255"
                     /old_locus_tag="Dda3937_04305"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013316159.1"
                     /db_xref="GI:503081276"
                     /db_xref="GeneID:9731864"
                     /translation="MHNSEIRYFMAVVNAGSISAASQQLFVAVSAISRQIQRLETRLG
                     MPLFERSTRGMVLNDAGHILANHVRRSMADMELAMAEIEGMKSARQTTLRVVCTDGLA
                     FNLLPALLARFREQHPRVNFYLTVGSARQVPELLRNGECDVALKFSLAPEHGVAVLAS
                     FPAPALVFMAQDHPLANRDFQLADLNAWPVVLPDQSATIRQLFDLSCRMNNVFIEPVF
                     TCNHFSALYEYVRTTPGAVSVCSHFSILCSARRDGLTMKAVNLDQLSQRTLQLQTEMG
                     KPRTAILESFFAFLKQALQQYDQQCRQDFGLLLR"
     gene            501271..502287
                     /locus_tag="DDA3937_RS02260"
                     /old_locus_tag="Dda3937_02864"
                     /db_xref="GeneID:9731865"
     CDS             501271..502287
                     /locus_tag="DDA3937_RS02260"
                     /old_locus_tag="Dda3937_02864"
                     /function="1.1.4 metabolism; carbon utilization; amines"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9ZHW3.1"
                     /note="catalyzes conversion of
                     1-aminocyclopropane-1-carboxylate to ammonia and
                     alpha-ketobutyrate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-aminocyclopropane-1-carboxylate deaminase"
                     /protein_id="WP_013316160.1"
                     /db_xref="GI:503081277"
                     /db_xref="GeneID:9731865"
                     /translation="MNLEKFPRYPLTFGPSPITPMKRLSEYLGGDVEIYAKREDCNSG
                     LAFGGNKTRKLEYLIPEALAQGCDTLVSIGGVQSNQTRQVAAVAAHLGMKCILVQENW
                     VNYADAVYDRVGNIELSRIMGADVRLDPAGFDIGIRASWQQAMEEAAQNGGKPFPIPA
                     GCSEHPYGGLGFVGFAEEVRQQEKELGFKFDYIVVCSVTGSTQAGMVVGFAADGRARN
                     VIGIDASAKPEKTKAQILRIAQNTAGLVELGRDITEEDVVLDTRYGGPEYGLPNDGTL
                     EAIRLCARLEGVLTDPVYEGKSMHGMIDMVRNGEFPKGSKVLYAHLGGAPALSAYSYI
                     FRNG"
     gene            502871..503962
                     /locus_tag="DDA3937_RS02265"
                     /old_locus_tag="Dda3937_02865"
                     /db_xref="GeneID:9731866"
     CDS             502871..503962
                     /locus_tag="DDA3937_RS02265"
                     /old_locus_tag="Dda3937_02865"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein SMC"
                     /protein_id="WP_013316161.1"
                     /db_xref="GI:503081278"
                     /db_xref="GeneID:9731866"
                     /translation="MKHVTNPDQLSKLLIEGYKSIERCELHMGSLNVLIGANGAGKSN
                     FISFFRLIATLLDQRLQSLVSKAGGPDAMLHFGRKKTPHLKGELYFGNNGYKFELEPT
                     NDNRMMFSREALWWNMGGDKGVVAGHFESRAEEHNTGIKKYTLPIMRRWRVYHFHDTS
                     ESARVKQIHRINDNDYLREDGANLAAFLYRLQKNHAAHYKRIVKSIQMVAPFFGDFYL
                     RPTSDNPDTIQLEWTEKEQDVPFKANELSDGSLRFILLATVLLQPEEYKPSAIIVDEP
                     ELGLHPYAIAVLAGLIKSASHEHQLIISTQSVELVNEFDAEDLIVVDKKGGASTFKRL
                     ESGSLEEWLSDYSLGELWTKNLLGGRPQR"
     gene            503959..504612
                     /locus_tag="DDA3937_RS02270"
                     /old_locus_tag="Dda3937_02866"
                     /db_xref="GeneID:9731867"
     CDS             503959..504612
                     /locus_tag="DDA3937_RS02270"
                     /old_locus_tag="Dda3937_02866"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111563.1"
                     /db_xref="GI:696580384"
                     /db_xref="GeneID:9731867"
                     /translation="MIRVNIFVEGQTEETFVRDVLAPAFAYQQIYFTPILAQTSRGYK
                     GGIVSYGKVKHQIERLCKQDPQAWVTTMIDYYGLPTDFPGLDENPAQHADIYVRIARL
                     EQAFKQDINLPNFLANFIVHEYEALLFCQPEKFIDWIDDETPVKKLLAMKAEFPTPEQ
                     INNSPQTAPSKRILATIPTYKKTLHGPLIAADIGLDSMRQQCPHFHSWLQRIEALAD"
     gene            complement(504657..505160)
                     /locus_tag="DDA3937_RS02275"
                     /old_locus_tag="Dda3937_02867"
                     /db_xref="GeneID:9731868"
     CDS             complement(504657..505160)
                     /locus_tag="DDA3937_RS02275"
                     /old_locus_tag="Dda3937_02867"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015847942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_033111564.1"
                     /db_xref="GI:696580385"
                     /db_xref="GeneID:9731868"
                     /translation="MKTKTTAADGPDDKNANLDRFDLAILRYLQSDASISNVALAEKV
                     KLSAPACLRRVERLKQVGLIKGYVALLNPQALNVGMVVLIGVVLDRSTPKSFEDFEAA
                     VQKISGCMECHVVTGEFDYILMIRTKDNQSFNKLHAEQLLFLPGVRQIRSFIGLREVL
                     STTQLVF"
     gene            complement(505344..505874)
                     /locus_tag="DDA3937_RS02280"
                     /old_locus_tag="Dda3937_02868"
                     /db_xref="GeneID:9731869"
     CDS             complement(505344..505874)
                     /locus_tag="DDA3937_RS02280"
                     /old_locus_tag="Dda3937_02868"
                     /EC_number="5.4.99.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883203.1"
                     /note="catalyzes the interconversion of chorismate to
                     prephenate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate mutase"
                     /protein_id="WP_033112197.1"
                     /db_xref="GI:696581018"
                     /db_xref="GeneID:9731869"
                     /translation="MLRTMCLVACLISTNALAAESAYLASLVNQRLGYMKDVAGYKAA
                     HHLAIEDLQQEDNVLKASRQQATQYGLDADSVTPFIQAQMDAAKAIQYRYRADWLAVP
                     EKDWQPRSLDEVRAQIAKLNGVLLQQLADTLHKQGGSLSHLNHAAFMHAVTQKNLSEH
                     DKARLFTTLKQAKLQN"
     gene            complement(506258..507490)
                     /locus_tag="DDA3937_RS02285"
                     /old_locus_tag="Dda3937_02869"
                     /db_xref="GeneID:9731870"
     CDS             complement(506258..507490)
                     /locus_tag="DDA3937_RS02285"
                     /old_locus_tag="Dda3937_02869"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_033111565.1"
                     /db_xref="GI:696580386"
                     /db_xref="GeneID:9731870"
                     /translation="MSPVLLFFLALVFIADGLMVFLIPVLVYAETQSLTYSGLAYALW
                     WLPRIVLIPALGALIDRWGVRPVSIASDAVKAFGCLLLCLVLNFAEQPLTLALACGLL
                     GAAVSIGNAQTLTAVEKLIAAHSRHIDRDANLLTRLDLLGMVLGPLIGILLYEYGFLT
                     LLYIAATFYLCNAYYFLTSRLFSFTPDPAPENKVNPPHPAQKKLFPLLMIIRSPFIIL
                     MIVLAAGNNMFDGLVESAGAALIETQMGLSVKYFGFIDICAGAAGFLSTLVYGAALNR
                     LSREALLAAGLGLIVIASLLLTTTLDHLGPFLTFYALGIVGKVFTGNIMRTLRLTLIP
                     YERLASVSSLILMLNQSVLPLMGLFLFLSERYGWPLTGFMHIAIALSLLAGIGLLLAL
                     RRKLTDTSLSSPRPDHSG"
     gene            507907..508617
                     /locus_tag="DDA3937_RS02290"
                     /old_locus_tag="Dda3937_02870"
                     /db_xref="GeneID:9731871"
     CDS             507907..508617
                     /locus_tag="DDA3937_RS02290"
                     /old_locus_tag="Dda3937_02870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent phosphohydrolase"
                     /protein_id="WP_033111566.1"
                     /db_xref="GI:696580387"
                     /db_xref="GeneID:9731871"
                     /translation="MDLLGFEQALSQYVARYLADSVDSAHDHHHLVRVANSARHIQRT
                     EGGDLRVIIAAAWLHDIVLIPKNHPDRSRASRMAAEEAVRILSLDFPDFPYALYPALF
                     HAVEAHSFSAGITAQTLEAKIVQDADRLDSLGALGLARVFYVAGMMGRPLFDPQDLFA
                     CERELDDRLYTLDHFRVKLMRLPETMNTAEGKRIAEANASWLVDFLAKLAGEVNGDPT
                     LLDPQVRARFSDWHPWLA"
     gene            508743..509549
                     /locus_tag="DDA3937_RS02295"
                     /old_locus_tag="Dda3937_02871"
                     /db_xref="GeneID:9731872"
     CDS             508743..509549
                     /locus_tag="DDA3937_RS02295"
                     /old_locus_tag="Dda3937_02871"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013316167.1"
                     /db_xref="GI:503081284"
                     /db_xref="GeneID:9731872"
                     /translation="MRTASHGHDKPAGNQSLLRGFLLLEILSNYPNGCPLAHLAGLAR
                     LNKSTVHRLLQGLQACGYVTPAPAAGSYRLTTRFITVGLTSLAPPEVIRLIAPPLQAL
                     NAATGETVNFSRRDGDYCILIHKLEPTTGMLRTRAYLGQQMTLFSSAMGKLFLADDTK
                     DALFSYWGRHQPHIRKLTPYTITDPGHMARELEDVRQRGVAFDREEHEVGVSCMAAPV
                     FDAHQRVNYAISLSLSSAKLRQIDEETLLTPLRQTADALTQALKTLPDDM"
     gene            complement(509628..511217)
                     /locus_tag="DDA3937_RS02300"
                     /old_locus_tag="Dda3937_02872"
                     /db_xref="GeneID:9731873"
     CDS             complement(509628..511217)
                     /locus_tag="DDA3937_RS02300"
                     /old_locus_tag="Dda3937_02872"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_033111567.1"
                     /db_xref="GI:696580388"
                     /db_xref="GeneID:9731873"
                     /translation="MKKFSQLTVFSKLLFGFSVLIVMMLLIGAVSIYQLSANNGRIDA
                     YRDSRLPGVRYTLEMRGVLSELRLQQIQYISSKTPDEREGHRKELLQNQDVFLNAQAN
                     YAKLVKSDAQDKQALFSQVTDNFKNFVDVNAKVIDAVNSEKLDDASKISGAVSAKYRT
                     QLMKDLAKLVEMEIASGDQAAVESAEGYRTALYILSGLLLLAVIATGIIATLIARNLS
                     RQLGGEPAYAASIMNQIAAGNLNTSIMLRAGDTQSMLATMKNMNEKLADIIHNIVNGS
                     ESISLAASEIAQGNSDLSQRTEEQAASLVQTSSNMQQITETVKRNADNAHQASELARQ
                     TSQTAVHGGNVVDDMLKRMHEISDSSQKIVDIISVIEGIAFQTNILALNAAVEAARAG
                     EQGKGFAVVAGEVRNLAQKSANAAKEIKTLIEGTVEKITDGSRHADTASQAMDEIVSS
                     VTKVTDIVAEISMASNEQHQGIKEIGVAIDQMDRVTQQNAALVEQAATAAQSMTEQGE
                     QLRDSVRFFRLEAQQSTLRLG"
     gene            complement(511778..512092)
                     /locus_tag="DDA3937_RS02305"
                     /old_locus_tag="Dda3937_02873"
                     /db_xref="GeneID:9731874"
     CDS             complement(511778..512092)
                     /locus_tag="DDA3937_RS02305"
                     /old_locus_tag="Dda3937_02873"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-rhamnose mutarotase"
                     /protein_id="WP_013316169.1"
                     /db_xref="GI:503081286"
                     /db_xref="GeneID:9731874"
                     /translation="MLKKAFVMQVFPDCHEEYQRRHSPIWPELEAELKAHGAHHYSIF
                     LDPARNLLFAYVEIESEERWNAIAQTDACQRWWKYMKEVMPANPDNSPVSAELSPVFY
                     LA"
     gene            complement(512361..513197)
                     /locus_tag="DDA3937_RS02310"
                     /old_locus_tag="Dda3937_02874"
                     /db_xref="GeneID:9731875"
     CDS             complement(512361..513197)
                     /locus_tag="DDA3937_RS02310"
                     /old_locus_tag="Dda3937_02874"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnulose-1-phosphate aldolase"
                     /protein_id="WP_013316170.1"
                     /db_xref="GI:503081287"
                     /db_xref="GeneID:9731875"
                     /translation="MQSLLTSWFVQGMVKATGDMWLKGWDERNGGNISLRLTEDDVTP
                     FESDFYPQPRREALSQPMPELAGCWFIVTGSGKFFRNVQLDTADNLVLLQVDDDGRGY
                     RIFWGLSHGGLPTSELAAHFQSHIVRMNVSGGRDRVIMHCHATNLIALSYVLELNSAA
                     FTRELWEGSTECLVVFPDGVGIVPWMVPGTDAIGSATAEQMQHHSLVLWPFHGIFGTG
                     PSLDDAFGLIDTAEKSAEVMVKVRAMGGKKQTISTEELIALGQRFGVTPMESALRYVS
                     GK"
     gene            complement(513221..514477)
                     /locus_tag="DDA3937_RS02315"
                     /old_locus_tag="Dda3937_02875"
                     /db_xref="GeneID:9731876"
     CDS             complement(513221..514477)
                     /locus_tag="DDA3937_RS02315"
                     /old_locus_tag="Dda3937_02875"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843696.1"
                     /note="catalyzes the formation of L-rhamnulose from
                     L-rhamnose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnose isomerase"
                     /protein_id="WP_013316171.1"
                     /db_xref="GI:503081288"
                     /db_xref="GeneID:9731876"
                     /translation="MNTAIETAWLLARERYARLNIDVDAALRQLDQIPVSIHCWQGDD
                     VAGFEQDSGALTGGIQATGNYPGKARNATELRADLEQAFRQIPGPKRLNLHAIYLESD
                     TPVARNAIEPHHFSRWVAWAKEHRLGLDFNPTCFSHPLSSDGFTLSHPDENVRRFWIE
                     HCQASRRISAYFGRELGTASVMNIWIPDGMKDLTVDRLAFRQRLLASLDDVIAEKLDP
                     AHHIDAVESKLFGLGAESFTVGSSEFYLGYATSRQTALCLDAGHFHPTEVISDKISSA
                     SLFVPRLLLHVSRPVRWDSDHVVLLDDETQAIAHEVVRHRLFDRVHIGLDFFDASINR
                     IAAWIIGTRNMKKALLRALLEPTDTLRTLEQNGDYTARLALLEEQKSLPWQAVWEHYC
                     QQHDVTPGSDWLQSVRHYENTVLCQR"
     gene            complement(514474..515946)
                     /locus_tag="DDA3937_RS02320"
                     /old_locus_tag="Dda3937_02876"
                     /db_xref="GeneID:9731877"
     CDS             complement(514474..515946)
                     /locus_tag="DDA3937_RS02320"
                     /old_locus_tag="Dda3937_02876"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnulokinase"
                     /protein_id="WP_013316172.1"
                     /db_xref="GI:503081289"
                     /db_xref="GeneID:9731877"
                     /translation="MAVKHYVAVDLGASSGRVMLASLASGTQRLTLEEIHRFSNPLRL
                     WQGHHLWDLDELERQIRHGLEAVDARGVHPVSIGIDSWGVDMVPLDRQGNRLGLSYSY
                     RDHRTDGQMAQVIAELGRERLYRQTGIQFLPFNTLYQLRALRQQDPDVWGQVAHLLMI
                     PDYFHYRLTGRMACEYTNASTTQLLNLDSGDWDRGLLDYLGVPPNWLAAPCQPGHRVG
                     EWIAPSGRAVPVVTVATHDTASAVVATPLTDADSAYLSSGTWSLIGMESREPLTGPAA
                     LAANITNEGGVGGRYRVLKNIMGLWLLQRVCQEQQVADLPALLDAAAAQPGFVSLINP
                     NDERLINPPSMSDALRECCREHGQPAPVTTAALARCILDSLALSYRQGLLTLGELRGA
                     PLRHLHVVGGGSRNGLLNQLCADICQVPVLAGPAEASTLGNIGCQLIAQGEVANLDAF
                     RRLLADNIPLQPFIPRQDCDFAGHWRRFQALCQVNEELTV"
     gene            516326..517162
                     /locus_tag="DDA3937_RS02325"
                     /old_locus_tag="Dda3937_02877"
                     /db_xref="GeneID:9731878"
     CDS             516326..517162
                     /locus_tag="DDA3937_RS02325"
                     /old_locus_tag="Dda3937_02877"
                     /function="RhaS controls the expression of genes involved
                     in rhamnose catabolism"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013316173.1"
                     /db_xref="GI:503081290"
                     /db_xref="GeneID:9731878"
                     /translation="MTQLHGDEFFASQAATVAVEPRMPQCAFPEHYHDFWEIVLVEQG
                     AGVHVFNDQPFALCSGAVFFVRDNDRHLFEQVEELHLTNVLYRSPRGFRFLSDIAPFL
                     PYGANGEWLGQWQVNVAAQQQVKQLILQLAALARRDQPEDIAASESLFLQILVLLRQK
                     RFQTQGDGSERQGIQALLGWLQHNFCEEVDWDTLADRFSLSLRTLHRQLKQHTGMTPQ
                     RYLNRLRLLEARRRLQHSDDSITTIAHDCGFSDSNHFSTQFRKAFALAPKTLRHQAQY
                     ED"
     gene            517200..518054
                     /locus_tag="DDA3937_RS02330"
                     /old_locus_tag="Dda3937_02878"
                     /db_xref="GeneID:9731879"
     CDS             517200..518054
                     /locus_tag="DDA3937_RS02330"
                     /old_locus_tag="Dda3937_02878"
                     /function="RhaR controls the expression of genes involved
                     in rhamnose catabolism"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316174.1"
                     /note="activates the expression of rhaRS in response to
                     L-rhamnose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013316174.1"
                     /db_xref="GI:503081291"
                     /db_xref="GeneID:9731879"
                     /translation="MPSRGLKLRTEDYFLTDKNTVTVAERSPQPAFPLHHHDFDELVI
                     VWRGNGLHLWNDVPYRITCGDLFYVSARDRHSYESVHDLELDNILYIRDRLTLPTDWQ
                     NLLPGGEVPQQQRYWRLATHSMDSLRDKVENLTQECMKSDPLSLQLSEVLLLQIALLA
                     LRYRYAPGSTQLADAQQLDLLMNALRASIARPFRLEDFCRLHDISMRSLRARFKQQTG
                     MSVAQYLRQLRLCRAMELLRHNRQTISEVAAECGFDDSNYFSVVFHQAFGVTPSGYRQ
                     RFQTSGKV"
     gene            complement(518072..518434)
                     /locus_tag="DDA3937_RS02335"
                     /old_locus_tag="Dda3937_04306"
                     /db_xref="GeneID:9731880"
     CDS             complement(518072..518434)
                     /locus_tag="DDA3937_RS02335"
                     /old_locus_tag="Dda3937_04306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316175.1"
                     /db_xref="GI:503081292"
                     /db_xref="GeneID:9731880"
                     /translation="MLRLIRTHDSVINTTLFNDIVKMTIESKRIIRHFLSIFLFIALF
                     LLAIRYVHTYPVPLTRKQTDLFVALSEKAGWKDPELFYITVMSIIDLIVATLVYVAII
                     KLWRYYRTSRSARQASSK"
     gene            complement(518418..518687)
                     /locus_tag="DDA3937_RS02340"
                     /old_locus_tag="Dda3937_04307"
                     /db_xref="GeneID:9731881"
     CDS             complement(518418..518687)
                     /locus_tag="DDA3937_RS02340"
                     /old_locus_tag="Dda3937_04307"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013316176.1"
                     /db_xref="GI:503081293"
                     /db_xref="GeneID:9731881"
                     /translation="MATLARRIFKTLLFTTLFFLSVRYVHTYPIPMPKEQVTLLFKLS
                     AALGIRDPDDLYISSMLIIELITTIAVYILIMKMWRRYNRNAKVD"
     gene            complement(518965..519222)
                     /locus_tag="DDA3937_RS02345"
                     /old_locus_tag="Dda3937_04455"
                     /db_xref="GeneID:9731882"
     CDS             complement(518965..519222)
                     /locus_tag="DDA3937_RS02345"
                     /old_locus_tag="Dda3937_04455"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316177.1"
                     /db_xref="GI:503081294"
                     /db_xref="GeneID:9731882"
                     /translation="MKVRDFEDKVWETEGIRIVIHAKDDKDVKDYEYKKAADASWRIT
                     ELGQKRIDKCLDGNTFSVIQGDGEEPNGRVILRTIRSSYNK"
     gene            complement(519588..521288)
                     /locus_tag="DDA3937_RS02350"
                     /old_locus_tag="Dda3937_03674"
                     /db_xref="GeneID:9731883"
     CDS             complement(519588..521288)
                     /locus_tag="DDA3937_RS02350"
                     /old_locus_tag="Dda3937_03674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_033111568.1"
                     /db_xref="GI:696580389"
                     /db_xref="GeneID:9731883"
                     /translation="MSQSALQPLLRVDGLNVTFPSPHGPVESVRDLSFQVNPGEILAL
                     VGESGSGKSVTARTLVGLAGERAQIQANAIELVRHDGSRCDLQTLSDRQWQQVRGREI
                     GFVLQDALVSLDPLRRIGQEVAEPLLTHKLASRNDVATRVAELLAQVGIPDPANRAAQ
                     YPHELSGGLRQRALIASALAAGPKLLIADEPTTALDATVQQQVLKLFTALAQAGHGVL
                     LITHDLAVVSQVADRVMVMQKGALVERGPARQVLSAPQHPYTRRLLAAIPTAATRSNW
                     LAGENPLSPQASTLLSSVGESGEKSGLALQVDGVSVSFKRPDGSRMTAVNNISLTVER
                     GETLGIVGESGSGKTTLGKVMLALQPPDSGDIRLSGQPWSSLTERERRPLRASIQTIT
                     QDPLSSFDPQFTIEQILLQPLRLRRDLSPQARQQRILALLELVGLSPTLLSRRPQSLS
                     GGQRQRISIAQALAAEPEVLICDEPVSALDVTTQAQVLDLLVALQQRLQLTMVFISHD
                     LGVVQHMSHRIAVMKDGNVVERGTVEQIFNQPQHPYTRQLLSTVAPVVINRQNNDIYA
                     "
     gene            complement(521285..522124)
                     /locus_tag="DDA3937_RS02355"
                     /old_locus_tag="Dda3937_03673"
                     /db_xref="GeneID:9731884"
     CDS             complement(521285..522124)
                     /locus_tag="DDA3937_RS02355"
                     /old_locus_tag="Dda3937_03673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_033111569.1"
                     /db_xref="GI:696580390"
                     /db_xref="GeneID:9731884"
                     /translation="MPTPYRTAYRSPWLAPATLLPAAAVLLLLLAVFFPALFTHRLPD
                     EMDMGAVLQPPGADHWFGTDTLGRDVFTRVVYGTSLSLSIGVGAMLIACLGGVLLGTL
                     SALAPLPVRRVLVRLLDIMLAFPEMLLALLVIAVLGRGPENTLLAVGLAGVAGYARLV
                     RSQVLQVKLSGYVEHAVALGEPPLYIVVRHIIPNTLRPLLILATIGVGNAVLSASALS
                     FLGLGVVPPTAEWGALLADGRNFLDIAPWVSLFPASVVALSVIVITLLGRRLQAILAR
                     GTA"
     gene            complement(522201..523166)
                     /locus_tag="DDA3937_RS02360"
                     /old_locus_tag="Dda3937_03672"
                     /db_xref="GeneID:9731885"
     CDS             complement(522201..523166)
                     /locus_tag="DDA3937_RS02360"
                     /old_locus_tag="Dda3937_03672"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013316180.1"
                     /db_xref="GI:503081297"
                     /db_xref="GeneID:9731885"
                     /translation="MMSGLNRNLAVTALQRLFTIVAVLWGAATLTFIAVKLIPGDPVA
                     ILSGGDNVVDGAYRAALIKQFGLDQPLWMQYLRYCGQALQGDFGVSYQYRQPVAALIG
                     DAMRETVQLALSALALALLLSILNALLTAGRHARLRALMSWLELTLLSTPVYWVGIVL
                     LSVFSFRLQWFPVMGNDGLISLVLPVITLSLPLAALLSQVLRDGLEEALSQPFALTVR
                     TRGVSETWLRVRHGLRHGALAASTLTGTLLAGVLSGSVLTETVFGRAGIGQITLHAIE
                     SRDMPLVLGLVMLSALLFVVINLLVDALYLIIDPRLRKKANAHEQ"
     gene            complement(523144..524772)
                     /locus_tag="DDA3937_RS02365"
                     /old_locus_tag="Dda3937_03671"
                     /db_xref="GeneID:9731886"
     CDS             complement(523144..524772)
                     /locus_tag="DDA3937_RS02365"
                     /old_locus_tag="Dda3937_03671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_033111570.1"
                     /db_xref="GI:696580391"
                     /db_xref="GeneID:9731886"
                     /translation="MVTLSPASKASRISLLTAGLLSLAVGASPFAHAADATVTPVQGG
                     TLNIGLGSDTPVIDPSITAYSVAALVARNVVDSLVGQAEDNRFTPWLAERWEISDNNT
                     RYTFHLRKDVTFSDGTKLDAAAIKYNLERILDPKTTSSYAKSLLGPIDSIATPDDNTV
                     VISYKSPFAALLQGLSLPYLGIQSPTYLKNTPNTSNTIVGSGPFILESFVKGSGSRLK
                     KRPDYHWGPGYAAHTGPAYLDKIEFKYLPESSVRLGALSSGQVQAIDAVPPANAAALK
                     KDTRLELITRENPGVNRVLYLNTSKGPFQDVNVRRAFLHAVDAASATKVAFFGTLKAA
                     ENILGPSTLYYDKSATALGGFDLKKANQLLDEAGWKTKDGQGYRTKDGKRLTVNFVYS
                     TGSSEAAEITLFQAVQYQVKQAGIDVQLNPVDSGGFISRTNDNDYDIASNYFVRAEPD
                     ILRTVFDSNYIPPNGNNFSRTHSLDDKLRKAIGASDAERQQLYSQIQHELLDQAYAVP
                     LFVPAYQLGLSKKVQGISWATNAKPNFYDVWIKP"
     gene            complement(524963..525505)
                     /locus_tag="DDA3937_RS02370"
                     /old_locus_tag="Dda3937_03670"
                     /db_xref="GeneID:9731887"
     CDS             complement(524963..525505)
                     /locus_tag="DDA3937_RS02370"
                     /old_locus_tag="Dda3937_03670"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013316182.1"
                     /db_xref="GI:503081299"
                     /db_xref="GeneID:9731887"
                     /translation="MQARTVKEKIILAVMIGIIAGIICAIAKFGWEIPFPPRTPERDL
                     TNPPQQLLQQLGMSFDLSHITYLFNGNPRPIMSFIMHFGFSITFTVLYCVAAEFWPRI
                     KRWQGAFYGLVLWAVFHVVLLPLFGTVPAPWDQPFAEHFSEIFGHMFCFWVAELARRD
                     LRNRITHQSEDNALTAQHAH"
     gene            526432..527436
                     /locus_tag="DDA3937_RS02375"
                     /db_xref="GeneID:23677389"
     CDS             526432..527436
                     /locus_tag="DDA3937_RS02375"
                     /function="8.3.1 extrachromosomal; transposon related;
                     transposases"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013315785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013315785.1"
                     /db_xref="GI:503080901"
                     /db_xref="GeneID:23677389"
                     /translation="MQNVTLIGIDLGKHSFHVHAQDKNGNALLRKKFSRNQLTAFLST
                     CTASTVVMESCAGAHFMARHISQFGHQVKLISPQFVRPFVKSNKNDFIDAEAICEAAS
                     RPSMRFVTPRTEDQQAMSAFHRVRDTLVRERVKTTNQMHAFLLEFGISMPRGIAIIRR
                     LAVVLEEHELPPYLARLLMRLHQHYACLTEQIKELEQELKIHIAGDDTAQRLLTIPGV
                     GLITASLLATKLGDGKSYASSRDFAASTGLVPRQYSTGGKSTLMGISKRGDKNLRRLL
                     VQCARAFMQRLEHNQGRLADWVKTQLSRHHSNVVACGLANKLARIAWSVTTHRTAFIQ
                     "
     gene            527720..528298
                     /locus_tag="DDA3937_RS02380"
                     /old_locus_tag="Dda3937_02685"
                     /db_xref="GeneID:9731889"
     CDS             527720..528298
                     /locus_tag="DDA3937_RS02380"
                     /old_locus_tag="Dda3937_02685"
                     /function="0 unknown function"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316184.1"
                     /db_xref="GI:503081301"
                     /db_xref="GeneID:9731889"
                     /translation="MSDASLNALAAALAQHRDPRPTIRIYDASLKDNYAGVLKKHYHG
                     VNELIGDERYTYRVSLADGGAVAYGIDNTVSPAPGIVEEKKTPLHDRCYQVITRQISE
                     NYFYRTYGVYISPLGFYLGDSVIRERIQEKLGTRPYFAFSLLDQVNGHKVLRGIVEYT
                     DWKNGDGKQQLFEYTYFFAGERVVLRDLRAAP"
     gene            complement(528351..529562)
                     /locus_tag="DDA3937_RS02385"
                     /old_locus_tag="Dda3937_02684"
                     /db_xref="GeneID:9731890"
     CDS             complement(528351..529562)
                     /locus_tag="DDA3937_RS02385"
                     /old_locus_tag="Dda3937_02684"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
                     /protein_id="WP_013316185.1"
                     /db_xref="GI:503081302"
                     /db_xref="GeneID:9731890"
                     /translation="MQSFDVVIAGGGMVGLALACGLQGSGLSVAVLEKQTTTEPLANG
                     PHALRVSAINAASEALLRKLNVWPGIAAQRLSPYNEMYVWDKDSFGNIRFCGEEFGFS
                     RLGHIIENDVIQWALWQQASQSRDITLLAPATLRQVAWGENEAFITLEDGSMLTARLV
                     VGADGAHSWLRQHADIPLTFWDYGHHALVANIRTEQPHGAIASQVFHGDGILAFLPLS
                     DPHLCSIVWSLPPERAQYMRELPADDFVKQLAMTFDMRLGLCQLESDRQTFPLTARYA
                     RSFAAHRLVLTGDAAHTIHPLAGQGVNLGFMDVAELIAELKRLQTQGKDIGQHLYLRR
                     YERRRKHSAALMLASMQGFRTLFAASHPVGGLLRDIGLKLADTLPGIKPTLVRQAMGL
                     NDLPDWLDHAD"
     gene            complement(529585..530763)
                     /locus_tag="DDA3937_RS02390"
                     /old_locus_tag="Dda3937_02683"
                     /db_xref="GeneID:9731891"
     CDS             complement(529585..530763)
                     /locus_tag="DDA3937_RS02390"
                     /old_locus_tag="Dda3937_02683"
                     /function="1.5.3.11 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier;
                     menaquinone, ubiquinone"
                     /function="1.3.6 metabolism; energy metabolism, carbon;
                     aerobic respiration"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316186.1"
                     /note="Oxygenase that introduces the hydroxyl group at
                     carbon four of 2-octaprenyl-6-methoxyphenol resulting in
                     the formation of 2-octaprenyl-6-methoxy-1,4-benzoquinone;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
                     /protein_id="WP_013316186.1"
                     /db_xref="GI:503081303"
                     /db_xref="GeneID:9731891"
                     /translation="MTVMIVGGGMAGATLALAISRLSGGRIPVDLIEARSPQENQHPG
                     FDARAIALAQGTCMQLDAIGVWQALAPVATPIASVHVSDQGHAGRVRLQASDYRVPAL
                     GHVVELHDAGKRLFSLLQNAPGVRLHCPATEVEVNREVDGASLLLDNGALLSGQLLVA
                     ADGSRSRLAQLAGIQWQQTPYEQVAIIANVTTAVAHQGRAYERFTEHGPLALLPMSKG
                     RSSLVWCHPLSQQAEVDSWSDAQFLQQLQRAFGWRLGAITQVGERHSYPLALVTAGQH
                     ISHRLALVGNAAQTLHPIAGQGFNLGLRDVMTLAETLTAAIGQGEDLGSQAVLQRYQR
                     RRQPDQHTTVALTDGLVRVFSNHLLPMEVGRNLGLMAMNSLPLLRDVLARRTLGWVER
                     "
     gene            complement(530760..532088)
                     /locus_tag="DDA3937_RS02395"
                     /old_locus_tag="Dda3937_02682"
                     /db_xref="GeneID:9731892"
     CDS             complement(530760..532088)
                     /locus_tag="DDA3937_RS02395"
                     /old_locus_tag="Dda3937_02682"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316187.1"
                     /note="exopeptidase able to cleave the peptide bond of the
                     last amino acid if linked to a proline residue; substrate
                     can be as short as a dipeptide; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline aminopeptidase P II"
                     /protein_id="WP_013316187.1"
                     /db_xref="GI:503081304"
                     /db_xref="GeneID:9731892"
                     /translation="MNQQEYLRRRLALLDKMAPGSAAILFAAPEAQRNADSDYPYRQS
                     SDFWYFTGFNEPEAALLLIKSDENHHHSVLFNRVRDVTAEIWFGRRLGQEAAPSKLGV
                     DRALPFSEIGEQLHLLLNGLDVVYHAQGEYAYADKLVFAALETLRTGGTRKGFHAPAT
                     LTDWRPWVHDMRLFKSSAEIDILRRAGEISALAHTRAMEKCRPGMFEYQLEGEIHHEF
                     TRHGARYPSYNTIVGSGENACILHYTENECQMRDGDLVLIDAGCEYQGYAGDITRTFP
                     VNGKFTPAQRAIYDIVLESEVRAIEMFAPGRSIREVNEEVVRIMLRGLIKLGILQGDV
                     DTLFAEQAHRQFFMHGLSHWLGMDVHDVGDYGTADRGRTLEPGMVLTVEPGLYIAPDA
                     DVPPEYRGIGIRIEDDIVITESGNDVLTGDVVKDPEEIEALMARAAGQAS"
     gene            complement(532127..532711)
                     /locus_tag="DDA3937_RS02400"
                     /old_locus_tag="Dda3937_02681"
                     /db_xref="GeneID:9731893"
     CDS             complement(532127..532711)
                     /locus_tag="DDA3937_RS02400"
                     /old_locus_tag="Dda3937_02681"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843711.1"
                     /note="the crystal structure of Haemophilus influenzae
                     HI0817 showed that this protein forms dimers; function
                     unknown; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316188.1"
                     /db_xref="GI:503081305"
                     /db_xref="GeneID:9731893"
                     /translation="MSIQNTLPGYDAIDQLLRQHQVALTAAEMHGLISGMLCGGNHDD
                     SWKTLTFELTNDGMAFPQTLAQPLQHLYQATRDALEDDGFLFQLFLPDDTQEHVSVFD
                     RADALAGWVNHFLLGLGVVQPRLGKTQGELKEAIDDLRNIAQLGYDEDEDKDELEQSL
                     EEVIEYVRVAAIMCHNEFTRPVITAPEKKKPTLH"
     gene            533044..533373
                     /locus_tag="DDA3937_RS02405"
                     /old_locus_tag="Dda3937_02680"
                     /db_xref="GeneID:9731894"
     CDS             533044..533373
                     /locus_tag="DDA3937_RS02405"
                     /old_locus_tag="Dda3937_02680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Z-ring-associated protein"
                     /protein_id="WP_012883229.1"
                     /db_xref="GI:502646900"
                     /db_xref="GeneID:9731894"
                     /translation="MSAQPVDIQIFGRSLRVNCPPEQQDALNQAAEDLNQRLQDLKVR
                     TRVTNTEQLVFIAALNVCHELAQERLKTRDYAANMEQRIRMLQQTIEQALLEQGRITE
                     RQGAQFE"
     gene            533693..534307
                     /locus_tag="DDA3937_RS02410"
                     /old_locus_tag="Dda3937_02679"
                     /db_xref="GeneID:9731896"
     CDS             533693..534307
                     /locus_tag="DDA3937_RS02410"
                     /old_locus_tag="Dda3937_02679"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="WP_013316189.1"
                     /db_xref="GI:503081306"
                     /db_xref="GeneID:9731896"
                     /translation="MNPASAASDLFSITALRQQIRQQVRQRRRALSREQQAIFAGQAA
                     ERAMAHPRLGDARRVALFLSFDGELDTQPLIEALWQRQKQVYLPVLHPFCNGHLLFLR
                     YAPDSELVWNRLKIQEPRLDVRQVLPVERLDVLLTPLVAFDAAGQRLGMGGGFYDRTL
                     QHWQSRGPYPIGLAHDCQQVDALPVESWDVPLPEIITPSRHWRW"
     gene            complement(534321..535577)
                     /locus_tag="DDA3937_RS02415"
                     /old_locus_tag="Dda3937_02678"
                     /db_xref="GeneID:9731897"
     CDS             complement(534321..535577)
                     /locus_tag="DDA3937_RS02415"
                     /old_locus_tag="Dda3937_02678"
                     /function="NadR controls the expression of genes involved
                     in NAD synthesis"
                     /function="1.5.2.4 metabolism; building block
                     biosynthesis; nucleotide; pyrimidine ribonucleotide
                     biosynthesis"
                     /function="4.9.A.4 transport; Transporters of Unknown
                     Classification; recognized transporters of unknown
                     biochemical mechanism; The Nicotinamide Mononucleotide
                     (NMN) Uptake Permease (PnuC) Family"
                     /function="4.S.144 transport; substrate; nicotinamide
                     mononucleotide"
                     /function="1.5.3.7 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier;
                     nicotinamide adenine dinucleotide"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.1.4 regulation; type of regulation;
                     regulation level unknown"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316190.1"
                     /note="catalyzes the formation of NAD(+) from nicotinamide
                     ribonucleotide; catalyzes the formation of nicotinamide
                     mononucleotide from nicotinamide riboside; also has a
                     regulatory function; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013316190.1"
                     /db_xref="GI:503081307"
                     /db_xref="GeneID:9731897"
                     /translation="MSPYDYLKTAIRQKGCTLQQVADAAGMTKGYLSQLLNAKIKSPS
                     AQKLESLHRFLGLEFPYQQKSIGVVFGKFYPLHTGHIYLIQRACSQIDELHVILGYDE
                     PRDRLLFEHSSMSQQPTVSDRLRWLLQTFKYQKNIHIHAFNEQGMEPYPHGWDVWSRG
                     IKQFMSEKGIDPRYVYTSEEQDAPQYKEHLGIETVLIDPKRSFMSISGAQIRQDPFRY
                     WEYIPTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDE
                     MALQYSDYDKIALGQAQYIDFAVKYANKVAFIDTDFITTQAFCKKYEGREHPFVQALV
                     EEYRFDLVILLENNTPWVADGLRSLGSAADRQAFQDVLKSMLAENNVPYIHVTESDYD
                     SRFLRCVELVQQMLGHDRQTPMPAAS"
     gene            complement(535647..537032)
                     /locus_tag="DDA3937_RS02420"
                     /old_locus_tag="Dda3937_02677"
                     /db_xref="GeneID:9731898"
     CDS             complement(535647..537032)
                     /locus_tag="DDA3937_RS02420"
                     /old_locus_tag="Dda3937_02677"
                     /function="1.2.3 metabolism; macromolecule degradation;
                     proteins/peptides/glycopeptides"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="2.3.6 information transfer; protein related;
                     turnover, degradation"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316191.1"
                     /note="Sms; stabilizes the strand-invasion intermediate
                     during the DNA repair; involved in recombination of donor
                     DNA and plays an important role in DNA damage repair after
                     exposure to mutagenic agents; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="WP_013316191.1"
                     /db_xref="GI:503081308"
                     /db_xref="GeneID:9731898"
                     /translation="MAKAVKRAFVCNECGADYPRWQGQCSACHAWNTITEVRLAAASS
                     SSRSDRFSGYAGDGGNVSRVQKLSEISLEALPRFSTGFQEFDRVLGGGVVPGSAILIG
                     GNPGAGKSTLLLQTLCKLAEQMKTLYVTGEESLQQVAMRAHRLGLPAQHINMLSETSI
                     EQICLIAEQEQPKLMVIDSIQVMHLADIQSSPGSVAQVRETAAYLTRFAKTRGVAIIM
                     VGHVTKDGSLAGPKVLEHCIDCSVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQ
                     GLREISNPSAIFLSRGDEITSGSSVMVVWEGTRPLLVEIQALVDQSMMANPRRVAVGL
                     EQNRLAILLAVLHRHGGLQMSDQDVFVNVVGGVKVTETSADLALLLSLVSSFRDRPLP
                     QDLVVFGEVGLAGEIRPVPSGQERITEAAKHGFKRAIVPFANMPKKPPANMQVMGVKK
                     LSDALAILDDL"
     gene            complement(537113..538090)
                     /gene="serB"
                     /locus_tag="DDA3937_RS02425"
                     /old_locus_tag="Dda3937_02676"
                     /db_xref="GeneID:9731899"
     CDS             complement(537113..538090)
                     /gene="serB"
                     /locus_tag="DDA3937_RS02425"
                     /old_locus_tag="Dda3937_02676"
                     /function="1.5.1.11 metabolism; building block
                     biosynthesis; amino acids; serine"
                     /function="1.5.1.10 metabolism; building block
                     biosynthesis; amino acids; glycine"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883233.1"
                     /note="catalyzes the formation of serine from
                     O-phosphoserine; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoserine phosphatase"
                     /protein_id="WP_013316192.1"
                     /db_xref="GI:503081309"
                     /db_xref="GeneID:9731899"
                     /translation="MSNRLTYSDLPDEINCWPNLPLSLSDDEVMPLDYRAGNTGWLMY
                     GDVLDKYLLSRIQRRLDEPLVIVSAWSVDDYQVVRLAGILTPRITKVAHELGLDVTPM
                     YNTPSLRSPGLLVMDMDSTAIQIECIDEIAKLAGTGEQVAEVTERAMRGELDFSASLR
                     QRVGTLKGADANILRQVRDALPLMPGLKNMVKQLQDAGWHLAIASGGFTYFADYLRDE
                     LGLVAAVANEMGMRDGKLTGDVVGPIVDAKYKADTLRQLAEKLEIPPHQTVAIGDGAN
                     DLLMIKAAGLGIAYHAKPKVNEKSAVSIRHADLTGVLCILSGSLRHEKS"
     gene            538220..538900
                     /locus_tag="DDA3937_RS02430"
                     /old_locus_tag="Dda3937_02675"
                     /db_xref="GeneID:9731900"
     CDS             538220..538900
                     /locus_tag="DDA3937_RS02430"
                     /old_locus_tag="Dda3937_02675"
                     /function="7.3 location of gene products; inner membrane"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015847912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="smp"
                     /protein_id="WP_013316193.1"
                     /db_xref="GI:503081310"
                     /db_xref="GeneID:9731900"
                     /translation="MVRARIKFRLHRTAIVLICLALLVVLLQGASYFSLSHQMARSEQ
                     VEELARTLVRQVAFGLTPLMESNSDNSGRIEETLRQLTDHSRILDAALYQQDGTLVAR
                     AGEQIEVRDRLALDGSRAGSYFNHQLVEPVNSKDGPIGFLRITLDTHVLATEARQVDN
                     TTNILRLMVLMALAIGIILARTLLQHRRSRWQQSPYLLTANAPVQDDEPANDDEPSAQ
                     DGDQTRKP"
     gene            complement(538915..539691)
                     /locus_tag="DDA3937_RS02435"
                     /old_locus_tag="Dda3937_02674"
                     /db_xref="GeneID:9731901"
     CDS             complement(538915..539691)
                     /locus_tag="DDA3937_RS02435"
                     /old_locus_tag="Dda3937_02674"
                     /function="1.7.1 metabolism; central intermediary
                     metabolism; unassigned reversible reactions"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316194.1"
                     /note="catalyzes the formation of
                     (E)-3-(methoxycarbonyl)pent-2-enedioate and
                     S-adenosyl-L-homocysteine from S-adenosyl-L-methionine and
                     trans-aconitate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trans-aconitate 2-methyltransferase"
                     /protein_id="WP_013316194.1"
                     /db_xref="GI:503081311"
                     /db_xref="GeneID:9731901"
                     /translation="MQDWNPELYLRFAGERTRPALELLSRISHPAPLAITDLGCGPGN
                     STELLHQAWPQARVTGVDNSSAMLQQARQRLPGCTFQEADIASWRPDTPQDIIYANAS
                     LQWLADHDQLLPTLIDNLAPGGVLAVQMPDTLSQPTHQLMRKIAAEGPWWERFGEVDQ
                     IRQALLSAGQYYDLLVSHGCDVDIWHTTYYHVMGGPQAIIEWLKGTGLRPFLAELNAQ
                     EQQDFLQQYQLCLQTAYPAQADGNSLLTYPRLFMVATKRQ"
     gene            complement(539842..540714)
                     /locus_tag="DDA3937_RS02440"
                     /old_locus_tag="Dda3937_02673"
                     /db_xref="GeneID:9731902"
     CDS             complement(539842..540714)
                     /locus_tag="DDA3937_RS02440"
                     /old_locus_tag="Dda3937_02673"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316195.1"
                     /db_xref="GI:503081312"
                     /db_xref="GeneID:9731902"
                     /translation="MSLSVTNPGYSSSQTQNATSSAAAQSADTMKVDPLTGKTIQLPT
                     SIKVSEETLARWRSATPLNGTLSKEEQEKLALTIRDLRNDVITRTSSGVSLNNPLFND
                     PVTSSDGLTFSSWANNLKTDSGISKEDLLTLVHDVLAYGFAEQQSNITSAMQLSVKKA
                     ELTAIKDKYLSSSYQQQAETAINSYANQKITDEDTIGKALMEGEYRIGIEVGDAARAV
                     WAQSQLQKYSTGASDLQVKRQQIFALASGGNVDGWFDSFSHYLQASSYGSDWEQQNID
                     GLQNQWQQFQQRLG"
     gene            541145..542734
                     /gene="prfC"
                     /locus_tag="DDA3937_RS02445"
                     /old_locus_tag="Dda3937_02672"
                     /db_xref="GeneID:9731903"
     CDS             541145..542734
                     /gene="prfC"
                     /locus_tag="DDA3937_RS02445"
                     /old_locus_tag="Dda3937_02672"
                     /function="2.3.2 information transfer; protein related;
                     translation"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010296292.1"
                     /note="stimulates the release of release factors 1 and 2
                     from the ribosome after hydrolysis of the ester bond in
                     peptidyl-tRNA has occurred; GDP/GTP-binding protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="WP_013316196.1"
                     /db_xref="GI:503081313"
                     /db_xref="GeneID:9731903"
                     /translation="MSPSEYAREVSKRRTFAIISHPDAGKTTITEKVLLFGQAIQVAG
                     TVKGRGSSQHAKSDWMEMEKQRGISITTSVMQFPYRECLVNLLDTPGHEDFSEDTYRT
                     LTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMEVLDEVES
                     ELNIACAPITWPIGCGKLFKGVYHLYKDETYLYQSGMGHTIQAVRIVKGLDNPELDQA
                     VGEDLAAQLRDELELVKGASHEFEQDAFLNGELTPVFFGTALGNFGVDHMLDGLVAWA
                     PTPMPRKTDARVVSADEEKFSGFVFKIQANMDPKHRDRVAFMRVVSGRYEKGMKLRQV
                     RTGKDVVISDALTFMAGDRSHVEEAYPGDIIGLHNHGTIQIGDTFTQGEDLKFTGIPN
                     FAPELFRRIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPLINNDLIVGAVGVLQFDVVV
                     ARLKTEYNVEAIYESVNVSTARWVECGDVKKFEEFKRKNEQYLALDGGDNLAYVAPTM
                     VNLNLAQERYPDVKFHKTREH"
     gene            543074..543730
                     /locus_tag="DDA3937_RS02450"
                     /old_locus_tag="Dda3937_02671"
                     /db_xref="GeneID:9731904"
     CDS             543074..543730
                     /locus_tag="DDA3937_RS02450"
                     /old_locus_tag="Dda3937_02671"
                     /function="7.2 location of gene products; periplasmic
                     space"
                     /function="5.5.1 cell processes; adaptation to stress;
                     osmotic pressure"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316197.1"
                     /db_xref="GI:503081314"
                     /db_xref="GeneID:9731904"
                     /translation="MKKTKIALSTKFAFPTKFAFSLATVVLGTVLAGGQALAEQETLA
                     QQAQRIADTAGKKIDSSVQQAVGYVDDSTLTARVKSALLKDETLDGNDISVSTRDGVV
                     TLSGFISSQQMATGAVKIAAQTEGVKSVSDKLQVKDDSGVQSVGSYADDTLTTSTIKA
                     KLLADDIVPSRHVKVETHDGIVLLTGQVTSRAQADRAEAIAKAVSGVKSVKNELAVKS
                     "
     gene            544152..544340
                     /locus_tag="DDA3937_RS02455"
                     /old_locus_tag="Dda3937_02669"
                     /db_xref="GeneID:9731906"
     CDS             544152..544340
                     /locus_tag="DDA3937_RS02455"
                     /old_locus_tag="Dda3937_02669"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stress-response protein"
                     /protein_id="WP_013316199.1"
                     /db_xref="GI:503081316"
                     /db_xref="GeneID:9731906"
                     /translation="MNLDVAIGRWKQWKGCLWELWAECFDSDGAWVSGNHGFLAGVMQ
                     EYYGKEQNEVSSGHDSLH"
     gene            544411..545253
                     /locus_tag="DDA3937_RS02460"
                     /db_xref="GeneID:23677390"
     CDS             544411..545253
                     /locus_tag="DDA3937_RS02460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015847908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribonuclease YjjV"
                     /protein_id="WP_042318723.1"
                     /db_xref="GI:754962801"
                     /db_xref="GeneID:23677390"
                     /translation="MTAGEPDRAQAANNVGFIDTHCHFDFPLFAENDAGSLAQAAQAG
                     VHRLIVPAVAAEHFERVLELSQRWPALYAALGLHPLYIAGHQEAHLAELASLLAQPHP
                     RLVAVGEIGLDLYMPEPQFERQKAFLGAQLKLAAQRDLPVILHSRRSHDQLAQILRRY
                     PVPCTGVVHGFAGSYDQAMTFIRLGYYIGVGGTITYPRANKTRQAIARLPLDRLLLET
                     DAPDMPVCGFQGQPNRPERITSVFETLCELRPEWPQVIAGAILANTLRLFPGLQSLEP
                     HQPA"
     gene            545538..546257
                     /locus_tag="DDA3937_RS02465"
                     /old_locus_tag="Dda3937_02667"
                     /db_xref="GeneID:9731908"
     CDS             545538..546257
                     /locus_tag="DDA3937_RS02465"
                     /old_locus_tag="Dda3937_02667"
                     /function="5.5.7 cell processes; adaptation to stress; Fe
                     aquisition"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="WP_013316201.1"
                     /db_xref="GI:503081318"
                     /db_xref="GeneID:9731908"
                     /translation="MLSSFINNIEWLTVRQAGNETTYPGHCARCHFDLSAYRDELFFR
                     AGIPIPTEIARSVPKRRAEYLAGRYLAKTVLSRLGVNDYVLTSAADRSPQWPERIAGS
                     LSHNVDSVLCAAHQCRHDGSCVGLDIETRMDVERANNLWPGIADEIEYDWLHSHNPIS
                     FASMLTLSFSAKESLYKALYPQVKRYFDFLDVRMVGLDTAQQTFTLQLLTDLSPAYLA
                     GRRFSGTYQLRENDITTFLFG"
     gene            546299..547063
                     /locus_tag="DDA3937_RS02470"
                     /old_locus_tag="Dda3937_02666"
                     /db_xref="GeneID:9731909"
     CDS             546299..547063
                     /locus_tag="DDA3937_RS02470"
                     /old_locus_tag="Dda3937_02666"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_013316202.1"
                     /db_xref="GI:503081319"
                     /db_xref="GeneID:9731909"
                     /translation="MKMTGNTILITGGGSGIGLGLAAAFHQRGNQVIIAGRREAALRQ
                     AAADFPGMAWRVLDQRDPAAISAFVGQLTQDYPALNVLINNAGIQRREDLTRPDPQLI
                     DDTVSTNLLGPLWLTGALIPHLLRQPHAAVLNVTSELAFLPQAITPTYCASKAALHAY
                     TDALRCQLRQTTVQVIEIIPPWVQTGLQGDWGYDPRAMPLPDFIDETLALLSQQPVAD
                     EIVVERARALRFAEREGAYAERFRAFNVDPETEIGN"
     gene            547421..549139
                     /locus_tag="DDA3937_RS02475"
                     /old_locus_tag="Dda3937_02665"
                     /db_xref="GeneID:9731910"
     CDS             547421..549139
                     /locus_tag="DDA3937_RS02475"
                     /old_locus_tag="Dda3937_02665"
                     /function="5.3 cell processes; motility (incl. chemotaxis,
                     energytaxis, aerotaxis, redoxtaxis)"
                     /function="3.1.3.3 regulation; type of regulation;
                     posttranscriptional; inhibition / activation of enzymes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_013316203.1"
                     /db_xref="GI:503081320"
                     /db_xref="GeneID:9731910"
                     /translation="MNTTAQSPSSPGVSFWHHWRLMPMFSSIIGVILILFALAIGFSV
                     HFLMRSNSSLNDVTAEIQVRLGVSNSSNHLRTARLMLIQAAAAAKDGDKDTASSSIQQ
                     AEGRLKQSADSFAAYQSREVKTPADLALDDVLQQRYNDYVNNGVRPMLDAVKAGRYDD
                     VVTTEWKQTRKLDLAYNEVLLKVVAIRTQRAEALNSEAQQESVLGYSVMAASFVVAVL
                     VSLFTYLCLRRVIIKPMRSLVERIEHIASGDLTMPLAQWGRGEVGQLGQYLQNMQQSL
                     ARTVSNVRHGVEAIYQGITEISAGNSDLSSRTEEQASALEQTASSMEELTSTVRHNAD
                     NANHASQLAGNASGKARQGGELVDSVVKTMGNIHQSSKKISEITNIINGIAFQTNILA
                     LNAAVEAARAGEQGRGFAVVAGEVRSLAQRSAQAAKEIEGLITESVSLVETGSGQVSR
                     AGETMQDIVNAVTSVTDIMAEISVASQEQSKGIDQVGQAINSIDNVTQQNAALVEQAT
                     AAAASLAEQAAGLNEAVSAFRIDGAERRPAINIAARPASAQAALPKALPGAKKAKSSN
                     DGWETF"
     gene            complement(549717..550139)
                     /locus_tag="DDA3937_RS02480"
                     /old_locus_tag="Dda3937_02663"
                     /db_xref="GeneID:9731912"
     CDS             complement(549717..550139)
                     /locus_tag="DDA3937_RS02480"
                     /old_locus_tag="Dda3937_02663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlhE"
                     /protein_id="WP_033111571.1"
                     /db_xref="GI:696580392"
                     /db_xref="GeneID:9731912"
                     /translation="MKRKSVFTRLALGGALLAASLSQAAIAAGSYTSSVVLPTVYARN
                     FLETVNVPVKGNPPTNGAITSVSWTWNVVGFPQGLSVYLCQGSTSNCIDVSRTRRMST
                     DAFNGKNPTQPFIFAMRVGSGGTVPVSGQQAQIIVNWQ"
     gene            550857..551480
                     /locus_tag="DDA3937_RS02485"
                     /old_locus_tag="Dda3937_02662"
                     /db_xref="GeneID:9731914"
     CDS             550857..551480
                     /locus_tag="DDA3937_RS02485"
                     /old_locus_tag="Dda3937_02662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP pyrophosphokinase"
                     /protein_id="WP_033111572.1"
                     /db_xref="GI:696580393"
                     /db_xref="GeneID:9731914"
                     /translation="MTLTERARIFATAAHAACEQKRKYTGEPYIVHPAAVVALLMQID
                     PSPEMIAAAWLHDTVEDTGVTLELVTELFGTQVARYVEMLTDVRTRQTGGERIHRKNA
                     NLLHSAVACPEAQSIKLCDLIDNSRNVLEHDPVFARPYMVEMRRLLAVLTQGDLGLYA
                     VATRQCEHNILAIHRTLGDEGWYQQLWQQYEAHLPLSVVLARAQALA"
     gene            551949..553118
                     /locus_tag="DDA3937_RS02490"
                     /old_locus_tag="Dda3937_02661"
                     /db_xref="GeneID:9731916"
     CDS             551949..553118
                     /locus_tag="DDA3937_RS02490"
                     /old_locus_tag="Dda3937_02661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M20"
                     /protein_id="WP_033111573.1"
                     /db_xref="GI:696580394"
                     /db_xref="GeneID:9731916"
                     /translation="MTEIPRHIIEQAVEWRRDFHAHPEIGLHEHRTSARVAELLASFG
                     LEVHQGMAQTGVVGTLRCGDGPAIGLRADMDALPIHELNHFPHRSRAEGCMHACGHDG
                     HTAMLLAAACYLSTTRGFRGTVHFVFQPAEENAGGGKMMVQEGLFERFPMQAIYALHN
                     WPGLAAGEVAVNPGPMMASQDSFRIVLSGVGCHAAMPERGADPIVAAAQLILALQTIT
                     ARRLSPLEQAVISITRIEGGEAVNAIPGQVTLAGTLRCLTPHTRERARQLIGEYVQAV
                     PQPMGVQSELRWRNGYPVTQNQPDAAETVREAAIAALGATRVHWNQPPSMAAEDFSYL
                     LQACPGAYFWLGADGAAPSASLHNAEYDFNDEIIASGVRVWVALVERSLRASEAG"
     gene            complement(553146..553388)
                     /locus_tag="DDA3937_RS02495"
                     /old_locus_tag="Dda3937_02660"
                     /db_xref="GeneID:9731917"
     CDS             complement(553146..553388)
                     /locus_tag="DDA3937_RS02495"
                     /old_locus_tag="Dda3937_02660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015847903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111574.1"
                     /db_xref="GI:696580395"
                     /db_xref="GeneID:9731917"
                     /translation="MKLRMSLVFLSFAAANASAFQAKLAPINPNDAMKLAQVETAFSN
                     GHVATGQQAGQLGICDATSVSGCNCPFCTQLRSIGR"
     gene            553639..554454
                     /locus_tag="DDA3937_RS02500"
                     /old_locus_tag="Dda3937_02659"
                     /db_xref="GeneID:9731918"
     CDS             553639..554454
                     /locus_tag="DDA3937_RS02500"
                     /old_locus_tag="Dda3937_02659"
                     /function="4.3.A.1.am transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, ATP binding and membrane component"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Vitamin B12 ABC transporter ATPase BtuD"
                     /protein_id="WP_013316211.1"
                     /db_xref="GI:503081328"
                     /db_xref="GeneID:9731918"
                     /translation="MWQAMPPLLRVEHLNVAHYAGQPLLTDIHFTVGSGECLAIVGPN
                     GSGKSTLLRALLHDPPPVSGCVWLGDKPLVQLSRAQRARRIALMSQHDSPSLALTVEE
                     YVSLGCLPHANALSLSAQQATVAQVLDETGLSPLRQRSLAALSGGERQRAFLARALAQ
                     RPDLLLLDEPTNHLDPPGRAVLLALVRQRGIAVVAVLHDLSLVEPFADRVLVLCQGRQ
                     ACWDVPSRALASDCIYPVFGIRSFTVPHPETGLPFRLFDAPAGACGFITRGSL"
     gene            554451..555443
                     /locus_tag="DDA3937_RS02505"
                     /old_locus_tag="Dda3937_02658"
                     /db_xref="GeneID:9731919"
     CDS             554451..555443
                     /locus_tag="DDA3937_RS02505"
                     /old_locus_tag="Dda3937_02658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_042318060.1"
                     /db_xref="GI:754962136"
                     /db_xref="GeneID:9731919"
                     /translation="MKISCGGASLVNGSAALMGLLWGLSAVTAQASGFPVTVQSCGKP
                     LTFTQAPQRAIINDLNMSEMAFALHLQPQIVGLTGISGWYKMTPEFRRQMGTIPELSP
                     KYPLLETLLAASPDFFFAGWNYGMKVGGDVTPDTLAKYGVKTLVLSESCIFEDQHRPR
                     ASMDLLYGDELTLGKIFGREEQAQALVEQWKARLAALPKPPSGQAALKVFVYDSGEDK
                     PFTSGVYAMPTAIIDAAGGRNVMDGMAASWATTSWETVAAAEPDLIILLDYQNGGGAA
                     ASQHFLEAHPLMKHTPAVAHQRYLKLQYAELTPGPANIDAIEKLAHALYPAAAR"
     gene            555440..556438
                     /locus_tag="DDA3937_RS02510"
                     /old_locus_tag="Dda3937_02657"
                     /db_xref="GeneID:9731920"
     CDS             555440..556438
                     /locus_tag="DDA3937_RS02510"
                     /old_locus_tag="Dda3937_02657"
                     /function="4.3.A.1.m transport; Primary Active
                     Transporters; Pyrophosphate Bond (ATP, GTP, P2)
                     Hydrolysis-driven Active Transporters; The ATP-binding
                     Cassette (ABC) Superfamily + ABC-type Uptake Permeases;
                     ABC superfamily, membrane component"
                     /function="7.3 location of gene products; inner membrane"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013316213.1"
                     /db_xref="GI:503081330"
                     /db_xref="GeneID:9731920"
                     /translation="MRARRHYALICLLIVTLLLAMMLFSTAVGAIRIPLTQVLAALTP
                     DHGDAPDSVRRIVLELRLPRTLLAAITGAGLAMVGALLQTTTRNDLADPFLFGLSSGA
                     SAGAVLVITRFGEWFGAFTLPVAAFGGGICSALAVMLLFFLRQGRQAEHLVICGLAIS
                     FLFGALTSYLAFSGDQRAASSVLFWSLGGLGLARWENLPVALSSLALLVGLVLARWRA
                     LDSLLAGEQTAASLGVHVNRLRIDVFLCCALATALLVSLTGVIGFVGLMVPHLCRPLA
                     GARHRRLIPLCGLLGAVLLCGGDTLSRVLLPSQELPVGIVTAGLGGVFVIVLLAKR"
     gene            556543..557106
                     /locus_tag="DDA3937_RS02515"
                     /old_locus_tag="Dda3937_02656"
                     /db_xref="GeneID:9731921"
     CDS             556543..557106
                     /locus_tag="DDA3937_RS02515"
                     /old_locus_tag="Dda3937_02656"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="1.5.3.9 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; riboflavin
                     (Vitamin B2), FAD, FMN"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004571255.1"
                     /note="with AhpF catalyzes the conversion of alkyl
                     hydroperoxides to their corresponding alcohols; AhpC
                     reduced the hydroperoxide substrate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase subunit C"
                     /protein_id="WP_013316214.1"
                     /db_xref="GI:503081331"
                     /db_xref="GeneID:9731921"
                     /translation="MSVINTKVKPFKNQAFKDGQFIEVTEKSIEGKWSVFFFYPADFT
                     FVCPTELGDVADYYDEFQKIGVDIYSVSTDTHFTHKAWHGSSDTIAKIKYAMIGDPTC
                     QLTRNFENLREDQGLADRGTFIVDPEGIIQAVEITAEGIGRDASDLLRKVKAAQYVAS
                     HPGEVCPAKWKEGDATLAPSLDLVGKI"
     gene            557186..558748
                     /locus_tag="DDA3937_RS02520"
                     /old_locus_tag="Dda3937_02655"
                     /db_xref="GeneID:9731922"
     CDS             557186..558748
                     /locus_tag="DDA3937_RS02520"
                     /old_locus_tag="Dda3937_02655"
                     /function="1.5.3.9 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier; riboflavin
                     (Vitamin B2), FAD, FMN"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase subunit F"
                     /protein_id="WP_013316215.1"
                     /db_xref="GI:503081332"
                     /db_xref="GeneID:9731922"
                     /translation="MLDNNMQLQLKAYLEKLTKPVELVATLDDSAKSAEVRELLTEIA
                     GLSDKVSFFENNDLPVRKPSFLITNPGSANGPRFAGAPMGHEFTSLVLALLQTGGHPS
                     KEAKELLDQIRDLDGKFHFETYYSLTCHNCPDVVQALNLMSVLNPNVTHTAIDGGVFQ
                     DEIKDRNIMGVPTVFLNGEHFSQGRMSLGEIVGKIDTGANARVVDKLNSRPVYDVLIV
                     GSGPAGAAAAVYAARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGAKLATALKTH
                     VDDYDVDVIDLQSAQKLIPASEPGQPHQIETVSGAVLKSRSIIIATGARWRNMNVPGE
                     DQYRTRGVTYCPHCDGPLFKGKHVAVIGGGNSGVEAAIDLAGVVKHVTLLEFAPELKA
                     DSVLQNKLRSLPNVDVIVNAQTSEVLGDGQKVTGLQYKDRVTDSVHKLALEGIFVQIG
                     LLPNTGWLEGAVDRNRIGEIEIDARCETSVKGVFAAGDCTTVPYKQIIIATGEGAKAS
                     LSAFDYLIRTQA"
     gene            complement(558888..559718)
                     /locus_tag="DDA3937_RS02525"
                     /old_locus_tag="Dda3937_02654"
                     /db_xref="GeneID:9731923"
     CDS             complement(558888..559718)
                     /locus_tag="DDA3937_RS02525"
                     /old_locus_tag="Dda3937_02654"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316216.1"
                     /db_xref="GI:503081333"
                     /db_xref="GeneID:9731923"
                     /translation="MNPLRRRFVLQLPLLAYGMSLFANARADDTFSTMRPSGSLIPTP
                     RDIGGKFNPDGSVRRFPGNTIISHIPLGSSASNAFTAVRDTLRQQDFSPCLAFTPPSS
                     YHMTVFEGVTESKRKLPFWPADLPTDAPMQSCTDHLARKLVGFDLQATLPFKLRITDF
                     NARQDSGATLRLTPADDNEERKLRTLRDRLSERLAIRAPDHDTYRFHVTLGYLVRWMT
                     EEESEAYLKVQQACLHYLQQQVPVLEVGVPEFCIFNDMFAFDTQFNVGQPVITVPLTA
                     "
     gene            559953..560633
                     /locus_tag="DDA3937_RS02530"
                     /old_locus_tag="Dda3937_02653"
                     /db_xref="GeneID:9731924"
     CDS             559953..560633
                     /locus_tag="DDA3937_RS02530"
                     /old_locus_tag="Dda3937_02653"
                     /function="1.6.3 metabolism; macromolecules (cellular
                     constituent) biosynthesis; lipopolysaccharide"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_013316217.1"
                     /db_xref="GI:503081334"
                     /db_xref="GeneID:9731924"
                     /translation="MCPQPPSPVLSPEPRLASDVKAHHIELGRWTEVAERTVLNHVSL
                     GDYSYIMNDCDLMFTRIGKFTSIASHVRINPSNHPWWRPTLHHFTYRPGKYRLSDNPA
                     TVDEEIFTWRQQDNVVIGHDVWIGHGAIVLPGVTIGNGAIVGAGSIVTKSVPAWTVVV
                     GNPARVLRPRFEDPAVAEKLEQLSWWDWPDEKIRDHLHLFQQDVTAFVDYFYRDPSLP
                     IQSDQLPR"
     gene            complement(560618..560950)
                     /locus_tag="DDA3937_RS02535"
                     /old_locus_tag="Dda3937_02652"
                     /db_xref="GeneID:9731925"
     CDS             complement(560618..560950)
                     /locus_tag="DDA3937_RS02535"
                     /old_locus_tag="Dda3937_02652"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015847895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-hydroxyisourate hydrolase"
                     /protein_id="WP_013316218.1"
                     /db_xref="GI:503081335"
                     /db_xref="GeneID:9731925"
                     /translation="MSTLSTHILDTALGQPAAGVLVLLERRVHDSWQPVARHHTDDDG
                     RIASFTPDPLPAGHYRLTADIGRWFAAGNREALYVSAQIDVRLGDAGHYHLPFLISTW
                     SWSTYRGS"
     gene            complement(560947..561447)
                     /locus_tag="DDA3937_RS02540"
                     /old_locus_tag="Dda3937_02651"
                     /db_xref="GeneID:9731926"
     CDS             complement(560947..561447)
                     /locus_tag="DDA3937_RS02540"
                     /old_locus_tag="Dda3937_02651"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OHCU decarboxylase"
                     /protein_id="WP_013316219.1"
                     /db_xref="GI:503081336"
                     /db_xref="GeneID:9731926"
                     /translation="MITLEQFNLLNVSEAVALLTPCVALPGWAKQVTAGRPYGNRAAL
                     LAAGLQATKGWQEEELAQALRTHPRIGEPAHSATPEAGLPRQEQAAVRTNDNTLTNAL
                     RTGNARYESQFGRVFLIRAKGRSGEEILQILHRRLQNTPQQETAEALEQLRQITLLRL
                     EGTIGE"
     gene            complement(561977..564415)
                     /locus_tag="DDA3937_RS02545"
                     /old_locus_tag="Dda3937_02650"
                     /db_xref="GeneID:9731928"
     CDS             complement(561977..564415)
                     /locus_tag="DDA3937_RS02545"
                     /old_locus_tag="Dda3937_02650"
                     /function="4.3.A.3 transport; Primary Active Transporters;
                     Pyrophosphate Bond (ATP, GTP, P2) Hydrolysis-driven Active
                     Transporters; The P-type ATPase (P-ATPase) Superfamily"
                     /function="4.S.151 transport; substrate; Pb/Cd/Zn/Hg"
                     /function="1.3.8 metabolism; energy metabolism, carbon;
                     ATP proton motive force interconversion"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc, cobalt and lead efflux system"
                     /protein_id="WP_013316221.1"
                     /db_xref="GI:503081338"
                     /db_xref="GeneID:9731928"
                     /translation="MIPLDPVVATGFLLQQNPEQESTMSEKHSPTSRRQFQPVALEKP
                     GKALFRPHQQGHAGLGQTAPNSALAQHSEQSCANHCCDNSAPPQPTSELTSAERTGDQ
                     QRTPIRIMQMDCPTEEAMLRKKLDALPEVSELEFNLMQRVMTVTHRYDALDKVLTAIR
                     SLGFEPEVRTENDRTPLPPEQKKAWWPLGLAVVAAAAAEAVEWTGLPEWWAAALAILA
                     VAASGLTTYRKGWIALRTGNLNINTLMSIAVTGALFLQQWPEAAMVMVLFTLAEHIEA
                     RSLDRARNAIAGLMNLAPDTATVQQPDGDWREVEAKTVTPGSIVRVRPGERIALDGEI
                     TSGHSAVNQAPITGESLPVDKRVGDSVFAGTINESGSFEYRVTAAAANTTLARIIHAV
                     EQAQGTKAPTQRFVDQFARVYTPLVFLGALLVAVLPPLFADGDWLDWTYKALVLLVIA
                     CPCALVISTPVTIVSGLAAAARRGILIKGGVFLEKGHALAWLALDKTGTLTHGKPVQT
                     GFESVADVDDARCRQLAASLASRSDHPVSQAVARAAQQAGTPLIDVDDFSAVAGQGVI
                     GTLQGQRYFLGNQRLARLWLGDAADGIIERLSALEQAGNTAIILGDGRQILALMAVAD
                     TVKPSSQEAINALHQAGIKTLMLTGDNQHVAQAIARDVGIDEARGNLLPEDKLSQIER
                     LSAQGVTGMVGDGINDTPALARADIGFAMGAMGTDSAIETADVALMNDDLRKIPEFVR
                     ISKATRAILIQNIVLALGIKALFLTLTLLGMGTMWMAVFADVGASLLVVGNGLRLLRQ
                     APVSTRQHQQPQPA"
     gene            564416..564847
                     /locus_tag="DDA3937_RS02550"
                     /old_locus_tag="Dda3937_02649"
                     /db_xref="GeneID:9731929"
     CDS             564416..564847
                     /locus_tag="DDA3937_RS02550"
                     /old_locus_tag="Dda3937_02649"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="5.6.2 cell processes; protection;
                     detoxification (xenobiotic metabolism)"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_013316222.1"
                     /db_xref="GI:503081339"
                     /db_xref="GeneID:9731929"
                     /translation="MKIGDLAKATNTTPETIRFYEKKGLLPEPERTEGNYRHYYQFHV
                     DRLRFIRNCRSLDMNHDEIRALVALSEQPAASCEGVNVLLNEHLGHVEARIAELQQLK
                     AQLMHISQRCQVTQTVDGCGILHGLSALEPEESGTGHTHLG"
     gene            complement(564864..565886)
                     /locus_tag="DDA3937_RS02555"
                     /old_locus_tag="Dda3937_02648"
                     /db_xref="GeneID:9731930"
     CDS             complement(564864..565886)
                     /locus_tag="DDA3937_RS02555"
                     /old_locus_tag="Dda3937_02648"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013316223.1"
                     /db_xref="GI:503081340"
                     /db_xref="GeneID:9731930"
                     /translation="MSTKKTTRHAAAVRAPTLDDVARAAGLSSMTVSRALNTPALVRA
                     KTIEKVQEAVRATGYIPNALAGGLASRRSKLIAVVVPQINNNMFVDTIQALSDELARR
                     GYHMLLCVAGYTQQAEEELVATLLSRRPDGVVLTGIHHSPALKKIILNAAVPVVEIWD
                     LTPTPLDMLVGFSHEKVGMTIAEYIRRKGYQRPGLIWTADPRAARRKTGLCEALSGHG
                     VPLPACIDAPLPATLAFGRHGLSQLLEQNQPDVVVCSSDTLAQGAIMEAESRGLRVPQ
                     DLAVMGFGDLDFAASNRPALTTVGIDRREMGRRAATLLADSIAGDTHSDAIVDIGFQL
                     IERESA"
     gene            566167..567366
                     /locus_tag="DDA3937_RS02560"
                     /old_locus_tag="Dda3937_02647"
                     /db_xref="GeneID:9731931"
     CDS             566167..567366
                     /locus_tag="DDA3937_RS02560"
                     /old_locus_tag="Dda3937_02647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015847886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase/muconate lactonizing protein"
                     /protein_id="WP_033111575.1"
                     /db_xref="GI:696580396"
                     /db_xref="GeneID:9731931"
                     /translation="MSLSANSDAVSYASVTGVKTAAETGDRIEWVKLSLAFLPLATPV
                     SDAKVLTGRQKPLTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLG
                     EDPNDIDKIYSKLLWAGASVGRSGMAVQAISPIDIALWDMKARRVGLPLAKLLGAHRD
                     SVQCYNTSGGFLHTPLDQVLKNVALSRESGIGGIKLKVGQPNTAEDIRRLTAVREALG
                     EDFPLMVDANQQWDRETAIRMGRKMEAFNLIWIEEPLDAYDVEGHAQLAAALDTPIAT
                     GEMLTSFREHEQLILGNASDFVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVH
                     LHLAAAYPLEPWLEHFEWLNPLFNEQLELRDGRMWVSDRHGLGFTLSEQARKWTQLSC
                     EFGKYAG"
     gene            567824..569173
                     /locus_tag="DDA3937_RS02565"
                     /old_locus_tag="Dda3937_02646"
                     /db_xref="GeneID:9731932"
     CDS             567824..569173
                     /locus_tag="DDA3937_RS02565"
                     /old_locus_tag="Dda3937_02646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010303435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-phosphate glucose phosphotransferase"
                     /protein_id="WP_042318064.1"
                     /db_xref="GI:754962140"
                     /db_xref="GeneID:9731932"
                     /translation="MDFLSINLTLIVSARLFLMGAFDDVIMISLLFSTSFLLIGEYTG
                     LYHHSLKNMQPGGKRRLWGSALLSVIFVEVVRNYAGTLYSLGLLHQLDNIYFSATLYW
                     YILSLCSLYITRLITFKFTTKKRMRIAIVGLTPGGLAAEKALLKEHANMQLELAFYDD
                     RSPSRCGYLFKSQFKGKVSELIEEAKAGRVDEIYIALPMVALKRIRYFLSMMSDTTVD
                     TYIIPDLYSYSSYVSQFRSINNIQTISIFRSPFDGIGSVIKRVEDLVIGGVITLMISP
                     LLLVIAIGIKLTSRGPVLFKQDRYGLSGNKIKVWKFRSMHVMENAGVVTQATKNDPRV
                     TRFGAFLRRTSLDELPQFFNVLQGTMSIIGPRPHAVVHNEQYRQLVENYMIRHKVKPG
                     ISGLAQVNGYRGEVDTLDKMEKRVHYDIAYIQSWSLWLDIKIIFRTIFKGFIGENAY"
     gene            569163..570449
                     /locus_tag="DDA3937_RS02570"
                     /old_locus_tag="Dda3937_02645"
                     /db_xref="GeneID:9731933"
     CDS             569163..570449
                     /locus_tag="DDA3937_RS02570"
                     /old_locus_tag="Dda3937_02645"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005971002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="WP_013316226.1"
                     /db_xref="GI:503081343"
                     /db_xref="GeneID:9731933"
                     /translation="MRTKLIIAAGMIVPHPSWADLMPKSHIGVAGIDFQSQVGLDYGH
                     ENNVTYQADDQDAVSSNFQSVRPMIKAIGARYQDQYLLMYSGDYRRYDSDSADNYTDH
                     FFRFNGAWRYGLRHGLTLSLEETLGHEVRGRGITEGFRPQQFSDFGIHSPLSTALFNS
                     ELRYSYGALKGRGKADVALLFRKLRLGRTEDIKNTDIDFYNYVLGQEWHENGLITELS
                     DQYSPATRFRYRFIGNQRRYEIDSQKDNDEYYLEYGIKSQLTGKTGIDANVSWLYKTF
                     DNNPNSRNFSGVNWDIQAEWKPLTQSVFTVHTSQNIKDPSEIGGYILVSKYGISYQHF
                     WLVDRFSTTFDYSYLTDVYKNYPRDRKDRNRAFTFAMSYNFRPSINVELKYQLNTLRS
                     NQDSDSFFIGPNGDRQVVRMLGRDNSLIMFTAKVQI"
     gene            570451..571008
                     /locus_tag="DDA3937_RS02575"
                     /old_locus_tag="Dda3937_02644"
                     /db_xref="GeneID:9731934"
     CDS             570451..571008
                     /locus_tag="DDA3937_RS02575"
                     /old_locus_tag="Dda3937_02644"
                     /function="7.4 location of gene products; outer membrane"
                     /function="4.1.B transport; Channel-type Transporters;
                     Beta barrel porins (The Outer Membrane Porin (OMP)
                     Functional Superfamily)"
                     /function="6.7 cell structure; capsule (M and K antigens)"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="WP_013316227.1"
                     /db_xref="GI:503081344"
                     /db_xref="GeneID:9731934"
                     /translation="MKIIKLCIFLCLSVWLAGCTLSSPRQMDKPESETTGYQLDEGDA
                     VNILVYGEPEMTMKFMLDKSGAITFPYIGQLVLKGKTPGQVGEELANRLRGDYLQNPM
                     VTVSIAEFRKFYITGEVEKPNGYAYEPGLTVEKALALAGGFTDRADRKDVGIRLSNSN
                     QLIENVDVRRVVHPGDTVIVGMSFF"
     gene            571011..573143
                     /locus_tag="DDA3937_RS02580"
                     /old_locus_tag="Dda3937_02643"
                     /db_xref="GeneID:9731935"
     CDS             571011..573143
                     /locus_tag="DDA3937_RS02580"
                     /old_locus_tag="Dda3937_02643"
                     /function="6.7 cell structure; capsule (M and K antigens)"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="WP_013316228.1"
                     /db_xref="GI:503081345"
                     /db_xref="GeneID:9731935"
                     /translation="MSLSIVENGRKLESTIDFSRFAQEIKQNGWKIMLAGLIVAVVAY
                     PLISMITPKYVSTATVLLKAQQDNVSPLPQVDGYDSTRSGYYETQYALMQSRIVLEQA
                     VRDIKLDQNPAFNGDTDKNADNRGDEQQRVDRALDTIVKNLTITGVRTTHLATISYES
                     ASPELAADIANGAAQAFIDYTARQKHLKTLKAKALNQKQMEEVWQQVVEQQTAIDQFL
                     KKEGLLTFRGVGGFETEQLGIVTTKLADATQRRIRAETNYNSVRLNAGTSLENIISLP
                     DISNHAQIQDLRIALIQARRSLYDLRKRYGLKHTKILEAEAQVQAIEEQTHTVLLELE
                     AGLNKQYQAALRDEKYYQQLLEQQKADFQTLASKRDEYNNLTTALDKTKELYKALYQR
                     TKEQTLAGNYLEPDAILYDPAVPADHPSKPNKAMLLVMVVMLTLIFSVVYFIVKAALD
                     NSINSLSQMKKRLNVAPVGEIRTFASGAKRSQVVRLITKTPLDVDIVHSMRTHILLSH
                     PSCQAIAISSAEHGEGRSLLAHLLATSFSADQKTLLIDLDFFNDDGLTQDLAYPSAIG
                     VAELLQGQSSLDAALVTISDNLSFLPRGNASMSSLLMLSSEHVVTLMAELRTRYQRII
                     VDVAAVNQTQDSQLISRVIDGVVFVLKAGEWRAGDVLNAIEKVKHHRAVLIGAVMNQV
                     ADKNLETKEGIRSLNHRMNALINSTGHL"
     gene            573157..574368
                     /locus_tag="DDA3937_RS02585"
                     /old_locus_tag="Dda3937_02642"
                     /db_xref="GeneID:9731936"
     CDS             573157..574368
                     /locus_tag="DDA3937_RS02585"
                     /old_locus_tag="Dda3937_02642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="WP_013316229.1"
                     /db_xref="GI:503081346"
                     /db_xref="GeneID:9731936"
                     /translation="MSLLKSVSTIAGSSVVSQLIGALSIWLISHKYNMAEVGIYALSY
                     SIVLVGAQVCTFASQLLIPKQQDSELAQSVVFSTLQSLLTAVPYAMLTAWLFQRNVFF
                     LYLLTLSYALVLISENLSLREGNYRFLAFQRLAVSVVVVLSLVFTSQTTAFYWSWAGA
                     MMVLICGCILHSFNIRTMTFGHFSLQRNVAFFHQHAHHLTRVGSAEVLAMVNSNLPVM
                     LINFWFSALTAGYFSVVSRFCLSPVVIIGNAVRNSIFSTWSADFRNKRFNYEEFKKVR
                     LVLLMAGVVCTLGVFIFYPLVMHLFFSEEWINSIPTSRYMLPYLFPALAVCPLTVIEL
                     IFGSHRYFLRIQLEQLSVVLIAFVIVPYFYNHYATSMILFSVLTFVRYAFIYLKVNKR
                     ANGLKNMMTES"
     gene            574365..575747
                     /locus_tag="DDA3937_RS02590"
                     /old_locus_tag="Dda3937_02641"
                     /db_xref="GeneID:9731937"
     CDS             574365..575747
                     /locus_tag="DDA3937_RS02590"
                     /old_locus_tag="Dda3937_02641"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="WP_013316230.1"
                     /db_xref="GI:503081347"
                     /db_xref="GeneID:9731937"
                     /translation="MILNTGLYLQVYVVITLVFCGLTQYFTGLLAVLWLPFILALIMV
                     GLLIMQTRYDTLHLDTQELMVLTLYLSFLAMAGVSTLLQGGITVTIVGFKNEIALSLM
                     MLCLLLGFCRESQIYRVTRSLYWVFYAQFPVVIYQVLFVLPRRVALRGEDEKWDSVVG
                     TFGGDPMGGGNTAAMGLFCLLIMLLKVSEFKHGLTSFKSTALHIVLGFGLCILGEVKF
                     VILVSPLLLAWVWLMPSYIKGMNNVNLKAIFLIFTGMALLITVAITILASGYSSAFGS
                     DPTKSAMSVFLDSLNYIFDTNYIMDSGELGRLTTIFFWLRNHDMWGMSGTLFGYGLNA
                     TNSGSAVSPGFLNIIYNLIIDSTSLSVLLWEVGVVGSLFFIGLIIYILIITQPKPVLE
                     RNKIDQQDLQLLSFSPAFNVFAVGCLLSLPYSQILMIIPMLQFLFYLSLGSSLVIRHS
                     VRRYIGKPYE"
     gene            575740..576729
                     /locus_tag="DDA3937_RS02595"
                     /db_xref="GeneID:23677391"
     CDS             575740..576729
                     /locus_tag="DDA3937_RS02595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005970996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_033111576.1"
                     /db_xref="GI:696580397"
                     /db_xref="GeneID:23677391"
                     /translation="MSDKPFISVSIKTFNEAECIEKTIDSIRRHIADYPHKIIVADSL
                     STDNTQQLASTKGVTVVSLTEPSERCCGVGHQLGYLYSQGDYLLLMDGDMELEDGFIE
                     QGIAFLTAHPDYAGVAGTVEMDGAANYEFTSRKQRLHKIYPLGDCGHLGGGGLYRRSA
                     IEKIGYLTNRSLHGYEEAELGIRLRHAQYKLHRLNVPYFRHTSYTMPTYKMLQYRWRN
                     GFLWAPGELLRSAWGMPYFREALHIVKNEAVFAVYLLALVMSLLTFNAVVIGAALLPL
                     LAFVALKTIKNRSLLNGLQSVMNLAVFSAGLIKGLTRPVRDPMTPPDSKVIHE"
     gene            576739..577950
                     /locus_tag="DDA3937_RS02600"
                     /old_locus_tag="Dda3937_02694"
                     /db_xref="GeneID:9731939"
     CDS             576739..577950
                     /locus_tag="DDA3937_RS02600"
                     /old_locus_tag="Dda3937_02694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_013316232.1"
                     /db_xref="GI:503081349"
                     /db_xref="GeneID:9731939"
                     /translation="MKVLLVNKFFYIKGGAETVYFQEIDMLKKADVDVIAFSMQHENN
                     FPSDYAPYFVGNVDYHQNSSAMGAIKTAVNFIHNAEACKKLLALLRKEKPDIVHFHNI
                     YHQLTPSLIKIARQFGCKTVLTAHDYKIICPSYTMLRDGKVCDACLTGSVFNAFKYRC
                     QQGSASKSLLLSLEGAWQNIAKNYQALDVIVSPSEFLRNQLMRKLPNVRIDVIVNGIN
                     DSLPVEEVKDDGYLLFIGRLSREKGVATLARAHQQMRNKIPLKIAGSGPLYNDLVAQF
                     PHAEFLGYKQQGEELNRLIKYARAVVVPSEYYENCSMSVLESMAFAKPVVGGRIGGIP
                     EQIRDKVDGILFEPGNVQALADVLDDLALNPQKAKEMGLNARQRLREKYSLRKHTESL
                     LALYQEILTEK"
     gene            577952..579067
                     /locus_tag="DDA3937_RS02605"
                     /old_locus_tag="Dda3937_02695"
                     /db_xref="GeneID:9731940"
     CDS             577952..579067
                     /locus_tag="DDA3937_RS02605"
                     /old_locus_tag="Dda3937_02695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013316233.1"
                     /db_xref="GI:503081350"
                     /db_xref="GeneID:9731940"
                     /translation="MTTKITVFGTRGIPNVLGGVETHCQNLYPTIKQQFDVDICVIAR
                     SPYVNYKESQYRGVMTRALLAPKKRSLEAIVHSVLAAFTTCFDQSTVVHVHAIGPGLV
                     VPLLRLLGKKVVFTHHGPDYDRQKWGFLAKRVLLLGEKVAVKYANEVIVISEVINNMI
                     KQKYGRDDAHLIYNGVNLSQQLTADVINQTLARFSLQPQNYLVAVGRFVEEKGLHDLI
                     AAYRQSGVTMPLVLVGDADHPTAYSMRLKQLAHETPNVILTGFLTGQELQTVFSQAKL
                     FVMSSYHEGLPIALLEAMSFSLPVVVSNIPANLEVKLAPETYFNVGDVADLSEKITLR
                     SKSLSIDYSEYLQRYNWQQIAQQTMAVYTAVNKSMSQ"
     gene            579083..579490
                     /locus_tag="DDA3937_RS02610"
                     /old_locus_tag="Dda3937_02696"
                     /db_xref="GeneID:9731941"
     CDS             579083..579490
                     /locus_tag="DDA3937_RS02610"
                     /old_locus_tag="Dda3937_02696"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012822356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013316234.1"
                     /db_xref="GI:503081351"
                     /db_xref="GeneID:9731941"
                     /translation="MNESNKRPLVIERFYEALDGKTDTELTSEQRLAVEQAVLSITAS
                     SMHWVDVRKSFPFLNRRYYFVFLFGLDHRKRPRKESTLFRILLTALILFTGLSCTLAA
                     LLTLYMIKSALGIDIFPHFHLGIWDWWLSLKDH"
     gene            579529..580923
                     /locus_tag="DDA3937_RS02615"
                     /old_locus_tag="Dda3937_02697"
                     /db_xref="GeneID:9731942"
     CDS             579529..580923
                     /locus_tag="DDA3937_RS02615"
                     /old_locus_tag="Dda3937_02697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="WP_013316235.1"
                     /db_xref="GI:503081352"
                     /db_xref="GeneID:9731942"
                     /translation="MHFKIIAVGGLLFSVLGVAEGAMTTITPRGLTGPLTNPGNGVAS
                     FNKGNNATLSLADYPDTGIEYDRLYWNELEPVEGQYNFQAVDAIFELASQHQPPMNVG
                     LRFMTLDEPASGSKIPDWLIQKGIKGEWTPDKKTFVPDLDDPVFIEYSQRLLNAFGQR
                     YDGNSNLAYIDIGLVGSWGEWHNTNFPTIKPLLERYTSAQLDQYVKMYFAAFPNSPKI
                     MLISGGDTLVSAVKQGAGWRADCWGDWHNFSTTWSHMQDDYPQRLQNAEALYPNFSSA
                     WQRAPVSLEICGYMSEWQSVQHYTRAQVQATFDWALAQHASTINLKSRSVPTEYRDIV
                     DNALTKLGYRFRLASLTHESELAQGQSLTLNQQWFNDGVAPIYLKYDVAYRVVNDANT
                     VMSMGKTADDIRTWLPGQHTSVYQLAMPEALPAGRYNIEMAMLDAKGVSRINLANEGK
                     QADGWYRISTVTVH"
     gene            580950..581450
                     /locus_tag="DDA3937_RS02620"
                     /old_locus_tag="Dda3937_02698"
                     /db_xref="GeneID:9731943"
     CDS             580950..581450
                     /locus_tag="DDA3937_RS02620"
                     /old_locus_tag="Dda3937_02698"
                     /function="1.6.2 metabolism; macromolecules (cellular
                     constituent) biosynthesis; colanic acid (M antigen)"
                     /function="1.1.3 metabolism; carbon utilization; amino
                     acids"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colanic acid biosynthesis acetyltransferase"
                     /protein_id="WP_013316236.1"
                     /db_xref="GI:503081353"
                     /db_xref="GeneID:9731943"
                     /translation="MLKNIGHVWREVKAAGSIKAKLVILLFRLSTIYQSSNALLKIIS
                     IPFVVLNKVINEWLFCVEIPHRTQIGFGLKIYHPHCIVVNSDVIIGANCTLRQGVTIG
                     SVINREGHTTKSPVLGNQVELGANAILLGDITLGDNVKVGAGTVVTKSLAAGKVVVGY
                     GARELN"
     gene            581656..581949
                     /locus_tag="DDA3937_RS02625"
                     /old_locus_tag="Dda3937_02699"
                     /db_xref="GeneID:9731944"
     CDS             581656..581949
                     /locus_tag="DDA3937_RS02625"
                     /old_locus_tag="Dda3937_02699"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011092560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CopG family transcriptional regulator"
                     /protein_id="WP_013316237.1"
                     /db_xref="GI:503081354"
                     /db_xref="GeneID:9731944"
                     /translation="MPAAKGVSAKRVTLNLRIKPAERDLIDRAAKARGKNRTDFVLEA
                     ARAAAEEALIDQRIIMADPDAYPEFLARLDQAPSPNAALRKTMQTPAPWEQKK"
     gene            582842..584452
                     /locus_tag="DDA3937_RS02630"
                     /old_locus_tag="Dda3937_02702"
                     /db_xref="GeneID:9731946"
     CDS             582842..584452
                     /locus_tag="DDA3937_RS02630"
                     /old_locus_tag="Dda3937_02702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011037251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033112204.1"
                     /db_xref="GI:696581025"
                     /db_xref="GeneID:9731946"
                     /translation="MRGELYTDQSESAPPTWGKFLGDFSRSDLSELSNKHCSAVLFIE
                     VPPTNEKNDTRIMALTFGYGHHALEISAFERNFGLKVTLSAVTRTELVSLDTATLDST
                     VFQRRIQASKKANFSGFGMNIERDLLRLAGGIPSDTSFASALVGKDALTITARTSPDD
                     FLSKCSKALDLFYSNKYKNEFSFIDHITPVYNSEHKDYLDSIIFSEISSLVGGGASDL
                     HMVIPEVTNPEFSHEISYYGAGFGKGTKKHFPGVDINDYISELSSGDFNSIQTFEEIR
                     KGQYIFEIQNGEKNKKSKRKVYDCLVFEVEVNNLNLMPDSSTASPINSLSNVPADLPE
                     GVYVLFSGNWYLVDKEFHTRIENSYLKYLTKSFLPNTKMKNERALILDLNKSSELLNL
                     DQVKINPTGTSNANIEPCDFLSTKCQFIHLKDGESSGPISHLWNQGVVSAEAYLNDMK
                     FRRDLNKEIKKRQREFNKSGFDSLLPRANGKLDTNKITVVFGVMRTPYVKTSQAGLPF
                     FSKVSFRPVAQAIESMGYKVELHLIEKI"
     gene            584924..585151
                     /locus_tag="DDA3937_RS02635"
                     /old_locus_tag="Dda3937_04460"
                     /db_xref="GeneID:9731947"
     CDS             584924..585151
                     /locus_tag="DDA3937_RS02635"
                     /old_locus_tag="Dda3937_04460"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111577.1"
                     /db_xref="GI:696580398"
                     /db_xref="GeneID:9731947"
                     /translation="MRFDKRNDYASLWRLDNITLYIDKRFVMAGSFIVRSNELHVHQF
                     LFSSEKEPFWAINMATSSIPSRFSFFQSSAF"
     gene            complement(585621..586112)
                     /locus_tag="DDA3937_RS02640"
                     /old_locus_tag="Dda3937_02703"
                     /db_xref="GeneID:9731949"
     CDS             complement(585621..586112)
                     /locus_tag="DDA3937_RS02640"
                     /old_locus_tag="Dda3937_02703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011062084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111578.1"
                     /db_xref="GI:696580399"
                     /db_xref="GeneID:9731949"
                     /translation="MSDNTSQFEQSSPKDFTLFEQDGILITLKLPKALQINQNRQESY
                     TSAPILHNNSSFHIKSATFTVELQDVIDASSNAIASVRWWDADTFNGVKSMKFSCKDI
                     KPGETLVCKPDDSAYTQVRWNATVSSGRGTGKLTSTVSLVELDYGPLKPNNSNDGPTV
                     QIG"
     gene            587253..587546
                     /locus_tag="DDA3937_RS02645"
                     /old_locus_tag="Dda3937_02704"
                     /db_xref="GeneID:9731951"
     CDS             587253..587546
                     /locus_tag="DDA3937_RS02645"
                     /old_locus_tag="Dda3937_02704"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CopG family transcriptional regulator"
                     /protein_id="WP_013316243.1"
                     /db_xref="GI:503081360"
                     /db_xref="GeneID:9731951"
                     /translation="MPVTNSVSVKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEA
                     ARAAAEEALIDQRIIMADPDAYQEFLARLDQAPAPNAALRKTMQTLAPWELKK"
     gene            587543..588031
                     /locus_tag="DDA3937_RS02650"
                     /old_locus_tag="Dda3937_02705"
                     /db_xref="GeneID:9731952"
     CDS             587543..588031
                     /locus_tag="DDA3937_RS02650"
                     /old_locus_tag="Dda3937_02705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_033111579.1"
                     /db_xref="GI:696580400"
                     /db_xref="GeneID:9731952"
                     /translation="MISAPEPLRAEHVLSSFCCGVESMDNWLKLRAMKNQVTGASRTF
                     VSCDDSKVLAYYSLASSAVATNAAPGRFRRNMPDPIPIVVLGRLAVDKSLHGQGVGRA
                     LVRDAGLRVIQVADTIGIRGMLVHALSDEAREFYLRVGFEPSPIDPMMLMVTLGDLVG
                     SI"
     gene            complement(588528..590570)
                     /locus_tag="DDA3937_RS02655"
                     /old_locus_tag="Dda3937_02706"
                     /db_xref="GeneID:9731953"
     CDS             complement(588528..590570)
                     /locus_tag="DDA3937_RS02655"
                     /old_locus_tag="Dda3937_02706"
                     /function="8 extrachromosomal"
                     /function="8.2 extrachromosomal; plasmid related"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013316245.1"
                     /db_xref="GI:503081362"
                     /db_xref="GeneID:9731953"
                     /translation="MSKKALSINFPIERVVLSDFLPYEVPITFSNRHFYNFIIEHKLR
                     HDGLNFRWLKGDDSLKKLVLLLLGLEQATKTVDVDEDGVSYTETKISHTNLPSIAFTF
                     PISHKHKEYRYLSLMHPKGQLLGVDFYRNYKDLITYYSDLSPLSLRAAKKVAGCTFID
                     KKSLIESFDHEDLSIELEGQNYENLKSFFVYKKYSNIFEFYESEDHHWCEKRFNYLSK
                     LDVSNCFDSIYTHSISWAVLQKDYAKKQLSKTKTTFPFKFDQLMQRSNYNETNGIIIG
                     PELSRIFAEIIMQSIDNSIIKDLNQENLVLSVDYQIYRYVDDYFIFYNDDDVFNKIKI
                     SAQTNLKTYKLNLNKYKEVTYSRPIITPITIAKKKIAALISEKISYNFKSDDDSDAEF
                     KKGNVYIHQNSLSTDFKSILSVSGVTYSDILNYSLAIIERKIKNLFRDYKELSINKDH
                     DRQLINAVVSVINFTYFIYAVAPKVNSTIKLCRIVQQIIMFIKDEKLGAEYQHVVFKC
                     IFDNSCSILDKYSIDRTTPIETLYLLVLIRQLGKYYWLSESSLIKYFNIKRDSDSYTF
                     DGNLSYFSITSLLFYISNKKRYDIIKQHLLLFIEKIYTMKVDTLLNESELVHLTLDLI
                     ACPYIPISFKRSLLSYYDIDKSYAKRIISLNQYWFTKWDDFNFAKELDAKLSNAVY"
     gene            complement(590563..591906)
                     /locus_tag="DDA3937_RS02660"
                     /old_locus_tag="Dda3937_02707"
                     /db_xref="GeneID:9731954"
     CDS             complement(590563..591906)
                     /locus_tag="DDA3937_RS02660"
                     /old_locus_tag="Dda3937_02707"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="reverse transcriptase"
                     /protein_id="WP_013316246.1"
                     /db_xref="GI:503081363"
                     /db_xref="GeneID:9731954"
                     /translation="MIDQSFSAKNFRKIYDLDRKNKGSIEVEYFPKAYNIRKKISRLK
                     KFINWLSSKNSQISSLNLEARKDKANKIIEIRKKQYDTEVNEQLSSISKTVSVKGYNL
                     PLTLLPQQVKNKDVYSIGNGVEELFVSMQIKNILNSLFNIKVNNRDLIISRLSALTKE
                     ISPKYIIRADVEKFYESINHKDLLEILHSSPKLSVPPRRVITQLIRKYQSLTGSDKGL
                     PRGVGISAYLSELYMTIIDNKIKSLLDITYYERFVDDFIVVFCPSKEKNTGSYLQQIA
                     SIINERGLTLNNKTTEIDLFTQTNKNFEYLGYKFNLSASHCEIKMSSNKIKKIRSRID
                     ISFDEYNKSYKHTPQKATKMILLRMKFITGNTRLYNSKSNAFVGIYFSNRFITDKSDL
                     NGLDAYLLSKANNLKNQALRKRIIKLSFKKGFEDQVFRNFSFEELSKISKGWANV"
     gene            complement(592071..592376)
                     /locus_tag="DDA3937_RS02665"
                     /old_locus_tag="Dda3937_02708"
                     /db_xref="GeneID:9731955"
     CDS             complement(592071..592376)
                     /locus_tag="DDA3937_RS02665"
                     /old_locus_tag="Dda3937_02708"
                     /function="8 extrachromosomal"
                     /function="8.2 extrachromosomal; plasmid related"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316247.1"
                     /note="controlled cell death protein; post-segregation
                     toxin; toxin addiction system; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_013316247.1"
                     /db_xref="GI:503081364"
                     /db_xref="GeneID:9731955"
                     /translation="MQFIVYEYKRASHYKMFVDVQSDIVDTPKRRMVIPLIETHHLSE
                     KVNKTLFPQIRIEGEDYRLMTTELSSVPVEVIGEVIADLGDYADEIKDAINLMFWGI"
     gene            complement(592379..592597)
                     /locus_tag="DDA3937_RS02670"
                     /old_locus_tag="Dda3937_02709"
                     /db_xref="GeneID:9731956"
     CDS             complement(592379..592597)
                     /locus_tag="DDA3937_RS02670"
                     /old_locus_tag="Dda3937_02709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014914376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_012773205.1"
                     /db_xref="GI:502366141"
                     /db_xref="GeneID:9731956"
                     /translation="MKHRVSVTVDKDNYQVLSAAGVNISGLVNDAIGKEARRIKAEEW
                     KKENREGMEEVARFIAQHGSFADENRNW"
     gene            complement(592656..593399)
                     /locus_tag="DDA3937_RS02675"
                     /old_locus_tag="Dda3937_02710"
                     /db_xref="GeneID:9731957"
     CDS             complement(592656..593399)
                     /locus_tag="DDA3937_RS02675"
                     /old_locus_tag="Dda3937_02710"
                     /function="8 extrachromosomal"
                     /function="8.2 extrachromosomal; plasmid related"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobC"
                     /protein_id="WP_013316248.1"
                     /db_xref="GI:503081365"
                     /db_xref="GeneID:9731957"
                     /translation="MLISDYRKRRERHCEKIRILLNFLKEETYSDFKTLMLLFDYKNH
                     KPLYLLLAKAIDMGFIQKQTFCTRMEKISLWGITNDGLAVVVTPDDDVFPARFEPSKV
                     TGWMLDQHLDSQLARLILEKKGAYGWVSGTCSTFRSRYQVKHRPDGAITLPNGTVIAI
                     ETERRLKTKARYQVIITNHLLARTQQHWMYVFYIVPNPQMKRAIELLFNSVKYAIVNR
                     QHIRLETKHRHVFRVYTFEELKGLNLNLG"
     gene            complement(594300..594650)
                     /locus_tag="DDA3937_RS02680"
                     /old_locus_tag="Dda3937_02712"
                     /db_xref="GeneID:9731959"
     CDS             complement(594300..594650)
                     /locus_tag="DDA3937_RS02680"
                     /old_locus_tag="Dda3937_02712"
                     /function="0 unknown function"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015855074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316250.1"
                     /db_xref="GI:503081367"
                     /db_xref="GeneID:9731959"
                     /translation="MADTDSNTGSSYQSLPDCESLYSAMNAALARLDFSNMDDDELSQ
                     VAEYCAETSAGLCHCLNFIGDALITFADNDVCESTPESLCQLGHGLNAISLLIPALND
                     MHRRAHAPTRPISL"
     gene            594773..594961
                     /locus_tag="DDA3937_RS02685"
                     /db_xref="GeneID:23677392"
     CDS             594773..594961
                     /locus_tag="DDA3937_RS02685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012773209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_033111580.1"
                     /db_xref="GI:696580401"
                     /db_xref="GeneID:23677392"
                     /translation="MEFVITMSSEKSKTDQYQIRLSHEFRAQLEEQAHKDGDKTLATW
                     IKRILRKELQTRGIEPKG"
     gene            complement(595102..596361)
                     /locus_tag="DDA3937_RS02690"
                     /old_locus_tag="Dda3937_02713"
                     /db_xref="GeneID:9731960"
     CDS             complement(595102..596361)
                     /locus_tag="DDA3937_RS02690"
                     /old_locus_tag="Dda3937_02713"
                     /function="8.1 extrachromosomal; prophage genes and phage
                     related functions"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008784408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_013316251.1"
                     /db_xref="GI:503081368"
                     /db_xref="GeneID:9731960"
                     /translation="MLTDSKVRSAKPLAKSYKLTDSQGLYLTVSTSGAKLWYFRYRFG
                     GKENRLAFGPYPQTTLAEAREKRDAARKLLASGISPSQLRKTNNPAVDESHTFQSVTM
                     AWHTSSLKLWSDAHADKILICLKRYVFPAIGAMDIAQVETRHLAQLVKSIDDKGVHDV
                     AGRVRQHLTKIMRHAVQQGVIKYNPAYDLDGVVTPVATQHHPALPLKRLPELLEKIES
                     YKGRMLTRLALELNLHVFLRSSELRFARWDEFNLKAHIWSVPAQREAVNDVRFSERGA
                     KMKDEHLVPLSRQAVALLKQIQAISGKSVFVFPGAHTLNKPMSENTINKALRVIGYDT
                     KSEVCGHGFRTMACSALNESGRWSKDAIERQMSHKERNGVRAAYVHKAEHLEARIEMM
                     QWWSDYLDVNREGYVAPYIYARSYAAG"
     gene            complement(596523..596598)
                     /locus_tag="DDA3937_RS02695"
                     /old_locus_tag="Dda3937_04267"
                     /db_xref="GeneID:9731961"
     tRNA            complement(596523..596598)
                     /locus_tag="DDA3937_RS02695"
                     /old_locus_tag="Dda3937_04267"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(596563..596565),aa:Phe,seq:gaa)
                     /db_xref="GeneID:9731961"
     gene            complement(596761..597336)
                     /locus_tag="DDA3937_RS02700"
                     /old_locus_tag="Dda3937_02714"
                     /db_xref="GeneID:9731962"
     CDS             complement(596761..597336)
                     /locus_tag="DDA3937_RS02700"
                     /old_locus_tag="Dda3937_02714"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013316252.1"
                     /db_xref="GI:503081369"
                     /db_xref="GeneID:9731962"
                     /translation="MQREEVLEQALALLERRGFADTTLEMLADQLGVSSAELLPFWPD
                     REALLYDSLRYHSQQVNTWRKQVQLDEQLGPEQKLLVRYQRLQDAVSQHRFPGCLFIA
                     ACSAFPDPLHPIHQIAEQQKQASYQYTKALLEELETDDTDMVALQLELILEGCLSKLL
                     VKRQLSDVTVAKRLAEDVLRVAMCRKHGALA"
     gene            complement(597429..599147)
                     /gene="dipZ"
                     /locus_tag="DDA3937_RS02705"
                     /old_locus_tag="Dda3937_02715"
                     /db_xref="GeneID:9731963"
     CDS             complement(597429..599147)
                     /gene="dipZ"
                     /locus_tag="DDA3937_RS02705"
                     /old_locus_tag="Dda3937_02715"
                     /function="2.3.4 information transfer; protein related;
                     chaperoning, folding"
                     /function="1.8.2 metabolism; metabolism of other
                     compounds; sulfur metabolism"
                     /function="1.6.15.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; large molecule carriers;
                     cytochromes"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.5.A.1 transport; Transport Electron Carriers;
                     Transmembrane 2-Electron Transfer Carriers; The Disulfide
                     Bond Oxidoreductase D (DsbD) Family"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316253.1"
                     /note="two electrons are transferred from cytoplasmic
                     NADPH to thioredoxin and then to the inner membrane
                     protein DsbD which keeps the disulfide isomerase DsbC in a
                     reduced state in the oxidizing periplasm; DsbC in turns
                     rearranges incorrectly made disulfide bonds in the
                     periplasm; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="WP_013316253.1"
                     /db_xref="GI:503081370"
                     /db_xref="GeneID:9731963"
                     /translation="MAQRIFTLTVLCLSLFFSTLAPAQNPFGRSTQSQFLPVDQAFAF
                     DFQQRGDRLTLNWQIHPGYYLYRQQIKLDSALIAPPGLTLPPGEQHRDEFFGEVAIYR
                     QSLTLNVPLRDVPPGASLSITYQGCADAGFCYPPETRSVPLSAISSGTPKAPAAVTPQ
                     PDRAYTPQLPFSPLWALLIGIGVAFTPCVLPMYPLISGLILGRQQRLSAGRTLLLTLV
                     YVQGMALTYTLLGLIVAAAGLRFQAALQHPYVLIGLSVMFVALALSMFGVYSLQLPSS
                     LQTRLTLWSNRQQSGSAAGVFAMGALAGLICSPCTTAPLSALLLYIAQSGNLLAGGGS
                     LYLYALGMGLPLMAITLFGNRLLPKRGPWMTHVKEGFGFVILALPVFLLGRVLGDTWE
                     WRLWGLLGVAFFGWAFALSLRSHAGGMRAVQILLFLGALLAARPLQDWVFAPVQAEPT
                     SGSQLHFMPTNTLDQLTTALNRSDNRITMLDLYADWCVACKEFEKYTFRDAAVQQSLL
                     AMQRLQADITANNETQRALLQHLQVLGLPTILFFDASGREIPGSRVTGFMDAAAFTAH
                     LQTLAR"
     gene            complement(599123..599476)
                     /locus_tag="DDA3937_RS02710"
                     /old_locus_tag="Dda3937_02716"
                     /db_xref="GeneID:9731964"
     CDS             complement(599123..599476)
                     /locus_tag="DDA3937_RS02710"
                     /old_locus_tag="Dda3937_02716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316254.1"
                     /note="copper binding protein required for copper
                     tolerance; involved in resistance toward heavy metals;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation tolerance protein CutA"
                     /protein_id="WP_033112205.1"
                     /db_xref="GI:696581026"
                     /db_xref="GeneID:9731964"
                     /translation="MDNALLNSNALLNNAAVVILCTAPDENCARQLAQSALDARLAAC
                     VTLLPGATSLYHWEGKLEQQTEIQLLLKSDREHQSALLTHLKQQHPYQTPELLVLPVE
                     GGDSDYLSWLNASLR"
     gene            complement(599639..600940)
                     /locus_tag="DDA3937_RS02715"
                     /old_locus_tag="Dda3937_02717"
                     /db_xref="GeneID:9731965"
     CDS             complement(599639..600940)
                     /locus_tag="DDA3937_RS02715"
                     /old_locus_tag="Dda3937_02717"
                     /function="4.2.A.13 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The C4-Dicarboxylate Uptake (Dcu) Family"
                     /function="4.S.46 transport; substrate; dicarboxylate"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_013316255.1"
                     /db_xref="GI:503081372"
                     /db_xref="GeneID:9731965"
                     /translation="MVILELFIVLLAIYLGARLGGIGIGFAGGLGVLVLTLGFHIKPG
                     AIPFDVIEIIMAVIAAIAAMQVAGGMDYLVSLAEKLLRRQPRYVTFLAPLVTYFMTLL
                     AGTGHTAFSTLPVIAEVAKEQGIRPSRPLSIAVVASQIAITASPISAAVVFVAGLLEP
                     KGVSYLALLGICIPSTLIAILLTAVLTNFLGKELKDDEVYQERLRKGEVALRGHGQLM
                     LKPGAKRSVGLFLVGIIAVVLYATAISDTVGLIQNPVLPRNEAIVVFMLTIATLICLT
                     CQVDTSHILSASTFKSGMSACVCVMGVAWLGDTFVKAHLADIQSTAGSLLQSHPWMLA
                     VVLFFAATLLYSQAATAKALMPAALLLGVSPVTAIASFAAVSALFVLPTYPTLLAAVE
                     MDDTGSTRIGKYVFNHAFLIPGVVAISLSVTFGFVIGHLVL"
     gene            complement(601115..602554)
                     /gene="aspA"
                     /locus_tag="DDA3937_RS02720"
                     /old_locus_tag="Dda3937_02718"
                     /db_xref="GeneID:9731966"
     CDS             complement(601115..602554)
                     /gene="aspA"
                     /locus_tag="DDA3937_RS02720"
                     /old_locus_tag="Dda3937_02718"
                     /function="1.7.13 metabolism; central intermediary
                     metabolism; amino acid conversion"
                     /function="1.5.1.6 metabolism; building block
                     biosynthesis; amino acids; asparagine"
                     /function="1.5.1.7 metabolism; building block
                     biosynthesis; amino acids; lysine, diaminopimelate"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943169.1"
                     /note="catalyzes the formation of fumarate from aspartate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="WP_013316256.1"
                     /db_xref="GI:503081373"
                     /db_xref="GeneID:9731966"
                     /translation="MSDNIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNQKISDI
                     PEFVRGMVMVKKAAAMANRELQTIPRKIADTIIKACDEVLVNGKCLDQFPVDVFQGGA
                     GTSVNMNTNEVLANIGLELMGHKKGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYNCI
                     LKLVEAVTVLGDGFEQKAKAFENILKMGRTQLQDAVPMSLGQEFHAFNVLLKEENKNL
                     LRTAELLLEVNLGATAIGTRLNTPEGYQPLAVQKLAEVSKLACVPAEDLIEATSDCGA
                     YVMVHSTLKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPE
                     VVNQVCFKVIGNDTCVTMAAEAGQLQLNVMEPVIGQAMFESTQILTNACYNLLEKCVE
                     GITANKDVCESYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTE
                     AELDDIFSVQNLMHPAYKAKRYTEDQDAS"
     gene            602997..603524
                     /gene="fxsA"
                     /locus_tag="DDA3937_RS02725"
                     /old_locus_tag="Dda3937_02719"
                     /db_xref="GeneID:9731967"
     CDS             602997..603524
                     /gene="fxsA"
                     /locus_tag="DDA3937_RS02725"
                     /old_locus_tag="Dda3937_02719"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316257.1"
                     /note="F exclusion of bacteriophage T7; overproduction of
                     this protein in Escherichia coli inhibits the F
                     plasmid-mediated exclusion of bacteriophage T7; interacts
                     with the F plasmid-encoded PifA protein; inner membrane
                     protein; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exclusion suppressor FxsA"
                     /protein_id="WP_013316257.1"
                     /db_xref="GI:503081374"
                     /db_xref="GeneID:9731967"
                     /translation="MRWLPLLLIFLFVYIEVSIFVRVAEVLGVAPTLLLVVLTSCIGI
                     SMVRNQGVKNIMLMQQRLQAGESPAAELVKSVSLILAGFLLVVPGFFTDFLGLLLLLP
                     PVQKHLTLKLMPHLQIWRGRPGPGGHGGQGNVFEGEFQRKDDHERLDQSKSDDDHHHD
                     GNSHNGNPPSGSSPR"
     gene            603719..604012
                     /gene="groES"
                     /locus_tag="DDA3937_RS02730"
                     /old_locus_tag="Dda3937_02720"
                     /db_xref="GeneID:9731968"
     CDS             603719..604012
                     /gene="groES"
                     /locus_tag="DDA3937_RS02730"
                     /old_locus_tag="Dda3937_02720"
                     /function="2.3.4 information transfer; protein related;
                     chaperoning, folding"
                     /function="5.1 cell processes; cell division"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1JIP2.1"
                     /note="10 kDa chaperonin; Cpn10; GroES; forms
                     homoheptameric ring; binds to one or both ends of the
                     GroEL double barrel in the presence of adenine nucleotides
                     capping it; folding of unfolded substrates initiates in a
                     GroEL-substrate bound and capped by GroES; release of the
                     folded substrate is dependent on ATP binding and
                     hydrolysis in the trans ring; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperonin GroES"
                     /protein_id="WP_013316258.1"
                     /db_xref="GI:503081375"
                     /db_xref="GeneID:9731968"
                     /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEVLAVG
                     HGRILENGEVKPLDVKVGDIVIFNDGYGVKTEKIDNEEVLIMSESDILAIVEA"
     gene            604063..605709
                     /gene="groEL"
                     /locus_tag="DDA3937_RS02735"
                     /old_locus_tag="Dda3937_02721"
                     /db_xref="GeneID:9731969"
     CDS             604063..605709
                     /gene="groEL"
                     /locus_tag="DDA3937_RS02735"
                     /old_locus_tag="Dda3937_02721"
                     /function="2.3.4 information transfer; protein related;
                     chaperoning, folding"
                     /function="5.1 cell processes; cell division"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005120975.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_013316259.1"
                     /db_xref="GI:503081376"
                     /db_xref="GeneID:9731969"
                     /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSF
                     GSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNE
                     GLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCADTKAIAQVGTISANSDETVGK
                     LIAEAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSVELESP
                     FILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAV
                     KAPGFGDRRKAMLQDIATLTSGTVISEEIGLELEKATLEDLGQAKRVVINKDTTTIID
                     GVGDEATIQGRVTQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEK
                     KARVEDALHATRAAVEEGVVAGGGVALIRVATAINGLKGDNEEQNVGIKVAQRAMEAP
                     LRQIVSNAGEEPSVVANNVKAGEGNYGYNAATEQYGNMIDMGILDPTKVTRSALQYAA
                     SVAGLMITTECMVTELPKGDAPDLGAAGGMGGMGGMGGMM"
     gene            606034..606549
                     /locus_tag="DDA3937_RS02740"
                     /old_locus_tag="Dda3937_02722"
                     /db_xref="GeneID:9731970"
     CDS             606034..606549
                     /locus_tag="DDA3937_RS02740"
                     /old_locus_tag="Dda3937_02722"
                     /function="1.5.3.11 metabolism; building block
                     biosynthesis; cofactor, small molecule carrier;
                     menaquinone, ubiquinone"
                     /function="1.3.6 metabolism; energy metabolism, carbon;
                     aerobic respiration"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate pyruvate lyase"
                     /protein_id="WP_013316260.1"
                     /db_xref="GI:503081377"
                     /db_xref="GeneID:9731970"
                     /translation="MSDEALASLHSVEWCTPENLPASVVDWLLYRDSMTRRLERHCLR
                     LTVQVSEELFVSSLDVAGESALLPLSERYWLREVTLLGDGKPWLFGRTVIPEQTLEEA
                     DIDLTQVGNTPLGRYLFLQGPPPRDVIQTGQSGALWVRRSRLLLSGNPLLITELFLPD
                     APIYYPDAHQG"
     gene            606619..607434
                     /gene="ubiA"
                     /locus_tag="DDA3937_RS02745"
                     /old_locus_tag="Dda3937_02723"
                     /db_xref="GeneID:9731971"
     CDS             606619..607434
                     /gene="ubiA"
                     /locus_tag="DDA3937_RS02745"
                     /old_locus_tag="Dda3937_02723"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316261.1"
                     /note="catalyzes the conversion of 4-Hydroxybenzoate into
                     3-octaprenyl-4-hydroxybenzoate, as part of the ubiquinone
                     biosynthesis pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate polyprenyltransferase"
                     /protein_id="WP_042318725.1"
                     /db_xref="GI:754962803"
                     /db_xref="GeneID:9731971"
                     /translation="MRINNPIGTLLLLWPTLWALWLAGRGTPAPWTLLVFVAGVFLMR
                     AAGCVINDYADRHFDGHVKRTAARPLPAGLVSEQAAKVLFVVLVLLAFGLVLTMNPLT
                     IWLSVAALALAWVYPFMKRVSHLPQLVLGAAFGWSIPMAYAAVSESLPATCWLMFFAY
                     ICWTVAYDTEYAMVDRDDDLKIGIKSTAILFGRHDTLIVGVLQLVTLVAMLALGRMMG
                     LSQIFYWSVLAAAALFAYQQKLIAGRERDDCFRAFNNNNYVGMVLFFGILFGL"
     gene            complement(607513..610002)
                     /locus_tag="DDA3937_RS02750"
                     /old_locus_tag="Dda3937_02724"
                     /db_xref="GeneID:9731972"
     CDS             complement(607513..610002)
                     /locus_tag="DDA3937_RS02750"
                     /old_locus_tag="Dda3937_02724"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="1.6.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; phospholipid"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316262.1"
                     /note="PlsB; catalyzes the formation of 1-acyl-sn-glycerol
                     3-phosphate by transfering the acyl moiety from acyl-CoA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_013316262.1"
                     /db_xref="GI:503081379"
                     /db_xref="GeneID:9731972"
                     /translation="MSGWRRIYYKLLNFPLKLLVKSKVIPQDPVNEQRLDPARPIFYV
                     LPYNSKADLLTLRTKCLELSLPDPLQPLQIDGKILPSYVFVNDGPRLFRYYVPKQQSI
                     KLFHDYLDLHRNNPELDIQMVPVSVMFGRSPGREGQNQDTPHLRLLNGIEKFFAVLWL
                     GRDSFVRFSVPVSLRYMATEHGTDKTIAHKLARVARMHFSRLRLAAVGPRLPVRQELF
                     NKLLSSRAIAKAIDDEARVKKISHDKAQQNAITLLEEIAADFSYEAVRLSDRVLSWTW
                     NRLYQGINVHNAERVRQLAQDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGI
                     NLNFWPAGPIFRRLGAFFIRRTFKGNKLYSTLFREYLGELFTRGYSVEYFVEGGRSRT
                     GRLLEPKTGTLAMTIQAMLRGGTRQITLVPIYIGYEHVMEVGTYAKELRGATKEKEGF
                     LQMVRGLRKLRNLGQGYVNIGEPLSLTTYLNNRVPQWRDAIDPIDPQRPAWLTPTVQD
                     IADDIMVRINNAAAANAMNLCCTALLASRQRALTREQMEEQLECYLQLLRNVPYSSDI
                     TVPKKTATELLEHALGMDKFEVEKDNVGDIIILPREQAVLMTYYRNNIHHMLVLPSLV
                     ASIVMHYRRISAGELLRQITLVYPLLQAELFLHYKQSELSDVLDALVAELARQQLILI
                     KDDGLELNPARIRALQLLAAGVRETLQRYAITLALLNANPTISRGALEKESRSMAQRL
                     SVLHGINAPEFFDKAVFSTLVNTLRNEGYVSDSGEAVLVHVQAIYAILGELLSPEVKL
                     TIESASLAQESGDGDSESVVGDVEKEKEEVE"
     gene            610131..610496
                     /locus_tag="DDA3937_RS02755"
                     /old_locus_tag="Dda3937_02725"
                     /db_xref="GeneID:9731973"
     CDS             610131..610496
                     /locus_tag="DDA3937_RS02755"
                     /old_locus_tag="Dda3937_02725"
                     /function="1.5.4 metabolism; building block biosynthesis;
                     fatty acid and phosphatidic acid"
                     /function="1.6.1 metabolism; macromolecules (cellular
                     constituent) biosynthesis; phospholipid"
                     /function="6.1 cell structure; membrane"
                     /function="7.3 location of gene products; inner membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316263.1"
                     /note="catalyzes the phosphorylation of diacylglycerol to
                     form diacylglycerol phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_013316263.1"
                     /db_xref="GI:503081380"
                     /db_xref="GeneID:9731973"
                     /translation="MNKTTGITRIIKAAGYSLQGLQQAWRHEAAFRQESLLTLAAIII
                     ACWLPVAMVERLLLIGSVVLIVLFELVNSAIEAVVDRIGMDYHELSGRAKDIGSAAVF
                     VACLLAAGVWGAILWNRFA"
     gene            610606..611217
                     /locus_tag="DDA3937_RS02760"
                     /old_locus_tag="Dda3937_02726"
                     /db_xref="GeneID:9731974"
     CDS             610606..611217
                     /locus_tag="DDA3937_RS02760"
                     /old_locus_tag="Dda3937_02726"
                     /function="LexA controls the expression of genes involved
                     in DNA repair (the SOS regulon)"
                     /function="5.8 cell processes; SOS response"
                     /function="2.1.4 information transfer; DNA related; DNA
                     repair"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.2 regulation; genetic unit regulated;
                     regulon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316264.1"
                     /note="Represses a number of genes involved in the
                     response to DNA damage; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LexA repressor"
                     /protein_id="WP_013316264.1"
                     /db_xref="GI:503081381"
                     /db_xref="GeneID:9731974"
                     /translation="MKALTTRQQQVYDLIRDHISQTGMPPTRAEIASQLGFRSPNAAE
                     EHLKALARKGVIEIVTGASRGIRLLMEEEDQGLPLIGRVAAGEPLLAQQHIECHYQVD
                     PAMFKPSADFLLRVSGMSMKDIGILDGDLLAVHKTQDVRNGQVVVARIEDEVTVKRLK
                     KQGNVVQLLAENKEFAPIVVDLREQSFSIEGLAVGVIRNSDWS"
     gene            complement(611561..612070)
                     /locus_tag="DDA3937_RS02765"
                     /old_locus_tag="Dda3937_02727"
                     /db_xref="GeneID:9731975"
     CDS             complement(611561..612070)
                     /locus_tag="DDA3937_RS02765"
                     /old_locus_tag="Dda3937_02727"
                     /function="Zur controls the expression of genes invoved in
                     zinc uptake"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016943161.1"
                     /note="Acts as a negative controlling element, employing
                     Zn(2+) as a cofactor to bind the operator of the repressed
                     genes znuACB; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013316265.1"
                     /db_xref="GI:503081382"
                     /db_xref="GeneID:9731975"
                     /translation="MDSTNPDKLVAQAEQLCQQRNVRLTPQRQEVLRLMAQQPGAISA
                     YDLLDLLRVSEPQAKPPTVYRALDFLLEQGFIHKVESTNSYVLCHHFEEHSHTSALFI
                     CDRCGLVTERQTEGVEETLHQLAKQSGFALRHSVVEAHGLCGECQKVESCEHRDSCNH
                     DHSILVKKR"
     gene            complement(612319..613023)
                     /locus_tag="DDA3937_RS02770"
                     /old_locus_tag="Dda3937_02728"
                     /db_xref="GeneID:9731976"
     CDS             complement(612319..613023)
                     /locus_tag="DDA3937_RS02770"
                     /old_locus_tag="Dda3937_02728"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_013316266.1"
                     /db_xref="GI:503081383"
                     /db_xref="GeneID:9731976"
                     /translation="MIISRAAEQCGQADYGWLQARYTFSFGHYFDPDLLGFASLRVLN
                     QEVLAPGASFQPRTYPRVDILNILLQGEAEYRDSNGNHTRAKAGEALLLASQPNVSYS
                     EHNIGDSTPLTRLQLWLDACPTRENQSLQRLTLEDQPYQLLASPDESADAFHLRQQVW
                     IHHLNLAAGEQHSLTLNGNRAYLQSIYGTISINGNSATIPNVLRCGDGAFVQQENSLI
                     IRAETATRALLIDLVV"
     gene            613133..614029
                     /locus_tag="DDA3937_RS02775"
                     /old_locus_tag="Dda3937_02729"
                     /db_xref="GeneID:9731977"
     CDS             613133..614029
                     /locus_tag="DDA3937_RS02775"
                     /old_locus_tag="Dda3937_02729"
                     /function="3.1.2 regulation; type of regulation;
                     transcriptional level"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcripitonal regulator"
                     /protein_id="WP_013316267.1"
                     /db_xref="GI:503081384"
                     /db_xref="GeneID:9731977"
                     /translation="MAKERALTLEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQK
                     LEDELDVVLFDRSGHRTKFTNVGRMLLERGRILLEAADKLTTDAEALARGWETHLTIV
                     VEALVPTERFFPLLDKLSLKANTQVSLLTEVLAGAWERLEQGRADIVVAPDMHFRSSS
                     EINTRKLYSMKNVYVASPDHPIHDEPEPLSEVTRIKYRGIAIADTARERPVLTVQLLD
                     KQPRLTVSSMDDKRRALLAGLGVATMPYERVAQDVAEGRLRVVSPENSMEGQIIMAWR
                     RDSMGEAKAWFLREIPRIFNAF"
     gene            complement(614136..615122)
                     /locus_tag="DDA3937_RS02780"
                     /old_locus_tag="Dda3937_02730"
                     /db_xref="GeneID:9731978"
     CDS             complement(614136..615122)
                     /locus_tag="DDA3937_RS02780"
                     /old_locus_tag="Dda3937_02730"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316268.1"
                     /db_xref="GI:503081385"
                     /db_xref="GeneID:9731978"
                     /translation="MGLLVDGVWHDTWYETQSSGGHFKRPQTFFRNWVTADGEAGPTG
                     TGGFKAEAGRYHLYVSLACPWAHRTLLLRKLKGLEQHIDVSVVHPLMLDHGWTFDTDF
                     PQATGDTLYQHEFLYQLYLHAKADYSGRVTVPVLWDTQQHTIVSNESADIIRMLNSAF
                     DGCGAATGDYYPQALRGQIDELNEWIYHQVNNGVYKAGFATTQTAYDESVGLVFTALD
                     KLETILARQRYLAGDRLTEADIRLWTTLIRFDPVYHTHFKCDKRRISDYPNLYGYLRE
                     IYQLPGISDTVDMAHIRHHYYRSHSTINPHGIISVGPEMDLNAPHGRDKRYP"
     gene            complement(615228..615623)
                     /locus_tag="DDA3937_RS02785"
                     /old_locus_tag="Dda3937_02731"
                     /db_xref="GeneID:9731979"
     CDS             complement(615228..615623)
                     /locus_tag="DDA3937_RS02785"
                     /old_locus_tag="Dda3937_02731"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012883291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_033111581.1"
                     /db_xref="GI:696580402"
                     /db_xref="GeneID:9731979"
                     /translation="MKNFENALLMVARILLPILFIVAGYGKLGASYAATQQYMQAMGV
                     PGALLPLTILLELGGGLAVLFGFMTRTAAIATAIFTLLTAFIFHTDFAQGANQLMFMK
                     NLSIAGGYVLLFVTGPGAFSIDRLLNKKW"
     gene            complement(615924..616229)
                     /locus_tag="DDA3937_RS02790"
                     /old_locus_tag="Dda3937_02732"
                     /db_xref="GeneID:9731980"
     CDS             complement(615924..616229)
                     /locus_tag="DDA3937_RS02790"
                     /old_locus_tag="Dda3937_02732"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316270.1"
                     /db_xref="GI:503081387"
                     /db_xref="GeneID:9731980"
                     /translation="MNRQQRLAAEKQQLLRQIQQQRLDLAANKNRWLEITAPCDDCWQ
                     KLARIRRYLVVIPPVVAILGIRHPRRLMGFVRKAASIWSVLKLIRSAVPSPPRPPRR"
     gene            complement(616226..616624)
                     /locus_tag="DDA3937_RS02795"
                     /old_locus_tag="Dda3937_02733"
                     /db_xref="GeneID:9731981"
     CDS             complement(616226..616624)
                     /locus_tag="DDA3937_RS02795"
                     /old_locus_tag="Dda3937_02733"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013316271.1"
                     /db_xref="GI:503081388"
                     /db_xref="GeneID:9731981"
                     /translation="METEPQRQGPGSSAVSTVQRILAILVGIAETRLRLAVVELEQEK
                     TLLIQLLLMVGLTLLFTAFGLMSLIVLIIWSLDPALRLTALCWITAALFGLALFGALW
                     TLKRLRRSTLLRDTRKELATDRSLLEDESK"
     gene            complement(616628..616933)
                     /locus_tag="DDA3937_RS02800"
                     /old_locus_tag="Dda3937_02734"
                     /db_xref="GeneID:9731982"
     CDS             complement(616628..616933)
                     /locus_tag="DDA3937_RS02800"
                     /old_locus_tag="Dda3937_02734"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013316272.1"
                     /db_xref="GI:503081389"
                     /db_xref="GeneID:9731982"
                     /translation="MAQEPNTEQLRAELRSLGDTLEEVLRSSSDKSKAELEKLRDKAE
                     TVLKESRERLNDTGERITAQAREATQCADDFVHKNPWTGVGIGAAVGMVLGLLLARR"
     gene            complement(617132..617482)
                     /locus_tag="DDA3937_RS02805"
                     /old_locus_tag="Dda3937_02735"
                     /db_xref="GeneID:9731983"
     CDS             complement(617132..617482)
                     /locus_tag="DDA3937_RS02805"
                     /old_locus_tag="Dda3937_02735"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:E0SKT0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="modulator protein"
                     /protein_id="WP_033111582.1"
                     /db_xref="GI:696580403"
                     /db_xref="GeneID:9731983"
                     /translation="MTNRRFRKPSAWRLLLLLLPLVVLLSMSSRRLPDEVMLHITPLH
                     QGAPLPDGFYIYQRLNERGIAIKSITPENDSIIVRLSSPEQSGAAREILSTALPYAIV
                     IAQRSNGTSPVTRS"
     gene            complement(617486..618160)
                     /locus_tag="DDA3937_RS02810"
                     /old_locus_tag="Dda3937_02736"
                     /db_xref="GeneID:9731984"
     CDS             complement(617486..618160)
                     /locus_tag="DDA3937_RS02810"
                     /old_locus_tag="Dda3937_02736"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013316274.1"
                     /db_xref="GI:503081391"
                     /db_xref="GeneID:9731984"
                     /translation="MDIVKELLYALWHQNFDVLANPKLVWTIYLLLFLILFLENGLLP
                     AAFLPGDSLLILVGVLVAKGTMNYPFTIALLTTAASLGCWVSYLQGKWLGNTRVVQGW
                     LSHLPSHYHQRAHQLFHRHGLSALLVGRFLAFVRTLLPTIAGLSGLNSARFQFFNWMS
                     GFLWVIILVSLGFALGKTSVFRKYEDQLMFCLMLLPLVLLFIGLAGSLLVLWRKKRMM
                     AREKRN"
     gene            complement(618904..619683)
                     /locus_tag="DDA3937_RS02815"
                     /old_locus_tag="Dda3937_02737"
                     /db_xref="GeneID:9731985"
     CDS             complement(618904..619683)
                     /locus_tag="DDA3937_RS02815"
                     /old_locus_tag="Dda3937_02737"
                     /function="ExuR controls the expression of the exuT and
                     uxaCBA genes"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.3 regulation; type of regulation;
                     transcriptional level; repressor"
                     /function="3.3.2 regulation; genetic unit regulated;
                     regulon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316275.1"
                     /note="regulates the expression of uxuBA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013316275.1"
                     /db_xref="GI:503081392"
                     /db_xref="GeneID:9731985"
                     /translation="MALTESRRLYQQLAAELKQRIENGVYPVGDKLPAERNISEEMNV
                     SRTVVREAIIMLEVEGYVEVRKGSGIHVMSSQQRHLLAANGSDADFLTAGPFELLQAR
                     QLIESNIAEFAATQVTRQDIIQLMEIQENARQEDRFRDSEWDLKFHVQVALATQNSAM
                     ATIVEKMWSQRIHNPYWRKLHEHIDDKSIESWCEEHDQILKALIRKDPYAAKLAMWQH
                     LENTKQMLFRSTTDDFEFNVDRYMFAENPVVHLDHITNGKS"
     gene            complement(620052..621350)
                     /locus_tag="DDA3937_RS02820"
                     /old_locus_tag="Dda3937_02738"
                     /db_xref="GeneID:9731986"
     CDS             complement(620052..621350)
                     /locus_tag="DDA3937_RS02820"
                     /old_locus_tag="Dda3937_02738"
                     /function="4.2.A.1 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Major Facilitator Superfamily (MFS)"
                     /function="4.S.87 transport; substrate; hexuronate"
                     /function="7.3 location of gene products; inner membrane"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316276.1"
                     /note="involved in the transport of aldohexuronates;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hexuronate transporter ExuT"
                     /protein_id="WP_013316276.1"
                     /db_xref="GI:503081393"
                     /db_xref="GeneID:9731986"
                     /translation="MFKIKGLRWYMIGLVTIGTVLGYLTRNAIAAAAPTLQEQLHIST
                     QQYSYIIAAYSACYTIMQPVAGYVLDLLGTKVGYAMFAVLWALFCAGTALASSWGGLA
                     IARGAVGAAEAAMIPAGLKASSEWFPAKERSVAVGYFNVGSSIGGMLAPPLVVWAIMA
                     HSWQMAFLVTGALSMVWALCWLYFYKHPKDQKKLSSEEREYILGGQEAQHQAGNAKKM
                     SAWQILRNRQFWGIALPRFLAEPAWGTFNAWIPLFMFKVYGFNLKEIAMFAWMPMLFA
                     DLGCILGGYMPMMFQKYFKVNLIVSRKLVVTLGALLMIGPGTIGLFTSPYIAIALLCV
                     GGFAHQSLSGALITLSSDVFGRNEVATANGLTGMAAWTASTLFALVVGALADTIGFSP
                     LFAVLAIFDLLGAVVIWTVLKNNPASEGSNDAELKAAQQH"
     gene            621865..623283
                     /locus_tag="DDA3937_RS02825"
                     /old_locus_tag="Dda3937_02739"
                     /db_xref="GeneID:9731987"
     CDS             621865..623283
                     /locus_tag="DDA3937_RS02825"
                     /old_locus_tag="Dda3937_02739"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316277.1"
                     /note="catalyzes the interconversion of D-glucuronate to
                     D-fructuronate or D-galacturonate to D-tagaturonate;
                     functions in glucuronic and galacturonic metabolism;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucuronate isomerase"
                     /protein_id="WP_013316277.1"
                     /db_xref="GI:503081394"
                     /db_xref="GeneID:9731987"
                     /translation="MPQFLSEDFLLDTEFARRLYHEFAADQPIFDYHCHLPPAQIAEN
                     YRFKNLYDIWLKGDHYKWRAMRTNGVPERLCTGDASDWEKFEAWAATVPHTIGNPLYH
                     WTHLELRRPFGVTGTLLSPSTAKDIWNRTNALLERDEFTARGIMQQMNVKMVGTTDDP
                     IDDLLHHKAVAQDKTFSIKVLPSWRPDKAFNIELATFNDYMAKLGEVSDTDIRRFSDL
                     QAALTKRLDHFAAHGCKVSDHALDVVLYADADEATLDGILARRLSGATLSEHEVAQFK
                     TAVLVWLGAEYARRGWVQQYHIGALRNNNLRQFNLLGPDVGFDSINDRPMAQELSRLL
                     SKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQGEGMPGKMQFGSGWWFNDQKDGMQR
                     QMTQLAQLGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVEDGEAPGDLPLLG
                     EMVKNICFDNAKNYFGIELYQK"
     gene            623578..625029
                     /locus_tag="DDA3937_RS02830"
                     /old_locus_tag="Dda3937_02740"
                     /db_xref="GeneID:9731988"
     CDS             623578..625029
                     /locus_tag="DDA3937_RS02830"
                     /old_locus_tag="Dda3937_02740"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316278.1"
                     /note="catalyzes the formation of D-tagaturonate from
                     D-altronate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="altronate oxidoreductase"
                     /protein_id="WP_013316278.1"
                     /db_xref="GI:503081395"
                     /db_xref="GeneID:9731988"
                     /translation="MQTLNRRDFPGRRHPDRVIQFGEGNFLRAFIDWQLDLLNEHTDL
                     DAGIVVVRPIDTDFPPALDTQDGLYTTIIRGLNEQGEAVREPRLIRSVNREINVYRQF
                     DDYLALAHDANIRFVFSNTTEAGISYHADDRLTDTPPASFPAKLTRLLFERFNHFNGA
                     ADKGWVLLPCELIDYNGEKLKELVLRYAAQWELPAAFTAWLNEHNTFCSTLVDRIVTG
                     YPRAEVDALQQELGYQDTFLDTAEYFYLFVIQGPQWLAEELRLNKLKLNVRIVDDIKP
                     YKERKVAILNGAHTALVPVAFLAGLDTVGESLNDAQIGKFVETTIADEIVPVLDLPHD
                     ELVSFAQAVLSRFRNPFIQHQLLSIALNGMTKFRTRILPQLLTYRERHGALPKRLTFA
                     LAALIAFYRGERNGDSYPLQDDAHWLERYEVLWGGVRAGTTSLAQVVNAVLGDAEHWE
                     QDLTLVPGLAALVTEQLQAIVERGMRDAVAGYC"
     gene            625048..626538
                     /locus_tag="DDA3937_RS02835"
                     /old_locus_tag="Dda3937_02741"
                     /db_xref="GeneID:9731989"
     CDS             625048..626538
                     /locus_tag="DDA3937_RS02835"
                     /old_locus_tag="Dda3937_02741"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="altronate hydrolase"
                     /protein_id="WP_013316279.1"
                     /db_xref="GI:503081396"
                     /db_xref="GeneID:9731989"
                     /translation="MQSIIKIHSLDNVAVALRDLAQDETVSVGDISLTLPQAVARGHK
                     FALKPIAPGDMIVKYGLPIGHALVAIAPGEHIHSQNAKTNLSDLDQYQYQPEFIDLPA
                     QVADREVEIYRRKNGDVGIRNELWILPTVGCVNGIARQIQQRFLKETNDAEGIDGVYL
                     FTHPFGCSQLGQDHENTRTMLQNMVRHPNAGAVLVIGLGCENNQVSAFRDTLGEFDAD
                     RVNFMICQQQEDEVEAGLERLHQLYQVMRDDRRVPGKLSELKFGLECGGSDGLSGITA
                     NPLLGRFSDYLIANGGTTVLTEVPEMFGAERILMSRCRDEATFEKTVHMVNDFKQYFI
                     EHNQPIYENPSPGNKAGGITTLEEKSLGCTQKAGQSQVVDVLKYGERLHTPGLNLLSA
                     PGNDAVATSALAGAGCHMVLFSTGRGTPYGGFVPTVKLATNTELAQKKPHWIDFDAGR
                     LIHGMSMDELLSQFVDLIVEIANGKQAKNEINDFRELAIFKSGVTL"
     gene            626669..627214
                     /locus_tag="DDA3937_RS02840"
                     /old_locus_tag="Dda3937_02742"
                     /db_xref="GeneID:9731990"
     CDS             626669..627214
                     /locus_tag="DDA3937_RS02840"
                     /old_locus_tag="Dda3937_02742"
                     /function="0.1 unknown function; conserved hypothetical
                     product"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013316280.1"
                     /db_xref="GI:503081397"
                     /db_xref="GeneID:9731990"
                     /translation="MTSYVFAQAVGVLAFLVGITMFFNRSEKKFKIQLSAYSAVIACH
                     FFLMGANAAGMSAMLNSGRTLITLKTNNTAVMFVFIILTLALGLPGVKHPMELLPIIG
                     TVCSTWALFRAHGLAMRGIIWCSTSLWVIHNIWLGSIGGSLIEASFLVMNGYNIVRFW
                     RMQRNGIDPFKMDEHSSTKSA"
     gene            complement(627260..628213)
                     /locus_tag="DDA3937_RS02845"
                     /old_locus_tag="Dda3937_02743"
                     /db_xref="GeneID:9731991"
     CDS             complement(627260..628213)
                     /locus_tag="DDA3937_RS02845"
                     /old_locus_tag="Dda3937_02743"
                     /function="5.6 cell processes; protection"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015847835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013316281.1"
                     /db_xref="GI:503081398"
                     /db_xref="GeneID:9731991"
                     /translation="MVTIGTPLMWGSFAIIVVVMLAIDLFYQGKKGSTVMTFKQAAVW
                     SMIWVTLSILFNAGFWWYLTGIAGREVADAQALAFFTGYLIEKALAVDNVFVWLMLFS
                     YFAIPAQYQRRVLIYGVLGAIVLRTIMVFAGSWLVSQFQWLLYLFGAFLLLTGLKMAL
                     AKADDTAIGDKPVVRWLRSHLRMTDNLQGEHFFIRQNGLLYATPLFLVLVMVEISDVI
                     FAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAMYFLLAGVAQKFSMLKYGLAVILIFI
                     GIKMMLIDLFHIPVAISLSVVAAILLVTILINIWVNRRAGR"
     gene            628664..629836
                     /locus_tag="DDA3937_RS02850"
                     /old_locus_tag="Dda3937_03553"
                     /db_xref="GeneID:9731993"
     CDS             628664..629836
                     /locus_tag="DDA3937_RS02850"
                     /old_locus_tag="Dda3937_03553"
                     /function="2.2.3 information transfer; RNA related; RNA
                     modification"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="WP_013316282.1"
                     /db_xref="GI:503081399"
                     /db_xref="GeneID:9731993"
                     /translation="MSQLDLETHRLTLVRYPQSDRESSLQAWEAADEYLLRELAAMPI
                     GPGPRLIFNDAFGALACGLQAQAPCGISDSYLSQLATRHNLSLNGFAPESVTLLDSLA
                     PLPDAPALVVLKVPKTLALLEHQLRQLRAVVTPQTVVIAGAKARDIHTSTLQLFEQIL
                     GPTRTSLAWKKARLIHCQPEPRVIDEQPRAIDEQPQTSVWTLDGADSPIHNYRIHNYA
                     NVFARSGLDIGARFFMQHLPQQLDGKIVDLGCGNGVIGLTALALNPQAYVSFFDESYM
                     AVASSQRNVEVNRPQDMARSSFVVNHALAGVGQDSQQAVLCNPPFHQQQAITDDIAWQ
                     MFLDARRCLAVGGELRIVGNRHLDYFHKLKRLFGNCENVASNAKFVVLRAVKTRSR"
     gene            629930..630226
                     /locus_tag="DDA3937_RS02855"
                     /old_locus_tag="Dda3937_03552"
                     /db_xref="GeneID:9731994"
     CDS             629930..630226
                     /locus_tag="DDA3937_RS02855"
                     /old_locus_tag="Dda3937_03552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013316283.1"
                     /db_xref="GI:503081400"
                     /db_xref="GeneID:9731994"
                     /translation="MCIEELEARLDSALQALEDSVSRQQQIWQRDYQQLHLQLAQARQ
                     READLCARINELVTRVNMMDESPERNPLLQKINLIRAHLDALAKEAAAFYRSLP"
     gene            630535..631482
                     /locus_tag="DDA3937_RS02860"
                     /old_locus_tag="Dda3937_03551"
                     /db_xref="GeneID:9731995"
     CDS             630535..631482
                     /locus_tag="DDA3937_RS02860"
                     /old_locus_tag="Dda3937_03551"
                     /function="1.2.4 metabolism; macromolecule degradation;
                     polysaccharides"
                     /function="7.5 location of gene products; extracellular"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019843777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pectate lyase"
                     /protein_id="WP_013316284.1"
                     /db_xref="GI:503081401"
                     /db_xref="GeneID:9731995"
                     /translation="MAYPTTGTSGMVGFAKSGSTTGGTGGTVVSITSLSDLKTHVAGT
                     DTKILVINANISASALTKVTLGANKSIIGSYSSNTLTNIHFRSSSSSKNIIFQNLTFK
                     HTSTINGNDDIQIYLTHGNKYWLDHLTFPGHDYTLTDGGLDKLIYIGEKADYVTISNC
                     LFKNHEYGLILGYPQDGSSNGSTYDGYPHLTICHCYFSNIYVRAPGLMRYGYYHAYNN
                     FIDKYQLGFTLAQNAKIVSEYNYFGTTTSSNKGMLDDKGTGTFTDTGSTPSITNQTSS
                     ASKWTPSSNYSYKLKTVSEAKTFTQNYAGAQSASLTFGG"
     gene            632074..632664
                     /locus_tag="DDA3937_RS02865"
                     /old_locus_tag="Dda3937_03550"
                     /db_xref="GeneID:9731996"
     CDS             632074..632664
                     /locus_tag="DDA3937_RS02865"
                     /old_locus_tag="Dda3937_03550"
                     /function="UhpA controls the expression of the uhpT gene
                     encoding hexose phosphate transport system"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.4.3 regulation; type of regulation;
                     transcriptional level; complex regulation; two component
                     regulatory systems (external signal)"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="7.1 location of gene products; cytoplasm"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005121502.1"
                     /note="response regulator in two-component regulatory
                     system wtih UhpB; phosphorylated UhpA is a positive
                     activator uhpT, a hexose phosphates transporter; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013316285.1"
                     /db_xref="GI:503081402"
                     /db_xref="GeneID:9731996"
                     /translation="MITLALIDDHLIVRSGFAQLLGLEPDMQVVGEFGSGREALAGLP
                     GRGAQVCICDISMPDLSGLELLAQLPTGMAVIMLSVHDSPALIEQALNAGARGFLSKR
                     CSPDELIAAVRTVAGGGCYLTPDIALKLASGRRDPLTRRERQVAEKLAQGMVVKAIAA
                     ELGLSPKTVHVHRANLMEKLGVNNDVELARRMFDGW"
     gene            632664..634175
                     /locus_tag="DDA3937_RS02870"
                     /old_locus_tag="Dda3937_03549"
                     /db_xref="GeneID:9731997"
     CDS             632664..634175
                     /locus_tag="DDA3937_RS02870"
                     /old_locus_tag="Dda3937_03549"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316286.1"
                     /note="Member of the two-component regulatory system
                     UhpB/UhpA involved in the regulation of the uptake of
                     hexose ph; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_033111583.1"
                     /db_xref="GI:696580404"
                     /db_xref="GeneID:9731997"
                     /translation="MRPIATWLIAAFASCFIFSAAWFCLWSISLHLVTRPDLAALLFP
                     FGLRLGLMLQSPRRFWPVLLGSEWLLLVWLAQEVALANLPLLLTGSMLALLPVMLVSR
                     RPRQDDWHTLLLQGGALIAAALLQSLPWLGRGEDTLTVLLLTLTGGLTLSPTCLLIWH
                     YLSSSTWLPLGPSLVSQPVNWRGRHLLWYLLLFVVSLWLQLGLPAELSRFTPFCLALP
                     IIALAWHYGWQGALIATLMNAIALIASQTWHEHPVDLLLSLLAQSLTGLLLGAGIQRL
                     RELNLSLQNQLARNRRLAERLLETEEDVRRDVARELHDDIGQTITAIRTQAGILQRLA
                     PENRNVRQSGALIEQLSLGVYDSVRRLMGRLRPRQLDDLTLEQAVRSLMREMELEAHG
                     IVSHLAWHIDEASLSEGLRVTLFRVCQEGLNNIVKHANASAVTLQVWQQHERLTLVIE
                     DDGGGLPPGSGAEGFGLLGMRERVTALGGTLQLSCTHGTRLTVSLPLPAGKES"
     gene            634175..635536
                     /locus_tag="DDA3937_RS02875"
                     /old_locus_tag="Dda3937_03548"
                     /db_xref="GeneID:9731998"
     CDS             634175..635536
                     /locus_tag="DDA3937_RS02875"
                     /old_locus_tag="Dda3937_03548"
                     /function="7.3 location of gene products; inner membrane"
                     /function="3.1.2.2 regulation; type of regulation;
                     transcriptional level; activator"
                     /function="1.1.1 metabolism; carbon utilization; carbon
                     compounds"
                     /function="2.2.2 information transfer; RNA related;
                     transcription related"
                     /function="3.1.2.4.2 regulation; type of regulation;
                     transcriptional level; complex regulation; regulons or
                     multilayer component regulatory systems"
                     /function="3.3.1 regulation; genetic unit regulated;
                     operon"
                     /function="6.1 cell structure; membrane"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013316287.1"
                     /note="membrane protein regulates uhpT expression; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="WP_013316287.1"
                     /db_xref="GI:503081404"
                     /db_xref="GeneID:9731998"
                     /translation="MSSFPNIRFPNIRFLTIPASAPPLADRQAIDETYRYWRRHILIT
                     LYLGYALFYFTRKSFNAAVPEIIASGLMARTDIGLLATLFYVTYGASKFLSGIVSDRS
                     NARYFMGIGLLATGVVNILFGFSSSLWAFAALWMANAFFQGWGAPVCARLLTSWYSRT
                     ERGGWWALWNTAHNVGGALIPMVVGAAALHYGWRAGMMIAGSLAILAGLFLCWRLRDK
                     PQTLGLPSVGEWRQDALEIAQQQEGAGLSRREILHKYVFTNPYIWLLACCYVLVYVVR
                     AAINDWGNLYMSETLGVDLVTANSAVTMFELGGFIGALVAGWGSDKLFNGNRGPMSLI
                     FAAGILLSVGSLWLMPFASYVMQAACFFTTGFFVFGPQMLIGMAAAECSHKDAAGAAT
                     GFVGLFAYLGASLSGWPLARIMDVWHWSGFFAVIAVAAGISALLLLPFLRASSPRATT
                     DVA"
     gene            635707..637098
                     /gene="uhpT"
                     /locus_tag="DDA3937_RS02880"
                     /old_locus_tag="Dda3937_03547"
                     /db_xref="GeneID:9731999"
     CDS             635707..637098
                     /gene="uhpT"
                     /locus_tag="DDA3937_RS02880"
                     /old_locus_tag="Dda3937_03547"
                     /function="7.3 location of gene products; inner membrane"
                     /function="4.2.A.1 transport; Electrochemical potential
                     driven transporters; Porters (Uni-, Sym- and Antiporters);
                     The Major Facilitator Superfamily (MFS)"
                     /function="4.S.86 transport; substrate; hexose phosphate"
                     /function="1.1.1 metabolism; carbon utiliza