GenomeNet

Database: RefSeq
Entry: NC_014643
LinkDB: NC_014643
Original site: NC_014643 
LOCUS       NC_014643            2506025 bp    DNA     circular CON 06-JUL-2013
DEFINITION  Rothia dentocariosa ATCC 17931 chromosome, complete genome.
ACCESSION   NC_014643
VERSION     NC_014643.1  GI:311111670
DBLINK      Project: 49331
            BioProject: PRJNA49331
KEYWORDS    RefSeq.
SOURCE      Rothia dentocariosa ATCC 17931
  ORGANISM  Rothia dentocariosa ATCC 17931
            Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
            Micrococcineae; Micrococcaceae; Rothia.
REFERENCE   1  (bases 1 to 2506025)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-NOV-2010) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 2506025)
  AUTHORS   Muzny,D., Qin,X., Buhay,C., Dugan-Rocha,S., Ding,Y., Chen,G.,
            Hawes,A., Holder,M., Jhangiani,S., Johnson,A., Khan,Z., Li,Z.,
            Liu,W., Liu,X., Perez,L., Shen,H., Wang,Q., Watt,J., Xi,L., Xin,Y.,
            Zhou,J., Deng,J., Jiang,H., Liu,Y., Qu,J., Song,X.-Z., Zhang,L.,
            Villasana,D., Johnson,A., Liu,J., Liyanage,D., Lorensuhewa,L.,
            Robinson,T., Song,A., Song,B.-B., Dinh,H., Thornton,R., Coyle,M.,
            Francisco,L., Jackson,L., Javaid,M., Korchina,V., Kovar,C.,
            Mata,R., Mathew,T., Ngo,R., Nguyen,L., Nguyen,N., Okwuonu,G.,
            Ongeri,F., Pham,C., Simmons,D., Wilczek-Boney,K., Hale,W.,
            Jakkamsetti,A., Pham,P., Ruth,R., San Lucas,F., Warren,J.,
            Zhang,J., Zhao,Z., Zhou,C., Zhu,D., Lee,S., Bess,C.,
            Blankenburg,K., Forbes,L., Fu,Q., Gubbala,S., Hirani,K.,
            Jayaseelan,J.C., Lara,F., Munidasa,M., Palculict,T., Patil,S.,
            Pu,L.-L., Saada,N., Tang,L., Weissenberger,G., Zhu,Y., Hemphill,L.,
            Shang,Y., Youmans,B., Ayvaz,T., Ross,M., Santibanez,J., Aqrawi,P.,
            Gross,S., Joshi,V., Fowler,G., Nazareth,L., Reid,J., Worley,K.,
            Petrosino,J., Highlander,S. and Gibbs,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) Human Genome Sequencing Center, Baylor
            College of Medicine, One Baylor Plaza, Houston, TX 77030, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002280.
            Rothia dentocariosa ATCC 17931
            
             Strain source, body site: oral, teeth
            
             Inquiries should be directed to microbe@hgsc.bcm.tmc.edu
            
             This is a reference genome for the Human Microbiome Project. This
            project is co-owned with the Human Microbiome Project DACC.  Source
            DNA provided by American Type Culture Collection (ATCC 17931).
            Funded by by ###Genomes and Genetics at BCM-HGSC### (U54 HG003273).
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler Assembler v. 2.3.10192009
            Genome Coverage          :: 35x
            Sequencing Technology    :: 454
            ##Genome-Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2506025
                     /organism="Rothia dentocariosa ATCC 17931"
                     /mol_type="genomic DNA"
                     /strain="ATCC 17931"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:17931"
                     /db_xref="HMP:0733"
                     /db_xref="HOMD:tax_587"
                     /db_xref="taxon:762948"
     gene            complement(join(2505928..2506025,1..1309))
                     /gene="rpoD"
                     /locus_tag="HMPREF0733_10001"
                     /db_xref="GeneID:9903520"
     CDS             complement(join(2505928..2506025,1..1309))
                     /gene="rpoD"
                     /locus_tag="HMPREF0733_10001"
                     /note="COG: COG0568; Pfam:
                     PF00140,PF04542,PF04539,PF04545; InterPro: IPR014284"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase sigma subunit RpoD"
                     /protein_id="YP_003982893.1"
                     /db_xref="GI:311111671"
                     /db_xref="GeneID:9903520"
                     /translation="MAPATSKKTATGETSEETVAETPKKTTRTKKTAATSKPAKKTPA
                     KKRAAAKTQEDAKSDAEDSVETTAEAVPEEKPKRARKTTTKRKTGGRKKKTDEDEFDL
                     DLDDELDPENVDGEEHEDADEDEEAVAKKEEKKAAEEVAAKGSGFVLTASDDDDAPAQ
                     RVVTPGATADPVKDYLKQIGKVSLLNAQQEVDLAMRIEAGLYAEHKLADNPDMDPKLK
                     KELRWVIHDGKRAKNHLLEANLRLVVSLAKRYTGRGMLFLDLIQEGNLGLIRAVEKFD
                     YSKGFKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLARVQRQMLQDLGREP
                     TPEELGKELDMAPEKVIEVQKYGREPISLHTPLGEDGDSEFGDLIEDSEAVVPADAVS
                     FTLLQEQLHSVLDTLSEREAGVVAMRFGMTDGQPKTLDEIGKVYGVTRERIRQIESKT
                     MSKLRHPSRSQVLRDYLD"
     misc_feature    complement(join(2505931..2506025,1..1306))
                     /gene="rpoD"
                     /locus_tag="HMPREF0733_10001"
                     /note="RNA polymerase sigma factor; Provisional; Region:
                     PRK05901"
                     /db_xref="CDD:235640"
     misc_feature    complement(695..805)
                     /gene="rpoD"
                     /locus_tag="HMPREF0733_10001"
                     /note="Sigma-70 factor, region 1.2; Region: Sigma70_r1_2;
                     pfam00140"
                     /db_xref="CDD:249622"
     misc_feature    complement(395..607)
                     /gene="rpoD"
                     /locus_tag="HMPREF0733_10001"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(137..370)
                     /gene="rpoD"
                     /locus_tag="HMPREF0733_10001"
                     /note="Sigma-70 region 3; Region: Sigma70_r3; pfam04539"
                     /db_xref="CDD:146934"
     misc_feature    complement(join(2505970..2506025,1..121))
                     /gene="rpoD"
                     /locus_tag="HMPREF0733_10001"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    complement(order(2505982..2505984,2505988..2505993,
                     2505997..2506005,2506009..2506014,2506018..2506020,23..28,
                     56..58,86..88))
                     /gene="rpoD"
                     /locus_tag="HMPREF0733_10001"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(1584..3221)
                     /locus_tag="HMPREF0733_10002"
                     /db_xref="GeneID:9901252"
     CDS             complement(1584..3221)
                     /locus_tag="HMPREF0733_10002"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982894.1"
                     /db_xref="GI:311111672"
                     /db_xref="GeneID:9901252"
                     /translation="MTTTSNLTTTYSLHTEEDLIALVLHQFGYWPQESLVLLSVTKHA
                     VGPCIRVNLPDEQQDLEQYFDKLANLVPATVDGFEPITGVFALIFSGNAATRERQLSP
                     ATRTVLHNTDLYIDNRAGISFNQWLPTFYAACNNVHLDLYDVLYCGSVSRWSLDRNQL
                     ALTYRGPIEDIMHSSYYLDRVYEGRRVSAEPLSAYTQCLWDTATSASTNEVTEWEQAS
                     LLWMHTFEEELNQATGRHTVLEHPGYYRQKSIELCYWESALEAVRWVMRTYPPENAEE
                     HDNAISFGDRLRSLISPEIAGYLLCSMNTQATPEFILYQAAKDLPEALGVLDGYDCMH
                     AACGEGSYEPVEPLCYGKPTTRRRTTLPETFYQTFRGESPRIGGIGHGRVSWHDWIRR
                     THRILQQQILDDTCDSSETRPEEHITKIDRMVEFLSGLTKDYKPAWSRLNALEVLCNL
                     LVHAVQSGEQYGRLRLLQAWINWLRGGNTYAGILADIARLHCDEDMPLFQALSESVFP
                     LWITDPVRCWRGDLYFSTLLPHEATAAKVETIEPKAG"
     misc_feature    complement(<2949..3170)
                     /locus_tag="HMPREF0733_10002"
                     /note="Domain of unknown function (DUF4192); Region:
                     DUF4192; pfam13830"
                     /db_xref="CDD:258106"
     gene            complement(3490..4401)
                     /locus_tag="HMPREF0733_10003"
                     /db_xref="GeneID:9901253"
     CDS             complement(3490..4401)
                     /locus_tag="HMPREF0733_10003"
                     /note="Pfam: PF01908; InterPro: IPR002766"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982895.1"
                     /db_xref="GI:311111673"
                     /db_xref="GeneID:9901253"
                     /translation="MLNPEDLYLANNKILHDARLKNLTLVIALSSPQDAGSTAGQLGH
                     FLLKELKNIEVVEFDTDQLHDYRSRRPHIFFNKDHFEQPIMPALKLYAVEDTLDKPFL
                     LLTGSEPDYQWQRFQQALLSIVRTLDPSLVVLVSAFPMPVPHTRPMPVTAHGSRKDLI
                     EGISPWRPKADLHANMTNLLEVLFTENGFDTVGFGINIPQYVSDADLPQGTLTALEHV
                     SMATRLAFPSDELREAARAVHGQINEQVKENPEIGRMISTMEANYDENFRTSNVAIPL
                     SQRDAHKIPGRDEIGAMFERFLEEHEE"
     misc_feature    complement(3649..4329)
                     /locus_tag="HMPREF0733_10003"
                     /note="PAC2 family; Region: PAC2; pfam09754"
                     /db_xref="CDD:255533"
     gene            4627..6120
                     /gene="pepA"
                     /locus_tag="HMPREF0733_10004"
                     /db_xref="GeneID:9901254"
     CDS             4627..6120
                     /gene="pepA"
                     /locus_tag="HMPREF0733_10004"
                     /EC_number="3.4.11.1"
                     /note="COG: COG0260; Pfam: PF02789,PF00883; InterPro:
                     IPR011356"
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl aminopeptidase"
                     /protein_id="YP_003982896.1"
                     /db_xref="GI:311111674"
                     /db_xref="GeneID:9901254"
                     /translation="MSTALSLHTNDLQSLNAEVLVLGVFSGEDGPYLASNSLPDDSAQ
                     SINKLLESLGATGALDQILRLPGVEGASSDIIALIGLGSDTTIDQERLNALRFAAGSA
                     TRQLLGTAHIALDFGITSRDEIEAVAHGAVLGSFSEEGVRSKTADSVRDEAESITIVA
                     KADASEAEPALVRAVILGEATKDARRLVNMPPSHLYPESFANLAAELVKDYSDVSIEV
                     YPYDRLLKEGFGGIAGVGQGSPRKPALAVVKYTPETPSAHVALVGKGITFDTGGNSLK
                     PAASMMTMKCDMAGAASVLHAVLAASELEIPVEVTGYLCLAENMPGGASLRPEDIITI
                     RDGRTVEVLNTDAEGRLVMADGIALASESNPTVILDIATLTGAAMAALGLRTAALMGD
                     EDIRDRVQQAGAKSGEAYWQIPLESYLRASMNSPVADIKNMGSRYGSMMIAGLFLQEF
                     VGEGIPWAHLDIAGPAFNEEGAYGFTPKEGTGFGTATLVNFIESYAQ"
     misc_feature    4639..6108
                     /gene="pepA"
                     /locus_tag="HMPREF0733_10004"
                     /note="multifunctional aminopeptidase A; Provisional;
                     Region: PRK00913"
                     /db_xref="CDD:234863"
     misc_feature    4675..6102
                     /gene="pepA"
                     /locus_tag="HMPREF0733_10004"
                     /note="Cytosol aminopeptidase family, N-terminal and
                     catalytic domains.  Family M17 contains zinc- and
                     manganese-dependent exopeptidases ( EC  3.4.11.1),
                     including leucine aminopeptidase. They catalyze removal of
                     amino acids from the N-terminus of a protein and...;
                     Region: Peptidase_M17; cd00433"
                     /db_xref="CDD:238247"
     misc_feature    order(4780..4785,4822..4824,4849..4851,4894..4896,
                     5191..5193,5197..5205,5338..5340,5344..5346,5428..5430,
                     5446..5448,5461..5463,5470..5472,5479..5484,5578..5580,
                     5584..5595,5599..5601,5605..5619,5635..5637,5641..5643,
                     5653..5655,5761..5775,5782..5784,5857..5862,5866..5868,
                     5881..5883,5887..5892,5905..5907,5911..5913,5938..5943,
                     5947..5949,6058..6060)
                     /gene="pepA"
                     /locus_tag="HMPREF0733_10004"
                     /note="interface (dimer of trimers) [polypeptide binding];
                     other site"
                     /db_xref="CDD:238247"
     misc_feature    order(5416..5418,5431..5433,5452..5454,5485..5487,
                     5662..5664,5668..5670,5674..5676,5746..5748)
                     /gene="pepA"
                     /locus_tag="HMPREF0733_10004"
                     /note="Substrate-binding/catalytic site; other site"
                     /db_xref="CDD:238247"
     misc_feature    order(5416..5418,5431..5433,5485..5487,5662..5664,
                     5668..5670)
                     /gene="pepA"
                     /locus_tag="HMPREF0733_10004"
                     /note="Zn-binding sites [ion binding]; other site"
                     /db_xref="CDD:238247"
     gene            6447..7829
                     /gene="lpd"
                     /locus_tag="HMPREF0733_10005"
                     /db_xref="GeneID:9901255"
     CDS             6447..7829
                     /gene="lpd"
                     /locus_tag="HMPREF0733_10005"
                     /EC_number="1.8.1.4"
                     /note="COG: COG1249; Pfam: PF07992,PF00070,PF02852;
                     InterPro: IPR006258"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoyl dehydrogenase"
                     /protein_id="YP_003982897.1"
                     /db_xref="GI:311111675"
                     /db_xref="GeneID:9901255"
                     /translation="MQGSNIVAQEFDILILGGGSAGYSAALRARQLGFTVGLVEKEKV
                     GGTCLHTGCIPTKAYLHAAELAEDAREASKVGVNATLESIEMGKVRDYKDGIVAGKFK
                     GLSGLLKMKGVEVIAGEGKLTAQDTVTVNGTDYKGKNIILASGSISKTFGLPIEGRVL
                     TSTEALEMDYLPKSAIVLGGGVIGCEFASMWKAMGVDVTIIEGLPNLVPNEDPAIIKV
                     LERAFKKRGIKFNTGTFFEKVEQDANGAKVTLADGKVFEADIVLVAVGRGPNTANMGY
                     EEQGIPMDRGFVLANERLHTGVGNIYAVGDIVPGVQLAHRGYQQGIFVAEEIAGLNPT
                     VVPDVNIPKVTFCDPEIASVGYSEPKAKEKFGEDNVEVAEYNLAGNGKSSILGASGIV
                     KVVREKDGPIVGVHAIGKRMGEQIGEAQMWVDWEAFPEDVAKFIHAHPTQNESLGEAA
                     MALNGTPLHG"
     misc_feature    6468..7823
                     /gene="lpd"
                     /locus_tag="HMPREF0733_10005"
                     /note="dihydrolipoamide dehydrogenase; Reviewed; Region:
                     PRK06416"
                     /db_xref="CDD:235798"
     misc_feature    6474..>6701
                     /gene="lpd"
                     /locus_tag="HMPREF0733_10005"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    6630..>7310
                     /gene="lpd"
                     /locus_tag="HMPREF0733_10005"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    6966..7205
                     /gene="lpd"
                     /locus_tag="HMPREF0733_10005"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    7467..7796
                     /gene="lpd"
                     /locus_tag="HMPREF0733_10005"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            7997..9670
                     /gene="sucB"
                     /locus_tag="HMPREF0733_10006"
                     /db_xref="GeneID:9901256"
     CDS             7997..9670
                     /gene="sucB"
                     /locus_tag="HMPREF0733_10006"
                     /EC_number="2.3.1.61"
                     /note="COG: COG0508; Pfam: PF00364,PF02817,PF00198;
                     InterPro: IPR014276"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoyllysine-residue succinyltransferase"
                     /protein_id="YP_003982898.1"
                     /db_xref="GI:311111676"
                     /db_xref="GeneID:9901256"
                     /translation="MSHTVELPALGESVTEGTVTRWLVAVGDTVAVDDPIVEVSTDKV
                     DTEIPSPVAGVVEQILVEEDEDVEVGAALVVIGDGSSAPTAAPAAPAAEAPAASAPAA
                     PEAPAAAAASAAGSVSGQEVTLPALGESVTEGTVTRWLKEVGEQVEVDEPLVEVSTDK
                     VDTEIPSPVAGTLLEIRIPEDEEAEVGQVLAIIGDSSAAAAPAAPAAPAPAAAAPAPA
                     TPAAPAAPASAPDTPATPAAPAADGEAYVTPLVRKLAKDNGIDLSTVKGTGVGGRIRK
                     QDVQAAIAAKGSTAPAAAPAASAAPAADGAPKAAHTFEVSPKRGTVEKTARIRQVIAK
                     RMRESLDISTQLTQVTEVDMTRVAQLRAKAKDGFLAREGAKLTFLPFFAQAVTEALQQ
                     HPALNASMTEDLKQITYPDSENVAIAVDTPKGLLVPVIKNASDLGIAGLAKAIGDLGG
                     RARTGDIAPEELTGSTFTITNIGSFGALFDTPIINQPNVAILGTGSIVKRPMVVKDVD
                     GNDSIAIRSMCYLSLTYDHRVVDGADAGRFLYTLKTRLEEANFEAELGL"
     misc_feature    7997..9667
                     /gene="sucB"
                     /locus_tag="HMPREF0733_10006"
                     /note="2-oxoglutarate dehydrogenase, E2 component,
                     dihydrolipoamide succinyltransferase; Region: SucB_Actino;
                     TIGR02927"
                     /db_xref="CDD:200219"
     misc_feature    8006..8224
                     /gene="sucB"
                     /locus_tag="HMPREF0733_10006"
                     /note="Lipoyl domain of the dihydrolipoyl acyltransferase
                     component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
                     dehydrogenase multienzyme complexes, like pyruvate
                     dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
                     and branched-chain 2-oxo acid...; Region: lipoyl_domain;
                     cd06849"
                     /db_xref="CDD:133458"
     misc_feature    order(8093..8095,8114..8131,8141..8143)
                     /gene="sucB"
                     /locus_tag="HMPREF0733_10006"
                     /note="E3 interaction surface; other site"
                     /db_xref="CDD:133458"
     misc_feature    8123..8125
                     /gene="sucB"
                     /locus_tag="HMPREF0733_10006"
                     /note="lipoyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133458"
     misc_feature    8354..8575
                     /gene="sucB"
                     /locus_tag="HMPREF0733_10006"
                     /note="Lipoyl domain of the dihydrolipoyl acyltransferase
                     component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
                     dehydrogenase multienzyme complexes, like pyruvate
                     dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
                     and branched-chain 2-oxo acid...; Region: lipoyl_domain;
                     cd06849"
                     /db_xref="CDD:133458"
     misc_feature    order(8444..8446,8465..8482,8492..8494)
                     /gene="sucB"
                     /locus_tag="HMPREF0733_10006"
                     /note="E3 interaction surface; other site"
                     /db_xref="CDD:133458"
     misc_feature    8474..8476
                     /gene="sucB"
                     /locus_tag="HMPREF0733_10006"
                     /note="lipoyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133458"
     misc_feature    8723..8839
                     /gene="sucB"
                     /locus_tag="HMPREF0733_10006"
                     /note="e3 binding domain; Region: E3_binding; pfam02817"
                     /db_xref="CDD:251550"
     misc_feature    9002..9640
                     /gene="sucB"
                     /locus_tag="HMPREF0733_10006"
                     /note="2-oxoacid dehydrogenases acyltransferase (catalytic
                     domain); Region: 2-oxoacid_dh; pfam00198"
                     /db_xref="CDD:249671"
     gene            9817..10164
                     /locus_tag="HMPREF0733_10007"
                     /db_xref="GeneID:9901257"
     CDS             9817..10164
                     /locus_tag="HMPREF0733_10007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982899.1"
                     /db_xref="GI:311111677"
                     /db_xref="GeneID:9901257"
                     /translation="MFLLNNILVFLHIIGAAIIIGLWIAHFRTPKVLPGQFHASLLML
                     ITGLLLVGIAEVTGSPNHIKIAVKILIALGISIAAFIGQRKYKAGEPISTGLAHAVGG
                     LAVINVAVATIWH"
     gene            complement(10309..11718)
                     /locus_tag="HMPREF0733_10008"
                     /db_xref="GeneID:9901258"
     CDS             complement(10309..11718)
                     /locus_tag="HMPREF0733_10008"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982900.1"
                     /db_xref="GI:311111678"
                     /db_xref="GeneID:9901258"
                     /translation="MNTDSITYLENLHEEPNLSIWTVKIHTNRDSSVKNRILPKQLAP
                     GLYTLAISHDSQQIPSHQIKTLCGLPPLPGVATVLAVTRDERQLSGTETGTYYWYEPV
                     EAGSLESLVHARGSLPLAEVATLAHHIGWGFKSLHAAHIYPEHLEPQYVMITIAGLPE
                     FLCLPSSIKASKHQPDEHEHVGVHDFVALLWYALTGESPRQTHQRIPLPLLADVPQTL
                     GTELERLLDDPKATVQEVLDAFSAFQTQPLNAYTSAPESVRSKLPVALREPNTVKSTK
                     TLPKVRHQNAQKLIGKSTFKVGHSRGRSKARNFTTRKLVILGVGSLIILGAGAIVGAT
                     WVPEAMHHHESHATQPAVVSTPQDEQAILAQVIEERNQSLSSQGAATLKLRSLTRILH
                     RDSDSLGITAEVESPGYTPTDAEQKESGVHLVDGVPVQTVIFELHRDEGVWRIVTATP
                     VTDETPNEPDAQPTVVREP"
     gene            11955..12659
                     /gene="lipB"
                     /locus_tag="HMPREF0733_10009"
                     /db_xref="GeneID:9901259"
     CDS             11955..12659
                     /gene="lipB"
                     /locus_tag="HMPREF0733_10009"
                     /EC_number="2.3.1.181"
                     /note="COG: COG0321; Pfam: PF03099; InterPro: IPR000544"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoyl(octanoyl) transferase"
                     /protein_id="YP_003982901.1"
                     /db_xref="GI:311111679"
                     /db_xref="GeneID:9901259"
                     /translation="MSVILERVGFAPDYVNYVESLDMQSRLHAEVAARARQNTILLLE
                     HEPVITAGKRTEDHEYPTDRSTPVVKIDRGGKLTWHGPGQLTGYPILKLPEPLDVVAY
                     VRILEEIIMNVLAHFGIKGERVEGRSGVWILGDGITPDKKIAAIGIRVSKQTTMHGFA
                     INCCNETAPFMQFIPCGITDAGVTTISEQLGRTVTPADILETLERELIKYQDRLAMPF
                     EPLVPQEHKVAHETAA"
     misc_feature    11955..12608
                     /gene="lipB"
                     /locus_tag="HMPREF0733_10009"
                     /note="lipoate-protein ligase B; Provisional; Region:
                     PRK14345"
                     /db_xref="CDD:184638"
     gene            12868..13875
                     /gene="lipA"
                     /locus_tag="HMPREF0733_10010"
                     /db_xref="GeneID:9901260"
     CDS             12868..13875
                     /gene="lipA"
                     /locus_tag="HMPREF0733_10010"
                     /EC_number="2.8.1.8"
                     /note="COG: COG0320; Pfam: PF04055; InterPro: IPR003698"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoyl synthase"
                     /protein_id="YP_003982902.1"
                     /db_xref="GI:311111680"
                     /db_xref="GeneID:9901260"
                     /translation="MSIKPEGRKLLRVEARNAEVPIEKKPHWIKTKAVVGPEYNEMKE
                     LARGQGLHTVCEEAGCPNIYECWEDREATYLIGGSECTRRCDFCNIATGKPAAVDYAE
                     PFKVAKNVKVMGLRYATVTGVARDDLEDGGAWLYAETTRQIHKMCPNTGVEMLIPDFK
                     GKPEHVQKVIDARPEVFAHNLETVPRIFKQIRPAFRYERSLDVITQGKEAGMVTKSNL
                     ILGMGETNDEIYEALCDLYDAGCDIITLTQYLRPGPLFHPIERWVKPAEFLEFSAMAE
                     SIGFAGVMAGPMVRSSYRAGRLWARAMKKNGYEIPENLAHIEDGGAALQEASSLVAAG
                     F"
     misc_feature    12928..13782
                     /gene="lipA"
                     /locus_tag="HMPREF0733_10010"
                     /note="lipoyl synthase; Provisional; Region: PRK05481"
                     /db_xref="CDD:235493"
     misc_feature    13108..13584
                     /gene="lipA"
                     /locus_tag="HMPREF0733_10010"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(13108..13110,13114..13116,13120..13122,13126..13134,
                     13228..13230,13240..13245,13330..13338,13405..13407,
                     13522..13524)
                     /gene="lipA"
                     /locus_tag="HMPREF0733_10010"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            14132..14851
                     /locus_tag="HMPREF0733_10011"
                     /db_xref="GeneID:9901261"
     CDS             14132..14851
                     /locus_tag="HMPREF0733_10011"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein"
                     /protein_id="YP_003982903.1"
                     /db_xref="GI:311111681"
                     /db_xref="GeneID:9901261"
                     /translation="MAEKREEKKKQKKDKSPGTFAQMKQVYQMTKKSDPNIGWILLLA
                     VVVTLLVFVLIGALLNNIITFIILGLAVGVLAAMIILGRRAQKAAFTQIEGQPGRAGA
                     AMNSVRRGWIVEEQPVAANRNQDLVFRGLGRPGIVLVTEGPSSRVQNLVKNEKKHLNR
                     VVPGVPVHVIETGHDENQVELKDVVKTMNKLPKALTQQEVQGVSNRLSTLNHVRNPMN
                     SIPKGIDPNRVRPDRRAMRGR"
     misc_feature    14177..14842
                     /locus_tag="HMPREF0733_10011"
                     /note="Domain of unknown function (DUF4191); Region:
                     DUF4191; pfam13829"
                     /db_xref="CDD:258105"
     gene            complement(14961..15410)
                     /locus_tag="HMPREF0733_10012"
                     /db_xref="GeneID:9901262"
     CDS             complement(14961..15410)
                     /locus_tag="HMPREF0733_10012"
                     /note="Pfam: PF06271; InterPro: IPR010432"
                     /codon_start=1
                     /transl_table=11
                     /product="RDD family domain-containing protein"
                     /protein_id="YP_003982904.1"
                     /db_xref="GI:311111682"
                     /db_xref="GeneID:9901262"
                     /translation="MIERDDLGSWLNGAPSDQKYPGEIMGRPETGPGAIARPMRRLLG
                     FIIDWYLCLGLAFLLVGGQNVQIHGLMTLGIFLLYLIVLVGFMGHTLGHFLVGVQVQT
                     LDGRPAGWKRALIRAVLTMLVLPTVILDANSRGLHDRAAGTILVRIR"
     misc_feature    complement(14985..15308)
                     /locus_tag="HMPREF0733_10012"
                     /note="RDD family; Region: RDD; pfam06271"
                     /db_xref="CDD:253650"
     gene            15601..17025
                     /gene="glnA"
                     /locus_tag="HMPREF0733_10013"
                     /db_xref="GeneID:9901263"
     CDS             15601..17025
                     /gene="glnA"
                     /locus_tag="HMPREF0733_10013"
                     /EC_number="6.3.1.2"
                     /note="COG: COG0174; Pfam: PF03951,PF00120; InterPro:
                     IPR004809"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="YP_003982905.1"
                     /db_xref="GI:311111683"
                     /db_xref="GeneID:9901263"
                     /translation="MFTSPQEVLDFIKSDEIVFVDIRFTDMPGVQQHFNLPAKAIDED
                     FFVNGQLFDGSSIRGFQGIAESDMQLIPDVKSAYVDPFRLEKTLVIICSIVNPRTGEP
                     YHRDPRGVAERAEAYLQSTGVADTAFFASEAEFFVFEDVRYQVEPNSVFYKIDSDEAY
                     WNTGRKEEGGNLGNKTPIKGGYFPVSPVDKQADLRDAMCVAMDQVGLEVERSHHEVGS
                     PGQAEINYKFSTLTNAADDLLKFKYVIKNTADEWGKSVTFMPKPVFGDNGSGMHCHQS
                     LWLGGDPLFYDERGYANLSDIARWYIGGLIEHSSAVLAFTNPTVNSYKRLVPGYEAPV
                     NMVYSQGNRSAGIRIPITGANPKAKRLEFRAPDPSCNPYFAFSAQLMAGLDGIRNRIE
                     PPAPIDKDLYELPAEEAKDIKKAPANLEEALAALEADHDFLLEGGVFTEDLIHAWIDY
                     KRTNELEPLSLIPHPLEYQLYYGV"
     misc_feature    15616..17016
                     /gene="glnA"
                     /locus_tag="HMPREF0733_10013"
                     /note="glutamine synthetase, type I; Region: GlnA;
                     TIGR00653"
                     /db_xref="CDD:233073"
     misc_feature    15646..15891
                     /gene="glnA"
                     /locus_tag="HMPREF0733_10013"
                     /note="Glutamine synthetase, beta-Grasp domain; Region:
                     Gln-synt_N; pfam03951"
                     /db_xref="CDD:252271"
     misc_feature    15913..16749
                     /gene="glnA"
                     /locus_tag="HMPREF0733_10013"
                     /note="Glutamine synthetase, catalytic domain; Region:
                     Gln-synt_C; pfam00120"
                     /db_xref="CDD:249604"
     gene            17639..18154
                     /locus_tag="HMPREF0733_10014"
                     /db_xref="GeneID:9901264"
     CDS             17639..18154
                     /locus_tag="HMPREF0733_10014"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982906.1"
                     /db_xref="GI:311111684"
                     /db_xref="GeneID:9901264"
                     /translation="MSHVLSRRTVCLSAGLTAVATFVGCASSSLSSDEALYKNDQLLP
                     SAPGEPYTGSDEQPIRTQERMFMAMMDADAESLRSTLTEDATLTHITGQIQTRDEWVQ
                     SVADKTMSYSNIEVVSAHVERSDNGAQLVARTRTTANINGSNGTWNLQLVSQIHPDGA
                     HFTKTVASLWS"
     misc_feature    17813..18067
                     /locus_tag="HMPREF0733_10014"
                     /note="Domain of unknown function (DUF4440); Region:
                     DUF4440; pfam14534"
                     /db_xref="CDD:258674"
     gene            18376..19242
                     /locus_tag="HMPREF0733_10015"
                     /db_xref="GeneID:9901265"
     CDS             18376..19242
                     /locus_tag="HMPREF0733_10015"
                     /note="COG: COG4975; Pfam: PF06800; InterPro: IPR010651"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose uptake protein"
                     /protein_id="YP_003982907.1"
                     /db_xref="GI:311111685"
                     /db_xref="GeneID:9901265"
                     /translation="MNILIGLIPALFWGILPLCVSKIGGKPTQQIMGTTMGVLLMGIA
                     TSLLFFPIRLDAWAFFLCFLSGASWAFGQMNQYRAFTQIGVSQTMPLSTGMQLVGTSL
                     MGVVAFGDWGTVQAKVIGAVALALIIIGIWMTTKQENPDPQSGGNMRTGIITLLFSTI
                     GYVGYSFFPNYVSVDGWYKFLPQSVGMVVAAITMSMLTRDGTRPWDKKSLQNIICGVI
                     FSGAALAYLVSIEPHRNGVASGFTLSQMNVIISTLGSILLLGEKKTRLELLYVLGGLA
                     LVVIGGVLIGTL"
     misc_feature    18376..19239
                     /locus_tag="HMPREF0733_10015"
                     /note="Putative glucose uptake permease [Carbohydrate
                     transport and metabolism]; Region: GlcU; COG4975"
                     /db_xref="CDD:227309"
     misc_feature    18424..19230
                     /locus_tag="HMPREF0733_10015"
                     /note="Sugar transport protein; Region: Sugar_transport;
                     pfam06800"
                     /db_xref="CDD:253917"
     gene            19337..19840
                     /locus_tag="HMPREF0733_10016"
                     /db_xref="GeneID:9901266"
     CDS             19337..19840
                     /locus_tag="HMPREF0733_10016"
                     /note="COG: COG2153; Pfam: PF00583; InterPro: IPR016181"
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="YP_003982908.1"
                     /db_xref="GI:311111686"
                     /db_xref="GeneID:9901266"
                     /translation="MTNAGEPVSKFIAKHFDELTAHELQQIHIIRSLVFTVGQQSTDQ
                     EPDDADFECIHMVNEDDSGKVLAYLRLFDLEKVQDARHRYIPGAWTFGRVAVHPDARG
                     TGLGRKLLHAALEWIRNNTDAKEIVIAAQAYLKDTYYSPEGFVERGEHYMESGIEHVE
                     MVLDLQR"
     misc_feature    19514..19693
                     /locus_tag="HMPREF0733_10016"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    <19616..>19798
                     /locus_tag="HMPREF0733_10016"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     misc_feature    order(19616..19624,19652..19657)
                     /locus_tag="HMPREF0733_10016"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            19995..20480
                     /locus_tag="HMPREF0733_10017"
                     /db_xref="GeneID:9901267"
     CDS             19995..20480
                     /locus_tag="HMPREF0733_10017"
                     /note="COG: COG2153; Pfam: PF00583; InterPro: IPR016181"
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="YP_003982909.1"
                     /db_xref="GI:311111687"
                     /db_xref="GeneID:9901267"
                     /translation="MTSSPGFTAKLFDELTLHELQQIHITRTLVFAAGQKITEPEADE
                     TDFECVHFFSADDSGRVLAYLRMFDLEHVNDGNHRTIADAWTLGRVAVRQEVRRNGLG
                     RKLLHAAIDWIRTNTSARQIVISAQAYLRDTYYGAAGFVARGEPYQEAGIKHIEMVLD
                     L"
     misc_feature    20148..20336
                     /locus_tag="HMPREF0733_10017"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(20262..20270,20298..20303)
                     /locus_tag="HMPREF0733_10017"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            20556..21320
                     /gene="budA"
                     /locus_tag="HMPREF0733_10018"
                     /db_xref="GeneID:9901268"
     CDS             20556..21320
                     /gene="budA"
                     /locus_tag="HMPREF0733_10018"
                     /EC_number="4.1.1.5"
                     /note="COG: COG3527; Pfam: PF03306; InterPro: IPR005128"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-acetolactate decarboxylase"
                     /protein_id="YP_003982910.1"
                     /db_xref="GI:311111688"
                     /db_xref="GeneID:9901268"
                     /translation="MEGKTMAYQPTQLNGETVFRNEVFQTGLMSQLLDGVYDGEMTIG
                     ELLSHGNFGVGTFNGLDGEMVVLDGDCYQVRHDGSVSIPQLTDRTPYAVVTNFVPMIR
                     RELPQNMLRTSTSQVLDNFTVSKNYMYAIKIYGEFEWVRTRTVVKQEKPYPKMVDATE
                     NEDIVQFDNLTGTIVGFRTPIYEQGISVPGCHAHFIDDDRTHGGHVVDFKLKSANVEI
                     CPGTGLQLHLPLTPEFSSANLSPEDLADQISKAEKH"
     misc_feature    20622..21284
                     /gene="budA"
                     /locus_tag="HMPREF0733_10018"
                     /note="Alpha-acetolactate decarboxylase; Region:
                     AAL_decarboxy; pfam03306"
                     /db_xref="CDD:251861"
     gene            complement(21552..21992)
                     /locus_tag="HMPREF0733_10019"
                     /db_xref="GeneID:9901269"
     CDS             complement(21552..21992)
                     /locus_tag="HMPREF0733_10019"
                     /note="COG: COG0537; Pfam: PF01230; InterPro: IPR011151"
                     /codon_start=1
                     /transl_table=11
                     /product="HIT family protein"
                     /protein_id="YP_003982911.1"
                     /db_xref="GI:311111689"
                     /db_xref="GeneID:9901269"
                     /translation="MEDRVSSIFTKIIDGEIPGRFVWKDEKCVAFMDIQPASHGHLLV
                     VPHEEIDRWPELPVELAAHLFAVAHKISGALDRAFDKDRVALMIAGFDVPHTHIHLFP
                     ADSMAEYDPANALANVTAEELDADAEAVRTALRDLGHGEFVPEA"
     misc_feature    complement(21591..21977)
                     /locus_tag="HMPREF0733_10019"
                     /note="Diadenosine tetraphosphate (Ap4A) hydrolase and
                     other HIT family hydrolases [Nucleotide transport and
                     metabolism / Carbohydrate transport and metabolism /
                     General function prediction only]; Region: Hit; COG0537"
                     /db_xref="CDD:223611"
     misc_feature    complement(order(21696..21698,21702..21704,21714..21716,
                     21864..21866,21870..21872,21894..21896,21900..21902))
                     /locus_tag="HMPREF0733_10019"
                     /note="nucleotide binding site/active site [active]"
                     /db_xref="CDD:238263"
     misc_feature    complement(order(21690..21698,21702..21704,21708..21710))
                     /locus_tag="HMPREF0733_10019"
                     /note="HIT family signature motif; other site"
                     /db_xref="CDD:238263"
     misc_feature    complement(21702..21704)
                     /locus_tag="HMPREF0733_10019"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238263"
     gene            complement(21996..22655)
                     /locus_tag="HMPREF0733_10020"
                     /db_xref="GeneID:9901270"
     CDS             complement(21996..22655)
                     /locus_tag="HMPREF0733_10020"
                     /EC_number="3.5.2.6"
                     /note="COG: COG2220; Pfam: PF00753"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain-containing protein"
                     /protein_id="YP_003982912.1"
                     /db_xref="GI:311111690"
                     /db_xref="GeneID:9901270"
                     /translation="MELTKYTHSSVRIEHDGHVLVFDPGNFAPEGEHAQLLDGADYLL
                     ITHEHPDHFDADRVLPLIAEKQQLRIWAPQAVAEKILDTAPNAHVTVVSADSEFSVPG
                     FDVQTFGGQHALIHPLIPTIANIGYLINGVVYHPGDSLVVPHGVKAPHVLVPVHAPWS
                     KVQEVIDFVIAVGAQHAYPIHNGMINENGTGIIEGLITTFSNKYGTEYSHLNPGDTVK
                     F"
     misc_feature    complement(22107..22655)
                     /locus_tag="HMPREF0733_10020"
                     /note="Predicted Zn-dependent hydrolases of the
                     beta-lactamase fold [General function prediction only];
                     Region: COG2220"
                     /db_xref="CDD:225130"
     gene            22766..23314
                     /gene="fur"
                     /locus_tag="HMPREF0733_10021"
                     /db_xref="GeneID:9901271"
     CDS             22766..23314
                     /gene="fur"
                     /locus_tag="HMPREF0733_10021"
                     /note="COG: COG0735; Pfam: PF01475; InterPro: IPR002481"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulation protein"
                     /protein_id="YP_003982913.1"
                     /db_xref="GI:311111691"
                     /db_xref="GeneID:9901271"
                     /translation="MQNFSVESLEKAHKPAYYLGVPHPEGYVLDTHIPVRKIVKQAEA
                     RNTKQRRIIKATMAELGDFISAQDLHLTLANRKEQVSLATTYRVLQSLANSGELDVVK
                     GVEGESLYRHCQGDTHHHHLLCRRCGKAVELEAPAIEDWALDMGKKYGFSELEHVVEV
                     TGYCPECTLELRDEENRLTGRQ"
     misc_feature    22907..23257
                     /gene="fur"
                     /locus_tag="HMPREF0733_10021"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    order(22952..22954,23096..23098,23120..23122,23126..23128,
                     23159..23161)
                     /gene="fur"
                     /locus_tag="HMPREF0733_10021"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    23006..23050
                     /gene="fur"
                     /locus_tag="HMPREF0733_10021"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(23117..23119,23123..23125,23180..23182,23231..23233)
                     /gene="fur"
                     /locus_tag="HMPREF0733_10021"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    order(23132..23140,23186..23191,23216..23224,23228..23254)
                     /gene="fur"
                     /locus_tag="HMPREF0733_10021"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(23135..23137,23144..23146,23255..23257)
                     /gene="fur"
                     /locus_tag="HMPREF0733_10021"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            complement(23441..24391)
                     /locus_tag="HMPREF0733_10022"
                     /db_xref="GeneID:9901272"
     CDS             complement(23441..24391)
                     /locus_tag="HMPREF0733_10022"
                     /note="Pfam: PF00950; InterPro: IPR001626"
                     /codon_start=1
                     /transl_table=11
                     /product="cation ABC transporter membrane protein"
                     /protein_id="YP_003982914.1"
                     /db_xref="GI:311111692"
                     /db_xref="GeneID:9901272"
                     /translation="MILSTVISPVLAASQQQNDLLSRIFVFDRYSELVQLLQNSILAG
                     AVLGIIGGFVGMFVMMRDHAFAVHGVSEMSFAGAALALLLGYDVITGSMIGSIISALL
                     IGMMGVKKSESNSVIGALMPFGLGLGILFLSLYQGRSANKFSLLTGQIVSVDGDQLNA
                     MIAGAIVIIAILTLVWRPLSFASLDPEVAQAKGVPMRTLSLVFMVVLGIAVALSVQVV
                     GSLLVLALLITPSAAALQVTASPLKALILSVIFAELAIVGGILLALAGSLPISPYVTS
                     VSFVIYLICRIIGGIRRRHSASGRIARQTQGDAHHHPASV"
     misc_feature    complement(23510..24286)
                     /locus_tag="HMPREF0733_10022"
                     /note="ABC-type Mn2+/Zn2+ transport systems, permease
                     components [Inorganic ion transport and metabolism];
                     Region: ZnuB; COG1108"
                     /db_xref="CDD:224033"
     misc_feature    complement(order(23669..23671,23690..23692,23816..23824,
                     23828..23845,23849..23854,23858..23866,23870..23875,
                     24209..24217,24227..24229))
                     /locus_tag="HMPREF0733_10022"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(23543..23548,23555..23557,23564..23569,
                     23576..23578,23723..23725,23951..23953,23960..23965,
                     23993..23995,23999..24004,24011..24013,24020..24025,
                     24032..24037,24044..24046,24191..24193,24206..24208,
                     24212..24214))
                     /locus_tag="HMPREF0733_10022"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(23585..23587,23735..23737,23747..23749,
                     23921..23923,23993..23995))
                     /locus_tag="HMPREF0733_10022"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            complement(24388..25374)
                     /locus_tag="HMPREF0733_10023"
                     /db_xref="GeneID:9901273"
     CDS             complement(24388..25374)
                     /locus_tag="HMPREF0733_10023"
                     /EC_number="3.6.3.-"
                     /note="COG: COG1121; Pfam: PF00005; InterPro: IPR003439"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_003982915.1"
                     /db_xref="GI:311111693"
                     /db_xref="GeneID:9901273"
                     /translation="MKNTTPSGTPAIEIRGGNLAFGTRTLWNDLNLSIAQGEYFAVLG
                     PNGSGKSTFLKVALGLTAMNTGTISVLGKPARAGNPGVGYIPQQKAIDPSTPMRARDL
                     VGLGIDGHRWGIRLGGRKYRAKVNELLEAVGALEYANVPVGLLSGGEQQRLRIAQALA
                     NNPQMLLADEALLSLDLNHQYAVADLIHRFNRDQGGSVIFVTHEINPIIEHVDRVLYL
                     ANGRFTVGTVPEVMNSETLSDLYGTPINVLKSNGRYVVVGETHASDHCHVVGGEQNLH
                     GAHQDLREIAVETDHDASSGKPVKTASAAGALEDSSNTTKYHAEHKGGGTPQ"
     misc_feature    complement(24574..25350)
                     /locus_tag="HMPREF0733_10023"
                     /note="ABC-type Mn/Zn transport systems, ATPase component
                     [Inorganic ion transport and metabolism]; Region: ZnuC;
                     COG1121"
                     /db_xref="CDD:224046"
     misc_feature    complement(24712..25323)
                     /locus_tag="HMPREF0733_10023"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(25222..25245)
                     /locus_tag="HMPREF0733_10023"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(24766..24768,24865..24870,25114..25116,
                     25219..25227,25231..25236))
                     /locus_tag="HMPREF0733_10023"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(25114..25125)
                     /locus_tag="HMPREF0733_10023"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(24913..24942)
                     /locus_tag="HMPREF0733_10023"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(24865..24882)
                     /locus_tag="HMPREF0733_10023"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(24847..24858)
                     /locus_tag="HMPREF0733_10023"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(24760..24780)
                     /locus_tag="HMPREF0733_10023"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(25375..26355)
                     /locus_tag="HMPREF0733_10024"
                     /db_xref="GeneID:9901274"
     CDS             complement(25375..26355)
                     /locus_tag="HMPREF0733_10024"
                     /note="COG: COG0803; Pfam: PF01297; InterPro: IPR006127"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_003982916.1"
                     /db_xref="GI:311111694"
                     /db_xref="GeneID:9901274"
                     /translation="MKKLMSTITVLAGVSLMVSGCSTANSGSNGSSGNDGGKVKVVAT
                     TDVYADIVKQVGGDNVDVTPIIASTSTDPHSYEATAADRVKTKDAGLVVVNGGGYDQF
                     LEDMAGKDNSSQKVVNAVKLSGKLTDSEYDHLAEDHKDGHHDHEDGEEHKHAHEFNEH
                     LWYDFDTMKKVATEVAEDLAQLDSAHADSYRENAKKLGTELDTLDSSAKKIDGKGKKY
                     ISTEPVPDYLIASTGAENATPEEFAESIEAEKDVPALVLKETQDLVTEKQVSLVAYNE
                     QTETSQTKEVLQTAKDAGVAHVSFTETLPENTDYLSWMKTNVSNLEKALS"
     misc_feature    complement(25378..26355)
                     /locus_tag="HMPREF0733_10024"
                     /note="ABC-type metal ion transport system, periplasmic
                     component/surface adhesin [Inorganic ion transport and
                     metabolism]; Region: LraI; COG0803"
                     /db_xref="CDD:223874"
     misc_feature    complement(25378..26244)
                     /locus_tag="HMPREF0733_10024"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    complement(order(25825..25827,26026..26028,26041..26046))
                     /locus_tag="HMPREF0733_10024"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            complement(26502..27596)
                     /locus_tag="HMPREF0733_10025"
                     /db_xref="GeneID:9901275"
     CDS             complement(26502..27596)
                     /locus_tag="HMPREF0733_10025"
                     /note="COG: COG1253; Pfam: PF01595,PF00571; InterPro:
                     IPR002550"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein containing CBS
                     domain-containing protein"
                     /protein_id="YP_003982917.1"
                     /db_xref="GI:311111695"
                     /db_xref="GeneID:9901275"
                     /translation="MNDWIAIALLVILLIGNAFFVAGEFAIMSTRRAQIEPLADGGNK
                     RAKVVLYALERVSLMLATCQLGITICSLLILNVSEPALHHLLGTPLELLGLPHATVDI
                     LAFVVTLIVVTYLHVIFGEMVPKNAAVTLAARGIALWIVPTLVRVSHVFAPIVAFLNG
                     MSNMLLRWMRVDIKDEVASTFTLGELQSIVAQSTAEGTVEDDAGVIGGALEFSGKHVS
                     EIMVSRDNVHTLPFGCTPAEVEHAVARTGYSRFPVHDEAGIYMGYLHLKDALDVAPER
                     TDQPFPWYKLRSLTVLTPTTEIDDALATMQQNRSHLAQVVDTSGTLLGVVFMEDVIEE
                     LVGEIRDTTQDSKRRKASTSHSEGISQDEQ"
     misc_feature    complement(26991..27584)
                     /locus_tag="HMPREF0733_10025"
                     /note="Domain of unknown function DUF21; Region: DUF21;
                     pfam01595"
                     /db_xref="CDD:250731"
     misc_feature    complement(26601..26948)
                     /locus_tag="HMPREF0733_10025"
                     /note="FOG: CBS domain [General function prediction only];
                     Region: COG0517"
                     /db_xref="CDD:223591"
     misc_feature    complement(26595..26921)
                     /locus_tag="HMPREF0733_10025"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     gene            complement(27593..28960)
                     /locus_tag="HMPREF0733_10026"
                     /db_xref="GeneID:9901276"
     CDS             complement(27593..28960)
                     /locus_tag="HMPREF0733_10026"
                     /note="COG: COG1253; Pfam: PF01595,PF00571,PF03471;
                     InterPro: IPR002550"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane transporter with CBS domains"
                     /protein_id="YP_003982918.1"
                     /db_xref="GI:311111696"
                     /db_xref="GeneID:9901276"
                     /translation="MRGERMNFILLALGIALILGTGFFVAVEFSLVALETATVYQERE
                     KGDTRANAVLQCLRTLSTQLSSCQIGITITTLLTGYTLDASINALTAGFISSWGLPRA
                     VTSTLTLVLAMGIATLLSMLLGELVPKGLAIAEPYRVARQVAPAQLIFTRIMKPVVVV
                     MNGSANRILRLFGMEAQEELSAARSPEELSAMVRRSAEQGTLDSDTARFVDRTLSFAE
                     LTASEVMTPRGRVTMLEDTAPVTEVIEQARATGHSRFPLYRGDHDNIVGVIHVKKAVG
                     VPTDVRETLEAGALADDVLQVPETLHVDALLTQLREGALQLAVVLDEYGGTSGIVTLE
                     DLVEEIVGEVSDEHDQGRTERPLRFGNGDWVFSGLRRPNEVNEFIPGVIAEHPSYETV
                     GGFMMEQLGRIPEQGDQVPISGGILRVDHVEGRRVDRIRFIPDSIGKGLVSQPAVLQN
                     RRVRS"
     misc_feature    complement(27659..28900)
                     /locus_tag="HMPREF0733_10026"
                     /note="Hemolysins and related proteins containing CBS
                     domains [General function prediction only]; Region: TlyC;
                     COG1253"
                     /db_xref="CDD:224173"
     misc_feature    complement(28346..28897)
                     /locus_tag="HMPREF0733_10026"
                     /note="Domain of unknown function DUF21; Region: DUF21;
                     pfam01595"
                     /db_xref="CDD:250731"
     misc_feature    complement(27944..28273)
                     /locus_tag="HMPREF0733_10026"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     misc_feature    complement(27659..27883)
                     /locus_tag="HMPREF0733_10026"
                     /note="Transporter associated domain; Region: CorC_HlyC;
                     smart01091"
                     /db_xref="CDD:215020"
     gene            29311..33141
                     /gene="odhA"
                     /locus_tag="HMPREF0733_10027"
                     /db_xref="GeneID:9901277"
     CDS             29311..33141
                     /gene="odhA"
                     /locus_tag="HMPREF0733_10027"
                     /EC_number="1.2.4.2"
                     /note="COG: COG0567; Pfam: PF00198,PF00676,PF02779;
                     InterPro: IPR011603"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate dehydrogenase E1 component"
                     /protein_id="YP_003982919.1"
                     /db_xref="GI:311111697"
                     /db_xref="GeneID:9901277"
                     /translation="MCARLEEAHTKPTYTQRDDSPLEDAGRLCRISPDATDKFTVKEE
                     AFTVPNLPDHLVPEEFAGNEWFVEEQYERYQQDKNLVDPSWWPIFQSIDKALQGTPAV
                     SAPVTATQKAEATPSAPAAAASITTPAPQPAAPTKSTASPAPKTSSKAENVEPLEDKI
                     VPLRGPAKAVAANMEDSLTVPTATTVRAVPAKLLIENRSAINAYLARTRGGKISFTHI
                     IGYAVIRALAAMPSMNVTYGHDEKGKPIAIHNANVNFGLAIDLPRPDGSRNLVVPNIK
                     GAQTLSFLEFWQAYDDIVKRGRAGQLGLEDFQGTTVTLTNPGGIGTVHSVPRLSKGQA
                     AIIGVGALEYPAEFRGVAETMVAQHAISKVITLTSTYDHRVIQGAGSGEFLKIVESYL
                     LGAEGFYDEIFQAIQIPFEPVRWSQDNQVNPDTEVSKVARIQQLIHAYRVHGHLIART
                     NPVGYQLHSNPDLNVESYGLTLWDLDRVWPTGGFGDKEQLPLRTILARLREAYAGTLA
                     VEYMYMEDRKAREWFQEKLEHGYSKPSRERLMHVLEKLVEAEAFETFLQTKYLGQKRF
                     SLEGGESLIPLLDAIINKAADNNMHGVAIGMAHRGRLNVLTNIAGKSYAQIFREFSGT
                     AAPYEGGSGDVKYHLGTEGTFTSTSGKQTQVYLAANPSHLEAVNTVLEGIVRAKQDVL
                     NDQGIEGHPILPILIHGDAAFAAQGIVMETLQMANLRGYTTGGTVHIVVNNQIGFTTS
                     PKDGRTATNATDIARMTKAPVFHVNADDPEAVVRAGRLAFEYRERFGRDAVIDLLCYR
                     RRGHNEADDPSMTQPKMYQVIDNMPSTRTKYAEALVGRGDITQEEADEALSAYHSKLD
                     AIFSETQAAVPAPETPNVAGLELPASQQSTEIVHGGNTAISRDTFEHIAKAFGEVPEG
                     FTVHKKLKKLCEQRVEMGTNGKVNWGMGELLAFGSLLMEGTDVRMSGQDVQRGTFVQR
                     HAVLHDHLTDDEWSPLQHLSDHQGKLRIYNSLLSEYGVIGFEYGYSVERPDSMVVWEA
                     QFGDFANGAQTIIDEFVSSSEQKWGQRSSLVLLLPHGYEGQGPDHSSARIERYLQLCA
                     ENNMTVAVPSTPASYFHLLRRHAQHRPYKPLVVISPKQLLRLKAASSSIEDFTEGSFQ
                     PVIGDRSGVTPAQVERVVFVSGRLYYDLEAERAKRGDTKTAIVSVEQLYPLPEAEIKA
                     QLDLYSNATDIVWAQDEPANQGQWPFMALNLLPIIDYRMRLVSRPASASPAAGTGKRH
                     AAEAEALMKQVFEG"
     misc_feature    29479..33135
                     /gene="odhA"
                     /locus_tag="HMPREF0733_10027"
                     /note="alpha-ketoglutarate decarboxylase; Reviewed;
                     Region: kgd; PRK12270"
                     /db_xref="CDD:237030"
     misc_feature    29830..30486
                     /gene="odhA"
                     /locus_tag="HMPREF0733_10027"
                     /note="2-oxoacid dehydrogenases acyltransferase (catalytic
                     domain); Region: 2-oxoacid_dh; pfam00198"
                     /db_xref="CDD:249671"
     misc_feature    30964..31758
                     /gene="odhA"
                     /locus_tag="HMPREF0733_10027"
                     /note="Thiamine pyrophosphate (TPP) family, E1 of
                     OGDC-like subfamily, TPP-binding module; composed of
                     proteins similar to the E1 component of the 2-oxoglutarate
                     dehydrogenase multienzyme complex (OGDC). OGDC catalyzes
                     the oxidative decarboxylation of...; Region:
                     TPP_E1_OGDC_like; cd02016"
                     /db_xref="CDD:238974"
     misc_feature    order(31300..31302,31405..31416,31507..31509,31513..31515)
                     /gene="odhA"
                     /locus_tag="HMPREF0733_10027"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238974"
     misc_feature    32116..32703
                     /gene="odhA"
                     /locus_tag="HMPREF0733_10027"
                     /note="Transketolase, pyrimidine binding domain; Region:
                     Transket_pyr; pfam02779"
                     /db_xref="CDD:251526"
     misc_feature    order(32182..32184,32197..32199,32257..32259,32314..32319,
                     32326..32328,32335..32337,32344..32349,32353..32361,
                     32368..32370,32440..32445,32455..32457)
                     /gene="odhA"
                     /locus_tag="HMPREF0733_10027"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    order(32197..32199,32257..32259,32314..32319,32326..32328,
                     32419..32424,32437..32439,32557..32559,32563..32565)
                     /gene="odhA"
                     /locus_tag="HMPREF0733_10027"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    order(32197..32199,32329..32331,32422..32424)
                     /gene="odhA"
                     /locus_tag="HMPREF0733_10027"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132915"
     gene            33381..33977
                     /locus_tag="HMPREF0733_10028"
                     /db_xref="GeneID:9901278"
     CDS             33381..33977
                     /locus_tag="HMPREF0733_10028"
                     /note="InterPro: IPR013831"
                     /codon_start=1
                     /transl_table=11
                     /product="lipase/acylhydrolase"
                     /protein_id="YP_003982920.1"
                     /db_xref="GI:311111698"
                     /db_xref="GeneID:9901278"
                     /translation="MEQRNIRLVAVGDDLLAGVGDPRTLGWFGRVMARTPQTSASISA
                     YNLAAPNEGSEQLSTRWFDEARRRFLPGADNRLVIAPSTFDIDLGLTSARSRLNLANM
                     VDMASQNSIRVLVVGPPPTLDPERNRRIADLSAAYADVVTRRNHVYVDTFNPLLHHEQ
                     WRNDLAANDGRPGQSGYGLMAWLVLHRGWYSWLNLPEQ"
     misc_feature    33396..33944
                     /locus_tag="HMPREF0733_10028"
                     /note="SGNH_hydrolase, or GDSL_hydrolase, is a diverse
                     family of lipases and esterases. The tertiary fold of the
                     enzyme is substantially different from that of the
                     alpha/beta hydrolase family and unique among all known
                     hydrolases; its active site closely...; Region:
                     SGNH_hydrolase; cl01053"
                     /db_xref="CDD:260768"
     misc_feature    order(33420..33422,33531..33533,33630..33632,33885..33887,
                     33891..33893)
                     /locus_tag="HMPREF0733_10028"
                     /note="active site"
                     /db_xref="CDD:238141"
     misc_feature    order(33420..33422,33885..33887,33891..33893)
                     /locus_tag="HMPREF0733_10028"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238141"
     misc_feature    order(33420..33422,33531..33533,33630..33632)
                     /locus_tag="HMPREF0733_10028"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238141"
     gene            34402..35094
                     /locus_tag="HMPREF0733_10029"
                     /db_xref="GeneID:9901279"
     CDS             34402..35094
                     /locus_tag="HMPREF0733_10029"
                     /note="COG: COG1595; Pfam: PF04542,PF08281; InterPro:
                     IPR014293"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-70 factor family protein"
                     /protein_id="YP_003982921.1"
                     /db_xref="GI:311111699"
                     /db_xref="GeneID:9901279"
                     /translation="MLYTGPPKVITRQKRAPMSESNAAEATATLTPRELRERFTADAM
                     QYVDQLYAAALRMSRNPADAEDLVQETYTKAFASFHQYRQGTNLKAWLYRILTNTYIN
                     LYRKRQREPQQAHTESVEDWQLAQAGAHDASGLRSAEMEALDALPDTEVRQALASLTE
                     DFRMVVYYSDVEGFSYKEIAEIMDIPLGTVMSRLHRGRRILREKLLDYARENGLRPST
                     IAKVEAKAAKKK"
     misc_feature    34483..35055
                     /locus_tag="HMPREF0733_10029"
                     /note="RNA polymerase sigma-70 factor, TIGR02947 family;
                     Region: SigH_actino"
                     /db_xref="CDD:131992"
     misc_feature    34531..34731
                     /locus_tag="HMPREF0733_10029"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    34846..35007
                     /locus_tag="HMPREF0733_10029"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(34876..34878,34906..34908,34924..34929,34957..34959,
                     34963..34968,34972..34980,34984..34989,34993..34995)
                     /locus_tag="HMPREF0733_10029"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            35131..35421
                     /locus_tag="HMPREF0733_10030"
                     /db_xref="GeneID:9901280"
     CDS             35131..35421
                     /locus_tag="HMPREF0733_10030"
                     /note="InterPro: IPR014295"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma factor family protein"
                     /protein_id="YP_003982922.1"
                     /db_xref="GI:311111700"
                     /db_xref="GeneID:9901280"
                     /translation="MEEQTPENSTALTEDCGGNPCSTTLKNLYEYLDGALTAEEIQEI
                     QRHLDACSHCTEAKDLEVLLRAKIKSSCDEQAPESLKARLLEHIDEFCSASA"
     misc_feature    35188..35400
                     /locus_tag="HMPREF0733_10030"
                     /note="mycothiol system anti-sigma-R factor; Region:
                     antisig_RsrA; cl15806"
                     /db_xref="CDD:247078"
     gene            35596..37119
                     /gene="aroA"
                     /locus_tag="HMPREF0733_10031"
                     /db_xref="GeneID:9901281"
     CDS             35596..37119
                     /gene="aroA"
                     /locus_tag="HMPREF0733_10031"
                     /EC_number="2.5.1.19"
                     /note="COG: COG0128; Pfam: PF00275; InterPro: IPR001986"
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="YP_003982923.1"
                     /db_xref="GI:311111701"
                     /db_xref="GeneID:9901281"
                     /translation="MVEVYGREEERPQVQITGEFQRKHQTDYGRQRVIPMSELSTAQN
                     TTAHAWEAPTYRGAPGMSARMRIPGSKSLTNRYLLLAALADSPSRLRAPLHSRDSALM
                     ISALEALGAQFERIETGSEFGPDLLITPLNLASAPPMVKIDCGLAGTVMRFVPALAAL
                     LPGDYNFDGDPQARKRPMAALCDGLRQLGARIERSGNDSVDTLPFTLHSPGLAAASGT
                     PAEIFIDASASSQFVSALLLIAPRLPQGLTIHHRGNAVPSIPHIEMTLQTLRDLGVRA
                     EAVADEYAWRIFPGTISGFDITVEPDLSNAGPFLAAAMVTGNSVTIPGWPAPTADGSP
                     GTTQGGDEWRTILPRLGGAVEFSNGSLTVTGPEDITRLSGVEFNLQTAGELAPTVAAL
                     VALLDSPSTLTGIGHLRGHETDRLAALVTEINRLGGLAEETADGIHVLRPVRRLPQDS
                     PVTVQTYEDHRVATFAAVIGLHEPGVRIENVQTTAKTLPQFTALWQKMLSQWEGARS"
     misc_feature    35776..37089
                     /gene="aroA"
                     /locus_tag="HMPREF0733_10031"
                     /note="EPSP synthase domain. 3-phosphoshikimate
                     1-carboxyvinyltransferase
                     (5-enolpyruvylshikimate-3-phosphate synthase) (EC
                     2.5.1.19) catalyses the reaction between
                     shikimate-3-phosphate (S3P) and phosphoenolpyruvate (PEP)
                     to form...; Region: EPSP_synthase; cd01556"
                     /db_xref="CDD:238797"
     misc_feature    35779..37104
                     /gene="aroA"
                     /locus_tag="HMPREF0733_10031"
                     /note="3-phosphoshikimate 1-carboxyvinyltransferase;
                     Provisional; Region: PRK02427"
                     /db_xref="CDD:235037"
     misc_feature    order(35794..35805,36490..36501)
                     /gene="aroA"
                     /locus_tag="HMPREF0733_10031"
                     /note="hinge; other site"
                     /db_xref="CDD:238797"
     misc_feature    order(35806..35811,35821..35823,36031..36033,36037..36042,
                     36121..36123,36280..36288,36367..36369,36376..36378,
                     36745..36747,36814..36816,36826..36831,36838..36840,
                     36973..36978,37051..37053)
                     /gene="aroA"
                     /locus_tag="HMPREF0733_10031"
                     /note="active site"
                     /db_xref="CDD:238797"
     gene            37098..38240
                     /locus_tag="HMPREF0733_10032"
                     /db_xref="GeneID:9901282"
     CDS             37098..38240
                     /locus_tag="HMPREF0733_10032"
                     /note="COG: COG1162; Pfam: PF03193; InterPro: IPR004881"
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase EngC"
                     /protein_id="YP_003982924.1"
                     /db_xref="GI:311111702"
                     /db_xref="GeneID:9901282"
                     /translation="MGRSALVNPSRNRSFDEWDESDVRVRPNKKGSRPRTKERPRYKH
                     AIRGRVVTVDRGRWSVVVDEGTPQERTLIAARARELRRTPIVTGDFVDVVGDISGAKD
                     TLARIVRLGERSSVLRRSADDTDTTERVVVANANQLVIVVAAANPQPRTGFIDRAVVA
                     AYDAGIEPILCITKTDVSHPQQLLDYYSASGLKIVLSGSADGRAPSESGAEGLLHAPV
                     HKLLEELVGKVSVLLGHSGVGKSTLVNALTGADRATGHVNAVTGRGRHTSSSALALQP
                     VSTPELHVPPGTWIIDTPGIRSFGLAHVPPEQVVQAFPDLAPGEQDCPKGCHHAAQAV
                     DCGINTYVQAGKAGASGAARLDSLRKLLQVVPDEEADSDKELGTLV"
     misc_feature    37236..38195
                     /locus_tag="HMPREF0733_10032"
                     /note="Predicted GTPases [General function prediction
                     only]; Region: COG1162"
                     /db_xref="CDD:224084"
     misc_feature    37494..38186
                     /locus_tag="HMPREF0733_10032"
                     /note="Ribosomal interacting GTPase YjeQ/EngC, a
                     circularly permuted subfamily of the Ras GTPases; Region:
                     YjeQ_EngC; cd01854"
                     /db_xref="CDD:206747"
     misc_feature    order(37548..37553,37560..37565,37569..37574,37581..37586,
                     37671..37673,38019..38021,38031..38033,38037..38039,
                     38157..38159,38166..38168,38178..38180)
                     /locus_tag="HMPREF0733_10032"
                     /note="GTPase/Zn-binding domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206747"
     misc_feature    order(37614..37619,37623..37628,37689..37694,37806..37823)
                     /locus_tag="HMPREF0733_10032"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206747"
     misc_feature    37614..37625
                     /locus_tag="HMPREF0733_10032"
                     /note="G4 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    37689..37697
                     /locus_tag="HMPREF0733_10032"
                     /note="G5 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    37797..37820
                     /locus_tag="HMPREF0733_10032"
                     /note="G1 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    order(37890..37910,37938..37940)
                     /locus_tag="HMPREF0733_10032"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206747"
     misc_feature    37899..37901
                     /locus_tag="HMPREF0733_10032"
                     /note="G2 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    37971..37982
                     /locus_tag="HMPREF0733_10032"
                     /note="G3 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    37977..37985
                     /locus_tag="HMPREF0733_10032"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206747"
     gene            38309..39121
                     /gene="hisN"
                     /locus_tag="HMPREF0733_10033"
                     /db_xref="GeneID:9901283"
     CDS             38309..39121
                     /gene="hisN"
                     /locus_tag="HMPREF0733_10033"
                     /EC_number="3.1.3.15"
                     /note="COG: COG0483; Pfam: PF00459; InterPro: IPR000760"
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphatase"
                     /protein_id="YP_003982925.1"
                     /db_xref="GI:311111703"
                     /db_xref="GeneID:9901283"
                     /translation="MNFTTSYTDDLRLAHILADNVDRVSMSRFKDRSFTVEHKSDGTP
                     VTEVDREVEELLRAQLSRVRTRDGIIGEELGSTGTAARQWVIDPIDGTQNFVRGVPVW
                     ATLIALLDQGEPVMGLISAPALQRRWWAAQGTGAYAGKSLTQATRLQVSSVPTVSGAS
                     LSYAEFKGWEGLELEQNFLSLVHAVNRSRAYGDFWSYCLVAEGAVDIACEAQVALHDI
                     AALVPLVHEAGGTFTTAAGDDAVATAQAEGTASTLATNGTLHRSVISQLAPE"
     misc_feature    38336..39091
                     /gene="hisN"
                     /locus_tag="HMPREF0733_10033"
                     /note="FIG, FBPase/IMPase/glpX-like domain. A superfamily
                     of metal-dependent phosphatases with various substrates.
                     Fructose-1,6-bisphospatase (both the major and the
                     glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate
                     to fructose-6-phosphate in...; Region: FIG; cl00289"
                     /db_xref="CDD:260329"
     misc_feature    order(38453..38455,38522..38527,38567..38581,38957..38959)
                     /gene="hisN"
                     /locus_tag="HMPREF0733_10033"
                     /note="active site"
                     /db_xref="CDD:238814"
     gene            complement(39261..39932)
                     /locus_tag="HMPREF0733_10034"
                     /db_xref="GeneID:9901284"
     CDS             complement(39261..39932)
                     /locus_tag="HMPREF0733_10034"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982926.1"
                     /db_xref="GI:311111704"
                     /db_xref="GeneID:9901284"
                     /translation="MEKKMTENPRQDPMPDSNTPQASYPQAEAPTLQEGHDMQNSAAS
                     DAPLAAYASATDGASHPQAQQAVPPVGNVAAAYDFGYRRAPRQYEVPPEDRRPYGEPT
                     GEIRGPGYFYSIGSFAASLCGLVLTGFSGFQVLGIAILHDDYDSMGYGAYEFTTISNT
                     MLLALVPIVISIWLGIFSFTVNKGCITPMTGRMRAFASLGIVMGALGALGIVGNFFLY
                     LLAIS"
     misc_feature    complement(39570..>39914)
                     /locus_tag="HMPREF0733_10034"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     gene            complement(40133..40505)
                     /locus_tag="HMPREF0733_nc10001"
                     /db_xref="GeneID:9901285"
     tmRNA           complement(40133..40505)
                     /locus_tag="HMPREF0733_nc10001"
                     /product="tmRNA"
                     /db_xref="GeneID:9901285"
     gene            complement(40743..41978)
                     /locus_tag="HMPREF0733_10035"
                     /db_xref="GeneID:9901286"
     CDS             complement(40743..41978)
                     /locus_tag="HMPREF0733_10035"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982927.1"
                     /db_xref="GI:311111705"
                     /db_xref="GeneID:9901286"
                     /translation="MSENLYGQNKPQGQSQQPGQDQNSQNQDSQAQQQYQGQVPQSNS
                     SQQGNYQGNGAQNSYQQQYPQQPQQGSGNQHLFYGGQAQNQQPTPSAGQPSYNTQYSS
                     SSNMVSGQQQHSAPQHSSQTGQNASGQGYASQQSYNSAQGYNQYQPTQESRNYSQQGN
                     SGQQNSNSAQNYQNSAGYQNAQQQGSPQQNSYGQSSAQTQQSGSSVYNGNSSYAQPQQ
                     QAPYGTSGSQPAQQNAQQGYGQQNSYSQTSGYQNQAVNSGYTSQNQNYYGAQNQQGQY
                     GQPAYGSSQFDANAQNAGGPSQAAPVMAIISLVLGVLAIVSGWFIVGGLLGIGAIVLG
                     ALGLRQSRQLGKGKGMSIAGIITGGVGIIVAIIATILFVLGQQTLQECQKVGTPDGNG
                     NKVCQVGDNPDSRMTVPAQ"
     misc_feature    complement(<40920..41072)
                     /locus_tag="HMPREF0733_10035"
                     /note="Domain of unknown function (DUF4190); Region:
                     DUF4190; pfam13828"
                     /db_xref="CDD:258104"
     gene            complement(42207..42683)
                     /locus_tag="HMPREF0733_10036"
                     /db_xref="GeneID:9901287"
     CDS             complement(42207..42683)
                     /locus_tag="HMPREF0733_10036"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982928.1"
                     /db_xref="GI:311111706"
                     /db_xref="GeneID:9901287"
                     /translation="MSENTPGRSEGQPEQPKFVPAAPPVAPAGNAYAGYVPTKLPAGL
                     AIASLVLGIVSIVGAIPLSFVTIVVALVGLILGIIALRKVSKGTGGGKGMAIGGVVTS
                     AIGFILSAVVLIFVIITLMMVQDCKNTGVQNSDGSVTCSINGQQMTVRTDGTTSIR"
     misc_feature    complement(42348..42554)
                     /locus_tag="HMPREF0733_10036"
                     /note="Domain of unknown function (DUF4190); Region:
                     DUF4190; pfam13828"
                     /db_xref="CDD:258104"
     gene            complement(42892..43386)
                     /gene="smpB"
                     /locus_tag="HMPREF0733_10037"
                     /db_xref="GeneID:9901288"
     CDS             complement(42892..43386)
                     /gene="smpB"
                     /locus_tag="HMPREF0733_10037"
                     /note="COG: COG0691; Pfam: PF01668; InterPro: IPR000037"
                     /codon_start=1
                     /transl_table=11
                     /product="SsrA-binding protein"
                     /protein_id="YP_003982929.1"
                     /db_xref="GI:311111707"
                     /db_xref="GeneID:9901288"
                     /translation="MAQKKKKGSKTDPNNSIIAQNKKARHNYNIVDTYEAGMVLLGTE
                     VKSLRDGGASITDGFCHVKDHELWLEGIHIAEYGYGTWTNHSARRSRKLLLHRSEINR
                     LEQKLKETGYTVVPLKLYFSGGRVKVEIALATGKREYDKRQALRERQDNLEAARAMRY
                     RNLG"
     misc_feature    complement(42979..43326)
                     /gene="smpB"
                     /locus_tag="HMPREF0733_10037"
                     /note="Small protein B (SmpB) is a component of the
                     trans-translation system in prokaryotes for releasing
                     stalled ribosome from damaged messenger RNAs; Region:
                     SmpB; cd09294"
                     /db_xref="CDD:187755"
     misc_feature    complement(order(43006..43008,43090..43107,43189..43191,
                     43240..43242,43249..43254,43258..43263,43267..43284))
                     /gene="smpB"
                     /locus_tag="HMPREF0733_10037"
                     /note="SmpB-tmRNA interface; other site"
                     /db_xref="CDD:187755"
     gene            complement(43401..44528)
                     /gene="prfB"
                     /locus_tag="HMPREF0733_10038"
                     /db_xref="GeneID:9901289"
     CDS             complement(43401..44528)
                     /gene="prfB"
                     /locus_tag="HMPREF0733_10038"
                     /note="COG: COG1186; Pfam: PF03462,PF00472; InterPro:
                     IPR004374"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor RF2"
                     /protein_id="YP_003982930.1"
                     /db_xref="GI:311111708"
                     /db_xref="GeneID:9901289"
                     /translation="MASFDFSAEIKDLRSIYASIVAVSDLEGIKCALEDLSQQASAPE
                     LWDDPEHAQRVTSALSHKQAELNRLTNLASRIDDVEVMVELAQTEDESSAEDLLAEAE
                     AECKELRKKLDELEVLVLLSGEYDQREAVVTIRSGAGGVDAADFAEMLLRMYLRWAEK
                     NGYPTKVLDTSYAEEAGLKSVTFEVNAPYAFGRLSVEAGTHRLVRISPFDNQGRRQTS
                     FAAVEVIPLIEQTDALEIPESEIKVDVFRSSGPGGQSVNTTDSAVRMTHIPTGIVVSM
                     QNEKSQIQNRAAALRVLQSRLLMLRQEQEDAKKKELAGDIKASWGDQMRSYVLHPYQM
                     VKDLRTGYEEGNTSSVLDGGLNRFIEEGIRWRASGRRVNEG"
     misc_feature    complement(43419..44525)
                     /gene="prfB"
                     /locus_tag="HMPREF0733_10038"
                     /note="peptide chain release factor 2; Validated; Region:
                     prfB; PRK00578"
                     /db_xref="CDD:234799"
     misc_feature    complement(43938..44279)
                     /gene="prfB"
                     /locus_tag="HMPREF0733_10038"
                     /note="PCRF domain; Region: PCRF; pfam03462"
                     /db_xref="CDD:251973"
     misc_feature    complement(43512..43847)
                     /gene="prfB"
                     /locus_tag="HMPREF0733_10038"
                     /note="RF-1 domain; Region: RF-1; pfam00472"
                     /db_xref="CDD:249886"
     gene            complement(44597..45067)
                     /locus_tag="HMPREF0733_10039"
                     /db_xref="GeneID:9901290"
     CDS             complement(44597..45067)
                     /locus_tag="HMPREF0733_10039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982931.1"
                     /db_xref="GI:311111709"
                     /db_xref="GeneID:9901290"
                     /translation="MVVSYIHAVRSRDGDNDEGSISPLIVGMCALILLIASVTLAVTG
                     AHVQTHRLEDLADAQAISIARTIEHGFSEYSDKSADNARARQLAAKYLEESGASHEFV
                     NLQVDSVQISDDRTVHVTLRARIHPPIVSAVVPDGFEVKAQARARIHQKQKDEK"
     misc_feature    complement(44873..45013)
                     /locus_tag="HMPREF0733_10039"
                     /note="Putative Flp pilus-assembly TadE/G-like; Region:
                     Tad; pfam13400"
                     /db_xref="CDD:257725"
     gene            complement(45078..45596)
                     /locus_tag="HMPREF0733_10040"
                     /db_xref="GeneID:9901291"
     CDS             complement(45078..45596)
                     /locus_tag="HMPREF0733_10040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982932.1"
                     /db_xref="GI:311111710"
                     /db_xref="GeneID:9901291"
                     /translation="MLRIFSLRNLALRLRARTEDSENTDHEHERGSAIVEFLGLGVTL
                     LLPIMYGVLTIFSVQASILGAHAASAQVAQYIQELPPETSMSQEQAQRLSALVARDFG
                     VAESDISVSLSCSGSCSARESIRVQVQVNAHLPLIPQGLGASVIPVSSQSVTWGQTEI
                     GSAASSASRETP"
     gene            complement(45574..45912)
                     /locus_tag="HMPREF0733_10041"
                     /db_xref="GeneID:9901292"
     CDS             complement(45574..45912)
                     /locus_tag="HMPREF0733_10041"
                     /codon_start=1
                     /transl_table=11
                     /product="TadE family protein"
                     /protein_id="YP_003982933.1"
                     /db_xref="GI:311111711"
                     /db_xref="GeneID:9901292"
                     /translation="MVSALLVLLTVAILQVSYAFYTRNILLDAASAGARYGTLYDRTP
                     EEGRERAEQIIRGNLPESYAQDVHTSVYVDPSGIRILEVHITAPLPVLGPWGFPGSIS
                     VSGHAAYIQS"
     misc_feature    complement(45808..45912)
                     /locus_tag="HMPREF0733_10041"
                     /note="TadE-like protein; Region: TadE; pfam07811"
                     /db_xref="CDD:254446"
     gene            complement(45989..46207)
                     /locus_tag="HMPREF0733_10042"
                     /db_xref="GeneID:9901293"
     CDS             complement(45989..46207)
                     /locus_tag="HMPREF0733_10042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982934.1"
                     /db_xref="GI:311111712"
                     /db_xref="GeneID:9901293"
                     /translation="MFTQLRMLFLSVPGIAFLLASYRGMHDDPERGDVPGWVMITMMS
                     AILVAAILAIAQPALIKMFNDAIALIRP"
     gene            complement(46269..47201)
                     /locus_tag="HMPREF0733_10043"
                     /db_xref="GeneID:9901294"
     CDS             complement(46269..47201)
                     /locus_tag="HMPREF0733_10043"
                     /note="Pfam: PF00482; InterPro: IPR001992"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein"
                     /protein_id="YP_003982935.1"
                     /db_xref="GI:311111713"
                     /db_xref="GeneID:9901294"
                     /translation="MNFAIIFGLFFAFGVMLIASSLRKRRGPNFGERIAPQMRSVSIR
                     ESLHRENQVSGTSVLDALYSFLEPMMQSFLGRVRSTESRDEALAARLRRAGSDQTVSA
                     FRAEQILWAVSSVALLGVLSVIGLLENQLSLWSGLMLIILGGVTGFLARDWWLGQIIV
                     RREKQLIAEFPALAEMMALSVAAGESALASLERICRTSRGELAREFNDILAQTRAGSS
                     LLAALNEFAQSTQIPALSRFVDGVAVAIERGTPLADVLRAQAQDVRDNAKRELLEVAG
                     KKEIAMLAPVVFLILPLTVVFAIFPGLSLMKLAF"
     misc_feature    complement(46305..>46877)
                     /locus_tag="HMPREF0733_10043"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; cl19503"
                     /db_xref="CDD:267856"
     gene            complement(47198..48052)
                     /locus_tag="HMPREF0733_10044"
                     /db_xref="GeneID:9901295"
     CDS             complement(47198..48052)
                     /locus_tag="HMPREF0733_10044"
                     /note="Pfam: PF00482; InterPro: IPR001992"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein"
                     /protein_id="YP_003982936.1"
                     /db_xref="GI:311111714"
                     /db_xref="GeneID:9901295"
                     /translation="MGVIYGLAMGIGVFLVWWSCWSMPQGAVKTEREPKIAVTLRKAG
                     MHTITPSAFTGVSILSGVLAGVLLFALTGLWSFAFLGTGSGFIMPRVVVNHRAKVREG
                     KLWQLWPDAVDHLRSAIRAGLSLPEALIQLSYRGPYELREAFARFGSDYRATGDFVAS
                     LNRLKEYVADPVADNIVEALKIAREVGGSDLGRLLGTLSNFLRENARTRAELQARQSW
                     TVNAARLACVAPWVVLMLMATQPAVRNIYNSFAGFVLMFAGAGLSVIAYRIMLRIGAL
                     PQERRVFA"
     misc_feature    complement(47234..>47935)
                     /locus_tag="HMPREF0733_10044"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; cl19503"
                     /db_xref="CDD:267856"
     gene            complement(48052..49314)
                     /gene="cpaF"
                     /locus_tag="HMPREF0733_10045"
                     /db_xref="GeneID:9901296"
     CDS             complement(48052..49314)
                     /gene="cpaF"
                     /locus_tag="HMPREF0733_10045"
                     /note="COG: COG4962; Pfam: PF00437; InterPro: IPR001482"
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein CpaF"
                     /protein_id="YP_003982937.1"
                     /db_xref="GI:311111715"
                     /db_xref="GeneID:9901296"
                     /translation="METPRSAVVPDYYSLLDAEIRDAIRDGDLDPYTSQDAVEGLIRS
                     TVSAYERRMVRASLPPLENVEEIIHRLRNDLCGYGPLQPYLDDEEVEEIWINSPDEIF
                     VARAGESELTGLHLSDEAIQQLLERMLKPSGRRVDLSSPFVDASLPDGSRLHAVIPDI
                     TRAHTSLNIRKFVVRAKRLPDLVKLGSLSAGAASFLHAAVESGVNILVSGATQAGKTT
                     MLNCLAASIPPRERVVTCEEIFELSIPLRDVVGMQCRQPNLEGKGAIALRRLVKEALR
                     MRPDRLLIGEVREAESLDMLIALNAGLPGMCTIHANSARDAVTKICTLPLLAGDNISS
                     AFVVPTVASCFDLVIHCGRDTHGHRQVEEIYMLGGRVEDGVIEMSPLFTRQQGEMVCV
                     ALEIPTPEKWVRAGHRPEQVLAAAKAGR"
     misc_feature    complement(48154..49209)
                     /gene="cpaF"
                     /locus_tag="HMPREF0733_10045"
                     /note="Flp pilus assembly protein, ATPase CpaF
                     [Intracellular trafficking and secretion]; Region: CpaF;
                     COG4962"
                     /db_xref="CDD:227297"
     misc_feature    complement(order(48664..48672,48682..48687))
                     /gene="cpaF"
                     /locus_tag="HMPREF0733_10045"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(48457..48462,48601..48606,48610..48612,
                     48664..48672,48682..48684))
                     /gene="cpaF"
                     /locus_tag="HMPREF0733_10045"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(48460..48474)
                     /gene="cpaF"
                     /locus_tag="HMPREF0733_10045"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(49580..50347)
                     /gene="rfbB"
                     /locus_tag="HMPREF0733_10046"
                     /db_xref="GeneID:9901297"
     CDS             complement(49580..50347)
                     /gene="rfbB"
                     /locus_tag="HMPREF0733_10046"
                     /note="COG: COG1134; Pfam: PF00005; InterPro: IPR003439"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_003982938.1"
                     /db_xref="GI:311111716"
                     /db_xref="GeneID:9901297"
                     /translation="MKIEKIDLPEIDPNAPVVIQVDELVKSFVLRHTRSMKEAFVWLM
                     KGRKGDLSEKFNALNGITLNVKQGERVALLGLNGSGKSTLLKLISGVMQPEGGQVLNR
                     GKIAGLIEVGAGFHPDLTGRDNVFLNGAILGMTKKEIEDAFDDIVAFSEIEEFIDTEV
                     KFYSSGMYLRLAFSVAVHTNPDIFLVDEILAVGDEPFQKKCIARIQELIQAGKTLVVV
                     SHDLDLVSQICDRGVVLDHGNLSFDGDIKDAVKMIRG"
     misc_feature    complement(49595..50299)
                     /gene="rfbB"
                     /locus_tag="HMPREF0733_10046"
                     /note="ABC-type polysaccharide/polyol phosphate transport
                     system, ATPase component [Carbohydrate transport and
                     metabolism / Cell envelope biogenesis, outer membrane];
                     Region: TagH; COG1134"
                     /db_xref="CDD:224057"
     misc_feature    complement(49616..50293)
                     /gene="rfbB"
                     /locus_tag="HMPREF0733_10046"
                     /note="ATP-binding cassette component of polysaccharide
                     transport system; Region: ABC_KpsT_Wzt; cd03220"
                     /db_xref="CDD:213187"
     misc_feature    complement(50102..50125)
                     /gene="rfbB"
                     /locus_tag="HMPREF0733_10046"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213187"
     misc_feature    complement(order(49688..49690,49784..49789,49895..49897,
                     50099..50107,50111..50116))
                     /gene="rfbB"
                     /locus_tag="HMPREF0733_10046"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213187"
     misc_feature    complement(49895..49906)
                     /gene="rfbB"
                     /locus_tag="HMPREF0733_10046"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213187"
     misc_feature    complement(49832..49861)
                     /gene="rfbB"
                     /locus_tag="HMPREF0733_10046"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213187"
     misc_feature    complement(49784..49801)
                     /gene="rfbB"
                     /locus_tag="HMPREF0733_10046"
                     /note="Walker B; other site"
                     /db_xref="CDD:213187"
     misc_feature    complement(49766..49777)
                     /gene="rfbB"
                     /locus_tag="HMPREF0733_10046"
                     /note="D-loop; other site"
                     /db_xref="CDD:213187"
     misc_feature    complement(49682..49702)
                     /gene="rfbB"
                     /locus_tag="HMPREF0733_10046"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213187"
     gene            complement(50353..51231)
                     /gene="wzm"
                     /locus_tag="HMPREF0733_10047"
                     /db_xref="GeneID:9901298"
     CDS             complement(50353..51231)
                     /gene="wzm"
                     /locus_tag="HMPREF0733_10047"
                     /note="COG: COG1682; Pfam: PF01061; InterPro: IPR013525"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide ABC transporter membrane protein"
                     /protein_id="YP_003982939.1"
                     /db_xref="GI:311111717"
                     /db_xref="GeneID:9901298"
                     /translation="MSTLHDEPLKAPGRGRGILDAIRNRYLLRLLVDKEIQVRYRGSV
                     LGILWSYIKPGVQFGVFYVAMGLFLGLERGMHNYAIYLFSGMIVINFFSEGFGNGART
                     MVVNSALIRKIYLPRELFSLSTVWVAVVHFIPQIVVMLIACFFAGWRPGLRNIAAILA
                     GMAIVMLLSYGLGLIFGVANVFFRDSENIVDMLLMVATWFSPVLYSWTMVRDTLYPWV
                     FNVFMLNPLTVAVELFHYGFWRPTADLEKSGHFAEIVPHLFSFWTPVGIGISLLTVLI
                     GDLLFRKFEGNFAQEL"
     misc_feature    complement(50356..51180)
                     /gene="wzm"
                     /locus_tag="HMPREF0733_10047"
                     /note="ABC-2 type transporter; Region: ABC2_membrane;
                     cl17235"
                     /db_xref="CDD:266576"
     misc_feature    complement(50524..51153)
                     /gene="wzm"
                     /locus_tag="HMPREF0733_10047"
                     /note="ABC-type multidrug transport system, permease
                     component [Defense mechanisms]; Region: COG0842"
                     /db_xref="CDD:223912"
     gene            complement(51228..53237)
                     /locus_tag="HMPREF0733_10048"
                     /db_xref="GeneID:9901299"
     CDS             complement(51228..53237)
                     /locus_tag="HMPREF0733_10048"
                     /note="COG: COG1216; Pfam: PF00535"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase domain-containing protein"
                     /protein_id="YP_003982940.1"
                     /db_xref="GI:311111718"
                     /db_xref="GeneID:9901299"
                     /translation="MAETQTLKTLQRVIFPSAVETDVVPLYVDAGVAAGVQLPTRIDG
                     DATTSITEAAQVQEQSAANIAANRTAAEGLIGRRSINVNPGQSLSFGTYFNAFPASYW
                     RRWTDLKEVVLSVQTRGEGMVIVYKSNGRGVIQRVDAKLLSGDETSIFTLPLAPFGDG
                     GWYWFDLSGTEDLELVEANWLGDIEPRADVQAGQATVQITTMNKVDYCIDNIRTLGNS
                     PEIFDAVHEFLIVDQGSSKVQDHEEFEEVVKPLAGKFRIINQGNLGGSGGFSRGMFEA
                     VKNGSDYVLLLDDDVIVEPEAILRMVTFANYCKDPTIVGAHMFDMFDRSVLHAFGEVV
                     DPWRNFYAKPHEDMAMGHDLGRSNLRSTHWLHRRVDVDYNGWWMCLIPTSVIRKIGLS
                     LPLFLKWDDAEYGLRAKAAGIPTVSFPGAGVWHVSWTDKDDSVGWQAYYHERNRLITA
                     LLHSPFDKGGRVLVDSMFLDVKHTLSMQYYTQAGRLMALEDLLAGPEHLHESLSARLP
                     VIRQLAGEYPESQMKPNVDDFPTVKSKKPPFRGRRNFKSPGYKKLVPWTARTVARQLF
                     KPVDDEAKEHPQIQLNYGETNWWTLSKFDSALATNAEGTGLFWYRRDPQQLRSKLIHA
                     TRLHAKIIKDWEQLRKRYQDAAADVASYDAWAETFAKHTESELKR"
     misc_feature    complement(51696..52643)
                     /locus_tag="HMPREF0733_10048"
                     /note="Predicted glycosyltransferases [General function
                     prediction only]; Region: COG1216"
                     /db_xref="CDD:224137"
     misc_feature    complement(51891..52643)
                     /locus_tag="HMPREF0733_10048"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    complement(order(52368..52370,52374..52376,52545..52547,
                     52632..52634,52638..52640))
                     /locus_tag="HMPREF0733_10048"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(53240..54427)
                     /gene="glf"
                     /locus_tag="HMPREF0733_10049"
                     /db_xref="GeneID:9901300"
     CDS             complement(53240..54427)
                     /gene="glf"
                     /locus_tag="HMPREF0733_10049"
                     /EC_number="5.4.99.9"
                     /note="COG: COG0562; Pfam: PF01266,PF03275; InterPro:
                     IPR016040"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-galactopyranose mutase"
                     /protein_id="YP_003982941.1"
                     /db_xref="GI:311111719"
                     /db_xref="GeneID:9901300"
                     /translation="MTADLVVVGSGLFGLTIAEQAATELGLKVVLLDRRSHIGGNAYS
                     ENEEQTGIEVHRYGAHLFHTSNERVWEYVNRFTGFTNYVHRVYTRHNGIVYPMPINLG
                     TINQFFNAAYSPAEAKALIAEQAGELAGTDPQNLNDKGISLIGRPLYEAFIKHYTAKQ
                     WQTPPEELPASIISRLPVRYTYDNRYFNDKYEGLPVDGYAAWLERMAAHPNIEVRLNT
                     DFFSDDHEYSREKVLGQIPVVYTGPVDRYFDYAEGDLSWRTIDLEEEVLPIEDFQGCS
                     VMNYPDADVPFTRIHEFRHFHPERDYTKDATVIMREYSRFANKGDEPYYPVNTSVDRE
                     KLLKYRDLAKGEQNVLFGGRLGTYKYLDMHMAIGAALSMFDNKIRPHFAQGAKIESGG
                     VDA"
     misc_feature    complement(53294..54418)
                     /gene="glf"
                     /locus_tag="HMPREF0733_10049"
                     /note="UDP-galactopyranose mutase [Cell envelope
                     biogenesis, outer membrane]; Region: Glf; COG0562"
                     /db_xref="CDD:223636"
     misc_feature    complement(54200..54409)
                     /gene="glf"
                     /locus_tag="HMPREF0733_10049"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    complement(53348..53977)
                     /gene="glf"
                     /locus_tag="HMPREF0733_10049"
                     /note="UDP-galactopyranose mutase; Region: GLF; pfam03275"
                     /db_xref="CDD:251844"
     gene            complement(54568..54735)
                     /locus_tag="HMPREF0733_10050"
                     /db_xref="GeneID:9901301"
     CDS             complement(54568..54735)
                     /locus_tag="HMPREF0733_10050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982942.1"
                     /db_xref="GI:311111720"
                     /db_xref="GeneID:9901301"
                     /translation="MQFEPKVETLRIPQPGSSVGLVHSNFGIIAYTVCVVGLNPQSAV
                     PGKYATDGVIG"
     gene            55597..58200
                     /locus_tag="HMPREF0733_10051"
                     /db_xref="GeneID:9901302"
     CDS             55597..58200
                     /locus_tag="HMPREF0733_10051"
                     /note="COG: COG1674; Pfam: PF01580; InterPro: IPR002543"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982943.1"
                     /db_xref="GI:311111721"
                     /db_xref="GeneID:9901302"
                     /translation="MMLMTILLPLVAGVAFALFTGMWIFLLMSVASSLFMLMHFFGGR
                     AENRGAAALVKSSAKQELERAQALPTAGTLLHAAAPDAARSPAVVLGYGPRLPYISGR
                     NVRFEKISPHPQAPHYIPIPVPGLPHDVLLRAEHLHAYLVQLVAHARDTITVITDAEH
                     AETPLYGALRSLGVCPRVFLHEGASQAHHILEKICDAAERPGTALSTSQEAGDDRLFI
                     ISASLVRSIPAALIKRAAQGARLCIVHMPIARGTIDSPRSASVFTHIPHLQVHTHGDY
                     LESVQYLLRGNITDDTAHKITGSSQHAGLTPHEGIVQNHPLDLHDICATADGLSTDTY
                     IRTLGALSAVQASSPPGSGHGTGSVHARTLAFSELTQQSTNLLYEQCLQRWEHNRYAE
                     DIRCLLGATTEGFCDIGFTTHGPHWLLGGTTGAGKSQLLRSLILSAALRYSPERLGLI
                     LVDFKGSAGLGPLAELPHTLSLLSDFDVAAVRRALEFLRADVNRRELDLRNLGVNSYH
                     DYLRLCASTGKTPQYPEVVIVVDEFRMLVESMPDAMTELMRIATIGRSLGIHLLLATQ
                     RPQGSISQDIRANIATNICLRVASAQDSYNLLGHEKAAHISASSPGAGYVSLPDGRIL
                     AFRAPLVDALPQQHADFQQIYRWESPGWVPLNEIPSVQQVPAEGEDKLLTRAVHSIRD
                     LYLSSHKSPAFVDHSEQNSSSVAYTRARYTPIPQALPENFPLTRTLLDTDLHQILGSD
                     GARRRGYLLGTVEIPQYGKRQPIRLDLEAHPGALAVLGTVSERTAITNALIAQAIERQ
                     NPVYVFTSDAGYHRRLHSYADSLAVLVGPHEPQHLRFCLEKYVRVIMLTRALSSLCSS
                     VTELMDGLKCS"
     misc_feature    56839..57306
                     /locus_tag="HMPREF0733_10051"
                     /note="FtsK/SpoIIIE family; Region: FtsK_SpoIIIE;
                     pfam01580"
                     /db_xref="CDD:250719"
     gene            58191..59216
                     /locus_tag="HMPREF0733_10052"
                     /db_xref="GeneID:9901303"
     CDS             58191..59216
                     /locus_tag="HMPREF0733_10052"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982944.1"
                     /db_xref="GI:311111722"
                     /db_xref="GeneID:9901303"
                     /translation="MLMRDPQTESYLYDVLAQSYREGYQVVFTSALPLRGRFNSVAYS
                     TLLSRRFVESDLLRKSSKSYPLPNATHFAIEGGLNTALVGDVPLEASTLCPVVTSCEN
                     IIELQSGNSNFSCDKSLSLRQFPQTFPMPQLETIVMWHRGYNAQGTHILCGYSRTGDP
                     SFLQAKEGVFIPVVGSRASGKTHFLSALRMLNPHLGALYINGNTPPDAQKIRQMCKSV
                     QDPEKTLILIDDLAYIPTAAQQVLLELGPRFRAVWVAYTPWARWHSSPILTALSGCSR
                     AVLLAPASISDGDICSLHEIPRDMYTEGMLPAGRGALVDAGRVQAFQVPDEVYQSAHN
                     AVQAYQE"
     misc_feature    58698..>58943
                     /locus_tag="HMPREF0733_10052"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     gene            complement(59219..59695)
                     /locus_tag="HMPREF0733_10053"
                     /db_xref="GeneID:9901304"
     CDS             complement(59219..59695)
                     /locus_tag="HMPREF0733_10053"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982945.1"
                     /db_xref="GI:311111723"
                     /db_xref="GeneID:9901304"
                     /translation="MGKTTNTMKARITVPITVKITSGILGFFAVVLVYRGIIAPFIMN
                     DSERNADRIVNSLIQVALGVGIMFCAVRFYQGHARVWVMLISLCAAFVGASNLSIYFS
                     LTPEVQAAAVTFLVINCVEILLAGTAFALLFTRATREYTLKVTEEEERELSRYAGR"
     gene            60107..60355
                     /locus_tag="HMPREF0733_10054"
                     /db_xref="GeneID:9901305"
     CDS             60107..60355
                     /locus_tag="HMPREF0733_10054"
                     /note="Pfam: PF02467; InterPro: IPR003482"
                     /codon_start=1
                     /transl_table=11
                     /product="WhiB family transcription regulator"
                     /protein_id="YP_003982946.1"
                     /db_xref="GI:311111724"
                     /db_xref="GeneID:9901305"
                     /translation="MDWRSRAACLDKDPELFFPVGNTGPALLQIEEAKTVCRSCEVID
                     VCLKWAIETGQDSGVWGGTSEDERRAMKRRAARARRAS"
     misc_feature    60113..60307
                     /locus_tag="HMPREF0733_10054"
                     /note="Transcription factor WhiB; Region: Whib; pfam02467"
                     /db_xref="CDD:111373"
     gene            complement(60461..62026)
                     /locus_tag="HMPREF0733_10055"
                     /db_xref="GeneID:9901306"
     CDS             complement(60461..62026)
                     /locus_tag="HMPREF0733_10055"
                     /note="COG: COG3920; Pfam: PF08448,PF07568,PF02518;
                     InterPro: IPR003594"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_003982947.1"
                     /db_xref="GI:311111725"
                     /db_xref="GeneID:9901306"
                     /translation="MSFTESNLSPGGFGPGDTEWIHLIIGEWQIIADIAQSDLVVWFP
                     TDYVVADGSGPDSVSGPSASSGFSAIAHVRPSNVHTLFHHDIVDHTMDDNICDEARKS
                     WHTQKIVHHVMEAGPSMRPGVKVTFVPIVRNSRTIALLSMHTIPTVVRASSQAEEIYN
                     WVTENMLEMIHLGIWPDPLAQENNTRGNPRAIDGIIVINPQGQVVLASPNANSMYARL
                     GLGDHLENLNLADVTRDMLPSGEEADETLQLVLAGRADIRTELTIGRTRVTMRSIPLV
                     HSTTFRLERRGALILCRDVTELRRRELELMTKDATIREIHHRVKNNLQTVSALLRLQS
                     RRMTTPEAKQGLEQAMRRVATIATVHEALSQGLTQSVDFDELIERQFHIAAELASPGQ
                     TVDTELLGHFGLLPSQFATPLALVINEVVANAVEHGLNGETGRVTLEGRRNINEQGDN
                     TLTVIITDNGRGMGDDPIEESGADAYRPTAEHEGLGMQIVRTLVASELNGSIRWEANE
                     PSGTRVIINAVLS"
     misc_feature    complement(61547..61990)
                     /locus_tag="HMPREF0733_10055"
                     /note="Signal transduction histidine kinase; Region:
                     H_kinase_N; pfam12282"
                     /db_xref="CDD:256954"
     misc_feature    complement(61127..61450)
                     /locus_tag="HMPREF0733_10055"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    complement(60479..61165)
                     /locus_tag="HMPREF0733_10055"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG3920"
                     /db_xref="CDD:226434"
     misc_feature    complement(60890..61087)
                     /locus_tag="HMPREF0733_10055"
                     /note="Histidine kinase; Region: HisKA_2; pfam07568"
                     /db_xref="CDD:203685"
     misc_feature    complement(60479..60790)
                     /locus_tag="HMPREF0733_10055"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(60485..60487,60491..60496,60509..60511,
                     60515..60517,60566..60577,60638..60643,60647..60649,
                     60653..60655,60659..60661,60749..60751,60758..60760,
                     60770..60772))
                     /locus_tag="HMPREF0733_10055"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(60758..60760)
                     /locus_tag="HMPREF0733_10055"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(60569..60571,60575..60577,60641..60643,
                     60647..60649))
                     /locus_tag="HMPREF0733_10055"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(62180..63736)
                     /locus_tag="HMPREF0733_10056"
                     /db_xref="GeneID:9901307"
     CDS             complement(62180..63736)
                     /locus_tag="HMPREF0733_10056"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase involved in chromosome partitioning
                     family protein"
                     /protein_id="YP_003982948.1"
                     /db_xref="GI:311111726"
                     /db_xref="GeneID:9901307"
                     /translation="MIHNIPLVLLGDDGTILNAIESQRGRVSVARSAHTFADALGYAH
                     AGIACAILSVGLPQEATVSILHELDEADVKFIALVPEDTPLPDLVMPLATDTEPHQLP
                     AVVEKLLDEASAEPEQELGITPQKAENGYGYDSGYSGHYGYDTQNLYNGSGEYLHPDT
                     SGYGYALVNPNRSQTEQSSMDFPLSCPSQEQLKASQLQEGYEASAHFESNMQQPTLNE
                     RRDSPRQYYPQFSAPQIDDTVEAGNRGTIVAVWGTGGAPGRSTLALNLANCAAAEGMR
                     VCLVDADTYNPSLSPLLGLLDDYSGIAQLCHFIERGQLDTQISDEAISTLRVGKYYLD
                     FLSGITRPDRWPELRTRALRDSIKWLAHRYDVIILDTAACLESDAELGFAQAGPRRNG
                     AAITALEMADHIVLLGNADIIGIPRTIRAYDQMHEGACTLRDTAKVHIWLNKVRAEAT
                     GRDAERELANTWQRFGPRNPISGFLPYDRKTVDRAWFRGQTLLEYAPRSPLIVGIRKL
                     YTSLGLRKLR"
     misc_feature    complement(62492..62998)
                     /locus_tag="HMPREF0733_10056"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    complement(62237..>62644)
                     /locus_tag="HMPREF0733_10056"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            complement(63737..64393)
                     /locus_tag="HMPREF0733_10057"
                     /db_xref="GeneID:9901308"
     CDS             complement(63737..64393)
                     /locus_tag="HMPREF0733_10057"
                     /note="Pfam: PF08666"
                     /codon_start=1
                     /transl_table=11
                     /product="SAF domain-containing protein"
                     /protein_id="YP_003982949.1"
                     /db_xref="GI:311111727"
                     /db_xref="GeneID:9901308"
                     /translation="MRMHKPGFKDPKLIVGLILILISIAGVIGIIRINNQTYTYYTAK
                     NDISIGQKITPDMLIEKQVNLGDSKDRYLSREQLESGKYIAVRQIPAGELISSASANE
                     NIQERRRLVTVTLDRGIASTFKAGERVDIWVISSGKEKQKVPEGEGKNEDIESEQKPL
                     VQNAEISTIAVDEGVLGANGHANVQLWIESEKLPDILHAMSSETKVTLVPIEYKSEGN
                     "
     misc_feature    complement(64100..64279)
                     /locus_tag="HMPREF0733_10057"
                     /note="SAF domains of the flagella basal body P-ring
                     formation protein FlgA and the flp pilus assembly CpaB;
                     Region: SAF_CpaB_FlgA_like; cd11614"
                     /db_xref="CDD:212159"
     gene            64785..65015
                     /locus_tag="HMPREF0733_10058"
                     /db_xref="GeneID:9901309"
     CDS             64785..65015
                     /locus_tag="HMPREF0733_10058"
                     /note="Pfam: PF00376"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA binding domain-containing protein"
                     /protein_id="YP_003982950.1"
                     /db_xref="GI:311111728"
                     /db_xref="GeneID:9901309"
                     /translation="MSAPRFLTLSDVAEELQVSLSQVRALVRSGELPAIQIGGRNQWR
                     IERTRFEEYINERHEQTLEAIASGKMTKIKAN"
     misc_feature    64800..64955
                     /locus_tag="HMPREF0733_10058"
                     /note="Helix-turn-helix domain; Region: HTH_17; pfam12728"
                     /db_xref="CDD:257254"
     gene            complement(65012..65587)
                     /locus_tag="HMPREF0733_10059"
                     /db_xref="GeneID:9901310"
     CDS             complement(65012..65587)
                     /locus_tag="HMPREF0733_10059"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982951.1"
                     /db_xref="GI:311111729"
                     /db_xref="GeneID:9901310"
                     /translation="MRMQRLFRDLDIQFEAEQLRALENQAQRRARMEYMAVTMRERCA
                     AQHGSRVKVNGTDGMVREGYLEAIGQGWIQISTGRENILIPESSILWWESESQAAEVK
                     VDVQARAYRFSMSDACYALMMAQEPVRLSCASPVNTMFEGVIARVGADFIEMALAPCE
                     PYSAYSNALAYKERGVRIIPTSRICAIVTVN"
     gene            65780..66814
                     /locus_tag="HMPREF0733_10060"
                     /db_xref="GeneID:9901311"
     CDS             65780..66814
                     /locus_tag="HMPREF0733_10060"
                     /note="Pfam: PF01476"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982952.1"
                     /db_xref="GI:311111730"
                     /db_xref="GeneID:9901311"
                     /translation="MKSQAQMSVLDGVLSIGVPTLSVLSGALAHSVRVISVSLTGLEN
                     AMMMSVEVLSAAVMLWWALGVILGVGYLLKVRAGSIHLHHREDRGTFLLPRYIRNTIL
                     TLGGAALGLSAAFAPAQAADAHPNISSPAISAPSQLSASPAAHSASSSEASVENSTPS
                     TEANASPQESAAGTPQGVPSQNSPFYQAAASSPQVTGAASASPHEYSESPAVPVKKHQ
                     QQRPSLSPYAQPYGTPPPYISAEPAVPSTTQPQAEHQSLSPFFGGQREGAPSREVAPA
                     SRNHTTRSSHQVVVGDSLWSIACHELSDDASPPEILEYSLRIHAANLDVMGDNPNILY
                     PGQTLTLPDR"
     misc_feature    66632..66802
                     /locus_tag="HMPREF0733_10060"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     gene            66872..67501
                     /locus_tag="HMPREF0733_10061"
                     /db_xref="GeneID:9901312"
     CDS             66872..67501
                     /locus_tag="HMPREF0733_10061"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982953.1"
                     /db_xref="GI:311111731"
                     /db_xref="GeneID:9901312"
                     /translation="MTAINISLHDLSKKIESHLLEEAAARAQQGDIPDVPPSTAPGNL
                     VQSQYGVVLSPINMYAQDQQNRESHHMLPQNTAVRARIRSRKSASHGRPLKRSDSGTL
                     RIESLCAGIGLAVLEVLMKKRSAQQFKHWLSPECFTALEQRRSSQEQHASYLAFTKTP
                     HVARSRAQRLNDETYEACIILTDGVVTRAMAMRVQARYGGWYITALHFI"
     gene            complement(67576..70185)
                     /gene="secA"
                     /locus_tag="HMPREF0733_10062"
                     /db_xref="GeneID:9901313"
     CDS             complement(67576..70185)
                     /gene="secA"
                     /locus_tag="HMPREF0733_10062"
                     /note="COG: COG0653; Pfam: PF07517,PF01043,PF07516;
                     InterPro: IPR000185"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="YP_003982954.1"
                     /db_xref="GI:311111732"
                     /db_xref="GeneID:9901313"
                     /translation="MASFLEKILRTGDKKILRQLEAYSAAVDSLEDSFASMTDAELRG
                     ETDKFRARIEDGESLDIMLPEAFAVVREASKRTLGKRHYKVQVMGGAALHLGNIAEMK
                     TGEGKTLVATLPAYLNALSGKGVHVVTVNDYLAEYQANLMGRVYRFLGMESGVILSSM
                     DPDQRRKQYEADITYGTNNEFGFDYLRDNMAWTVDEQVQRGHNFAIIDEVDSILIDEA
                     RTPLIISGPAAGEANRWYGEFARIAKNVLKEDEDYEVDEKKRTVGILESGIDKVEDHL
                     GIKNLYESRNTPLIGFLNNSIKAKELFTNNKDYVVIDGEVLIVDEHTGRILPGRRYND
                     GIHQAIEAKEGVEIKPENQTMATVTLQNYFRMYDKLSGMTGTAETEASEFMSTYELGV
                     VAIPTNKDVQRIDNPDKVYRNEVAKFKAVVKDIKKRHEKGQPILVGTTSVEKSEYLSR
                     QLAKEGVRHEVLNAKNNEREAHIVAQAGRKGAVTVATNMAGRGTDIMLGGNPEFEAVA
                     KMAELGLDPNRDSEAYEKRWPDILEQCEEEAAAEHDEVTELGGLYVLGTERHESRRID
                     NQLRGRSGRQGDPGESRFYLSLTDELMRLFNTGAATRLMAMAPEDSSLDSKLVTRAIA
                     TAQSNVESRNAEQRKNVLKYDDVLNRQREAIYKDRSLILHGDDLKEQISGFVDEVLTT
                     AIDERVSEGHAEDWDLDDLWEALESIYPVSITADDLAEDAGDRTQITRDQIVKEILAD
                     AHLVYDEREESVGEDSMREIERRVMLSTIGERWPEHLYEMDYLKEGIGLRAMAQRDPL
                     VEYQREGYSMYQAMLDAIREETVSYLFNLDLSKQRTKASAVQLQSPSRPKFLQYSAPN
                     EEGGTDVRVENAD"
     misc_feature    complement(67699..70185)
                     /gene="secA"
                     /locus_tag="HMPREF0733_10062"
                     /note="preprotein translocase subunit SecA; Reviewed;
                     Region: PRK12904"
                     /db_xref="CDD:237259"
     misc_feature    complement(<69544..69894)
                     /gene="secA"
                     /locus_tag="HMPREF0733_10062"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cl17251"
                     /db_xref="CDD:266587"
     misc_feature    complement(69163..69504)
                     /gene="secA"
                     /locus_tag="HMPREF0733_10062"
                     /note="SecA preprotein cross-linking domain; Region:
                     SecA_PP_bind; smart00958"
                     /db_xref="CDD:214938"
     misc_feature    complement(<68698..68961)
                     /gene="secA"
                     /locus_tag="HMPREF0733_10062"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(68719..68727,68794..68799,68857..68868))
                     /gene="secA"
                     /locus_tag="HMPREF0733_10062"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(67699..68346)
                     /gene="secA"
                     /locus_tag="HMPREF0733_10062"
                     /note="SecA Wing and Scaffold domain; Region: SecA_SW;
                     pfam07516"
                     /db_xref="CDD:254253"
     gene            complement(70438..71088)
                     /locus_tag="HMPREF0733_10063"
                     /db_xref="GeneID:9901314"
     CDS             complement(70438..71088)
                     /locus_tag="HMPREF0733_10063"
                     /note="COG: COG1544; Pfam: PF02482; InterPro: IPR003489"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated inhibitor protein Y"
                     /protein_id="YP_003982955.1"
                     /db_xref="GI:311111733"
                     /db_xref="GeneID:9901314"
                     /translation="MEGNIVEVNIYGRNIKISDRLREYVEEKVEKFEQLGDNVSDIDV
                     KVTKDGHLGGESIRVEITVVGRGPVLRAEAQGHDKFAVFDETYGKLLERLRRARDRRK
                     LRKHGGKHPVSVADATGSLPTVTETITEILLPDVPVEEAAFDNSEVTLVDEAASPIEI
                     RHKSFVGEKLTPAEAVDRMELVGHDFYLYIDKETGAPAAAYRRKGWSYGIITLTEE"
     misc_feature    complement(70834..71070)
                     /locus_tag="HMPREF0733_10063"
                     /note="RaiA ('ribosome-associated inhibitor A', also known
                     as Protein Y (PY), YfiA, and SpotY,  is a stress-response
                     protein that binds the ribosomal subunit interface and
                     arrests translation by interfering with aminoacyl-tRNA
                     binding to the ribosomal...; Region: RaiA; cd00552"
                     /db_xref="CDD:238308"
     misc_feature    complement(order(70846..70848,70855..70857,70861..70863,
                     70870..70872,70876..70878,70885..70896,70903..70905,
                     70942..70944,70954..70956,70966..70971,70987..70989,
                     70996..70998,71050..71052,71056..71058,71062..71064))
                     /locus_tag="HMPREF0733_10063"
                     /note="30S subunit binding site; other site"
                     /db_xref="CDD:238308"
     gene            complement(71247..72071)
                     /gene="comF"
                     /locus_tag="HMPREF0733_10064"
                     /db_xref="GeneID:9901315"
     CDS             complement(71247..72071)
                     /gene="comF"
                     /locus_tag="HMPREF0733_10064"
                     /note="Pfam: PF00156"
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein F"
                     /protein_id="YP_003982956.1"
                     /db_xref="GI:311111734"
                     /db_xref="GeneID:9901315"
                     /translation="MDKTPRKRGKKALYAVWELFFPATCVGCGVGGTALLDAAGTRRA
                     LCTRCETSLRKQTSAVHTPVLQHPVPGAVAAGIYEKTLAHVILSMKNAGRTDAVPELA
                     RALGRAVATIIDRAQVPAGTRILLIPAPSSQRSVQRRGYVPAELLARQVEHELNRSVA
                     LYRRKVRVKTHHILSLEKENIYQRLIRPNTAGQKTLGVSARAQRMEGAMRVSPRASVA
                     GALCIVCDDVMTTGATVFEASRVLHQGGARVLGAACVAAVSMQKKVDEEALMVHPD"
     misc_feature    complement(71292..72017)
                     /gene="comF"
                     /locus_tag="HMPREF0733_10064"
                     /note="Predicted amidophosphoribosyltransferases [General
                     function prediction only]; Region: ComFC; COG1040"
                     /db_xref="CDD:223970"
     misc_feature    complement(71259..>71471)
                     /gene="comF"
                     /locus_tag="HMPREF0733_10064"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(71298..71300,71370..71384,71388..71396))
                     /gene="comF"
                     /locus_tag="HMPREF0733_10064"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(72079..73746)
                     /locus_tag="HMPREF0733_10065"
                     /db_xref="GeneID:9901316"
     CDS             complement(72079..73746)
                     /locus_tag="HMPREF0733_10065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982957.1"
                     /db_xref="GI:311111735"
                     /db_xref="GeneID:9901316"
                     /translation="MLLGGVGSIALLVQACSGLPDPKGIQKYSESLDNADDRKSAIHA
                     MSPQVGGTPEGIIEGFLRAGVDSSDNYGVARQYLTTEFAQQWVPEVQTRIYSETARIT
                     RGEDNIYKVSIKQTARVDERGLVTSFINAPAPTPETFEMIQEGGEWRIRNCPNGLWID
                     GSEFDRSFKSYRLYYYDPSYTYAVPDLRWFARSDEIFKTLAQTLIMGPANYLKESVFS
                     ATYESMKVNGANFDAEKHTIKVDFGGESTDELQLARLRQQIVHLASNFTGIETVVFCY
                     NGHEISSSDKPEGFHEIPLVTQSNTRIVALNEDRLVTQRDFDAGDSQRTLVEKIKDPS
                     APTIGYDGTTYAYLSEGRKKLYTVRDTNSSKVWETRDLSRPSIDHYGWVWATDHSGTV
                     RAFNPASDSVEEREKGINISVPWQNGLVFNSLKISRDGTRGAFITTRDNASMLVISGI
                     IRDESGKPRSFTELVRVNASVSPHCVDWAGEQTLAVVNTTTGEAELTSLNSEETKLDR
                     LEGLRSMSAAGDSGHIIGHVDTGECYLLEDRGWKLISGSLSEITYAG"
     misc_feature    complement(72082..73716)
                     /locus_tag="HMPREF0733_10065"
                     /note="lipoprotein LpqB; Provisional; Region: PRK13614"
                     /db_xref="CDD:237448"
     misc_feature    complement(72898..73230)
                     /locus_tag="HMPREF0733_10065"
                     /note="Sporulation and spore germination; Region: Germane;
                     pfam10646"
                     /db_xref="CDD:256105"
     gene            complement(73821..75569)
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /db_xref="GeneID:9901317"
     CDS             complement(73821..75569)
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /EC_number="2.7.13.3"
                     /note="COG: COG0642; Pfam: PF00672,PF00512,PF02518;
                     InterPro: IPR003594"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase MtrB"
                     /protein_id="YP_003982958.1"
                     /db_xref="GI:311111736"
                     /db_xref="GeneID:9901317"
                     /translation="MPTPDATSGASDSRDLDAKSKPRKKRTLNPFRAIHRLWVHSLQF
                     RSVTSAGIMMLIAFIAVGTSLSNQIATSLFENKKNQALEETSKGFETVQRVLDPISAR
                     EDSEVRRTVKHNLTVLDAGGDTQRRWVLVSLDQQSKKGFIPEQSSDNAPLDASVIPTD
                     FKDTVRDSPGVFWEKTTLSEPGKSNGEPYPALIIGTSVSIPQNPNYGLFMVYDLSESE
                     STITYINVVLSTGFTVLLILVLSIVWFVTRLVVRPITSTAITAEKLAAGDLNRRVNIR
                     GKHQAARLGISFNKMADSLQDQITQLERLSTLQQRFVSDVSHELRTPLSTVRLSSELL
                     YDSRDTLNPVQSRSVELMHNQVDRFQALLSDLLEISRFDAGSAVLNIDAEDFMSVLND
                     VLVEVIPHLERTGTRLIVHSEQAHIDIDIDRVRIERVLRNLLFNAIEHGESKPVDIYI
                     ATNATNLGVAVRDHGIGLSEEEAAQVFNRFWCADTSRKRTLGGTELGLSITAEDVRLH
                     GGRIEAWGIKGKGACFTMNLPLVQGGELGPSPVLITGEPEPEAYAHSALAGDTLSTSL
                     RKTRHETQDDASEGQI"
     misc_feature    complement(74028..75410)
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /note="heavy metal sensor kinase; Region: cztS_silS_copS;
                     TIGR01386"
                     /db_xref="CDD:233391"
     misc_feature    complement(74679..74822)
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(74685..74690,74697..74702,74706..74711,
                     74718..74723,74727..74732,74778..74780,74784..74789,
                     74796..74801,74805..74810,74817..74822))
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(74457..74648)
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(74472..74474,74484..74486,74493..74495,
                     74505..74507,74514..74516,74526..74528,74580..74582,
                     74589..74591,74601..74603,74610..74612,74622..74624,
                     74634..74636))
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(74616..74618)
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(73986..74294)
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(73998..74000,74004..74009,74022..74024,
                     74028..74030,74076..74087,74166..74171,74175..74177,
                     74181..74183,74187..74189,74253..74255,74262..74264,
                     74274..74276))
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(74262..74264)
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(74079..74081,74085..74087,74169..74171,
                     74175..74177))
                     /gene="mtrB"
                     /locus_tag="HMPREF0733_10066"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(75624..76319)
                     /gene="mtrA"
                     /locus_tag="HMPREF0733_10067"
                     /db_xref="GeneID:9901318"
     CDS             complement(75624..76319)
                     /gene="mtrA"
                     /locus_tag="HMPREF0733_10067"
                     /note="COG: COG0745; Pfam: PF00072,PF00486; InterPro:
                     IPR001789"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="YP_003982959.1"
                     /db_xref="GI:311111737"
                     /db_xref="GeneID:9901318"
                     /translation="MTTTTSTVLVVDDDDALAEMIGIVLAQEGYNAVFCENGSRAFET
                     FMRHSPDLVLLDLMLPGKSGIEVCEQIRSSSNVPIIMLTAKSDTEDVVKGLEAGADDY
                     IAKPFKHLELMARIRARLRPRESRQLVVRVGDTIMDMDGRTLKYKGVEVPMTPLEFDL
                     LAALVRRPGQAMSRQELLETVWGYSDVSDSLVNVHVQRLRAKFTDIGAEQVIQTVRGV
                     GYKVPLENVGGAA"
     misc_feature    complement(75657..76286)
                     /gene="mtrA"
                     /locus_tag="HMPREF0733_10067"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(75960..76286)
                     /gene="mtrA"
                     /locus_tag="HMPREF0733_10067"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(76002..76007,76014..76016,76071..76073,
                     76128..76130,76152..76154,76281..76286))
                     /gene="mtrA"
                     /locus_tag="HMPREF0733_10067"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(76152..76154)
                     /gene="mtrA"
                     /locus_tag="HMPREF0733_10067"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(76128..76136,76140..76145))
                     /gene="mtrA"
                     /locus_tag="HMPREF0733_10067"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(75999..76007)
                     /gene="mtrA"
                     /locus_tag="HMPREF0733_10067"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(75657..75932)
                     /gene="mtrA"
                     /locus_tag="HMPREF0733_10067"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(75663..75665,75678..75680,75711..75716,
                     75738..75740,75747..75749,75798..75803,75858..75860))
                     /gene="mtrA"
                     /locus_tag="HMPREF0733_10067"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(76357..77616)
                     /locus_tag="HMPREF0733_10068"
                     /db_xref="GeneID:9901319"
     CDS             complement(76357..77616)
                     /locus_tag="HMPREF0733_10068"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="YP_003982960.1"
                     /db_xref="GI:311111738"
                     /db_xref="GeneID:9901319"
                     /translation="MTSFSTRFADENTRKQYVPERLLLPGDYRAPEREFATELAERDT
                     VAVRASGLGEFPGTQIIDALHRVRGELGHPHLPFLPELPERGWQSTTLARTIATLSGM
                     ELEGASYGWRLVHARGGGTRESARARSCYVSDINALADVVGGESSGASVPEDAAPSFK
                     IQLCGPYTLAARVYAPNGERAISDAGAARDIRDAFLEGLGESISLIRQALNQPEARLT
                     VQLDEPELGRIISGTIPTVSGFRTIPAVPVSEIYESYRICANTFTELTITPMLNLTKV
                     PLTYPDDRTSNLSSVADACAIARTFSTADNPAELLFDPDEASQNLIQAQPLSDPHRWE
                     IAAAVLESGARLWLPIVDSDAIPQQAQRLWRLWNDVGLQKTEIRSVGLTHRANTTHIN
                     PHEATLQMARTTEYARIVAEMAAEGLG"
     misc_feature    complement(<76936..77472)
                     /locus_tag="HMPREF0733_10068"
                     /note="The URO-D_CIMS_like protein superfamily includes
                     bacterial and eukaryotic uroporphyrinogen decarboxylases
                     (URO-D), coenzyme M methyltransferases and other putative
                     bacterial methyltransferases, as well as cobalamine (B12)
                     independent methionine synthases; Region: URO-D_CIMS_like;
                     cl00464"
                     /db_xref="CDD:260440"
     gene            complement(77634..78023)
                     /locus_tag="HMPREF0733_10069"
                     /db_xref="GeneID:9901320"
     CDS             complement(77634..78023)
                     /locus_tag="HMPREF0733_10069"
                     /EC_number="5.4.99.5"
                     /note="COG: COG1605; Pfam: PF01817; InterPro: IPR010951"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate mutase"
                     /protein_id="YP_003982961.1"
                     /db_xref="GI:311111739"
                     /db_xref="GeneID:9901320"
                     /translation="MTQQEFDPRATSMGDEVSAEVYEELFAMRRSIDNFDAALVHILA
                     ERFRATQRVGVLKAQHNLPAGDPGREEAQIARLRAMAKESSLDPEFAEKFLNFIISEV
                     IRHHEKIAHAHKDELAQNDDSLDRQTD"
     misc_feature    complement(77679..77987)
                     /locus_tag="HMPREF0733_10069"
                     /note="chorismate mutase; Provisional; Region: PRK09239"
                     /db_xref="CDD:181719"
     gene            complement(78052..79263)
                     /gene="trmU"
                     /locus_tag="HMPREF0733_10070"
                     /db_xref="GeneID:9901321"
     CDS             complement(78052..79263)
                     /gene="trmU"
                     /locus_tag="HMPREF0733_10070"
                     /EC_number="2.1.1.61"
                     /note="COG: COG0482; Pfam: PF03054; InterPro: IPR004506"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /protein_id="YP_003982962.1"
                     /db_xref="GI:311111740"
                     /db_xref="GeneID:9901321"
                     /translation="MKILAAMSGGVDSAVAAARAVEAGHEVVGVHLALSRMPGTLRTG
                     SRGCCTLEDSMDARRVCAQLGIPFFVWDFSERFKEDVVDDFIAEYEAGRTPNPCMRCN
                     EKIKFAALLERAVSLGFDAVVTGHYARVITNDDGNRELHRAADWAKDQSYVLGVLTHE
                     QLKHAWFPLATTPSKAEVRAEAERRGFSVAKKPDSYDICFIPEGDTRAWLGEHIQMRP
                     GMIKDTSGNVVGEHPGAQGFTVGQRKGLALGTPAPDGKPRFVLEIRPKTNEVIVGSRE
                     LLSIDEIRGIRATWAGIPVPEAEHFLAQEPKLGVRSETFDVTAQVRAHADPVRGTAHL
                     EWAEDTDAETPGKLRVETVVRLHDGLFGVAPGQTMVLYQGTRVLGQSTIARAYSLARE
                     DLDDLRENAAV"
     misc_feature    complement(78115..79263)
                     /gene="trmU"
                     /locus_tag="HMPREF0733_10070"
                     /note="tRNA methyl transferase; Region: tRNA_Me_trans;
                     pfam03054"
                     /db_xref="CDD:251696"
     misc_feature    complement(78115..79260)
                     /gene="trmU"
                     /locus_tag="HMPREF0733_10070"
                     /note="tRNA methyl transferase. This family represents
                     tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase
                     which is involved in the biosynthesis of the modified
                     nucleoside 5-methylaminomethyl-2-thiouridine present in
                     the wobble position of some tRNAs; Region: tRNA_Me_trans;
                     cd01998"
                     /db_xref="CDD:238956"
     misc_feature    complement(order(79165..79167,79171..79173,79225..79236,
                     79240..79248))
                     /gene="trmU"
                     /locus_tag="HMPREF0733_10070"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238956"
     gene            complement(79361..80590)
                     /gene="iscS"
                     /locus_tag="HMPREF0733_10071"
                     /db_xref="GeneID:9901322"
     CDS             complement(79361..80590)
                     /gene="iscS"
                     /locus_tag="HMPREF0733_10071"
                     /EC_number="2.8.1.7"
                     /note="COG: COG1104; Pfam: PF00266; InterPro: IPR000192"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="YP_003982963.1"
                     /db_xref="GI:311111741"
                     /db_xref="GeneID:9901322"
                     /translation="MNRVYLDHAATTDVLPIAIDAMVQQMRAGGNPSSLHATGRDARA
                     TVEYARERIARAVGCDAAEVIFTSGGTEADNLAVKGMYWKRREADPVRRRILVSSIEH
                     HAVEETCEWLQKTEGAIIDWIPVDSQGLVDPENVRELIAQNPADVALVTVMWANNEVG
                     TVQPIQDIAAIASEYGIPMHTDAVQAFGAVPVNFRDSGVDTMAISGHKIGGPMGIGAL
                     IATRTAQLTPVLHGGGQERSVRSGTIDAPAIAGFAEAAAHVIEHLEEESIRIAALRNE
                     LIAAVQAVIPQAHLSGIDPTTEAFPGEKRLPANAHFTFEGAEGDTILFLLDMQGIQTS
                     TGSACNAGVTRPSHVLLAMGLDEDTARSAQRFTLGHSSTGEDIARLLAALPEAYAQAA
                     KAGLSSHLPDAQRWYGG"
     misc_feature    complement(79421..80587)
                     /gene="iscS"
                     /locus_tag="HMPREF0733_10071"
                     /note="Cysteine sulfinate desulfinase/cysteine desulfurase
                     and related enzymes [Amino acid transport and metabolism];
                     Region: NifS; COG1104"
                     /db_xref="CDD:224029"
     misc_feature    complement(order(79967..79969,79976..79978,80036..80038,
                     80045..80047,80129..80131,80369..80371,80378..80383))
                     /gene="iscS"
                     /locus_tag="HMPREF0733_10071"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(79967..79969)
                     /gene="iscS"
                     /locus_tag="HMPREF0733_10071"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            80707..81195
                     /locus_tag="HMPREF0733_10072"
                     /db_xref="GeneID:9901323"
     CDS             80707..81195
                     /locus_tag="HMPREF0733_10072"
                     /note="COG: COG0219; Pfam: PF00588; InterPro: IPR001537"
                     /codon_start=1
                     /transl_table=11
                     /product="TrmH family RNA methyltransferase"
                     /protein_id="YP_003982964.1"
                     /db_xref="GI:311111742"
                     /db_xref="GeneID:9901323"
                     /translation="MRGTLGYVFKILFYTPEIPGNTGNAIRLAAVTGAELHLVEPLGF
                     NFEDAHLRRAGLDYHDLAVVTVHKTLQDAWKAMMPARVFAFTTTAATSYADLEYRDGD
                     VLMFGPESVGLPADVQQDEHITERVKIPMIPGRRSLNLANSASIAIFEAWRQHGFTGG
                     KI"
     misc_feature    80731..81189
                     /locus_tag="HMPREF0733_10072"
                     /note="Predicted rRNA methylase (SpoU class) [Translation,
                     ribosomal structure and biogenesis]; Region: CspR;
                     COG0219"
                     /db_xref="CDD:223297"
     gene            81200..81805
                     /gene="ung"
                     /locus_tag="HMPREF0733_10073"
                     /db_xref="GeneID:9901324"
     CDS             81200..81805
                     /gene="ung"
                     /locus_tag="HMPREF0733_10073"
                     /EC_number="3.2.2.-"
                     /note="COG: COG1573; Pfam: PF03167; InterPro: IPR005122"
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase"
                     /protein_id="YP_003982965.1"
                     /db_xref="GI:311111743"
                     /db_xref="GeneID:9901324"
                     /translation="MCANRQVPLLFEDIAADPMNAEYTSRGWEPVYSASARSRIILVG
                     QAPGRIAQETRIPWNDVSGRLLRTWLSVSDDEFYNPELFALMPMDFYYPGKGKHGDLP
                     PRKDFAPRWHPRLRAMMPHAQLTILVGAYAQKYYLDGVSAPRLRSNLTETVAHAEDYL
                     PGFVPLVHPSPLNIGWRKRNPWFEAENIPDLRERVRKILGA"
     misc_feature    81269..81796
                     /gene="ung"
                     /locus_tag="HMPREF0733_10073"
                     /note="Uncharacterized subfamily of Uracil-DNA
                     glycosylases; Region: UDG_like_1; cd10033"
                     /db_xref="CDD:198431"
     misc_feature    order(81329..81337,81458..81460,81701..81703)
                     /gene="ung"
                     /locus_tag="HMPREF0733_10073"
                     /note="putative uracil binding site [chemical binding];
                     other site"
                     /db_xref="CDD:198431"
     misc_feature    order(81332..81337,81341..81343,81584..81592,81698..81703,
                     81707..81709)
                     /gene="ung"
                     /locus_tag="HMPREF0733_10073"
                     /note="putative active site [active]"
                     /db_xref="CDD:198431"
     gene            complement(81861..82868)
                     /gene="etfA"
                     /locus_tag="HMPREF0733_10074"
                     /db_xref="GeneID:9901325"
     CDS             complement(81861..82868)
                     /gene="etfA"
                     /locus_tag="HMPREF0733_10074"
                     /note="COG: COG2025; Pfam: PF00766; InterPro: IPR014731"
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit alpha"
                     /protein_id="YP_003982966.1"
                     /db_xref="GI:311111744"
                     /db_xref="GeneID:9901325"
                     /translation="MMTTAYRVLVIGGTTNFATEPSSVDRELLALARLRAGVGQGGTQ
                     LGVMTFAQGSADIAQFYAKQGAARVFAPAQSMTDTLPAARVELAVQAITEFGPDVVLA
                     PHDIDSIELLGRVAVRLGNSEAGSRPVGVVTGAHDVDDALNIRKNVLAGEYDSTVRVE
                     GLPLVTLRLNSVDTAAAPTAVGEGVLTTYTLPGYDMVRITEITEKPTSARPNLEEAAT
                     VVAAGRGIGGKLAPIEDLADALGAAIGSTRAVTDAGWLDHSTQIGQTGKSVSPELYVS
                     VGISGALQQKVGMDTSKTIVAINRDADAPIFEIADFGVIGDLFTVIPQAVEEIKRRRN
                     A"
     misc_feature    complement(order(82716..82718,82722..82724,82800..82811,
                     82833..82838))
                     /gene="etfA"
                     /locus_tag="HMPREF0733_10074"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238942"
     misc_feature    complement(81873..82811)
                     /gene="etfA"
                     /locus_tag="HMPREF0733_10074"
                     /note="Electron transfer flavoprotein, alpha subunit
                     [Energy production and conversion]; Region: FixB; COG2025"
                     /db_xref="CDD:224936"
     misc_feature    complement(82350..82805)
                     /gene="etfA"
                     /locus_tag="HMPREF0733_10074"
                     /note="Electron transfer flavoprotein domain; Region: ETF;
                     pfam01012"
                     /db_xref="CDD:250293"
     misc_feature    complement(81990..82241)
                     /gene="etfA"
                     /locus_tag="HMPREF0733_10074"
                     /note="Electron transfer flavoprotein FAD-binding domain;
                     Region: ETF_alpha; pfam00766"
                     /db_xref="CDD:189709"
     gene            complement(82884..83705)
                     /gene="etfB"
                     /locus_tag="HMPREF0733_10075"
                     /db_xref="GeneID:9901326"
     CDS             complement(82884..83705)
                     /gene="etfB"
                     /locus_tag="HMPREF0733_10075"
                     /note="COG: COG2086; Pfam: PF01012; InterPro: IPR014729"
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit beta"
                     /protein_id="YP_003982967.1"
                     /db_xref="GI:311111745"
                     /db_xref="GeneID:9901326"
                     /translation="MSVSENAYRIAVLTKYVPDTQFEQKIDDTLRVDRSESVMSELDE
                     YAVEAAMQIVEAEDTDAANSAVIAFTLGAADASKGLRRALQLGAHAGVHILDDAFAGA
                     DALATSRIIAAALSTYEQEHGTFDLILTGMASTEGETSLVPVQVSELLGRTGISQVAS
                     LTVAGRTVRARRDLDTRSQHCETELPALISVTDQVNTPRYPNFKALMAAKKKPITTVN
                     AADIADELAKFGGSASTVTVTEAQTREERTAGETIVDEGDGGIQLVEFLASRNLI"
     misc_feature    complement(83052..83681)
                     /gene="etfB"
                     /locus_tag="HMPREF0733_10075"
                     /note="The electron transfer flavoprotein (ETF) serves as
                     a specific electron acceptor for various mitochondrial
                     dehydrogenases. ETF transfers electrons to the main
                     respiratory chain via ETF-ubiquinone oxidoreductase. ETF
                     is an heterodimer that consists of an...; Region:
                     ETF_beta; cd01714"
                     /db_xref="CDD:238847"
     misc_feature    complement(order(83280..83291,83304..83309,83313..83318,
                     83493..83495,83577..83579,83586..83588,83664..83669))
                     /gene="etfB"
                     /locus_tag="HMPREF0733_10075"
                     /note="Ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:238847"
     gene            complement(83895..85229)
                     /locus_tag="HMPREF0733_10076"
                     /db_xref="GeneID:9901327"
     CDS             complement(83895..85229)
                     /locus_tag="HMPREF0733_10076"
                     /EC_number="3.4.21.-"
                     /note="COG: COG0265; Pfam: PF00089,PF00595; InterPro:
                     IPR001254"
                     /codon_start=1
                     /transl_table=11
                     /product="Do/DeqQ family periplasmic serine protease"
                     /protein_id="YP_003982968.1"
                     /db_xref="GI:311111746"
                     /db_xref="GeneID:9901327"
                     /translation="MTQYPGGWNQDSGANGYNDATRPMQHSAPGSYAQQDYQSTGYQQ
                     QGYQQNYQTSGYQQSSQNPQNGYQNQYSGQGQNPQQEPKKKYGTGVVLTAALLAALVG
                     GGVGAGVGGGIAASTSSNSSSVTGRNAGGSATNPTVVTDTAKKVLPSTVTVGSKLTDG
                     NGVGTGEVLDNQGHILTNNHVVSTNGTQQSSRVEVRLHDGSIRVAKIVGTDVTSDLAV
                     IKIDPSGLDLKPITFGDSSKVVPGETVVALGSPHNLQDTVTAGVISNTDRAAEAEKDG
                     VYIPMIQTDAPVNHGNSGGPLVNSSGALVGINSQIESEGGGNEGIAYAIPSNYAKRIS
                     DEIISKGKATHGYLGANIESAPGQTNEGESRFFPDGVRVTNISSGSPAEKAGLQKGDV
                     IVEADGHRIEQSKTLNGVVRAQAAGATVDMKIKRGSETKNIKVTLGDADNQH"
     misc_feature    complement(83901..84854)
                     /locus_tag="HMPREF0733_10076"
                     /note="Trypsin-like serine proteases, typically
                     periplasmic, contain C-terminal PDZ domain
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: DegQ; COG0265"
                     /db_xref="CDD:223343"
     misc_feature    complement(84309..84740)
                     /locus_tag="HMPREF0733_10076"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    complement(83925..84194)
                     /locus_tag="HMPREF0733_10076"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(84006..84011,84018..84023,84174..84176,
                     84180..84191))
                     /locus_tag="HMPREF0733_10076"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     gene            85527..85688
                     /locus_tag="HMPREF0733_10077"
                     /db_xref="GeneID:9901328"
     CDS             85527..85688
                     /locus_tag="HMPREF0733_10077"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982969.1"
                     /db_xref="GI:311111747"
                     /db_xref="GeneID:9901328"
                     /translation="MLTALIISTMLAVILGLGTGLVACCAGIVHRRLARAQSCSSALE
                     QQLSSATSL"
     gene            85990..86835
                     /locus_tag="HMPREF0733_10078"
                     /db_xref="GeneID:9901329"
     CDS             85990..86835
                     /locus_tag="HMPREF0733_10078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982970.1"
                     /db_xref="GI:311111748"
                     /db_xref="GeneID:9901329"
                     /translation="MVTLMLSFICALTGIGASFIAYPTAAHAQAPFEVTLNPQTPIID
                     RDGTLNALSDGLEDELTEGLSTSNALHSVEAYMVLVSGTNGKPLKEWGQEFLSLNHAR
                     PRTVILLIDTSKNQGTIISNDQSFMSDAWAHALYVKDNSSSQNSSIKRVIADHGLYGT
                     AGRMFTDIFIGDHDYSASNDGNIPQGLSDISEADGWFENFLVAAGVLVFILFILLGIP
                     VLIIRVVRKNRRKTAELQKWQNDLPLRDPSQVQVPQQYQMPNRPGHHMVTDTEYMKNR
                     GYDLN"
     gene            87048..89111
                     /locus_tag="HMPREF0733_10079"
                     /db_xref="GeneID:9901330"
     CDS             87048..89111
                     /locus_tag="HMPREF0733_10079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982971.1"
                     /db_xref="GI:311111749"
                     /db_xref="GeneID:9901330"
                     /translation="MRKNGSLPLSNITNADRPFGSRRIRRALSVGALAFGTTMLSVAL
                     PAAGSSFLTPGISTAQAQTPMTITGRVQDTTNVLGDTSELNSKISELSKNHNIDLHVL
                     TIDKFESPEEAKAWTEETAKKNSYGNADAILVIATESRRAYFAAGSNKPLSSDQQSEV
                     YQKYIKPKLQSGDYKGAALEAVNGINAQKGGISPAVAIGGGAIGVAGVAGAGYYIMKR
                     RRSKNEPGSTPAYSASKVPEVSLEELRTRAGAALVQADNSMVQSKQELEFARAQYGNE
                     HVKPFEEELTRAQELMQASFHRQKLLNDDVPDTVAEQRAWLSEIIDNSQEISDISRDQ
                     AQKLSEMRNLEHEAPQAIARLQGRIPELQQIVETAQHTYARLKDQYLPSALEPINKSA
                     ALLDSHQSLVAQELQEASRLVDVSRSEAVVHLRNAEESAAQITSLAEAVSNHASALES
                     AQSSLSTDILSIQRDVAEAKSLAESQNRAELAATAAGMEAILGQVSQQAQERPNDPIA
                     LTEQLHQLTSELNRSMSSLRADREREQAAKESLSRTLRSAEAQVRSASDFINNRRRGV
                     GSQARTYLSEAQTALSDAHRLRESDPVNSLNRAYEAISLASDAQNSANQDVNNYWDDN
                     RYGQSYGGDSLAQGMLLGAIFSAMGSHSASASTGHHWGGGDSGGGWDFGGGGGDFGGG
                     DGGSF"
     misc_feature    87285..87611
                     /locus_tag="HMPREF0733_10079"
                     /note="TLP18.3, Psb32 and MOLO-1 founding proteins of
                     phosphatase; Region: TPM; pfam04536"
                     /db_xref="CDD:252657"
     gene            complement(89183..89302)
                     /locus_tag="HMPREF0733_10080"
                     /db_xref="GeneID:9901331"
     CDS             complement(89183..89302)
                     /locus_tag="HMPREF0733_10080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982972.1"
                     /db_xref="GI:311111750"
                     /db_xref="GeneID:9901331"
                     /translation="MLYPFLSRGTGKELIRTYSAATFLIIVGQPEKLLGKYRL"
     gene            89301..90017
                     /locus_tag="HMPREF0733_10081"
                     /db_xref="GeneID:9901332"
     CDS             89301..90017
                     /locus_tag="HMPREF0733_10081"
                     /note="COG: COG1842; Pfam: PF04012; InterPro: IPR007157"
                     /codon_start=1
                     /transl_table=11
                     /product="phage shock protein A PspA/IM30 family protein"
                     /protein_id="YP_003982973.1"
                     /db_xref="GI:311111751"
                     /db_xref="GeneID:9901332"
                     /translation="MVKQSIFGRIAQLAKANINALIDAAEDPQKMLDQMVRDYTNNIV
                     EAEAAVAQTIGNLRLLEQDHAEDLRDADEWGSKALAASNKADEFRAAGDTANADKFDN
                     LAKIALGKQMQAEREAKAAEPQIASQTQVVEQLKDGLTKMRAKLDELKSKRDELNARQ
                     KTAAAQSQVNDALKAFDVMDPTSEVSRFEEKVRREEARVQGQQELAASSLDAQFNDLE
                     ELGRQSELDARLAALKNKNA"
     misc_feature    89313..90008
                     /locus_tag="HMPREF0733_10081"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl19113"
                     /db_xref="CDD:267466"
     misc_feature    89313..90008
                     /locus_tag="HMPREF0733_10081"
                     /note="Phage shock protein A (IM30), suppresses
                     sigma54-dependent transcription [Transcription / Signal
                     transduction mechanisms]; Region: PspA; COG1842"
                     /db_xref="CDD:224755"
     gene            complement(90111..91466)
                     /locus_tag="HMPREF0733_10082"
                     /db_xref="GeneID:9901333"
     CDS             complement(90111..91466)
                     /locus_tag="HMPREF0733_10082"
                     /note="Pfam: PF00395; InterPro: IPR001119"
                     /codon_start=1
                     /transl_table=11
                     /product="subtilase family serine protease"
                     /protein_id="YP_003982974.1"
                     /db_xref="GI:311111752"
                     /db_xref="GeneID:9901333"
                     /translation="MTRIRKMRAGTLAALTVPAIVGATLTAPAHATIASGTYRSYTAP
                     NGLNSQYHVYANGIDWSKPVGVVFYIDGDYWRNDQSKIHSPEQGMLPAMGRIANARNM
                     VFVPVVSPDKNASGNGITWWENLDANGDYFRSFAQQFISSNGIDPSQVWTMGYSGGAE
                     FITYELNADRQGTWRSGGGSILVAGGGYERMQTEAPQNIKNQPMYWWVGAADTSGTTN
                     PPTWSARGAVEQGYAAYRNSGFTNTQMKLIPGFSHQDYDLPLIMAQSLDTGGHRFGAG
                     YSDLPTTNPFYTEISWNSDRRIMTGFADRTFRPYSAVNRAQVATYLYRLAGSPAVELP
                     ATSPFPDVTPNHPAYKEIVWLKQQGITTGWSDGTFRPHDTISREALAAFFYRFNGSPA
                     YAPGAQQFADVNPSTMFYKEISWMADQGITTGWPDGTFRPGEATSREAMAAFLYRASK
                     L"
     misc_feature    complement(<91239..>91346)
                     /locus_tag="HMPREF0733_10082"
                     /note="glycosyl hydrolase family 16; Region:
                     Glyco_hydrolase_16; cl00218"
                     /db_xref="CDD:260271"
     misc_feature    complement(90510..90638)
                     /locus_tag="HMPREF0733_10082"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    complement(90324..90455)
                     /locus_tag="HMPREF0733_10082"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    complement(90141..90272)
                     /locus_tag="HMPREF0733_10082"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            complement(92005..93048)
                     /locus_tag="HMPREF0733_10083"
                     /db_xref="GeneID:9901334"
     CDS             complement(92005..93048)
                     /locus_tag="HMPREF0733_10083"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982975.1"
                     /db_xref="GI:311111753"
                     /db_xref="GeneID:9901334"
                     /translation="MQQTETQLRQSERKDPDNSQNQSSPNIESSPETLDEIRARQEAY
                     RRWYGEHHHGNLGFAQDKSGANKSFSFDVANDGSYCVSRDGRVGQYKEFTDDGQAKPV
                     GETITNHLFGDTCTLNDPEAAQQAQGEYERIITEMRTHLLELIPAHPHLTLDSAHPPH
                     TSKGEETNFYTTLEGSSNIFEGDLPIGRTRIRAVPVAYRYEYGDGHDLKTHSAGNPVS
                     SQYSGQPLHETSTSYAYPQVGNFHAYVTVTYAGQYSIDGGPWQFFGTEVSRISDPVLV
                     RVWESEVHSVGKTCAEDPGAKGCPGHEEEPDVGNPNPQLRKVDVYTGQRWHLDDVGVG
                     DSEGRLHPTWPNM"
     gene            complement(93171..93899)
                     /locus_tag="HMPREF0733_10084"
                     /db_xref="GeneID:9901335"
     CDS             complement(93171..93899)
                     /locus_tag="HMPREF0733_10084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982976.1"
                     /db_xref="GI:311111754"
                     /db_xref="GeneID:9901335"
                     /translation="MNTRTPVLSRRALMSVLGVSGFAVLLSACGEGAKPAGMATESPS
                     SSSSATAVASASSSDSPSPSLSTSPHYSGKSKAPEGEYRPADFYGPAQNVPKPKTEEG
                     YTNASLEGMRKTVQAWTEWRNYGLQTGDFKDAMKFVDKQYTDELELYQNTSRFYKDGG
                     WIVGGDLHQYEFHGEPINQGNGKYEWKYLLLWPYRIYIAADGRVNKVYNDDYENNWYM
                     MTLHHDGNRWFIDGTRFLNVQGNK"
     gene            94565..95413
                     /gene="dkgB"
                     /locus_tag="HMPREF0733_10085"
                     /db_xref="GeneID:9901336"
     CDS             94565..95413
                     /gene="dkgB"
                     /locus_tag="HMPREF0733_10085"
                     /EC_number="1.1.1.274"
                     /note="COG: COG0656; Pfam: PF00248; InterPro: IPR001395"
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-diketo-D-gluconate reductase"
                     /protein_id="YP_003982977.1"
                     /db_xref="GI:311111755"
                     /db_xref="GeneID:9901336"
                     /translation="MQYVTLNNGVKMPQLGLGVLYIDDLTECERVVSEALEVGYRLID
                     TAAGYQNEQAVGAAIEASGLDREDIFVTSKLWVPDYSYEGAKRGFEESRRRLGVDYLD
                     LYLIHLPLNNYFGAWRALEELYQAGHARAIGVSNFDSVRIADISHFSEVTPAVNQIEI
                     NPFHQRVDEISYMKGKGIQPEAWAPFAEGANDIFSNPILLEIGEKYGKSPAQIILRWQ
                     MQEGVVAIPKSVRRERMEQNFDIFDFALTVEDMASVKTLNTDQSLIFDPRKVEHVEGL
                     LTRFNL"
     misc_feature    94571..95335
                     /gene="dkgB"
                     /locus_tag="HMPREF0733_10085"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    order(94616..94624,94694..94696,94709..94711,94784..94786,
                     94883..94888,94967..94972,95033..95035,95111..95128,
                     95195..95197,95240..95251,95264..95266,95273..95278)
                     /gene="dkgB"
                     /locus_tag="HMPREF0733_10085"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(94694..94696,94709..94711,94784..94786,94883..94885)
                     /gene="dkgB"
                     /locus_tag="HMPREF0733_10085"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(95619..95692)
                     /locus_tag="HMPREF0733_t10001"
                     /db_xref="GeneID:9901337"
     tRNA            complement(95619..95692)
                     /locus_tag="HMPREF0733_t10001"
                     /product="tRNA-Met"
                     /db_xref="GeneID:9901337"
     gene            complement(95908..99090)
                     /locus_tag="HMPREF0733_10086"
                     /db_xref="GeneID:9901338"
     CDS             complement(95908..99090)
                     /locus_tag="HMPREF0733_10086"
                     /note="COG: COG1615; Pfam: PF03699; InterPro: IPR005372"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein"
                     /protein_id="YP_003982978.1"
                     /db_xref="GI:311111756"
                     /db_xref="GeneID:9901338"
                     /translation="MTASDNEHQPPQPPRRAGADQKKKKRRYPGPLGITIAVVIVLIM
                     AFVYATQVYTDWLWFNQLGFGSVFTTEILLQSSIFVVTALVVAVPFWASMSYAIKHAD
                     HDDSQAKKDAKNADKSEEQAHHETSKSGPHERHTTEHEHTEAEDLLRDMFGGRDFTDS
                     MARYRRGMERIRKILLVILPIALGFFIGSAGISQWQTVALFLNRQDFGVQDPEFGLDV
                     GFFVFTLPFLNLVVNLLTAVIVLCAIGGAIMHYFYGGIKVRPGGVGTSAAFRRHAAVL
                     ACAFLLVRGAAFWLERYTAVQQQSGRWAGAMYTDTNAIIPVRSILAISAVLVAVLFLA
                     TASAHRWRLPLVGTAMLVVVALVAGGLYPWIVQRFQVVPNEQAAQSQFIQRNIDATRY
                     AYGLDKVETTPYDATIDTRQGALGNSSETIANIRLLDPNVVSSAFAQMQQFRPYYRFD
                     SNLSVDRYSVDNKTQDTVIAARELNPSQTSDDSWYNRHVVYTHGYGVIAAYGNQVDGA
                     GNPKFMQSGIKANGVISENYEPRIYFGMSSPQYSIVGGSGDQLELDRPQSADETNSSD
                     AKYTFNGNGGPRLDSTLNRLSYAIKFQSSDILLSDAVRDGSQILYERNPVDRVQKAAP
                     YLKVDSKAYPAIINNRVQWIVDAYTTTNQFPYAQGVSQENNQNPRTNSMNYIRNSVKA
                     TVDAYDGSVTLYAWDENDPILKAWQGVFPGTVKSYKEMSAELLNHVRYPSDMFTIQRS
                     MLNKYHVTNSNSLYAGDDVWSIPNDPTNDSGRQIPPYYLSLQMPGDRKAHFSLTSTFI
                     PQQSDSNSRNVMYGFLAANGDAGTGKDGERSADYGKLRLLELPRSSVVPGPGQAQNIF
                     NSDAEVSNQLNLLRRGSSEVINGNMLTLPVAGGILYVQPVYVQSSGDARYPRLQRVLV
                     SFGDKVGFAPTLEEALNQVFNGSSGAKIDAQSGPSGAGTEGNGEKTSGSSSSSSGASG
                     SDQSASLKQHLADASKAMQDSDAALKKGDWAAYGEAQKRLNDSLQKAIEAENKQQQDQ
                     KQGGDQQGSEQQPSGSSSASQSPSGEATSK"
     misc_feature    complement(96484..99000)
                     /locus_tag="HMPREF0733_10086"
                     /note="Uncharacterized protein family (UPF0182); Region:
                     UPF0182; pfam03699"
                     /db_xref="CDD:252106"
     gene            complement(99244..100437)
                     /locus_tag="HMPREF0733_10087"
                     /db_xref="GeneID:9901339"
     CDS             complement(99244..100437)
                     /locus_tag="HMPREF0733_10087"
                     /note="COG: COG3480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982979.1"
                     /db_xref="GI:311111757"
                     /db_xref="GeneID:9901339"
                     /translation="MAKRAFFLRKSHQQSDESLPLSERRSLNLRFLTASATCLLMLGA
                     FVLPSSYSKEGPGPLFDILGQYQDQDIIQINGTQTYPTTGKLNMTTVSVSGGPYTVLP
                     GADAFYSWLATDGNRYLVVPSEITYPHVTHQQANQVSSAQMADSQTQAKVAAARYLKL
                     PVTEKISVLQTASGSPAEGQVQGGDRILKVGDKQINTLKDVTGTVQASEGRPVTFEIS
                     RNGENQNITLTPRRDDKSGRWLVGIVLKQDFDLPFEATYNLDGVGGPSAGLMLTLGTI
                     DKLTEQSLLAPEDAGNEESARSYVAGTGTIDASGKVGAIGGIKYKIIASGRHGAHYFL
                     APRENCDDLQEIRRTDPNVFKYYRGETPAGDMQVIPVDNVDEAVDALTKIKNGAAPDQ
                     FPTCG"
     misc_feature    complement(99283..100323)
                     /locus_tag="HMPREF0733_10087"
                     /note="Predicted secreted protein containing a PDZ domain
                     [Signal transduction mechanisms]; Region: SdrC; COG3480"
                     /db_xref="CDD:226011"
     misc_feature    complement(99748..>99930)
                     /locus_tag="HMPREF0733_10087"
                     /note="PDZ domain of bacterial and plant zinc
                     metalloprotases, presumably membrane-associated or
                     integral membrane proteases, which may be involved in
                     signalling and regulatory mechanisms. May be responsible
                     for substrate recognition and/or binding, as most PDZ...;
                     Region: PDZ_metalloprotease; cd00989"
                     /db_xref="CDD:238489"
     misc_feature    complement(99310..>99648)
                     /locus_tag="HMPREF0733_10087"
                     /note="Lon protease (S16) C-terminal proteolytic domain;
                     Region: Lon_C; pfam05362"
                     /db_xref="CDD:191262"
     gene            100652..102094
                     /locus_tag="HMPREF0733_10088"
                     /db_xref="GeneID:9901340"
     CDS             100652..102094
                     /locus_tag="HMPREF0733_10088"
                     /note="COG: COG5282"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982980.1"
                     /db_xref="GI:311111758"
                     /db_xref="GeneID:9901340"
                     /translation="MAENPTNDNSNDRDPLEEFLKKMQEQGFDPNAEQNGNGTADNPF
                     AFLNGNINPEDMNAMGMSFDPSMLQGIFAQVQSMFTAGASENGINWQGVKDQARQLLA
                     TTGEDPAITESLRAATRDASNLADLWLDSVTIFERHNIPVEAWSKAEWLDSSFESWRD
                     MVQPVAAEVTQAMVLPSTEDVPEELAQLLGGTGFLNNIGSMIFGAQMAQALTELAGEV
                     YSSTDIGFPLAPGRSALLPAGYTQLAEDIEVPAQEILLYLAVREAALIRLHRTNPWLR
                     EDILELVSRYARGIRVDMNRIQDAASQVDLSNPEAVQDAFDGGLFNPQRTEDQELAVE
                     RLEALLALVEGWVSLVAEQATQNLPTAPQLAETLVRRRIEGGPTERVFETLVGLEIRP
                     RLVREAQNFWRTYEEKHGYEARDELWAAPETLPTAAELEDPDAYEARQDEFKVEDIDF
                     DTELQKLLDGGFDEGESDGGESSTGDEPNT"
     misc_feature    100913..101959
                     /locus_tag="HMPREF0733_10088"
                     /note="Uncharacterized conserved protein (DUF2342);
                     Region: DUF2342; pfam10103"
                     /db_xref="CDD:255756"
     gene            complement(102247..102837)
                     /locus_tag="HMPREF0733_10089"
                     /db_xref="GeneID:9901341"
     CDS             complement(102247..102837)
                     /locus_tag="HMPREF0733_10089"
                     /note="Pfam: PF01863; InterPro: IPR002725"
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="YP_003982981.1"
                     /db_xref="GI:311111759"
                     /db_xref="GeneID:9901341"
                     /translation="MMARQKVRQHHEVIPATASTPEILVVRSSRRRRTVSAQPQKDGS
                     IRLLVPGASTDAQIREYLENLIPRVQRKQRESARRRRTFTSDDYLTERARALTADHLP
                     ELAPEKFPDSIRWVSNQRKRWGSTTPTQGTIRISDDLQGAPEYVVDSVIYHELCHFVE
                     LHHNARFRTLEARFPNLDKARAFLAGMEFIRAQATN"
     misc_feature    complement(102286..>102696)
                     /locus_tag="HMPREF0733_10089"
                     /note="Protein of unknown function DUF45; Region: DUF45;
                     cl00636"
                     /db_xref="CDD:241996"
     gene            complement(102908..104854)
                     /locus_tag="HMPREF0733_10090"
                     /db_xref="GeneID:9901342"
     CDS             complement(102908..104854)
                     /locus_tag="HMPREF0733_10090"
                     /EC_number="3.6.1.-"
                     /note="COG: COG0210; Pfam: PF00580; InterPro: IPR000212"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="YP_003982982.1"
                     /db_xref="GI:311111760"
                     /db_xref="GeneID:9901342"
                     /translation="MPAQGAGASKQQALFGIPAQKSSPTHTQTPQVPARPAPPPAAPQ
                     QNHAAPQLSPEDILAGLDEDQRRVASELNGAMRVLAGAGTGKTRAITHRIAYGIACGK
                     YVPQRVMALTFTTRAAEEMRLRLRSLGAVGVQTRTFHSAALRQLRYFWPSAIGGSFPD
                     IVKHKAGLITEAAQRLRMSVDRALVRDIAAEIEWAKVSLFTPDTLTPHLHQRNLPSGI
                     TPQNMVRLFRAYEDLKDERNLIDFEDVLLLTVGIIEDDDALAATIREQYRHFVVDEYQ
                     DVSPLQQRLLDAWLGERDDLCVVGDASQTIYSFTGATSRHLLEFPRRYRGAHTVRLTR
                     DYRSHSQVVELANRLLAARRPRPDSTEFSWAPPLKLVSQRGPGVESQWFGYTDDEREA
                     EGIAEQIQDLLEKDGVPASEIAVLFRTNGQSGLLEAALADRGIPYQLRGAEQFFDRPE
                     VKQAMLALRASAKSTDGSENVPRYVREVLEPLGYTEKAPQSAGAVRQKWESLAAIVSM
                     VDHLEATRIEDIAQAEAAGAPVPHRLTVHDVVATLAHRLATQDAPVMEGVTLASLHSA
                     KGLEWDAVFLCGLNEGLMPITFAQTSDEIDEERRLLYVGITRARKYLWFTWSDSRTTG
                     GRGKRRRSRFLDDIDPSRQSARHS"
     misc_feature    complement(103007..104677)
                     /locus_tag="HMPREF0733_10090"
                     /note="Superfamily I DNA and RNA helicases [DNA
                     replication, recombination, and repair]; Region: UvrD;
                     COG0210"
                     /db_xref="CDD:223288"
     misc_feature    complement(104429..104656)
                     /locus_tag="HMPREF0733_10090"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    complement(103007..>103201)
                     /locus_tag="HMPREF0733_10090"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            105083..106078
                     /locus_tag="HMPREF0733_10091"
                     /db_xref="GeneID:9901343"
     CDS             105083..106078
                     /locus_tag="HMPREF0733_10091"
                     /note="Pfam: PF01636; InterPro: IPR002575"
                     /codon_start=1
                     /transl_table=11
                     /product="macrolide 2'-phosphotransferase"
                     /protein_id="YP_003982983.1"
                     /db_xref="GI:311111761"
                     /db_xref="GeneID:9901343"
                     /translation="MTLTPLQLAAIVSAGVPGIYPVGASAVLDDTADFDSAIIVDSTN
                     RRWRVRAPRRPDASMRLEAEHLILQSFTPGLRARLPFQVPTVVGTVPYQDGSVFIYTH
                     IPGTSYEVDDLAAQNGHTAEGQDSLAVSLGKILATLHTMPHDLVFEAGLPSYNSEEIR
                     RRRSVELERVAQTGKIPADLLAHWRSVLSPGPTWQFQAHVIHGDMNSDNLVLDGAKIV
                     EVTGWSDVQVGDPAQDFAWLFSCSDQGFTDSVLDAYQRQMRPEPDEHLIQRAHFYAEF
                     AIAQWLAHGAEIGDDDIVQHAVAMLLDVQDGLRATGGLLGQEEEEDIPQVIDDED"
     misc_feature    105245..105916
                     /locus_tag="HMPREF0733_10091"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cl17270"
                     /db_xref="CDD:266599"
     misc_feature    105245..105850
                     /locus_tag="HMPREF0733_10091"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    order(105320..105322,105380..105391,105692..105694,
                     105704..105709,105713..105715,105803..105805)
                     /locus_tag="HMPREF0733_10091"
                     /note="active site"
                     /db_xref="CDD:240159"
     misc_feature    order(105320..105322,105380..105391,105692..105694,
                     105704..105709,105713..105715)
                     /locus_tag="HMPREF0733_10091"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240159"
     misc_feature    order(105692..105694,105803..105805)
                     /locus_tag="HMPREF0733_10091"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240159"
     gene            complement(106206..110555)
                     /locus_tag="HMPREF0733_10092"
                     /db_xref="GeneID:9901344"
     CDS             complement(106206..110555)
                     /locus_tag="HMPREF0733_10092"
                     /note="COG: COG0210; Pfam: PF00580; InterPro: IPR000212"
                     /codon_start=1
                     /transl_table=11
                     /product="UvrD/REP helicase family protein"
                     /protein_id="YP_003982984.1"
                     /db_xref="GI:311111762"
                     /db_xref="GeneID:9901344"
                     /translation="MDTYRMTTSEPDQPHKHDGDRGASGVSGGTAHQPARLSAREIAH
                     ALGLNPPTDEQVRIIESPLEPRLVIAGAGSGKTATMVDRVVWLVANKIVRADEVLGVT
                     FTRKAAGELRDRMRTRLNILRERNLIELSEEELLAGSSEPTVSTYHSYANNLVKEYGL
                     RLGVEQDAQMLGDAQAWQLAAQIVQYWDGDLPAASSALGVASKSTIVQSLLQLSGECA
                     EHLVSPQQVIEFCSAHLAAYESLSSPGPSANAKKVIERLKAKIILAQLVQRYARVKAR
                     MQVLDYGDLIALAARIAREVPAAAQLERERYKVVLLDEFQDTSHAQLRLFADLYGAGD
                     GHDGRPGQPEHPVMAVGDPKQSIYGFRGASDGQLFSFYQYFPTRDETPLYLTVAWRND
                     VAILDAANLIAAKLKNIPDWVRAPAPPHVPDLRPRSVVLNPDESGYRAMLGSVQLARY
                     GSETEEAQGIAERIVQERARYANTPEQMPTMAVLTRTRAQMEPIRQACESLGVPVQVV
                     GLGGLLERPEIIDMVSMLRVLADPNRSDALMRLLAGARWRLGTADLLALGDWSNYLTT
                     TREKNMGRTFGEQSSGETSGDVPSSPQTDTDANLRAAHEEFERVRKNAVEDLAEYGSL
                     IEAIEHLPAADEAGNPIYPADYPESRRRLSVEGLRRLHAFTAEVEYLRQFTTEDIGTL
                     LYEIERVMLLDIELAARPGGDAYGSRAHLDAFHEVAASYAASSPRINAMLYAGADGTE
                     VDEDAPTARRFVLSANGISYLLGFLSWLEQAQNHERGLTPAEEEPRRDAVQILTMHAS
                     KGLEWDHVYLPRMCDKYPTRPHTWHRLEHGSLPWPLRGDRDYLPSALERAEEVSALEN
                     YKELNARLEDGEDMANDYVGFEGRRLVYVAMTRARSLLHISNCRWVGPNVNPYQPEPY
                     WNELVQFAQGYAEEPYEGIQVAPWLYPGYLGTGFYTSGWAIEHRDASIEVLFGRCLWL
                     ENYSIPRGIRLENGTSVPVIPAPDDPEDTAASQRYTSAVYEQIAHALVHDGGNPITNA
                     EVLNLPEVHRVKQALMGGVQEPGLPDPQESKGAYDENLEGLKKRYGLDVVENFRYARE
                     PLAQLAQGKQGPEQPGVRPQIVHRFLEPAAWVKDNPQQGSVLTADWPFDPFDGAQVIR
                     WASEKDLAERTENRDIIAVPGQRRARVERTALNVARGSLSLDELDKLTSPTEAEAQQI
                     QDWEHEVDLLLALAQRAVTPAVPTKPEHMSASTLIALSEDKETVLSRLVRPVPMQPSA
                     AARQGTLFHAWVEEYFGDEPMLDIQDELYSDDDLDGSFDLDKLRATFLESEWASRTIW
                     RAEYPVETHVAGVNIRGRIDAVFRRTEQVTNADGTLQEQEHWDLVDWKTGRKPSAHAM
                     RHKRIQLALYRLAFAKIQGIDPECVHAAFYYVGSDQTVWDTDIAGGLQNEQQLERIIS
                     RAGWGEELPGRPR"
     misc_feature    complement(107853..110420)
                     /locus_tag="HMPREF0733_10092"
                     /note="Superfamily I DNA and RNA helicases [DNA
                     replication, recombination, and repair]; Region: UvrD;
                     COG0210"
                     /db_xref="CDD:223288"
     misc_feature    complement(110199..110357)
                     /locus_tag="HMPREF0733_10092"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    complement(106326..106799)
                     /locus_tag="HMPREF0733_10092"
                     /note="PD-(D/E)XK nuclease superfamily; Region: PDDEXK_1;
                     pfam12705"
                     /db_xref="CDD:257237"
     gene            complement(110744..114262)
                     /locus_tag="HMPREF0733_10093"
                     /db_xref="GeneID:9901345"
     CDS             complement(110744..114262)
                     /locus_tag="HMPREF0733_10093"
                     /note="COG: COG0210; Pfam: PF00580"
                     /codon_start=1
                     /transl_table=11
                     /product="UvrD/REP helicase family protein"
                     /protein_id="YP_003982985.1"
                     /db_xref="GI:311111763"
                     /db_xref="GeneID:9901345"
                     /translation="MTATLILGAPGTGKTERVITAAVDFLNAGGDPARLLVLTPTRAG
                     ATRVRDELARRIDRSMSTAPTRAWAAYAFDLLRRAHVSGLLPGVEFAPKLLSGPEQDV
                     MIGEILAGHREGKGAAVRWPADLHEALGTRGFRQEIRDFFDRIAEYALTAEDLENLAQ
                     TLDRPAWHSVAQLYTEYQQIRRLRAPNAYDPAALIHEACAFLLANPEYLREERARFDL
                     ILIDDAQELSPSVYRLMRILVGREPGQVLATYTGDQREAVEAAFAPSARVLMTCCTET
                     VVQGFRGARPDLAATLPQIFPELQREELKTSYCMNAPITQAWRNIARRLPVIANVPTP
                     REPQAAPSKYEESALLRLSDDGDLLDPRHSDELPEGVFGYLLGSPQDEANQVAQLLLE
                     DYLYRGAAYARSAIIVRSGTEVARFRRVLAASGIPTVTGAALVPVRDEPAVRPFLDAL
                     SLLVYARQQSADYLKLPDHNEFDGSLTENISPEAVTEAGTRSADDEAEKLARQSLADV
                     LAEENRTNPGSGAHNAITLLTSRLGGASSMEVRRLRQQLRAAELRAGGHRCSDDLLLG
                     ALLNPQALPAQGIGAAVRRVARVLAAGHKALSERGANAETVLWALWQASGLEKNWVTE
                     SAQTGPEAERAHRNLDAMIGLFEAATRFVDQMPGSSAELFLDYIDAQDLPMDTLAARG
                     KRYDAVEILTPALAAGRHWQTVYVCGLQDGTWPNTTVRGSLLKAGELTDICDMGVAAA
                     QQVRMSDRVRAVRHDELRMFSTAISRANERLVVTAVSSTEDAPSEFFDILVPDARTAG
                     ITHVRRPMTLRALVAELRRYAQAQDTDPTLANAAAAQLNRLAQAGVPGAAPEQWWGLL
                     PLSTEQNAFTPHPHRDGLSTDSGDPEKLTVPVSPSRIETIHKSPLDWFVSAARAEAQT
                     DTSRSLGTLIHAIAEEYPDADYMTLRGQLEERLSTLALPDTWEGQQIRERAEKMVDKL
                     AVYINEIMPGDHRELVGVEGSFRVLVPGDAVNAQISGRVDRLEKTEDGRYVIVDLKTG
                     KTKPNKNQIAEHAQLAAYQVAVEAGAGDAMSRDFGVEPDGLDIPAGLEHREAAPQRFE
                     VFTRKSGGAALVQLGDGTAASSRNRPQEQDALDPETGIWAVQLVQRAAELIAGAVMQT
                     RHRPGETCRLPEICPLCPQGRQITQD"
     misc_feature    complement(114080..114253)
                     /locus_tag="HMPREF0733_10093"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    complement(111899..114250)
                     /locus_tag="HMPREF0733_10093"
                     /note="Superfamily I DNA and RNA helicases [DNA
                     replication, recombination, and repair]; Region: UvrD;
                     COG0210"
                     /db_xref="CDD:223288"
     misc_feature    complement(<111089..111604)
                     /locus_tag="HMPREF0733_10093"
                     /note="PD-(D/E)XK nuclease superfamily; Region: PDDEXK_1;
                     pfam12705"
                     /db_xref="CDD:257237"
     gene            114369..115061
                     /gene="dnaQ"
                     /locus_tag="HMPREF0733_10094"
                     /db_xref="GeneID:9901346"
     CDS             114369..115061
                     /gene="dnaQ"
                     /locus_tag="HMPREF0733_10094"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="YP_003982986.1"
                     /db_xref="GI:311111764"
                     /db_xref="GeneID:9901346"
                     /translation="MSWIDAPRATFDLETTGVDVTTARIVTASLLLLNPDGSVQRAGE
                     WLANPGIEIPEGAASVHGITTEYARSHGQPAQQVIWEVAGAIGSLFLDGIPVIAFNAA
                     YDFSVLHHEMLRYNIAHGELPAGHILDPYVIHKHVIPRKRGNRKLETLTAEHDVVLEN
                     AHTSKADALAAERLLVKLAERFPEIATDAAALHTHQVQWSLDQARDFQDWLRTKPGKE
                     NEVIDGRWPIRR"
     misc_feature    114369..>114911
                     /gene="dnaQ"
                     /locus_tag="HMPREF0733_10094"
                     /note="DNA polymerase III, epsilon subunit and related
                     3'-5' exonucleases [DNA replication, recombination, and
                     repair]; Region: DnaQ; COG0847"
                     /db_xref="CDD:223916"
     misc_feature    114399..114893
                     /gene="dnaQ"
                     /locus_tag="HMPREF0733_10094"
                     /note="DEDDh 3'-5' exonuclease domain family; Region:
                     DEDDh; cd06127"
                     /db_xref="CDD:176648"
     misc_feature    order(114402..114413,114417..114419,114663..114668,
                     114672..114680,114852..114854,114867..114869)
                     /gene="dnaQ"
                     /locus_tag="HMPREF0733_10094"
                     /note="active site"
                     /db_xref="CDD:176648"
     misc_feature    order(114402..114413,114417..114419,114663..114668,
                     114672..114677,114852..114854,114867..114869)
                     /gene="dnaQ"
                     /locus_tag="HMPREF0733_10094"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176648"
     misc_feature    order(114402..114404,114408..114410,114678..114680,
                     114852..114854,114867..114869)
                     /gene="dnaQ"
                     /locus_tag="HMPREF0733_10094"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176648"
     gene            115283..116626
                     /locus_tag="HMPREF0733_10095"
                     /db_xref="GeneID:9901347"
     CDS             115283..116626
                     /locus_tag="HMPREF0733_10095"
                     /note="Pfam: PF06738; InterPro: IPR010619"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982987.1"
                     /db_xref="GI:311111765"
                     /db_xref="GeneID:9901347"
                     /translation="MEYQDTNTYSIYLGSSREQHKYIVSQSQVVLKLGRILMKSGASA
                     YRIKASMARLAKAVGLQEHHAQVTFTEIATSSYADGNFRTEVAEQRTMGINSYKIDLL
                     GKFISELPDRISPSEADAEITRIDSMPHLYKRWMLSLASAIACTGFAFLNRGGLVECL
                     VVFIAAGAGQFLRSTLMKRGTSHMAIWMACGFLGAGTYIGIIRLLVALNLVGSDHMVG
                     FISSILFLVPGFPMVTGMLDISRMDFLAGVSRLTYVAVLLVSGSFAVWVLASLFEIPL
                     LQNIRPDIPVGLYILLQVISSGVAAAGFAMLFAASPVACVWGGVIAAIANPARIWLVE
                     AGWAPHMAATVAVFGVGIMAEIVAPLHGRKYSRISLSVPAVVTMVPGVPFYLSMSYFS
                     GGNMYAATNGFVQSLLTFLALGLGLAFVRLLFDKNWLFDQDTQVMKKLDSASHMR"
     misc_feature    115379..115969
                     /locus_tag="HMPREF0733_10095"
                     /note="Protein of unknown function (DUF1212); Region:
                     DUF1212; pfam06738"
                     /db_xref="CDD:253886"
     misc_feature    116156..116551
                     /locus_tag="HMPREF0733_10095"
                     /note="Protein of unknown function (DUF3815); Region:
                     DUF3815; pfam12821"
                     /db_xref="CDD:257323"
     gene            116852..117514
                     /locus_tag="HMPREF0733_10096"
                     /db_xref="GeneID:9901348"
     CDS             116852..117514
                     /locus_tag="HMPREF0733_10096"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982988.1"
                     /db_xref="GI:311111766"
                     /db_xref="GeneID:9901348"
                     /translation="MLHRIIQRPLNTAFDKLYARRAAKFPINPDGVLRVRHPALILIS
                     VFISALVGTLLTALIVYMVLHPNTTQTPQQSLSILGSFILCVVIFYGLAVWAYLNYRN
                     IYVETARDYVEQRNAFGRITRIYYSEVSAYSYWYEYNNKMLTLFSSDGRQVSFRPKIY
                     RGERVLAVLAFRMYNSRWPDPRNSSDQHIVETQAANGIAERALWNEHPVGKNLLMPQD
                     IQ"
     gene            complement(117622..118473)
                     /locus_tag="HMPREF0733_10097"
                     /db_xref="GeneID:9901349"
     CDS             complement(117622..118473)
                     /locus_tag="HMPREF0733_10097"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982989.1"
                     /db_xref="GI:311111767"
                     /db_xref="GeneID:9901349"
                     /translation="MVFAWIAVAALCSIHLIFSLAQSWVESKKHPYRVRRFHGANYIL
                     YILVIGYLYFAPLIFSGEYDGSHTIKITIFAYGGPILILGLFFLVAQHDMSYIDITSE
                     GFLTQTVFGKEKFTPFAAIDGYIYSPKRKRQTLDGQHWKITQDLSDDLYLIDPWGNTV
                     FSCIPAKPQERIFGALLYARARSGRWPDLENPEDELVIMKLADSKYEVTDFLMEYPQV
                     NGFITPEQTAVPQQPMPPQYPQNAYPQEGYLNSGQQPSNQQMNPYGYLQQPHNYQQNQ
                     NPPQGSA"
     gene            complement(118555..119187)
                     /locus_tag="HMPREF0733_10098"
                     /db_xref="GeneID:9901350"
     CDS             complement(118555..119187)
                     /locus_tag="HMPREF0733_10098"
                     /codon_start=1
                     /transl_table=11
                     /product="HPP family protein"
                     /protein_id="YP_003982990.1"
                     /db_xref="GI:311111768"
                     /db_xref="GeneID:9901350"
                     /translation="MRAKRESEAMLRRARYPWWILVIVDIFLVGFGSFFAFVLSVILT
                     PSAGTPIVIVLFAVPMCLIFAFFIFIILLIRGLTIRYIELVPSGFVFRSGFGRVHNIP
                     FSDIKGYDYRPARFDFEGTLRVSMGDRHAVNTSRGDRLRVINHEGKKILQTQVRHSAM
                     PDYVGQCLMFRGMQERWPQLGYSEDEKILAEYTKDVVVRYLTVNRWRQDF"
     gene            complement(119471..119917)
                     /locus_tag="HMPREF0733_10099"
                     /db_xref="GeneID:9901351"
     CDS             complement(119471..119917)
                     /locus_tag="HMPREF0733_10099"
                     /note="Pfam: PF01047; InterPro: IPR000835"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_003982991.1"
                     /db_xref="GI:311111769"
                     /db_xref="GeneID:9901351"
                     /translation="MRQEEFNQLIGYRLKEVQSLLRSRMEEVLRPLGITVAQYVCLEI
                     LKSTPGASNAELARQAFVTRQTMNTLLRGLQERSLIERAEQAPRGRALPTILTAEGER
                     VLDQATGRIRDVEQHMVGGLSDAKRQELWDLLTICIEGLHAGGSKT"
     misc_feature    complement(119528..119866)
                     /locus_tag="HMPREF0733_10099"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(119537..119839)
                     /locus_tag="HMPREF0733_10099"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            119992..120360
                     /gene="gloA"
                     /locus_tag="HMPREF0733_10100"
                     /db_xref="GeneID:9901352"
     CDS             119992..120360
                     /gene="gloA"
                     /locus_tag="HMPREF0733_10100"
                     /EC_number="4.4.1.5"
                     /note="Pfam: PF00903; InterPro: IPR004360"
                     /codon_start=1
                     /transl_table=11
                     /product="lactoylglutathione lyase and lyase"
                     /protein_id="YP_003982992.1"
                     /db_xref="GI:311111770"
                     /db_xref="GeneID:9901352"
                     /translation="MTVTGPSFIALQVRDLERSAQFYETYLGLRRTPQAPPNAVVFAT
                     EPIPFAVREPLPGVNLDEISRPGLGVALWMHGNDVRSLHAKLKEAGVRILQEPTSGPF
                     GENIIFADPDGYAVTVHDRV"
     misc_feature    120016..120339
                     /gene="gloA"
                     /locus_tag="HMPREF0733_10100"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    order(120025..120027,120106..120108,120139..120141,
                     120145..120147,120190..120192,120310..120312,
                     120334..120336)
                     /gene="gloA"
                     /locus_tag="HMPREF0733_10100"
                     /note="active site"
                     /db_xref="CDD:211348"
     gene            120455..120889
                     /locus_tag="HMPREF0733_10101"
                     /db_xref="GeneID:9901353"
     CDS             120455..120889
                     /locus_tag="HMPREF0733_10101"
                     /note="Pfam: PF01878; InterPro: IPR002740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982993.1"
                     /db_xref="GI:311111771"
                     /db_xref="GeneID:9901353"
                     /translation="MRYWVGVASRDHVLLGVAGGFCQVCHGKQVPLARMKQGDWILYY
                     SPKTGMNSGEKVQAFTAVGQIVDDRVYQFRMAENFEPFRRDVVFQDAPHPCPIEVARE
                     HPEWRSYAKQLRYGHFEVSHDFFEHIYRYMMASKHEITPDRC"
     misc_feature    120455..120859
                     /locus_tag="HMPREF0733_10101"
                     /note="hypothetical protein; Provisional; Region:
                     PRK02268"
                     /db_xref="CDD:235021"
     gene            121101..122450
                     /gene="hemL"
                     /locus_tag="HMPREF0733_10102"
                     /db_xref="GeneID:9901354"
     CDS             121101..122450
                     /gene="hemL"
                     /locus_tag="HMPREF0733_10102"
                     /EC_number="5.4.3.8"
                     /note="COG: COG0001; Pfam: PF00202; InterPro: IPR004639"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde-2,1-aminomutase"
                     /protein_id="YP_003982994.1"
                     /db_xref="GI:311111772"
                     /db_xref="GeneID:9901354"
                     /translation="MSLSAEHHLAHQHSEELFERSRSVIPGGVNSPVRAFNSVGGTPA
                     FVDRASGPYIYDADGNEYVDLVCSWGPAILGHAHPQVVAAVQEAASRGLSFGAASAPE
                     AELAELVVDRINTAIPGAIEQVRMVSTGTEATMTAIRLARGITGRDKIIKFSGCYHGH
                     VDALLSEAGSGVATLALPGSAGVTAATASETIVLPYNDLDAVREAFAAHPGEIAAVIT
                     EAAPCNMGVVTPEPGFNRGLREITQSNNALLIFDEVLTGFRVSSAGYWGKFAPEDNGW
                     VPDIFTFGKVIGGGMPIAALAGKREVMEYLAPTGPVYQAGTLSGNPLSVASGITTLKL
                     ADDALYRTLDTRSEQLQAALTQALTDAGVDHSIQTAGNLFSVAFGTGEHGVHNYADIK
                     GSATAKYTAFFHAMLDAGVYLPPSAFEAWFLSGAHDDAAMERIIEALPGAARAAAKA"
     misc_feature    121131..122420
                     /gene="hemL"
                     /locus_tag="HMPREF0733_10102"
                     /note="glutamate-1-semialdehyde aminotransferase;
                     Provisional; Region: PRK00062"
                     /db_xref="CDD:234607"
     misc_feature    121149..122417
                     /gene="hemL"
                     /locus_tag="HMPREF0733_10102"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(121485..121493,121569..121574,121578..121580,
                     121755..121757,121854..121856,121860..121865,
                     121953..121955)
                     /gene="hemL"
                     /locus_tag="HMPREF0733_10102"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(121488..121493,121569..121574,121755..121757,
                     121854..121856,121863..121865,121953..121955)
                     /gene="hemL"
                     /locus_tag="HMPREF0733_10102"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    121953..121955
                     /gene="hemL"
                     /locus_tag="HMPREF0733_10102"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            122611..123615
                     /locus_tag="HMPREF0733_10103"
                     /db_xref="GeneID:9901355"
     CDS             122611..123615
                     /locus_tag="HMPREF0733_10103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982995.1"
                     /db_xref="GI:311111773"
                     /db_xref="GeneID:9901355"
                     /translation="MDFRDIWLIAFIVYLGLCLLIEAVYPVRVRKKYALKDEHAQWFW
                     AYKHFFLYIWSWFVAASLFMLFWDISDFIRPVALFFPFLMVYAGARIGRRNYRISHGT
                     FPDNRAVGMPKIYAATLGALSKPLRFKPDTPDSQLVRETSWSVIVGAIVFALCTLIFL
                     LSLTDFDISPTVTFGTIVLAIGLLEGLWAIFVHTGMYTVFTPHHMRVSKTLGSARNIP
                     YRDIIGYRVIPKNPDDLNPDAKQVSQWKIELQIPWGTRSVIARNWELQNPHIEYLTRQ
                     IAFRVEQERWADENSPADRERLDEYRQDARLVCTTKGYIPAGKYAQEAANRASFKQTH
                     "
     gene            123700..123825
                     /locus_tag="HMPREF0733_10104"
                     /db_xref="GeneID:9901356"
     CDS             123700..123825
                     /locus_tag="HMPREF0733_10104"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982996.1"
                     /db_xref="GI:311111774"
                     /db_xref="GeneID:9901356"
                     /translation="MESLSLNILRLLPISPQSSTKSYDSKVNLLYFFNGFLRISY"
     gene            124214..124942
                     /locus_tag="HMPREF0733_10105"
                     /db_xref="GeneID:9901357"
     CDS             124214..124942
                     /locus_tag="HMPREF0733_10105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982997.1"
                     /db_xref="GI:311111775"
                     /db_xref="GeneID:9901357"
                     /translation="MSISNNFITCTRRAAFGFLGASSLVALLTACDDEDKPGARPSTT
                     TSSTAAPETEPPEPADSPSAAPSSSGPKYSGKSKAPAGEFRAADIYGPAQNVPKPTNP
                     PGYTEPTLDGMMKSMKAWTQWRNYGMQTGDYTEAYKFVSKNLVEEINAYNADAKLYHD
                     GGWIIGGEQRSYDFRNDPVHQGNGVYSWDFFVGWSYIITVGADGRHKRSRNTNYADNL
                     YTLTVHYEETGWIIDSITRKQAQK"
     gene            complement(125416..126054)
                     /locus_tag="HMPREF0733_10106"
                     /db_xref="GeneID:9901358"
     CDS             complement(125416..126054)
                     /locus_tag="HMPREF0733_10106"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003982998.1"
                     /db_xref="GI:311111776"
                     /db_xref="GeneID:9901358"
                     /translation="MVANVYIYSHSISGSTYAKAEEELTSYYEGLGYKVIRGQYPTGL
                     GSVTLPASVSLLLKVVSVAVKLGRPIATIVSQGLRQWSINQIIGGRDRTHGFIHIQSI
                     PMVSDESHGVSRGISTDNLLLSLVRATEIIRENTEPFRVVLKGVGDGHRGDKTYINGL
                     RCDKNTVRPLARIAKVYRQFSDENNRQDLHFAFEERKVLGPKLTWHLAQEDK"
     gene            complement(126445..129297)
                     /gene="gcrY"
                     /locus_tag="HMPREF0733_10107"
                     /db_xref="GeneID:9901359"
     CDS             complement(126445..129297)
                     /gene="gcrY"
                     /locus_tag="HMPREF0733_10107"
                     /codon_start=1
                     /transl_table=11
                     /product="GcrY protein"
                     /protein_id="YP_003982999.1"
                     /db_xref="GI:311111777"
                     /db_xref="GeneID:9901359"
                     /translation="MQTYYDRTYIQGELSRFTQQWRQKIDSHRRSSRKNFEISETQTF
                     WNSLLACFGIKPGTVAEFERPARRASTGNHGRIDMFWPSVLLVEQKTEGKNLEEALDQ
                     ARDYIAGGSIPEENLPRYLAVSDFERFIFVNRRTGDREEFTLEQLPDRYDTLKFLAGE
                     EAISAEEQQELTIAASKIMANLYQAMMGDTDTPVGEEAAQNAEDEDLRVQETSMFLTR
                     ILFLLFGDDAGIWEMHLFTRFLRKHTREDGSDLGTQINALFEYLDTPESKRTRMRHVP
                     ELMARFPYVNGSLFAERTPTEYFTRELREQLLIACGFDWSQISTAIFGSMFQLVKSRE
                     ARRAAGEHYTSEENILKTINPLFLDDLRARAESLIASTKGSKTKRAELAAFLDELGSM
                     HFMDPACGSGNFLQVAYMRLRELETRVLTEIHRLEDSGGFTLDASLNTRLSISQFHGI
                     EINWWPSKIAEVAMFLSEFQADRTLARALGQVPTRLPITSVAHIVHADALTTNWREMI
                     PAEATKVFVFGNPPFLGQWTMSKAQTSAMKTVWGKDYDGYLDFVTAWFWKAVQFFDQD
                     FEGEFAFVSTNSIAQGQPVPALFGPIFREGWRIKFAYHTFPWDSQAPGQAAVHCVITG
                     FTRSEDYKPRLFEYDWNARQTREAADVKNINAYLLDAPNILVKKRSKPLATQLPPVRF
                     GSKPVDGGNLIVEEKDYAEISSDSIAAKYLRPFRMGKELVRGLDRWCLWLEDANPADI
                     TKSPVLKKRTEAVRTVREKSPKKATQELASVPRLFAEIHQPDTSYVGIPRVVSETRLF
                     YTVAHLSSDVIAGDKVYTAIDPDGFLFAIISSSMFITWQKAVGGRLKSDLSFSNTIVW
                     NNLPLPEVAEDLRSKIITAGQKILKVRKALAEKHNGRVSLADMYNPLAMNAELLKAHK
                     ELDRHVDKAFGAAKLCASNNKRLEILFARYAELTAE"
     misc_feature    complement(126685..128454)
                     /gene="gcrY"
                     /locus_tag="HMPREF0733_10107"
                     /note="Type II restriction enzyme, methylase subunits
                     [Defense mechanisms]; Region: COG1002"
                     /db_xref="CDD:223934"
     gene            complement(129603..130598)
                     /gene="hemB"
                     /locus_tag="HMPREF0733_10108"
                     /db_xref="GeneID:9901360"
     CDS             complement(129603..130598)
                     /gene="hemB"
                     /locus_tag="HMPREF0733_10108"
                     /EC_number="4.2.1.24"
                     /note="COG: COG0113; Pfam: PF00490; InterPro: IPR013785"
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen synthase"
                     /protein_id="YP_003983000.1"
                     /db_xref="GI:311111778"
                     /db_xref="GeneID:9901360"
                     /translation="MNLTRRPRRLRITAAMRALTAETALRPEQLIQVFFVRDGISEPQ
                     PISSMPGQYQHTLDSLIPAVRQAVEAGIKCIDLFGVPLDDDKDEIGSAAWDDNGILNR
                     AIAACRADFGDEIVIMADTCLDEFTSHGHCGVLVDDGYGTMIVDNDATVELYCKMAVS
                     QARAGAHTVSPSGMMDGQIAAMRAALDEAGFQNVSIMAYSAKYASAFFGPFRDAVESS
                     FTGNRKTYQQDPANRRESLLEVQTDIDEGADMVMVKPAGSYLDIVREVAEFSPVPVAA
                     YQVSGEYAMIEAAAANGWIDRRAVALEALRSIHRAGADMILTYYAAEAARWLRED"
     misc_feature    complement(129615..130577)
                     /gene="hemB"
                     /locus_tag="HMPREF0733_10108"
                     /note="Porphobilinogen synthase (PBGS), which is also
                     called delta-aminolevulinic acid dehydratase (ALAD),
                     catalyzes the condensation of two 5-aminolevulinic acid
                     (ALA) molecules to form the pyrrole porphobilinogen (PBG),
                     which is the second step in the...; Region: ALAD_PBGS;
                     cd00384"
                     /db_xref="CDD:238226"
     misc_feature    complement(order(129669..129671,129678..129680,
                     129690..129692,129744..129746,129816..129830,
                     129882..129887,129894..129896,129912..129914,
                     129921..129923,129978..129986,130071..130076,
                     130155..130160,130449..130451,130458..130460,
                     130530..130532,130563..130568,130575..130577))
                     /gene="hemB"
                     /locus_tag="HMPREF0733_10108"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238226"
     misc_feature    complement(order(129642..129644,129759..129761,
                     129768..129770,129837..129839,129918..129920,
                     129930..129932,129948..129950,129963..129968,
                     129975..129977,129993..129995,130083..130085,
                     130203..130205,130227..130229,130233..130235,
                     130239..130241))
                     /gene="hemB"
                     /locus_tag="HMPREF0733_10108"
                     /note="active site"
                     /db_xref="CDD:238226"
     misc_feature    complement(order(129837..129839,129993..129995))
                     /gene="hemB"
                     /locus_tag="HMPREF0733_10108"
                     /note="Schiff base residues; other site"
                     /db_xref="CDD:238226"
     gene            complement(130644..131543)
                     /gene="hemD"
                     /locus_tag="HMPREF0733_10109"
                     /db_xref="GeneID:9901361"
     CDS             complement(130644..131543)
                     /gene="hemD"
                     /locus_tag="HMPREF0733_10109"
                     /EC_number="4.2.1.75"
                     /note="COG: COG1587; Pfam: PF02602"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="YP_003983001.1"
                     /db_xref="GI:311111779"
                     /db_xref="GeneID:9901361"
                     /translation="MARVLLTRTAAQGAPFERALNDLAAERGIPKIQVDFAPMQLPRT
                     VAPEYSLFSLVSLAAEGAFLWATFTSANAVRSCAELFGTSFAWALRDGGTRIACVGSA
                     TARALREIGLEPHFMPEKQDALGMLAEFPTEGANPELGIPESLRKPQNTPESAALGWD
                     DMLSAQANVLVFEGANARPTLREGLVGLGFRAVRAVVYEMVPATASVLEAGEISCVNA
                     RELTAGTGSNSAAVDVIIATAPSRLKELVGENPNPERIPPAVAIGSTTARTCEELGLR
                     HRTADSPTPEALALAAIELLHSA"
     misc_feature    complement(130689..131534)
                     /gene="hemD"
                     /locus_tag="HMPREF0733_10109"
                     /note="Uroporphyrinogen-III synthase (HemD) catalyzes the
                     asymmetrical cyclization of tetrapyrrole (linear) to
                     uroporphyrinogen-III, the fourth step in the biosynthesis
                     of heme. This ubiquitous enzyme is present in eukaryotes,
                     bacteria and archaea. Mutations in...; Region: HemD;
                     cd06578"
                     /db_xref="CDD:119440"
     misc_feature    complement(order(130818..130832,130944..130946,
                     130950..130952,131022..131024,131238..131240,
                     131328..131336,131520..131522))
                     /gene="hemD"
                     /locus_tag="HMPREF0733_10109"
                     /note="active site"
                     /db_xref="CDD:119440"
     gene            complement(131547..132662)
                     /gene="hemC"
                     /locus_tag="HMPREF0733_10110"
                     /db_xref="GeneID:9901362"
     CDS             complement(131547..132662)
                     /gene="hemC"
                     /locus_tag="HMPREF0733_10110"
                     /EC_number="2.5.1.61"
                     /note="COG: COG0181; Pfam: PF01379,PF03900; InterPro:
                     IPR000860"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylbilane synthase"
                     /protein_id="YP_003983002.1"
                     /db_xref="GI:311111780"
                     /db_xref="GeneID:9901362"
                     /translation="MSDPYILGTRGSALALTQSTLAAEHIVQMFNAHSREHGAERTLS
                     FDITTVKTDGDVLTGPLATLGGTGVFAAALRQRLLDGDTPDGVDVAVHSLKDLPAEPC
                     PGLVIAAILEREDPRDALVARDNLTLDTLPTGARVGTGSPRRAAQVHALRPDLEIVDI
                     RGNVGTRIARVKGLEEHGNRQVIVRDSAETDEAAHRGIGTENTGDCDAVILAVSGLKR
                     LGKESVITEYLDPSRMLPAPGQGALAIEVRETEFANPDTATLFNSEISQPVRTLGEAL
                     IAADHFETHLEVTAERRLLRRLEAGCAAPIGAYATVKDGDLVLTAVVASPDGTESLRH
                     TSATGELDVPGAERLGIRVAEDLLQMGAAALAGLEVK"
     misc_feature    complement(131586..132662)
                     /gene="hemC"
                     /locus_tag="HMPREF0733_10110"
                     /note="porphobilinogen deaminase; Reviewed; Region: hemC;
                     PRK00072"
                     /db_xref="CDD:234612"
     misc_feature    complement(131586..132647)
                     /gene="hemC"
                     /locus_tag="HMPREF0733_10110"
                     /note="Hydroxymethylbilane synthase (HMBS), also known as
                     porphobilinogen deaminase (PBGD), is an intermediate
                     enzyme in the biosynthetic pathway of tetrapyrrolic ring
                     systems, such as heme, chlorophylls, and vitamin B12.
                     HMBS catalyzes the conversion of...; Region: HMBS;
                     cd00494"
                     /db_xref="CDD:238276"
     misc_feature    complement(order(131664..131666,131670..131672,
                     131679..131681,131688..131690,131703..131705,
                     131739..131741,131745..131747,131757..131759,
                     131778..131780,131787..131792,131802..131804,
                     131811..131813,131877..131879,131940..131963,
                     132009..132014,132021..132023,132174..132176,
                     132213..132215,132225..132230,132234..132236,
                     132309..132326,132330..132335,132360..132362,
                     132366..132383,132612..132614,132627..132629))
                     /gene="hemC"
                     /locus_tag="HMPREF0733_10110"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238276"
     misc_feature    complement(order(131757..131759,131940..131945,
                     131952..131954,132009..132011,132018..132020,
                     132027..132035,132162..132164,132183..132185,
                     132231..132236,132240..132248,132375..132380,
                     132384..132386,132609..132611,132621..132623))
                     /gene="hemC"
                     /locus_tag="HMPREF0733_10110"
                     /note="active site"
                     /db_xref="CDD:238276"
     gene            complement(132738..134102)
                     /gene="hemH"
                     /locus_tag="HMPREF0733_10111"
                     /db_xref="GeneID:9901363"
     CDS             complement(132738..134102)
                     /gene="hemH"
                     /locus_tag="HMPREF0733_10111"
                     /EC_number="4.99.1.1"
                     /note="COG: COG0276; Pfam: PF00762; InterPro: IPR001015"
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="YP_003983003.1"
                     /db_xref="GI:311111781"
                     /db_xref="GeneID:9901363"
                     /translation="MSETVRAGCCGNIPDDVCPNATDPANTASNGPAALTPETLKSYR
                     GECGITRSRTAVPAPYDLVILSSFGGPEGQEDVIPFLRNVTAGRGIPDERLEEVATHY
                     RANGGISPINEQNRALLVALREAMQERGPHIPIVWANRNWKPYVTDVVQQAYEEGHRN
                     ILVLATSAYPGYSSCRQYREDYGVALEKLGLQDRMRIDKIRQFFDAPGFVEAFTEGLE
                     NGLKQVRNTVAERIADGTAAAGNGRIRIMFCTHSVPTSAANEAGPRGIDYEGGSAYVE
                     KHLQVARAILAKIREQDESLLDNIDWELVYQSRSGSPSTPWLEPDVNDAIDKIAGDVD
                     GIIMVPLGFVSDHMEVLWDLDTEAMETCRNHGIVAVRTPTPGVHPAYVESLRRLIAER
                     MAEPAESGHDRRESVFGESISGELGWFDECDPDCCKPLRGQEKPVIAEYTPKKTCACC
                     HEHV"
     misc_feature    complement(132906..133937)
                     /gene="hemH"
                     /locus_tag="HMPREF0733_10111"
                     /note="ferrochelatase; Reviewed; Region: hemH; PRK00035"
                     /db_xref="CDD:234585"
     misc_feature    complement(133488..133916)
                     /gene="hemH"
                     /locus_tag="HMPREF0733_10111"
                     /note="Ferrochelatase, N-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_N;
                     cd03411"
                     /db_xref="CDD:239504"
     misc_feature    complement(order(133491..133493,133497..133499,
                     133587..133598,133605..133607,133749..133751,
                     133761..133763,133788..133790,133800..133802,
                     133902..133904))
                     /gene="hemH"
                     /locus_tag="HMPREF0733_10111"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239504"
     misc_feature    complement(order(133581..133586,133845..133853,
                     133863..133865,133899..133901))
                     /gene="hemH"
                     /locus_tag="HMPREF0733_10111"
                     /note="active site"
                     /db_xref="CDD:239504"
     misc_feature    complement(132975..133418)
                     /gene="hemH"
                     /locus_tag="HMPREF0733_10111"
                     /note="Ferrochelatase, C-terminal domain: Ferrochelatase
                     (protoheme ferrolyase or HemH) is the terminal enzyme of
                     the heme biosynthetic pathway. It catalyzes the insertion
                     of ferrous iron into the protoporphyrin IX ring yielding
                     protoheme. This enzyme is...; Region: Ferrochelatase_C;
                     cd00419"
                     /db_xref="CDD:238240"
     misc_feature    complement(order(133056..133058,133152..133154,
                     133335..133337,133350..133352))
                     /gene="hemH"
                     /locus_tag="HMPREF0733_10111"
                     /note="active site"
                     /db_xref="CDD:238240"
     misc_feature    complement(order(132975..132977,133047..133049,
                     133059..133061,133065..133073,133077..133079,
                     133260..133262,133272..133274,133281..133289))
                     /gene="hemH"
                     /locus_tag="HMPREF0733_10111"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238240"
     gene            complement(134099..134890)
                     /locus_tag="HMPREF0733_10112"
                     /db_xref="GeneID:9901364"
     CDS             complement(134099..134890)
                     /locus_tag="HMPREF0733_10112"
                     /note="COG: COG3253; Pfam: PF06778; InterPro: IPR010644"
                     /codon_start=1
                     /transl_table=11
                     /product="chlorite dismutase family protein"
                     /protein_id="YP_003983004.1"
                     /db_xref="GI:311111782"
                     /db_xref="GeneID:9901364"
                     /translation="MSHEEHQNAAHGSHGSGYGGAPKGYAVQHSPADENKRGREEGET
                     LHYTLYTVFARAGQRAESASSAEAIAEFEQLIEELKADGVTLRGLYDVSAMRDNADVM
                     VWTHGPTPEKLQAAVRKIRRTALFSATTIVWSTMGVHREAEFTRNHAPAYARQKAPEA
                     WVCVYPFVRSYDWYYMNPERRAEMLKNHGMKAIDFPQVLANTVATFGLNDYEWVLALE
                     APELVDLVDMMRHFRNTEARLHVREEIPFYTGRRVNAADVAEVLA"
     misc_feature    complement(134102..134761)
                     /locus_tag="HMPREF0733_10112"
                     /note="Chlorite dismutase; Region: Chlor_dismutase;
                     cl01280"
                     /db_xref="CDD:260869"
     gene            134904..135029
                     /locus_tag="HMPREF0733_10113"
                     /db_xref="GeneID:9901365"
     CDS             134904..135029
                     /locus_tag="HMPREF0733_10113"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983005.1"
                     /db_xref="GI:311111783"
                     /db_xref="GeneID:9901365"
                     /translation="MKTAQDSLNVLCSPASLSQTDLSLPAVMLLTREVLSSVFFG"
     gene            complement(135070..136533)
                     /gene="hemG"
                     /locus_tag="HMPREF0733_10114"
                     /db_xref="GeneID:9901366"
     CDS             complement(135070..136533)
                     /gene="hemG"
                     /locus_tag="HMPREF0733_10114"
                     /EC_number="1.3.3.4"
                     /note="Pfam: PF01593; InterPro: IPR004572"
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="YP_003983006.1"
                     /db_xref="GI:311111784"
                     /db_xref="GeneID:9901366"
                     /translation="MNMVHQHKNHHAPSAIVVGGGISGLLAARRLTDAGVNVTVLDQN
                     DYLGGALGAHKVAGLVLDSGAESYATRTPTVTNLVKELGLDDQIVHPNSHGSWLYLPQ
                     GARKTPSTGIMGIPGDLSDKSLAGVLGKSGLRRARMDKVLPASVGANAKTLGELVRAR
                     MGKKVLDNLVAPVVSGVYSTHPDMLDIDAVIPGLREGLKKHKSLAAASAAIRAQAPAG
                     SQVAGLSGGMHLLIEQLIEKMPAPVRYIPECGVIAVDRDPITNEWVVIRRRSDGEKAA
                     SVGADYLVIATDGSTAARLLGPHIKGSSLPNIDPGPEVALVTLVVDQPALNSNPRGTG
                     LLVSEAVTNVRAKALTHATAKWAWVAEEAGKNRHVVRLSYGRGGEQSTFSDVSLDEDQ
                     LITLALRDASKLLDVPITAQNLVDADVVRWNGVLPLSTPGYRERVQLFRERAAELDTV
                     CTVGSWAAGSGLAAVVRDTQEQLDQFIAHITQKRASK"
     misc_feature    complement(135136..136497)
                     /gene="hemG"
                     /locus_tag="HMPREF0733_10114"
                     /note="protoporphyrinogen oxidase; Reviewed; Region:
                     PRK11883"
                     /db_xref="CDD:237009"
     misc_feature    complement(136288..136485)
                     /gene="hemG"
                     /locus_tag="HMPREF0733_10114"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     gene            complement(136581..137768)
                     /gene="hemE"
                     /locus_tag="HMPREF0733_10115"
                     /db_xref="GeneID:9901367"
     CDS             complement(136581..137768)
                     /gene="hemE"
                     /locus_tag="HMPREF0733_10115"
                     /EC_number="4.1.1.37"
                     /note="COG: COG0407; Pfam: PF01208; InterPro: IPR000257"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="YP_003983007.1"
                     /db_xref="GI:311111785"
                     /db_xref="GeneID:9901367"
                     /translation="MTETQQPQRAANGADSQQSRSTVGAHPRDRQRDLLTEAQLSRLD
                     ASHPLRAAQTADSPMLQALTGRASEHRPVWFMRQAGRSLPEYRKAREGIPMLDACLTP
                     ELAAEITVQPVRRHKVDAGIFFSDIVIPMKLAGVNVDIVPGRGPVLEHPVRTLDEVRA
                     LPELTDAALDPIRESVAATVEMLGSTPLIGFAGAPFTVAAYMVEGGPSRDHLRPRTMM
                     HADPVAWRELAQWAARTAGQFLRAQIEAGASAVQLFDSWAGSLGEADYRRYVQEHSAA
                     ALGMVEEFGVPRIHFGTGTAELLPAMHEAGADVIGVDYRLPLDEANRRLNGAVPLQGN
                     IDPALLAAGRETLYAHADEVLAAGASAPAHIVNLGHGVPPTTDPQVLTDLVTYLHERT
                     RRP"
     misc_feature    complement(136599..137591)
                     /gene="hemE"
                     /locus_tag="HMPREF0733_10115"
                     /note="Uroporphyrinogen decarboxylase (URO-D) is a dimeric
                     cytosolic enzyme that decarboxylates the four acetate side
                     chains of uroporphyrinogen III (uro-III) to create
                     coproporphyrinogen III, without requiring any prosthetic
                     groups or cofactors. This reaction...; Region: URO-D;
                     cd00717"
                     /db_xref="CDD:238368"
     misc_feature    complement(order(136659..136661,136896..136898,
                     136998..137003,137007..137009,137148..137150,
                     137166..137168,137196..137198,137334..137336,
                     137349..137351,137385..137405,137484..137486,
                     137499..137501,137511..137513,137526..137543))
                     /gene="hemE"
                     /locus_tag="HMPREF0733_10115"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238368"
     misc_feature    complement(order(136659..136661,137001..137003,
                     137166..137168,137391..137393,137526..137528,
                     137538..137540))
                     /gene="hemE"
                     /locus_tag="HMPREF0733_10115"
                     /note="active site"
                     /db_xref="CDD:238368"
     gene            138045..139292
                     /gene="hemA"
                     /locus_tag="HMPREF0733_10116"
                     /db_xref="GeneID:9901368"
     CDS             138045..139292
                     /gene="hemA"
                     /locus_tag="HMPREF0733_10116"
                     /EC_number="1.2.1.70"
                     /note="COG: COG0373; Pfam: PF05201,PF01488,PF00745;
                     InterPro: IPR000343"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA reductase"
                     /protein_id="YP_003983008.1"
                     /db_xref="GI:311111786"
                     /db_xref="GeneID:9901368"
                     /translation="MATYSFVASHRIIDLTTVALLSNGAAGIPELFRTETAQNLGVTG
                     TIVLATCNRLEIYVQLSVAEHLGPVSDMLYAEIAQKSELDAELIADSFEIYENLEAAK
                     HLFTVASGLESAVVGEREIAGQVRRALAYAQEEGTVPGELVQLFEHAAHTARQVGQHT
                     TIGSQGRSIVSVALDLADAVAEKDWKTRRALVFGTGAYAGATIAALRERGCEDIWVNS
                     RSGRAPEFAAKRDVRAVPKGETYKAMEQADVIVGCSGGSDPLSPAEIPPGHHTILDLA
                     LSRDFDPAIADLPQVELITLESVRLAAPEETEEAVATAERIVESETQAFAARQKTRNI
                     DSAIVALRSHTMEVLDEELDKVRSQFGCTAATEQLELAMRRMVKSLLHTPTIRAKQLA
                     TQGRTSDYIAALETLYGITIDDR"
     misc_feature    138045..139274
                     /gene="hemA"
                     /locus_tag="HMPREF0733_10116"
                     /note="glutamyl-tRNA reductase; Reviewed; Region: hemA;
                     PRK00045"
                     /db_xref="CDD:234592"
     misc_feature    138069..138935
                     /gene="hemA"
                     /locus_tag="HMPREF0733_10116"
                     /note="NAD(P) binding domain of amino acid
                     dehydrogenase-like proteins; Region:
                     NAD_bind_amino_acid_DH; cl17226"
                     /db_xref="CDD:266569"
     misc_feature    order(138630..138638,138696..138701,138801..138806,
                     138867..138869)
                     /gene="hemA"
                     /locus_tag="HMPREF0733_10116"
                     /note="NAD(P) binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:133449"
     misc_feature    138984..139274
                     /gene="hemA"
                     /locus_tag="HMPREF0733_10116"
                     /note="Glutamyl-tRNAGlu reductase, dimerization domain;
                     Region: GlutR_dimer; pfam00745"
                     /db_xref="CDD:250100"
     gene            139441..139668
                     /locus_tag="HMPREF0733_10117"
                     /db_xref="GeneID:9901369"
     CDS             139441..139668
                     /locus_tag="HMPREF0733_10117"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_003983009.1"
                     /db_xref="GI:311111787"
                     /db_xref="GeneID:9901369"
                     /translation="MEIKIGIRHISREVTLETKESVETIRTKVADAITNGSLLEITDD
                     KGATTLVPGEQIGYVELGSEEKRRVGFGVGA"
     misc_feature    139441..139659
                     /locus_tag="HMPREF0733_10117"
                     /note="Protein of unknown function (DUF3107); Region:
                     DUF3107; pfam11305"
                     /db_xref="CDD:151746"
     gene            complement(139821..139952)
                     /locus_tag="HMPREF0733_10118"
                     /db_xref="GeneID:9901370"
     CDS             complement(139821..139952)
                     /locus_tag="HMPREF0733_10118"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983010.1"
                     /db_xref="GI:311111788"
                     /db_xref="GeneID:9901370"
                     /translation="MKEADRGKFIFRSRALEDVPAVKELRLSERRGVWYIKNDRAST"
     gene            140094..141836
                     /locus_tag="HMPREF0733_10119"
                     /db_xref="GeneID:9901371"
     CDS             140094..141836
                     /locus_tag="HMPREF0733_10119"
                     /EC_number="3.6.1.-"
                     /note="COG: COG0513; Pfam: PF00270,PF00271; InterPro:
                     IPR014001"
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD-box RNA helicase"
                     /protein_id="YP_003983011.1"
                     /db_xref="GI:311111789"
                     /db_xref="GeneID:9901371"
                     /translation="MTDAQNATTDEAQPSSVPQSSPKSFADFGVRQDISDALAAVGIV
                     SPFPIQEMTLPVALAGHDIIGQAKTGTGKTLGFGLPTIQRVVGRDDDQWGSLQKPGAP
                     QALILVPTRELAIQVGNDLAVASKLRNARVATLYGGVPYEPQVEQLTKGLEVVVGTPG
                     RLIDLYQHGALTLTQVKTVVLDEADEMLDLGFLPSVEKIMGYLPTDRQTMLFSATMPG
                     PVITMARKYMTKPMHISAADPEDHAKTKASIRQVVYRVHHMDKDEMLGRILRAHGRGR
                     TVIFTKTKRDAARVADELIARGFAAAPLHGDLNQGAREQALRAFRNGKVDILVATDVA
                     ARGIDVEDVTHVINHRVPEDEKTYLHRTGRTGRAGHEGTAVTFVDWEDIARWRLINDA
                     LDLGVSDPVETYSSSEHLFYDLDIPPGTKGRLPRSEQTLEGLDAEHLDDYGDSRSSRG
                     SSRSSRGSRSRGSKSRGSRGGSRKAKSEKRGEDSFSKDAAPKRERRPRRRTRRVEGET
                     VETRAEKTAGKAPEKKSAKKSGSAKDSSVEKTDSQGSSRRRSRRRSGNKGKADWTTAK
                     KAGRKKSDAASGEE"
     misc_feature    140112..141260
                     /locus_tag="HMPREF0733_10119"
                     /note="helicase 45; Provisional; Region: PTZ00424"
                     /db_xref="CDD:185609"
     misc_feature    140166..140798
                     /locus_tag="HMPREF0733_10119"
                     /note="DEAD-box helicases. A diverse family of proteins
                     involved in ATP-dependent RNA unwinding, needed in a
                     variety of cellular processes including splicing, ribosome
                     biogenesis and RNA degradation. The name derives from the
                     sequence of the Walker  B motif; Region: DEADc; cd00268"
                     /db_xref="CDD:238167"
     misc_feature    140301..140315
                     /locus_tag="HMPREF0733_10119"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    140637..140648
                     /locus_tag="HMPREF0733_10119"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    140730..140738
                     /locus_tag="HMPREF0733_10119"
                     /note="motif III; other site"
                     /db_xref="CDD:238167"
     misc_feature    140838..141224
                     /locus_tag="HMPREF0733_10119"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(140937..140948,141006..141011,141084..141092)
                     /locus_tag="HMPREF0733_10119"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(141108..141110,141171..141173,141183..141185,
                     141192..141194)
                     /locus_tag="HMPREF0733_10119"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            141844..143085
                     /locus_tag="HMPREF0733_10120"
                     /db_xref="GeneID:9901372"
     CDS             141844..143085
                     /locus_tag="HMPREF0733_10120"
                     /EC_number="2.1.1.72"
                     /note="COG: COG0863; Pfam: PF01555; InterPro: IPR002941"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine specific DNA methylase"
                     /protein_id="YP_003983012.1"
                     /db_xref="GI:311111790"
                     /db_xref="GeneID:9901372"
                     /translation="MSEAVSSADASVPKRSDTDDIPAFDPNGSSLVVQADNLAYLSEL
                     PSASFTVIYIDPPFNTGKTQTRRTLKTAPAADGEEQGKGNGNRTGFQGKSYTSALQTL
                     ASYHDAFEDYWAFLEPRIRQAHRLLTEDGTLYLHLDWREVHYAKVMCDMIFGRDCFIN
                     EIIWAYDYGAKSTKRWPTKHDNILMYVKNPQEYYFNADAVDREPYMAPGLVTEEKAAR
                     GKLPTDVWWHTIVSPTGKEKTGYPTQKPLGLLKRMIAASSRPGDWVLDFFAGSGTTGA
                     AAAALGRRFVCVDQNPPAIEVMAKRLNVDAESFADYRGVPRGAAVLFTPHRHVGVRGG
                     TSRDALTAASRRALAEQSKKIQERVKPIDGAHSQFVRHPSTDVLERELRAQAREKLRK
                     DRKRQELTKKRKQVKETAASS"
     misc_feature    <141937..>142050
                     /locus_tag="HMPREF0733_10120"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     misc_feature    141997..142650
                     /locus_tag="HMPREF0733_10120"
                     /note="DNA methylase; Region: N6_N4_Mtase; pfam01555"
                     /db_xref="CDD:250703"
     gene            complement(143198..144061)
                     /locus_tag="HMPREF0733_10121"
                     /db_xref="GeneID:9901373"
     CDS             complement(143198..144061)
                     /locus_tag="HMPREF0733_10121"
                     /note="COG: COG0613; Pfam: PF02811; InterPro: IPR004013"
                     /codon_start=1
                     /transl_table=11
                     /product="PHP domain-containing protein"
                     /protein_id="YP_003983013.1"
                     /db_xref="GI:311111791"
                     /db_xref="GeneID:9901373"
                     /translation="MTERYDLHIHSAISDGTQPLTELIPLIHEAGLTGFALTDHDTAC
                     GWSQAAELAGEYGLDFLPGAEFSCRYTYCDEQGRKRTKSVHLLAYGYDPQSSELARRV
                     EEIRRSRAGRARRIVELLSADYPLTWEHVQEQTGEENASVGRPHIADALIAAGIVASR
                     EEAFGRILYAGSPYYVPQESMDPLEATRLVRAAGGVPVVAHPMSENRGPALPLEYLGQ
                     MVDAGLAGVEVYHRENSEPNRARLLEFARDRELLVTGSSDYHGAGKPNRLGENTTARE
                     TVEAIRAQIRG"
     misc_feature    complement(143273..144052)
                     /locus_tag="HMPREF0733_10121"
                     /note="Predicted metal-dependent phosphoesterases (PHP
                     family) [General function prediction only]; Region:
                     COG0613"
                     /db_xref="CDD:223686"
     misc_feature    complement(143279..144049)
                     /locus_tag="HMPREF0733_10121"
                     /note="Polymerase and Histidinol Phosphatase domain of
                     Histidinol phosphate phosphatase (HisPPase) AMP bound;
                     Region: PHP_HisPPase_AMP; cd07438"
                     /db_xref="CDD:213993"
     misc_feature    complement(order(143282..143284,143288..143290,
                     143459..143461,143807..143809,143867..143869,
                     143942..143944,144017..144019,144032..144034,
                     144038..144040))
                     /locus_tag="HMPREF0733_10121"
                     /note="active site"
                     /db_xref="CDD:213993"
     gene            144188..145717
                     /gene="pepP"
                     /locus_tag="HMPREF0733_10122"
                     /db_xref="GeneID:9901374"
     CDS             144188..145717
                     /gene="pepP"
                     /locus_tag="HMPREF0733_10122"
                     /EC_number="3.4.11.9"
                     /note="COG: COG0006; Pfam: PF05195,PF00557; InterPro:
                     IPR000994"
                     /codon_start=1
                     /transl_table=11
                     /product="xaa-Pro aminopeptidase I"
                     /protein_id="YP_003983014.1"
                     /db_xref="GI:311111792"
                     /db_xref="GeneID:9901374"
                     /translation="MTENTKKSTGAPTTDHRDTPKASAFQEFIASNWEPAADDGYTRE
                     RVADFAAQRRKKISQKFPGERLVLPAGPLKVRSNDCDYRFRPHSAFAHQTGLGVDHEA
                     DAVLVFEPVDEGTGDNGSNHEVTLYFRPLAGRDTTQFYADARYGEFWVGPRPTLKEFS
                     ERYGVRTKDLSELEVAITKNAGAQALGGVRIRLVREVDPSIDALVDTSRYNTGVALEE
                     SDKLDSELTVALSEARLIKDEIEVENLQRSVDMTVKGFEEVVRELPKAVAHHRGERVV
                     ETAFFSVARTDGNDLGYDTIAACGNNATILHWIRNNGTVDEGKLLLLDAGVEDDTLYT
                     ADVTRTFPVNGKFTEVQAKVYNAVLDAADAAFKVAVPGRKFHEIHDAAMEVLAHRLEE
                     WGLLPVSAEVSLTVEGGQHRRWMPHGTSHHLGLDVHDCAQAKAELYTGATLEPGMVFT
                     IEPALYFKDEDLSVPEEYRGIGIRLEDDVLCTEDGNVNLSAALPRTVEEIEEWMAKLA
                     Q"
     misc_feature    144326..144793
                     /gene="pepP"
                     /locus_tag="HMPREF0733_10122"
                     /note="Aminopeptidase P, N-terminal domain; Region: AMP_N;
                     smart01011"
                     /db_xref="CDD:198079"
     misc_feature    144329..145714
                     /gene="pepP"
                     /locus_tag="HMPREF0733_10122"
                     /note="proline aminopeptidase P II; Provisional; Region:
                     PRK10879"
                     /db_xref="CDD:182804"
     misc_feature    144911..145660
                     /gene="pepP"
                     /locus_tag="HMPREF0733_10122"
                     /note="Prolidase. E.C. 3.4.13.9. Also known as Xaa-Pro
                     dipeptidase, X-Pro dipeptidase, proline dipeptidase.,
                     imidodipeptidase, peptidase D, gamma-peptidase. Catalyses
                     hydrolysis of Xaa-Pro dipeptides; also acts on
                     aminoacyl-hydroxyproline analogs. No action on...; Region:
                     Prolidase; cd01087"
                     /db_xref="CDD:238520"
     misc_feature    order(145106..145108,145157..145159,145193..145195,
                     145448..145450,145541..145543,145613..145615)
                     /gene="pepP"
                     /locus_tag="HMPREF0733_10122"
                     /note="active site"
                     /db_xref="CDD:238520"
     gene            complement(145811..146818)
                     /locus_tag="HMPREF0733_10123"
                     /db_xref="GeneID:9901375"
     CDS             complement(145811..146818)
                     /locus_tag="HMPREF0733_10123"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983015.1"
                     /db_xref="GI:311111793"
                     /db_xref="GeneID:9901375"
                     /translation="MTQMPPNMPPSSYLASRLAQANGQLMPQGEPVAAFSRREEAFAA
                     FDVLAAANYPITALYLVNEGLKQVEYPTQQGYGRPLLVALIQGILAGLFYSALVSTAG
                     TNFLSAASSAVPIAVAVFVVWKIFELRRGGSGRYPMRGEAVPERTIVYALSDYSSEAR
                     RILSANPLFQKAVAAVSSGTPSAGTGLPHAASPYVSYTPTPAGESSQTPSTPSTVTDQ
                     QGGYPENHESAAKNPNPEQADADGQQSSAAQEIPWQSPAGGDSQAPQTAASQTAMQQT
                     QPDDSSEQSSPAADARERKPQAPAAQRFGLRIDDPEEYAKTIRQAPTRETPKPKGVKE
                     D"
     misc_feature    complement(<145856..>146344)
                     /locus_tag="HMPREF0733_10123"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK07764"
                     /db_xref="CDD:236090"
     gene            147003..148331
                     /gene="mgtE"
                     /locus_tag="HMPREF0733_10124"
                     /db_xref="GeneID:9901376"
     CDS             147003..148331
                     /gene="mgtE"
                     /locus_tag="HMPREF0733_10124"
                     /note="COG: COG2239; Pfam: PF03448,PF00571; InterPro:
                     IPR006668"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter MgtE"
                     /protein_id="YP_003983016.1"
                     /db_xref="GI:311111794"
                     /db_xref="GeneID:9901376"
                     /translation="MSNTKFSAPSKIYIARLLGLDVFDPFGDRLGRLRDVVVLKRGFG
                     AALAAGAHLRKGSEPVVVGIIIEVLGKKRVFMPMTRVRSIDASQIISTGLVNLRRFEQ
                     RNSETLVVGELFDRRVRLLDGSGDAVIEDVAIEQRRNGDWGVTELFVSRVSSSSGWRR
                     RSKETLVVDWDQAMLSTELEPQAATAFVANHENSKPADLADAIHEMNDKRMVEIAAEL
                     QDERLADVLQELPEEDQVQILSYLADERAAQVLEEMEPDDAADLLIELDDVQREKLLE
                     LMEPDEADDVRRLLEYDEGTAGSLMNPVPIILSPEATVAEALAHIRAEEISPAMAAAV
                     LVARPPLETPTGKYLGLVHMQQLLRVPPSESIGHILDTDTEPVSDQASLAELARVLAA
                     YDLTIIPIVNESHRLVGAVTIDDVLDALLPEDWRTFDDGTPVRKVGRRFV"
     misc_feature    147513..>148286
                     /gene="mgtE"
                     /locus_tag="HMPREF0733_10124"
                     /note="Mg/Co/Ni transporter MgtE (contains CBS domain)
                     [Inorganic ion transport and metabolism]; Region: MgtE;
                     COG2239"
                     /db_xref="CDD:225148"
     misc_feature    147588..147893
                     /gene="mgtE"
                     /locus_tag="HMPREF0733_10124"
                     /note="MgtE intracellular N domain; Region: MgtE_N;
                     smart00924"
                     /db_xref="CDD:214915"
     misc_feature    147921..148262
                     /gene="mgtE"
                     /locus_tag="HMPREF0733_10124"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domain in the
                     magnesium transporter, MgtE.  MgtE and its homologs are
                     found in eubacteria, archaebacteria, and eukaryota.
                     Members of this family transport Mg2+ or other...; Region:
                     CBS_pair_Mg_transporter; cd04606"
                     /db_xref="CDD:239979"
     gene            148324..149115
                     /locus_tag="HMPREF0733_10125"
                     /db_xref="GeneID:9901377"
     CDS             148324..149115
                     /locus_tag="HMPREF0733_10125"
                     /note="COG: COG4420; Pfam: PF06210; InterPro: IPR010406"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein"
                     /protein_id="YP_003983017.1"
                     /db_xref="GI:311111795"
                     /db_xref="GeneID:9901377"
                     /translation="MSDQNRRNENLKHEENPRIDKARILKDRLEKKYAERSRDTRETS
                     RSGNRAESQLSTPAERKNKLFAYNPNPDAFGRMTEAFARYMGTPQFLLWMTVFCGVWL
                     GWNTLAPEELQFDPRSLNFTLLTLMLSLQASYAAPLLLLAQNRQDDRDRVVASEDRKR
                     DQQNLEETQYLTREIASLRIALREVATRDFVRSELRDILEELKSIQEEQERQAEQLQD
                     IGDDIEELEDADGEENTEAESHTANTENSPDAKAPTAHKGERPTS"
     misc_feature    148576..148905
                     /locus_tag="HMPREF0733_10125"
                     /note="Protein of unknown function (DUF1003); Region:
                     DUF1003; pfam06210"
                     /db_xref="CDD:253620"
     STS             148670..150249
                     /standard_name="Tjp1"
                     /db_xref="UniSTS:144635"
     gene            149299..150555
                     /gene="mrp"
                     /locus_tag="HMPREF0733_10126"
                     /db_xref="GeneID:9901378"
     CDS             149299..150555
                     /gene="mrp"
                     /locus_tag="HMPREF0733_10126"
                     /note="COG: COG0489; Pfam: PF01883; InterPro: IPR002744"
                     /codon_start=1
                     /transl_table=11
                     /product="Mrp ATPase family protein"
                     /protein_id="YP_003983018.1"
                     /db_xref="GI:311111796"
                     /db_xref="GeneID:9901378"
                     /translation="MSSPNATPHDRSRENEPAPDNPLEDALWAALARVEDPELRRPIT
                     ELGMVEYARVLAEEDDPQRRYAQVKVLLTIEGCPLKNTIDTQVREAAAAVTGIDRVQL
                     ELGAMNSEQRGALKSRLKPERTNPFTAPGSLTRIFGVVSGKGGVGKSSMTANLAAAFA
                     SRGLAVGIIDADVHGFSIPGLMGITEAPTRLDDLIIPPTVDVPASVRGKDDTGGQESA
                     TGASGGFVKVISIGMFLKDNQPVAWRGPMLHRALEQFILDVHFGALDVLLLDLPPGTG
                     DIAISMAQLLPNAELILVSTPQHAAVDVAERAGTLSLQTQQKVVGVIENMAAMTLPDG
                     TVLEMFGSGGGEHLAKRLTEALDYSVPLLGSVPLDVALRTGGDEGMPVVWGHPESATS
                     VEIRNIAAQLLRRKDSLAGKPLSLIV"
     misc_feature    149329..>149610
                     /gene="mrp"
                     /locus_tag="HMPREF0733_10126"
                     /note="Domain of unknown function DUF59; Region: DUF59;
                     cl00941"
                     /db_xref="CDD:260711"
     misc_feature    149494..150417
                     /gene="mrp"
                     /locus_tag="HMPREF0733_10126"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Mrp;
                     COG0489"
                     /db_xref="CDD:223563"
     misc_feature    149752..150405
                     /gene="mrp"
                     /locus_tag="HMPREF0733_10126"
                     /note="MRP (Multiple Resistance and pH adaptation) is a
                     homologue of the Fer4_NifH superfamily. Like the other
                     members of the superfamily, MRP contains a ATP-binding
                     domain at the N-termini. It is found in bacteria as a
                     membrane-spanning protein and functions...; Region:
                     MRP-like; cd02037"
                     /db_xref="CDD:238994"
     gene            complement(150721..152199)
                     /locus_tag="HMPREF0733_10127"
                     /db_xref="GeneID:9901379"
     CDS             complement(150721..152199)
                     /locus_tag="HMPREF0733_10127"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983019.1"
                     /db_xref="GI:311111797"
                     /db_xref="GeneID:9901379"
                     /translation="MSESLDSPTYGEAEKPRGPISPLNPRRAERFNPTRFTLHTGGFF
                     FFDSLGTSATAALHRVAHRFAALPAWAQVLSIWAPSRLWGFIVFWVVGMQQVAGQQKM
                     GDGHVPTLLEYLGWWDAEWYERIYKNGYPVQLPVYDNGVVGHNTWAFLPAQPTIAGFI
                     ADTTGIPFALSTVMLSVVVSFALAWVIYLLFVGCLNWREHGVFEIRASQESPHRSLAL
                     WSVAAYGFCGPAVIFGTGYAESLTIFAIALFILLLAYDRYLWAIPVAFLATQSRPVGV
                     PLGALAGIWWLYCVASEYHVRRAADGPSALSTGQALMGAFAARSLHLISALIVCFFAL
                     GHALHAAIATGRIDAYLATEIGWSGRTVDDGQHYVVQWVTNLNIYLPQWNMWAVALLV
                     AVGFFAYFCWIFSRSTRSLLHPVMLIWCAAYMVYLGVFWLPQTSTFRILLPLFPLALV
                     LINYGKDSRAYRWLLVFFGLVLQLIWVGWLWHSHGPGDLNIP"
     gene            complement(152364..152735)
                     /locus_tag="HMPREF0733_10128"
                     /db_xref="GeneID:9901380"
     CDS             complement(152364..152735)
                     /locus_tag="HMPREF0733_10128"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983020.1"
                     /db_xref="GI:311111798"
                     /db_xref="GeneID:9901380"
                     /translation="MFGISGTEFVVLAVLTFFVIGPERMPEYVRQIKELIKTVRRMAF
                     EARDEFKDTLGDATLNEINWRQYDPRQYDPRVIVREAFAEDDAERAREAKERSEANKP
                     AASNLNRLPRGAYAPYDTEAT"
     misc_feature    complement(152367..152735)
                     /locus_tag="HMPREF0733_10128"
                     /note="mttA/Hcf106 family; Region: MttA_Hcf106; cl00788"
                     /db_xref="CDD:260623"
     gene            complement(152699..152935)
                     /locus_tag="HMPREF0733_10129"
                     /db_xref="GeneID:9901381"
     CDS             complement(152699..152935)
                     /locus_tag="HMPREF0733_10129"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983021.1"
                     /db_xref="GI:311111799"
                     /db_xref="GeneID:9901381"
                     /translation="MALEATTGRRGLPALNRTVYPGASRREITAGCASHIDDKTVRLS
                     AKHLIKALVAIPVALKMLVLYILCLVLVALSSSS"
     gene            complement(152890..154392)
                     /locus_tag="HMPREF0733_10130"
                     /db_xref="GeneID:9901382"
     CDS             complement(152890..154392)
                     /locus_tag="HMPREF0733_10130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983022.1"
                     /db_xref="GI:311111800"
                     /db_xref="GeneID:9901382"
                     /translation="MNNPSDKTPQQHTTVPSIPWSSANKPVSQTKPASTSSRDEDKNP
                     SKTSTLNADITWLYIASGERLRRMGDAFLRLPAWLQVMLVYAFSRVWGFIIFSVVGNQ
                     QLLGPWGQHLGYLPFISTWDSSWYGQIAQSGYPSKLPYDSTGAVAQNPWAFYPLFPLI
                     AGGINRITGIGYYPVAATVALLAGFAAAWVIYLLFTTSLNIVGYRDQSHGEKVSEAAS
                     STEDSKDVKTSRHNLALWAVAAVAFLPVAPVLQVPYAESLNLVFLVWVLLLMMRKQYL
                     LMMPVALLACLSRPVGVPLGATAGLWWFACLITEAKAQQQRRQRGEDQERFESVFLRS
                     LPQLGSALFICFCALIWPIYAWQITGRIDAYTATETAWRQGDLAPVAPWISQGIAYFG
                     YFTILLFPLLIVGYAAFLASPLVKRVLASPIILWCACYGAYLLIFLNPQSSTFRLLLP
                     LFPLMLPIVAISSSRAYRWLLIGSGALLQLVWVGWLWHWKQLPGGGDYPP"
     gene            complement(154389..154610)
                     /locus_tag="HMPREF0733_10131"
                     /db_xref="GeneID:9901383"
     CDS             complement(154389..154610)
                     /locus_tag="HMPREF0733_10131"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983023.1"
                     /db_xref="GI:311111801"
                     /db_xref="GeneID:9901383"
                     /translation="MNILITLLAVVVLILTLLGTFGLTSQRLYPGKKLAAYIARDGLD
                     VFADKTAPRESVSDESTLTSSPVLPQHSR"
     gene            complement(154865..155998)
                     /gene="dapE"
                     /locus_tag="HMPREF0733_10132"
                     /db_xref="GeneID:9901384"
     CDS             complement(154865..155998)
                     /gene="dapE"
                     /locus_tag="HMPREF0733_10132"
                     /EC_number="3.5.1.18"
                     /note="COG: COG0624; Pfam: PF01546,PF07687; InterPro:
                     IPR010174"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-diaminopimelate desuccinylase"
                     /protein_id="YP_003983024.1"
                     /db_xref="GI:311111802"
                     /db_xref="GeneID:9901384"
                     /translation="MTISLDLNVSMPELTRTLLDIYSVSGEEKTIADAVYESLSAYPH
                     LHLTRDGDAMIARTEFGPRNGEERTRILLAGHLDTVPLPKVAGSLGTVPASIVEDNGD
                     WILYGRGATDMKGGVAVQLKLAAELGEHDTDYNLTYVFYDHEEVASELSGMARLIRNH
                     GELLTDADFGVLLEPTDGTIEGGCNGTMRFYLRTAGLAAHSGRAWKGENAIHKLAGAL
                     RVLEEYEPQTYKVEGLAYREGLNAVQVSGGVAGNVIPDAAALHINYRFAPNKTLDEAK
                     AHVTEIFDGYELDFVDLSPAARPGLDTPLAASLIAAVGQEPKPKYGWTDVARLSEIGI
                     PAVNFGPGDALLAHTDNEHVSFSALTRCYTDLLFWLHTEVDED"
     misc_feature    complement(154889..155989)
                     /gene="dapE"
                     /locus_tag="HMPREF0733_10132"
                     /note="succinyl-diaminopimelate desuccinylase; Reviewed;
                     Region: PRK13007"
                     /db_xref="CDD:237264"
     misc_feature    complement(154889..155968)
                     /gene="dapE"
                     /locus_tag="HMPREF0733_10132"
                     /note="M20 Peptidase actinobacterial DapE encoded
                     N-succinyl-L,L-diaminopimelic acid desuccinylase; Region:
                     M20_DapE_actinobac; cd05647"
                     /db_xref="CDD:193525"
     misc_feature    complement(order(154955..154957,155477..155479,
                     155564..155569,155663..155665,155771..155773))
                     /gene="dapE"
                     /locus_tag="HMPREF0733_10132"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193525"
     misc_feature    complement(order(155033..155035,155204..155206,
                     155210..155212,155234..155239,155255..155278,
                     155282..155284,155333..155335,155342..155347,
                     155351..155356,155363..155368,155372..155374,
                     155390..155401,155432..155434))
                     /gene="dapE"
                     /locus_tag="HMPREF0733_10132"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193525"
     gene            156106..157080
                     /gene="dapD"
                     /locus_tag="HMPREF0733_10133"
                     /db_xref="GeneID:9901385"
     CDS             156106..157080
                     /gene="dapD"
                     /locus_tag="HMPREF0733_10133"
                     /EC_number="2.3.1.117"
                     /note="COG: COG2171"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase"
                     /protein_id="YP_003983025.1"
                     /db_xref="GI:311111803"
                     /db_xref="GeneID:9901385"
                     /translation="MVGMSENLSSESRYASGVALVNVVAAGNEAGTVLDAWFPAPALT
                     QTPDLSLADELDALVADHPERNARTEVRTASINLDEAPEDAVDAYLRLHLLSHTLVRP
                     NSINLDGLFGKLANVAWTNHGPVLASEFQKLALGLRKLGHLSVSHIDKFPRLVDYVVP
                     AGVRVGDGDRLRLGAHLSPGTTVMHEGFVNFNAGTLGTSMVEGRISQGVVVGDGSDVG
                     GGASTMGTLSGGGTQRVSIGERSLLGAESGIGIALGDDCVVEAGLYVTAGSRVSVLIP
                     GEEPRVVKAAELSGVSNLLFRRNSVSGAIEVLPRAKNTVELNDALHLN"
     misc_feature    156142..157077
                     /gene="dapD"
                     /locus_tag="HMPREF0733_10133"
                     /note="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
                     N-succinyltransferase; Region: DapD_actino; TIGR03535"
                     /db_xref="CDD:188336"
     misc_feature    <156340..156441
                     /gene="dapD"
                     /locus_tag="HMPREF0733_10133"
                     /note="Tetrahydrodipicolinate N-succinyltransferase
                     N-terminal; Region: THDPS_N; pfam14790"
                     /db_xref="CDD:258927"
     misc_feature    156445..156564
                     /gene="dapD"
                     /locus_tag="HMPREF0733_10133"
                     /note="Tetrahydrodipicolinate N-succinyltransferase
                     middle; Region: THDPS_M; pfam14789"
                     /db_xref="CDD:258926"
     misc_feature    156589..157026
                     /gene="dapD"
                     /locus_tag="HMPREF0733_10133"
                     /note="Putative
                     2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP)
                     N-succinyltransferase (THP succinyltransferase),
                     C-terminal left-handed parallel alpha-helix (LbH) domain:
                     This group is composed of mostly uncharacterized proteins
                     containing an N-terminal...; Region:
                     LbH_THP_succinylT_putative; cd04649"
                     /db_xref="CDD:100054"
     misc_feature    order(156703..156705,156709..156711,156715..156717,
                     156721..156723,156751..156753,156769..156771,
                     156775..156777,156829..156831,156844..156849,
                     156853..156855,156877..156879,156889..156891,
                     156895..156897,156901..156903)
                     /gene="dapD"
                     /locus_tag="HMPREF0733_10133"
                     /note="putative trimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100054"
     misc_feature    order(156829..156831,156835..156840,156853..156855,
                     156883..156885,156901..156903)
                     /gene="dapD"
                     /locus_tag="HMPREF0733_10133"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100054"
     gene            157409..158425
                     /gene="galE"
                     /locus_tag="HMPREF0733_10134"
                     /db_xref="GeneID:9901386"
     CDS             157409..158425
                     /gene="galE"
                     /locus_tag="HMPREF0733_10134"
                     /EC_number="5.1.3.2"
                     /note="COG: COG1087; Pfam: PF01370; InterPro: IPR005886"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="YP_003983026.1"
                     /db_xref="GI:311111804"
                     /db_xref="GeneID:9901386"
                     /translation="MMKVLVTGGAGYIGSHTVLELLNAGHEVVVMDNLSNSSETSLQR
                     VAELAGRAPEFHKVDLLDFEGMKKLFLEIRPDAVIHFAGLKAVGESAEKPLWYYQTNV
                     AGTLNLLYAMDAADCRSIVFSSSATVYGEPESMPLIEKLNMDAQSCYGRTKEHIEDML
                     VDLAASDDRWNIALLRYFNPVGAHESGRIGEDPSGIPNNLVPFIAQVAVGRREHLNVF
                     GNDYPTVDGTGVRDYIHVVDLADGHLKALDYISEHGGLHTWNLGTGNGYSVLEVLHAF
                     EKACGKELPYKIVARRPGDVAVSYADPSSALADLGWSASRDIDTMVRDHWNWQKNNPN
                     GYDA"
     misc_feature    157415..158398
                     /gene="galE"
                     /locus_tag="HMPREF0733_10134"
                     /note="UDP-glucose 4 epimerase, subgroup 1, extended (e)
                     SDRs; Region: UDP_G4E_1_SDR_e; cd05247"
                     /db_xref="CDD:187558"
     misc_feature    157418..158416
                     /gene="galE"
                     /locus_tag="HMPREF0733_10134"
                     /note="UDP-glucose 4-epimerase; Region: PLN02240"
                     /db_xref="CDD:177883"
     misc_feature    order(157430..157432,157436..157447,157502..157519,
                     157580..157588,157649..157657,157661..157663,
                     157706..157708,157775..157783,157853..157855,
                     157865..157867,157937..157942,157946..157948)
                     /gene="galE"
                     /locus_tag="HMPREF0733_10134"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187558"
     misc_feature    order(157679..157681,157685..157693,157700..157705,
                     157712..157717,157724..157729,157733..157738,
                     157745..157747,157850..157852,157859..157861,
                     157871..157873,157880..157885,157889..157897)
                     /gene="galE"
                     /locus_tag="HMPREF0733_10134"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187558"
     misc_feature    order(157709..157711,157781..157783,157853..157855,
                     157865..157867)
                     /gene="galE"
                     /locus_tag="HMPREF0733_10134"
                     /note="active site"
                     /db_xref="CDD:187558"
     misc_feature    order(157781..157789,157853..157855,157937..157945,
                     158000..158008,158051..158062,158093..158095,
                     158099..158101,158105..158107,158213..158215,
                     158282..158284,158291..158293)
                     /gene="galE"
                     /locus_tag="HMPREF0733_10134"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187558"
     gene            158774..159535
                     /gene="gluA"
                     /locus_tag="HMPREF0733_10135"
                     /db_xref="GeneID:9901387"
     CDS             158774..159535
                     /gene="gluA"
                     /locus_tag="HMPREF0733_10135"
                     /EC_number="3.6.3.-"
                     /note="COG: COG1126; Pfam: PF00005; InterPro: IPR003593"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate ABC transporter ATP-binding protein"
                     /protein_id="YP_003983027.1"
                     /db_xref="GI:311111805"
                     /db_xref="GeneID:9901387"
                     /translation="MTQASAPAEKPLVELNEVNKYYGTNHVLKNINLAVNKGEVIILL
                     GPSGSGKSTLCRTINRLETTSSGSIHIDGKELPKEGRELAKLRAEVGMVFQSFNLFAH
                     KTILDNVTLGPRRIRKLSKEQAEAEAMELLAKVGVDSQAEKMPAQLSGGQQQRVAIAR
                     ALAMKPKVMLFDEPTSALDPEMVNEVLDTMVSLARDGMTMIVVTHEMGFARKAADRIV
                     FLADGEIVEEATPDEFFTKPKSERARDFLSKIIDH"
     misc_feature    158804..159523
                     /gene="gluA"
                     /locus_tag="HMPREF0733_10135"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    158810..159448
                     /gene="gluA"
                     /locus_tag="HMPREF0733_10135"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    158906..158929
                     /gene="gluA"
                     /locus_tag="HMPREF0733_10135"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    order(158915..158920,158924..158932,159056..159058,
                     159287..159292,159386..159388)
                     /gene="gluA"
                     /locus_tag="HMPREF0733_10135"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    159047..159058
                     /gene="gluA"
                     /locus_tag="HMPREF0733_10135"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    159215..159244
                     /gene="gluA"
                     /locus_tag="HMPREF0733_10135"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    159275..159292
                     /gene="gluA"
                     /locus_tag="HMPREF0733_10135"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    159299..159310
                     /gene="gluA"
                     /locus_tag="HMPREF0733_10135"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    159374..159394
                     /gene="gluA"
                     /locus_tag="HMPREF0733_10135"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            159546..160394
                     /gene="gluB"
                     /locus_tag="HMPREF0733_10136"
                     /db_xref="GeneID:9901388"
     CDS             159546..160394
                     /gene="gluB"
                     /locus_tag="HMPREF0733_10136"
                     /note="COG: COG0834; Pfam: PF00497; InterPro: IPR001638"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="YP_003983028.1"
                     /db_xref="GI:311111806"
                     /db_xref="GeneID:9901388"
                     /translation="MKKSFFNRAATKFFAASTAAALALGFTLTGCSSASDSKPKIRIG
                     IKYDQPGLGYQDGQDYTGFDVDVARYIAGKLGYSEDQIEFVESPSANRENMLSNGQVD
                     MILATYSISDSRKKSVDFAGPYYVAGQDLLVRADETSITGPDSLNGKNLCSVTGSTSA
                     KKIQDTYAKNVNLVKQNSYSDCVVALNGGVVDAVTTDDIILAGLAATKANKGKLKLVG
                     KTFTTEKYGVGLPKGTDKCEAINKAINEMVEDGTWENLVKKHTDGTGYSYNTEKNPPK
                     PSASCA"
     misc_feature    159666..160325
                     /gene="gluB"
                     /locus_tag="HMPREF0733_10136"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    159666..160325
                     /gene="gluB"
                     /locus_tag="HMPREF0733_10136"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    order(159690..159692,159810..159812,159885..159887,
                     160017..160019,160134..160136)
                     /gene="gluB"
                     /locus_tag="HMPREF0733_10136"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(160083..160085,160095..160097,160113..160115)
                     /gene="gluB"
                     /locus_tag="HMPREF0733_10136"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    160215..160232
                     /gene="gluB"
                     /locus_tag="HMPREF0733_10136"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            160415..161098
                     /gene="gluC"
                     /locus_tag="HMPREF0733_10137"
                     /db_xref="GeneID:9901389"
     CDS             160415..161098
                     /gene="gluC"
                     /locus_tag="HMPREF0733_10137"
                     /note="COG: COG0765; Pfam: PF00528; InterPro: IPR000515"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine ABC transporter membrane protein"
                     /protein_id="YP_003983029.1"
                     /db_xref="GI:311111807"
                     /db_xref="GeneID:9901389"
                     /translation="MSFFDQLGALFAKYDVLGAFWVNIQLTFWAAIGSFVLGAILALM
                     RISPVPSLRWAGTIYVHLFRNTPLTILMTLALLGVWTQFQLSFSTDFETNFFVYAVIV
                     LSIYHASFVCEAIRSGVNTVPTGQAEAARAIGLGFMDTARMIIFPQALRGSITPLGNT
                     LIALAKNTTVASVASVAEASGMMKSMIEFDANMVLAIFLIFALGFVAIVVPLGILTTW
                     SSRKLAVKR"
     misc_feature    160415..161095
                     /gene="gluC"
                     /locus_tag="HMPREF0733_10137"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    160472..161050
                     /gene="gluC"
                     /locus_tag="HMPREF0733_10137"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(160520..160525,160532..160537,160550..160552,
                     160580..160591,160595..160624,160631..160636,
                     160640..160642,160727..160732,160736..160738,
                     160742..160744,160751..160756,160760..160762,
                     160772..160777,160784..160786,160835..160837,
                     160877..160882,160889..160891,160910..160921,
                     160928..160933,160967..160972,161000..161005,
                     161012..161017,161021..161026,161033..161038,
                     161045..161050)
                     /gene="gluC"
                     /locus_tag="HMPREF0733_10137"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(160598..160642,160910..160927)
                     /gene="gluC"
                     /locus_tag="HMPREF0733_10137"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(160640..160642,160712..160714,160928..160930,
                     160961..160963,160970..160972,161000..161002)
                     /gene="gluC"
                     /locus_tag="HMPREF0733_10137"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(160787..160825,160841..160846,160856..160858)
                     /gene="gluC"
                     /locus_tag="HMPREF0733_10137"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            161095..162030
                     /gene="gluD"
                     /locus_tag="HMPREF0733_10138"
                     /db_xref="GeneID:9901390"
     CDS             161095..162030
                     /gene="gluD"
                     /locus_tag="HMPREF0733_10138"
                     /note="COG: COG0765; Pfam: PF00528; InterPro: IPR000515"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine ABC transporter permease"
                     /protein_id="YP_003983030.1"
                     /db_xref="GI:311111808"
                     /db_xref="GeneID:9901390"
                     /translation="MKFFNSDVTTSTTVLFDAPGPRAKARTRVFNIAAILVFIAFAVY
                     VLSVMGAKGQLEAEKWTDLFTAKAWGSYYLPGLVSTLQAAGISVITSIAFGVIFGMAR
                     LAQNRVLRWFGTIVVEFFRAVPVLMMMIFFWLFLSRFSWINPSQLPFLAVVIGLTFYN
                     GSVIAELLRSGVKQLPRGQGEAGLAIGLTPGQTLRTILMPQAFNAMMPSMLSQFVVIL
                     KDTALGYIISYPELLASARRIGSGDGNVLQTLLLAAALFVIVNFALTALATWLSSFLA
                     SRTSSKVRKVDLVPGEVDNPNPPTLQMFLLPGKRK"
     misc_feature    161272..161907
                     /gene="gluD"
                     /locus_tag="HMPREF0733_10138"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    161323..161925
                     /gene="gluD"
                     /locus_tag="HMPREF0733_10138"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(161371..161376,161383..161388,161401..161403,
                     161431..161442,161446..161475,161482..161487,
                     161491..161493,161566..161571,161575..161577,
                     161581..161583,161590..161595,161599..161601,
                     161611..161616,161623..161625,161674..161676,
                     161716..161721,161728..161730,161749..161760,
                     161767..161772,161845..161850,161878..161883,
                     161890..161895,161899..161904,161911..161916,
                     161923..161925)
                     /gene="gluD"
                     /locus_tag="HMPREF0733_10138"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(161449..161493,161749..161766)
                     /gene="gluD"
                     /locus_tag="HMPREF0733_10138"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(161491..161493,161551..161553,161767..161769,
                     161839..161841,161848..161850,161878..161880)
                     /gene="gluD"
                     /locus_tag="HMPREF0733_10138"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(161626..161664,161680..161685,161695..161697)
                     /gene="gluD"
                     /locus_tag="HMPREF0733_10138"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(162113..163291)
                     /gene="dapC"
                     /locus_tag="HMPREF0733_10139"
                     /db_xref="GeneID:9901391"
     CDS             complement(162113..163291)
                     /gene="dapC"
                     /locus_tag="HMPREF0733_10139"
                     /EC_number="2.6.1.17"
                     /note="COG: COG0436; Pfam: PF00155; InterPro: IPR004839"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyldiaminopimelate transaminase"
                     /protein_id="YP_003983031.1"
                     /db_xref="GI:311111809"
                     /db_xref="GeneID:9901391"
                     /translation="MRAYGLDLPEYPWETLIPYRKLAAEHPGGTIDLSIGTPVDDTPQ
                     LIQDALTAASDAPGYPTTHGTVELRQAIVDWFARCRGVTGLSTDQVMPTVGSKELVAW
                     LPFLLGLGTDPGTQERDVVVYPRVAYPTYDIGARFAGAQSVPADSLDELPEDVRRRVR
                     LVWVNSPANPNGVVRDVAELREIVRQARDIGAVVASDECYAELGWGAWDEARGGQRVP
                     SILDPRVCDGDFTGLFAAYSLSKQSNLAGYRAAFIAGDAQLMPNLINSRKHAGMIVPA
                     PVQRALIAALGDEAHVAAQKNKYRARREELLAAITAAGGRVENSEAGLYLWTTFGEDT
                     WASIERLAKLGIVAGPGVFYGEDGAGYVRIALTASDEDIAKASERLTASAGIGNAVRE
                     "
     misc_feature    complement(162146..163288)
                     /gene="dapC"
                     /locus_tag="HMPREF0733_10139"
                     /note="N-succinyldiaminopimelate aminotransferase;
                     Reviewed; Region: PRK07865"
                     /db_xref="CDD:236119"
     misc_feature    complement(162152..163201)
                     /gene="dapC"
                     /locus_tag="HMPREF0733_10139"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(162545..162547,162569..162574,
                     162578..162580,162692..162694,162785..162787,
                     162908..162910,163001..163009))
                     /gene="dapC"
                     /locus_tag="HMPREF0733_10139"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(162449..162451,162458..162460,
                     162545..162553,162713..162715,162878..162880,
                     162998..163000))
                     /gene="dapC"
                     /locus_tag="HMPREF0733_10139"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(162569..162571)
                     /gene="dapC"
                     /locus_tag="HMPREF0733_10139"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(163468..163950)
                     /locus_tag="HMPREF0733_10140"
                     /db_xref="GeneID:9901392"
     CDS             complement(163468..163950)
                     /locus_tag="HMPREF0733_10140"
                     /note="COG: COG1146; Pfam: PF00037"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="YP_003983032.1"
                     /db_xref="GI:311111810"
                     /db_xref="GeneID:9901392"
                     /translation="MAVCYDTKICLNALCKLDLYTDFHEVITLVITCAGRRPCRITGQ
                     AHAARFRKAPMTYVIALPCVDVKDRACVEECPVDCIYEGDRTLYIHPDECVDCGACEP
                     VCPVEAIYYEDDVPEEWSEYITANAEFFDDLGSPGGAAKMGPTGKDVPFIAALPPQGE
                     "
     misc_feature    complement(<163636..163842)
                     /locus_tag="HMPREF0733_10140"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:267455"
     misc_feature    complement(163594..163755)
                     /locus_tag="HMPREF0733_10140"
                     /note="Ferredoxin [Energy production and conversion];
                     Region: COG1146"
                     /db_xref="CDD:224069"
     gene            complement(164112..165491)
                     /locus_tag="HMPREF0733_10141"
                     /db_xref="GeneID:9901393"
     CDS             complement(164112..165491)
                     /locus_tag="HMPREF0733_10141"
                     /note="COG: COG2120; Pfam: PF02585; InterPro: IPR003737"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983033.1"
                     /db_xref="GI:311111811"
                     /db_xref="GeneID:9901393"
                     /translation="MPETSAPQYPAQGEHLMKNAKRDLLPSGYTPSEAVMLFVHAHPD
                     DETTATGATMAYYAKKGAKVHLLTLTRGEMGEVIPPKLQHLEVGKPGNSDNGEALGEY
                     RTVELNNATAKLGVRKRFFLGEEPATAPGALNIYRDSGMAWGKDGKPVANPKASEDSL
                     TAQPIAPQAEAIANAIRDIKPDVLITYDLDGGYGHPDHVRTHQAVLEALKILGDSNDR
                     PILTWGIEGEFSEQDARQQCAITGSVEAKREAMKAHGTQIVVTGDTTFEFSNKVEQKI
                     SAVETYRLLDGNAQRKIPETPTQAGIVSLLITCILLGTLAGIAGSIYHAWVMYTGETP
                     LPVGLVFGFATVFFASLWASLALCRGGATVITGAFAFLVIYALAFMRPDSPFVLVNPD
                     YPPIGLYGTLWLLGTPVISLLAFFVFTRTKEGNAFYNTPRQVHLRHRRAEEKARRAQT
                     LNNSSRTAP"
     misc_feature    complement(164586..165383)
                     /locus_tag="HMPREF0733_10141"
                     /note="GlcNAc-PI de-N-acetylase; Region: PIG-L; cl00929"
                     /db_xref="CDD:260701"
     misc_feature    complement(<164208..164615)
                     /locus_tag="HMPREF0733_10141"
                     /note="Transmembrane subunit (TM) of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which are involved in the uptake of
                     branched-chain amino acids (AAs), as well as TMs of
                     transporters involved in the uptake of...; Region:
                     TM_PBP1_branched-chain-AA_like; cl00454"
                     /db_xref="CDD:260432"
     gene            complement(165626..167536)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /db_xref="GeneID:9901394"
     CDS             complement(165626..167536)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="COG: COG1217; Pfam: PF00009,PF03144,PF00679;
                     InterPro: IPR006298"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein TypA/BipA"
                     /protein_id="YP_003983034.1"
                     /db_xref="GI:311111812"
                     /db_xref="GeneID:9901394"
                     /translation="MSENTASRPDLRNVAIVAHVDHGKTTIVDAMLKQTHAFSAHADV
                     EDRVMDSGDLEKEKGITILAKNTTVFYDGPSANGETITINVIDTPGHADFGGEVERGL
                     SMVDGVVLLVDASEGPLPQTRFVLRKALAAKLPVILVVNKVDRSDARIDEVVSETMDL
                     LLGLASDLSEEVPDLDLDSVLDVPVVYASGKAGAASLNQPADGALPDNDDLEPLFKTI
                     IEHVPAPTYNPDEVLQAHVTNLDSSPFLGRLALVRIFNGTLKKGQTVAWARQDGDIKN
                     VRISELLATKALERVPAEEAGPGEIVAVAGIEDITIGETLTDAENPKPLPLIKVDDPA
                     ISMTIGINTSPMAGRVKGAKVTARQVKDRLDRELIGNVSIKVLPTQRPDAWEVQGRGE
                     LALAILVEQMRREGFELTVGKPQVVTKTIDGKLYEPMEHMIIDVPEEHLGAVTQLMAA
                     RKGRMENMSNHGTGWVRMEFAVPARGLIGFRTQFLTETRGAGISSSYSIDPEPWAGDI
                     EYRTNGSMIADRAGVVTPYAMINLQERGTFFVEPTSEVYEGMVVGMNSRADDMEVNIT
                     KEKKLTNMRSSTADSFENLTPPKKLTLEECLEFAREDECVEVTPEAIRIRKVILDANE
                     RVREFRRRARAN"
     misc_feature    complement(166862..167509)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="Tyrosine phosphorylated protein A (TypA)/BipA
                     family belongs to ribosome-binding GTPases; Region:
                     TypA_BipA; cd01891"
                     /db_xref="CDD:206678"
     misc_feature    complement(165668..167506)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="GTP-binding protein TypA/BipA; Region: TypA_BipA;
                     TIGR01394"
                     /db_xref="CDD:233394"
     misc_feature    complement(167462..167485)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="G1 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    complement(order(167069..167071,167081..167083,
                     167189..167194,167261..167266,167339..167344,
                     167438..167443,167450..167452,167459..167464,
                     167474..167476,167480..167482))
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206678"
     misc_feature    complement(order(166964..166972,167105..167107,
                     167111..167116,167459..167476))
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206678"
     misc_feature    complement(167342..167377)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206678"
     misc_feature    complement(167354..167356)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="G2 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    complement(167267..167278)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="G3 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    complement(167216..167272)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206678"
     misc_feature    complement(167105..167116)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="G4 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    complement(166964..166972)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="G5 box; other site"
                     /db_xref="CDD:206678"
     misc_feature    complement(166583..166840)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="BipA_TypA_II: domain II of BipA (also called TypA)
                     having homology to domain II of the elongation factors
                     (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein
                     with global regulatory properties in Escherichia coli.
                     BipA is phosphorylated on a...; Region: BipA_TypA_II;
                     cd03691"
                     /db_xref="CDD:239662"
     misc_feature    complement(166022..166258)
                     /gene="typA"
                     /locus_tag="HMPREF0733_10142"
                     /note="BipA_TypA_C: a C-terminal portion of BipA or TypA
                     having homology to the C terminal domains of the
                     elongation factors EF-G and EF-2. A member of the ribosome
                     binding GTPase superfamily, BipA is widely distributed in
                     bacteria and plants.  BipA is a highly...; Region:
                     BipA_TypA_C; cd03710"
                     /db_xref="CDD:239681"
     gene            complement(167743..168681)
                     /gene="nudC"
                     /locus_tag="HMPREF0733_10143"
                     /db_xref="GeneID:9901395"
     CDS             complement(167743..168681)
                     /gene="nudC"
                     /locus_tag="HMPREF0733_10143"
                     /EC_number="3.6.1.22"
                     /note="COG: COG2816; Pfam: PF00293; InterPro: IPR000086"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(+) diphosphatase"
                     /protein_id="YP_003983035.1"
                     /db_xref="GI:311111813"
                     /db_xref="GeneID:9901395"
                     /translation="MGTGAKTACGRVETMSVQQNLYLVISRRGETLINRDGTVHYLPE
                     APQNTIIETSLEPKFRKPSDREGTDYCAAYLEDEELLALAEDLSRANADAPITASQNG
                     FRFYPVHKDSAGRARYAAALAKRDYLLEMEYSAYSGDPALIDRERQVRRTASGELVFP
                     RIEPAVMALVLSRDGERVLLANNRLWHENRFALIAGFVDPGENLEQAVAREVYEETGL
                     QALNLDYRMSDVWPFPRSLMICYRVTVDDTQPVEHLDGEIRAARWFTAPELAQAIAES
                     EAIRQKQGVPKLELPGTNAVARRMLDDWLHEKNAGR"
     misc_feature    complement(167761..168192)
                     /gene="nudC"
                     /locus_tag="HMPREF0733_10143"
                     /note="NADH pyrophosphatase, a member of the Nudix
                     hydrolase superfamily, catalyzes the cleavage of NADH into
                     reduced nicotinamide mononucleotide (NMNH) and AMP. Like
                     other members of the Nudix family, it requires a divalent
                     cation, such as Mg2+ or Mn2+, for...; Region:
                     NADH_pyrophosphatase; cd03429"
                     /db_xref="CDD:239521"
     misc_feature    complement(order(167968..167970,167974..167976,
                     167980..167982,167989..167991,168091..168099,
                     168187..168189))
                     /gene="nudC"
                     /locus_tag="HMPREF0733_10143"
                     /note="putative NADH binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239521"
     misc_feature    complement(order(167968..167970,167974..167976,
                     167980..167982,167989..167991,168037..168042,
                     168049..168051,168085..168087,168091..168096))
                     /gene="nudC"
                     /locus_tag="HMPREF0733_10143"
                     /note="putative active site [active]"
                     /db_xref="CDD:239521"
     misc_feature    complement(168028..168096)
                     /gene="nudC"
                     /locus_tag="HMPREF0733_10143"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239521"
     misc_feature    complement(order(167911..167913,168037..168042,
                     168049..168051))
                     /gene="nudC"
                     /locus_tag="HMPREF0733_10143"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239521"
     misc_feature    complement(168803..171075)
                     /note="potential frameshift: common BLAST hit:
                     gi|283458736|ref|YP_003363374.1| predicted
                     acyltransferase"
     gene            complement(168803..169522)
                     /locus_tag="HMPREF0733_10144"
                     /db_xref="GeneID:9901396"
     CDS             complement(168803..169522)
                     /locus_tag="HMPREF0733_10144"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983036.1"
                     /db_xref="GI:311111814"
                     /db_xref="GeneID:9901396"
                     /translation="MHESLNTSCAVKQNGDDSAPLTIVVGSSHALQMTAAFEPIAQRT
                     GTNQMNLLETGCPYPFAAPEGYLNDRKKRCIAFSQNATEEILRLKPTTVVIIATTTDT
                     SADAETADPNLDETLRVFTDAGIQVIGLRDNPRFAQDMYVCAIRAQGDKSSCSEPIEQ
                     KYGDNPAAPIFEKYADRGAYLLDLKDIYCPDGLCRSVIGNVYVYADTNHLTKAFEHTL
                     AETIYERALAAGWKPEGYPGS"
     gene            complement(169507..171075)
                     /gene="wbpC"
                     /locus_tag="HMPREF0733_10145"
                     /db_xref="GeneID:9901397"
     CDS             complement(169507..171075)
                     /gene="wbpC"
                     /locus_tag="HMPREF0733_10145"
                     /note="COG: COG1835; Pfam: PF01757; InterPro: IPR002656"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_003983037.1"
                     /db_xref="GI:311111815"
                     /db_xref="GeneID:9901397"
                     /translation="MSGQAFARRAWKFSTTRRIMKTHSRLPYSLQDIFMPINPLRGIR
                     VPVAEHTPPYESFLESRGFRPEIQGLRAFAVLLVMLYHVWIGKVSGGVDVFLFISAFL
                     LSLSFMRKINEGKALNLLAYWTHVFARLLPAAAVVIVLTLAASLAILPALYWNARAVD
                     AQASLFYYQNWNLANGAVNYFAQGISDKSPFQHFWSLSIQGQIFLLWPVLFAVAAFLV
                     HRVRFKPVPAAVTVFGTVFMTSFAFSIWETKQISAYAYFDTRTRLWEFAIGTLLAVMT
                     LKWKPRHVRTRVVMGWVGALGLVTCGAVLPVERTFPGYLALWPVLSGALVMIAGRTDH
                     KFAIDRLLVSTPLQSLGNISYALYLVHWPLLVLYSAAVNKPRVNFLEGTVIIAVSIGL
                     AWVLSTYIEKPLRSRSSVFLDKTVSKLRVTTIFTPTLWVNQLAYVLVILLVIGAPVLS
                     VRAWAQQRDITVIQNTEELVKNDEATYPGARAVGTDQMSRVSKPIPQDIPIYGMLADW
                     GGDAPHPLPPCMNL"
     misc_feature    complement(169798..170898)
                     /gene="wbpC"
                     /locus_tag="HMPREF0733_10145"
                     /note="Predicted acyltransferases [Lipid metabolism];
                     Region: COG1835"
                     /db_xref="CDD:224748"
     gene            171379..173049
                     /gene="pgi"
                     /locus_tag="HMPREF0733_10146"
                     /db_xref="GeneID:9901398"
     CDS             171379..173049
                     /gene="pgi"
                     /locus_tag="HMPREF0733_10146"
                     /EC_number="5.3.1.9"
                     /note="COG: COG0166; Pfam: PF00342; InterPro: IPR001672"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="YP_003983038.1"
                     /db_xref="GI:311111816"
                     /db_xref="GeneID:9901398"
                     /translation="MTITNPTTTSAWSALTQHKASLTPNLRAWFEQDPSRAQKLSFDA
                     ADLHVDLSKNLVTEETVQLLLKLAEEVNLAERRDAMFTGEHINVTEDRAVLHTALRRP
                     KGYSPALVVDGQDVDSDVHAVLNKIYAFADRVRSGEWTGVSGKRIETVVNIGIGGSDL
                     GPVMVYEALKPYADAGISARFISNIDPTDVAEKVSDLNPETTLFIVASKTFGTLETLT
                     NARVARDWLLTALGEANALQGKTAEEAVAKHFIAVSTALDKVAAFGIDPENAFGFWDW
                     VGGRYSVDSAIGTSLAIVFGPKVFEEFLAGFHAMDEHFRTAPFEKNVPVLMGLLNVWY
                     VNFLGAETHAVLPYDQYLHRFPAYLQQLTMESNGKSVRADGSFVDYSTGEVFWGEPGT
                     NGQHAFYQLLHQGTRLIPADFLAFANPAHPTKDGEQDVHELFLANFFAQTQALAFGKT
                     EDEVRAEGTAEHVVNARIFSGNRPSTSIMASRLTPRVLGELIALYEHITFVQGIVWGI
                     DSFDQWGVELGKKLALDLVPAIKGDREVLARQDSSTASLIDYYLKHRK"
     misc_feature    171388..173046
                     /gene="pgi"
                     /locus_tag="HMPREF0733_10146"
                     /note="glucose-6-phosphate isomerase; Reviewed; Region:
                     pgi; PRK00179"
                     /db_xref="CDD:234679"
     misc_feature    171739..172257
                     /gene="pgi"
                     /locus_tag="HMPREF0733_10146"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the first SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_1; cd05015"
                     /db_xref="CDD:240146"
     misc_feature    order(171841..171843,171847..171852,172000..172008,
                     172015..172017,172213..172215)
                     /gene="pgi"
                     /locus_tag="HMPREF0733_10146"
                     /note="active site"
                     /db_xref="CDD:240146"
     misc_feature    order(171925..171936,172021..172023,172033..172035,
                     172042..172044)
                     /gene="pgi"
                     /locus_tag="HMPREF0733_10146"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240146"
     misc_feature    172399..172947
                     /gene="pgi"
                     /locus_tag="HMPREF0733_10146"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the second SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_2; cd05016"
                     /db_xref="CDD:240147"
     misc_feature    order(172399..172401,172423..172425,172459..172461,
                     172471..172473,172480..172485,172543..172545,
                     172549..172557,172564..172569,172576..172581,
                     172588..172590,172666..172668,172672..172674,
                     172696..172698,172705..172707)
                     /gene="pgi"
                     /locus_tag="HMPREF0733_10146"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240147"
     misc_feature    order(172459..172461,172471..172473)
                     /gene="pgi"
                     /locus_tag="HMPREF0733_10146"
                     /note="active site"
                     /db_xref="CDD:240147"
     gene            complement(173159..173833)
                     /gene="pcp"
                     /locus_tag="HMPREF0733_10147"
                     /db_xref="GeneID:9901399"
     CDS             complement(173159..173833)
                     /gene="pcp"
                     /locus_tag="HMPREF0733_10147"
                     /EC_number="3.4.19.3"
                     /note="COG: COG2039; Pfam: PF01470; InterPro: IPR000816"
                     /codon_start=1
                     /transl_table=11
                     /product="pyroglutamyl-peptidase I"
                     /protein_id="YP_003983039.1"
                     /db_xref="GI:311111817"
                     /db_xref="GeneID:9901399"
                     /translation="MTKTLLITYFGPFPGVSVNPSGVTARQVADVLANESAVRVITRE
                     VPVSYTGSSEALGEMLTDIRPDAVLSLGVAVGRDKVSFEKVAINLDSADIEDNDGVVR
                     VDEAIAPDGREAYFSTLPVRASYERLRGVGLPVEISYTAGTYVCNHVFYEAHRILELQ
                     GRRIPAGFVHIPATRVDHEPADAQTTLTAHADAGGVESESVPTLPEAVVARIVAELVR
                     DTLKVM"
     misc_feature    complement(173312..173827)
                     /gene="pcp"
                     /locus_tag="HMPREF0733_10147"
                     /note="Pyroglutamyl peptidase (PGP) type I, also known as
                     pyrrolidone carboxyl peptidase (pcp) type I:  Enzymes
                     responsible for cleaving pyroglutamate (pGlu) from the
                     N-terminal end of specialized proteins. The N-terminal
                     pGlu protects these proteins from...; Region:
                     Peptidase_C15; cd00501"
                     /db_xref="CDD:238279"
     misc_feature    complement(order(173396..173404,173693..173695,
                     173795..173797,173804..173806))
                     /gene="pcp"
                     /locus_tag="HMPREF0733_10147"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:238279"
     misc_feature    complement(order(173426..173440,173447..173449,
                     173597..173605))
                     /gene="pcp"
                     /locus_tag="HMPREF0733_10147"
                     /note="AC domain interface; other site"
                     /db_xref="CDD:238279"
     misc_feature    complement(order(173324..173326,173396..173398,
                     173585..173587))
                     /gene="pcp"
                     /locus_tag="HMPREF0733_10147"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238279"
     misc_feature    complement(order(173405..173407,173414..173419,
                     173468..173470,173486..173497,173522..173527,
                     173555..173557,173561..173563,173567..173569,
                     173579..173584))
                     /gene="pcp"
                     /locus_tag="HMPREF0733_10147"
                     /note="AB domain interface; other site"
                     /db_xref="CDD:238279"
     gene            173870..174289
                     /locus_tag="HMPREF0733_10148"
                     /db_xref="GeneID:9901400"
     CDS             173870..174289
                     /locus_tag="HMPREF0733_10148"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983040.1"
                     /db_xref="GI:311111818"
                     /db_xref="GeneID:9901400"
                     /translation="MARTHRHKEEPVFLLQDTPDALREIGVDDEQEALAAVREPAQAL
                     EGASFLQAVGRFYRFYTLGRGHASRSEVLWALLYLILTTGVVLGLTVYLGMLSEDPHM
                     ESLIRVLYMLMMTLTPVWIIVHILPLSSLLSRARGKN"
     gene            complement(174386..174931)
                     /locus_tag="HMPREF0733_10149"
                     /db_xref="GeneID:9901401"
     CDS             complement(174386..174931)
                     /locus_tag="HMPREF0733_10149"
                     /note="COG: COG1611; Pfam: PF03641; InterPro: IPR005269"
                     /codon_start=1
                     /transl_table=11
                     /product="decarboxylase"
                     /protein_id="YP_003983041.1"
                     /db_xref="GI:311111819"
                     /db_xref="GeneID:9901401"
                     /translation="MRDSFNLAVYCGATMGNDPDFAACARELGTLCAKRGVGVVYGGG
                     RTGLMGTVAGATLDAGGKVYGVVTHQLVEWEGVYPGQTTLDIVDTMHQRKIAMINKAD
                     AFVAMPGGPGTLEEFFEVFSWQFLKIHTKPVALLNVNGYWDKLVEAMQYMASTELLRP
                     SYLERLIVVDTPEELMKVLGK"
     misc_feature    complement(174401..174787)
                     /locus_tag="HMPREF0733_10149"
                     /note="Possible lysine decarboxylase; Region:
                     Lysine_decarbox; pfam03641"
                     /db_xref="CDD:252079"
     gene            complement(175092..175568)
                     /locus_tag="HMPREF0733_10150"
                     /db_xref="GeneID:9901402"
     CDS             complement(175092..175568)
                     /locus_tag="HMPREF0733_10150"
                     /note="COG: COG0494; Pfam: PF00293; InterPro: IPR000086"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX family hydrolase"
                     /protein_id="YP_003983042.1"
                     /db_xref="GI:311111820"
                     /db_xref="GeneID:9901402"
                     /translation="MVDEHSAIDTAQRIVHVSAVVIRNHAGHVLTVRKAASHGFMMPG
                     GKPDAGESPLYTAVREVTEELGFAPDPAQMVYLGKFDAPALNESGFVVRAETFEYMPH
                     PQEEKILEQLSPHAEIAELRWVDPAADYTDQAPLNTECIFPLICRISPGETPSVPL"
     misc_feature    complement(175152..175520)
                     /locus_tag="HMPREF0733_10150"
                     /note="Members of the Nudix hydrolase superfamily catalyze
                     the hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+, for their
                     activity and contain a highly...; Region:
                     Nudix_Hydrolase_31; cd04690"
                     /db_xref="CDD:240046"
     misc_feature    complement(175368..175436)
                     /locus_tag="HMPREF0733_10150"
                     /note="nudix motif; other site"
                     /db_xref="CDD:240046"
     gene            complement(175611..175988)
                     /locus_tag="HMPREF0733_10151"
                     /db_xref="GeneID:9901403"
     CDS             complement(175611..175988)
                     /locus_tag="HMPREF0733_10151"
                     /EC_number="2.1.1.107"
                     /note="COG: COG3189; Pfam: PF04343; InterPro: IPR007438"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_003983043.1"
                     /db_xref="GI:311111821"
                     /db_xref="GeneID:9901403"
                     /translation="MDIVIKRIYEEPSPDDGYRVLVDRLWPRGVSKDKAHLDEWAKDL
                     APSTEARRDFGHKPENFESFKQRYLNELDSNSEVYPELERMVAGAQKLQSSRVTLLYG
                     AKSPTCNHAVILRDYLIDRLKSL"
     misc_feature    complement(175635..175985)
                     /locus_tag="HMPREF0733_10151"
                     /note="Protein of unknown function, DUF488; Region:
                     DUF488; cl01246"
                     /db_xref="CDD:260852"
     gene            complement(176741..178240)
                     /gene="lysP"
                     /locus_tag="HMPREF0733_10152"
                     /db_xref="GeneID:9901404"
     CDS             complement(176741..178240)
                     /gene="lysP"
                     /locus_tag="HMPREF0733_10152"
                     /note="COG: COG0833; Pfam: PF00324; InterPro: IPR002293"
                     /codon_start=1
                     /transl_table=11
                     /product="APC family lysine-specific permease"
                     /protein_id="YP_003983044.1"
                     /db_xref="GI:311111822"
                     /db_xref="GeneID:9901404"
                     /translation="MAQTSQQSSPASDASDVAADTDLKRGLSARHMQMIAIGGAIGTG
                     LFVASGKTISTAGPGGAIVAYGLIGIMVLFLMQSLGEMAAHLPVPGSFQTYATRYVSS
                     SFGFAMGWNYWFNWAITVAAELVAVGEVMKYWLPETPSWVWAGIFLVLLTGLNALSAK
                     AYGEGEFWLATIKVVTVIVFLIAGIAMIFGVLGGASPGTSNWTTGEAPFVGGPVAIFA
                     IFMVAGFSFQGTEMIGIAAGESKNPRRDVPRALTSVFWRIMLFYIGAMVVIGFLIPYT
                     DPNLLTAAEGDINISPFTLIFERAGIAFAAAAMNAVILTAVLSAGNSGLYVSARMLFS
                     LAQEGKAPKIFTKVNKGGVPMPALMATSAVGAIGFIASVISPDAAYLWLVNVSGLAGF
                     ITWVGIAVAHYRFRRAYMRQGHNLNDLPYTAPFFPVGPIIAFIMCLLVIGGQNYEAIL
                     AGDWVGVMSSYIGLPVFVAVWAIHAIVTRDRLIPLEQVDVSGLEVKTSK"
     misc_feature    complement(176768..178228)
                     /gene="lysP"
                     /locus_tag="HMPREF0733_10152"
                     /note="Amino acid transporters [Amino acid transport and
                     metabolism]; Region: LysP; COG0833"
                     /db_xref="CDD:223903"
     gene            178278..178409
                     /locus_tag="HMPREF0733_10153"
                     /db_xref="GeneID:9901405"
     CDS             178278..178409
                     /locus_tag="HMPREF0733_10153"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983045.1"
                     /db_xref="GI:311111823"
                     /db_xref="GeneID:9901405"
                     /translation="MSHSHQLSYGVPSISKPEDLMYVSSEETPLRHPEVFLMMPKFF"
     gene            complement(178580..181282)
                     /locus_tag="HMPREF0733_10154"
                     /db_xref="GeneID:9901406"
     CDS             complement(178580..181282)
                     /locus_tag="HMPREF0733_10154"
                     /note="Pfam: PF01391; InterPro: IPR008160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983046.1"
                     /db_xref="GI:311111824"
                     /db_xref="GeneID:9901406"
                     /translation="MTSHQRKSPGIKKALVTTGTAASLLGASFVAMPATFANVPDQVP
                     TSPACDCQPGQPGQPGQGGQGQTGQPGTPGDNGQTSTPGGGNGQTGDNGQPGQGGQGQ
                     TGQPGDHDSDHPDTPDTPDTPDTPGDHDSDQPGTPGQGGQGQTGQPGTPGQGGQGQTG
                     DNGQPGTPAQPGTPGQGGQGQTGQPGTPGQGGQGQTGQPGTPGQGGQGQTGQPGTPGQ
                     GGQGQTGQPGTPGQGGQGQTGQPGTPGQGGQGQTGQPGTPGQGGQGQTGQPGTPGQGG
                     QGQTGQPGTPGQGGQGQTGQPGTPGQGGQGQTGDNGQPGTPAQPGTPGNNGGNGGDGI
                     GGNGGNVTPGTPGQPGTPGNNGGNGGNGIGGNGGNVNPGTPGQPGTPGGNNGGNGGNG
                     IGGNGGNVNPGTPGQPGTPGGNNGGNGGNGIGGNGGNVNPGTPGQPGTPGGNNGGNGG
                     DGIGGNGGNVTPGTPGQPGTPGEPGQPGQPGQPGQPGQPGQPGQPGTPGEPGQPGQPG
                     QPGQPGQPGQPGTPGEPGQPGQPGQPGTPGEPGQPGQPGTPDPSLPDNNKGGGDWNIG
                     GGGYYEGDFNLNGHYQGGWDFGATVPGWGQWDNGGDDCFQGGGNFFQVTPGENNAVTP
                     APNGHGGLGWVGDNATPNTPGNAGNTPAPNGHGGLGQTGDTPQSVAPDTTGQGGLGQV
                     GGNTTTETGQATGSESQGAQFGQLSESYTRTSEGEILQEQQRHQDHGGLGLTADNDSD
                     NGRGGLGQTGDNRAPQRQGTVTISNDVDIDLNAGAVSRGSEAVNTNASEDVNGGGAGL
                     VGNGSENNNGGGAGLVGNAPNVNGGGAGLVGDNGNGGSAQVNGGGNAAVNQATQADNG
                     SSASSQKSGSLAHTGVSGVLFAAGLGLLSLMTGLVVLLTRRNKA"
     gene            complement(181793..182467)
                     /locus_tag="HMPREF0733_10155"
                     /db_xref="GeneID:9901407"
     CDS             complement(181793..182467)
                     /locus_tag="HMPREF0733_10155"
                     /note="Pfam: PF03575; InterPro: IPR005320"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase E"
                     /protein_id="YP_003983047.1"
                     /db_xref="GI:311111825"
                     /db_xref="GeneID:9901407"
                     /translation="METQRTIVLLSGGFSDGENTDQDVFLLESSMRRKPRVCFIPTAS
                     GDSRAYIERFYTAFKRYSCIPAHLELFRRTEPNLEEFIRRQDIIYVGGGNTANLLAVW
                     RLHGLDRVLRKAYVEGTVLSGISAGAACWFESCLTDSFGGLEALNDGLGILPGSFCSH
                     FNTEPGRPRSFLQTLQSGTLPPGVALDDGAAARYCNEVVDVVYRSVSNAGLYNQTAKG
                     ICAVEL"
     misc_feature    complement(181871..182452)
                     /locus_tag="HMPREF0733_10155"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in peptidase E; Region: GAT1_Peptidase_E;
                     cd03146"
                     /db_xref="CDD:153240"
     misc_feature    complement(order(181904..181906,181988..181990,
                     182051..182053,182093..182095,182189..182191))
                     /locus_tag="HMPREF0733_10155"
                     /note="active site pocket [active]"
                     /db_xref="CDD:153240"
     misc_feature    complement(order(182090..182092,182189..182191))
                     /locus_tag="HMPREF0733_10155"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:153240"
     misc_feature    complement(order(181904..181906,181988..181990,
                     182093..182095))
                     /locus_tag="HMPREF0733_10155"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153240"
     misc_feature    complement(182093..182095)
                     /locus_tag="HMPREF0733_10155"
                     /note="active site nucleophile [active]"
                     /db_xref="CDD:153240"
     gene            complement(182598..182774)
                     /locus_tag="HMPREF0733_10156"
                     /db_xref="GeneID:9901408"
     CDS             complement(182598..182774)
                     /locus_tag="HMPREF0733_10156"
                     /note="Pfam: PF03575; InterPro: IPR005320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983048.1"
                     /db_xref="GI:311111826"
                     /db_xref="GeneID:9901408"
                     /translation="MALSVLLRILSFFRRTEPNLEEFIRRQDIIYVGGGNTANLLAAW
                     RLHGLSYGGVSNEG"
     misc_feature    complement(<182628..182768)
                     /locus_tag="HMPREF0733_10156"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain; Region: GAT_1; cl00020"
                     /db_xref="CDD:260141"
     gene            182890..183546
                     /locus_tag="HMPREF0733_10157"
                     /db_xref="GeneID:9901409"
     CDS             182890..183546
                     /locus_tag="HMPREF0733_10157"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983049.1"
                     /db_xref="GI:311111827"
                     /db_xref="GeneID:9901409"
                     /translation="MIIIITVAIAIFYLTYDAVRRSREKKLPYVFKRKYHQLEGWLNV
                     TALGLTIDALIIPWDMAWTGTWNTILFGGTALLSANFLYAYEMEYFSIHSDGTIKYHT
                     RTGKIITTHFNCINKYSYSPWGKNFRGGEDISFPDIFHLRTRDDKTAAKFSIKATKEY
                     SIAAHVIFRQEKGRWAHIHSSEDQAQIEEILHDKKAIIQYLTENPQGTDLADDSAHYM
                     "
     misc_feature    183007..>183165
                     /locus_tag="HMPREF0733_10157"
                     /note="Threonine/homoserine efflux transporter [Amino acid
                     transport and metabolism]; Region: rhtA; COG5006"
                     /db_xref="CDD:227339"
     gene            complement(183662..184126)
                     /locus_tag="HMPREF0733_10158"
                     /db_xref="GeneID:9901410"
     CDS             complement(183662..184126)
                     /locus_tag="HMPREF0733_10158"
                     /note="Pfam: PF02566; InterPro: IPR003718"
                     /codon_start=1
                     /transl_table=11
                     /product="redox protein"
                     /protein_id="YP_003983050.1"
                     /db_xref="GI:311111828"
                     /db_xref="GeneID:9901410"
                     /translation="MNKAPAEKTIVRRESEDYREVRVERVDRLRYRAHGANGATLDFG
                     VGDGLLTPVELLLAAIAGCSSVDVDAVTTRREIPQVFEVLASALKKHEDGAVRLDDVE
                     VDFDVQFPETEAGTQAAKMVDRLIRLSAEKDCTVSRTVEHPTKVEFHNVNAE"
     misc_feature    complement(183680..183991)
                     /locus_tag="HMPREF0733_10158"
                     /note="OsmC-like protein; Region: OsmC; pfam02566"
                     /db_xref="CDD:251379"
     gene            184298..185173
                     /gene="azlC"
                     /locus_tag="HMPREF0733_10159"
                     /db_xref="GeneID:9901411"
     CDS             184298..185173
                     /gene="azlC"
                     /locus_tag="HMPREF0733_10159"
                     /note="COG: COG1296; Pfam: PF03591; InterPro: IPR011606"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transporter"
                     /protein_id="YP_003983051.1"
                     /db_xref="GI:311111829"
                     /db_xref="GeneID:9901411"
                     /translation="MKDTAKETSDAEHYAAIGHNPTESGFKQALRASSVVLASFVVLG
                     LGLGVIISAHHLPWWLAPAISLIVYAGSVEFLVVEMIATGASVGAIGFTTLLVNSRHL
                     VYGISFPLQNVKGFWAKLYAIYTLCDESYALNTGPNRNTLSHARILWVSTFLHISWVA
                     GTTAGFFIGASFLSHLEGMDFAMTALFTILAIDAYRAQRDNVTALLTLISGAVGIILA
                     PGSMLLVSMGTYTALLIVRFFIAKSRGTLPEHQIPAPENNASLTVAEDSTTDQVKTPS
                     PTFTHYTDPQENPHD"
     misc_feature    184352..184975
                     /gene="azlC"
                     /locus_tag="HMPREF0733_10159"
                     /note="Predicted branched-chain amino acid permease
                     (azaleucine resistance) [Amino acid transport and
                     metabolism]; Region: AzlC; COG1296"
                     /db_xref="CDD:224215"
     gene            185166..185504
                     /gene="azlD"
                     /locus_tag="HMPREF0733_10160"
                     /db_xref="GeneID:9901412"
     CDS             185166..185504
                     /gene="azlD"
                     /locus_tag="HMPREF0733_10160"
                     /note="Pfam: PF05437; InterPro: IPR008407"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transporter AzlD"
                     /protein_id="YP_003983052.1"
                     /db_xref="GI:311111830"
                     /db_xref="GeneID:9901412"
                     /translation="MINGHIDSGYIISAVLVAAAVTFVLRVLPFGLKKALAGSEVLDA
                     LSHWIPLGAVALLAIYAVSRIDFSSTHTAVPYLAGFVVTALVHLWKKNMVYSMIAGTA
                     TCVILINWVF"
     misc_feature    185193..185501
                     /gene="azlD"
                     /locus_tag="HMPREF0733_10160"
                     /note="Branched-chain amino acid transport protein (AzlD);
                     Region: AzlD; cl00735"
                     /db_xref="CDD:260597"
     gene            185514..186467
                     /locus_tag="HMPREF0733_10161"
                     /db_xref="GeneID:9901413"
     CDS             185514..186467
                     /locus_tag="HMPREF0733_10161"
                     /note="Pfam: PF03591; InterPro: IPR011606"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transport protein"
                     /protein_id="YP_003983053.1"
                     /db_xref="GI:311111831"
                     /db_xref="GeneID:9901413"
                     /translation="MFERSSHPNRHLGEAPQQTSDEQVLDIIASAGLATSSIPVVQER
                     EQALRAGDDALSLELRRTGESGFREAMRVASLVMLGLFFVGIGLGVVIHSLGFPWWLA
                     PLLPGVLFAGSVEFVLLTMMAAGASLVSVAVMTLLINSRHLMYGLSYPIERVHGSLAK
                     FYTVYTLIDEAFALNSGPERHTLRGSRILWIHAGMHVSVILSSTLGFFLGSSFLAHLE
                     GFDFVMTALFTVLALDAYRANPDRLTVLFSVIAAAVALIIAPGSMLLVAMAVYMALLV
                     GRYAAAKKRGSLPQHMLVADELTHHRTEHDRAEETPHEPAQ"
     misc_feature    185712..186371
                     /locus_tag="HMPREF0733_10161"
                     /note="AzlC protein; Region: AzlC; cl00570"
                     /db_xref="CDD:260507"
     gene            complement(186546..187127)
                     /gene="tpx"
                     /locus_tag="HMPREF0733_10162"
                     /db_xref="GeneID:9901414"
     CDS             complement(186546..187127)
                     /gene="tpx"
                     /locus_tag="HMPREF0733_10162"
                     /EC_number="1.11.1.-"
                     /note="COG: COG2077; Pfam: PF08534; InterPro: IPR012335"
                     /codon_start=1
                     /transl_table=11
                     /product="thiol peroxidase"
                     /protein_id="YP_003983054.1"
                     /db_xref="GI:311111832"
                     /db_xref="GeneID:9901414"
                     /translation="MYDETARPGSYATVPLAQRQRTRDNEEMAEITFQNNLAVHTSGN
                     LPAIGSKVPAFSVLDADLAEVTGAQFSGKNLVLNIFPSVDTGVCAASVRNFNKEAAGL
                     DNTVVVNVSHDLPFALGRFCAAEGIENVVTTSAFRSSFGQDFGVTMTDGPLEGLLARA
                     VVVVNPAGEVVYTELVPEITNEPNYEAALAALK"
     misc_feature    complement(186555..186989)
                     /gene="tpx"
                     /locus_tag="HMPREF0733_10162"
                     /note="Peroxiredoxin (PRX) family, Atypical 2-cys PRX
                     subfamily; composed of PRXs containing peroxidatic and
                     resolving cysteines, similar to the homodimeric thiol
                     specific antioxidant (TSA) protein also known as
                     TRX-dependent thiol peroxidase (Tpx). Tpx is a...; Region:
                     PRX_Atyp2cys; cd03014"
                     /db_xref="CDD:239312"
     misc_feature    complement(order(186663..186668,186720..186722,
                     186768..186770,186786..186791,186876..186878,
                     186882..186884))
                     /gene="tpx"
                     /locus_tag="HMPREF0733_10162"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239312"
     misc_feature    complement(order(186651..186653,186864..186866,
                     186873..186875))
                     /gene="tpx"
                     /locus_tag="HMPREF0733_10162"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:239312"
     misc_feature    complement(order(186762..186764,186864..186866))
                     /gene="tpx"
                     /locus_tag="HMPREF0733_10162"
                     /note="peroxidatic and resolving cysteines [active]"
                     /db_xref="CDD:239312"
     gene            187296..187937
                     /locus_tag="HMPREF0733_10163"
                     /db_xref="GeneID:9901415"
     CDS             187296..187937
                     /locus_tag="HMPREF0733_10163"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983055.1"
                     /db_xref="GI:311111833"
                     /db_xref="GeneID:9901415"
                     /translation="MSRFPVKPLVFCAGAALLLSSCGNPFGASTDSGSSSQAARSSSS
                     SSSSSASTSASHSPTASATSSSASPSPSVSVVTVTANPQPEASTVTVTASSNSNSGSS
                     SSSGRLALDSNASKLRGHHSWSLSSADTSTFDSSAELSWITVGSSDGASHIMLFHHGD
                     YLGTGTLNPVQGSPSVSRNSANQISASVGSSQATFTWDSAQEKIVMNGDLPTG"
     misc_feature    187683..187901
                     /locus_tag="HMPREF0733_10163"
                     /note="LppP/LprE lipoprotein; Region: Lipoprotein_21;
                     pfam14041"
                     /db_xref="CDD:258275"
     gene            188399..188815
                     /locus_tag="HMPREF0733_10164"
                     /db_xref="GeneID:9901416"
     CDS             188399..188815
                     /locus_tag="HMPREF0733_10164"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="YP_003983056.1"
                     /db_xref="GI:311111834"
                     /db_xref="GeneID:9901416"
                     /translation="MSLKKNVSEDSRSGGKKHIAPVVTAGFLGTTGVLHFAKPEHYDA
                     IVPRALPGSARFYTYASGAAELGIAGLLTVPTTRRAGALAAIALYTAVFPANVQMAWD
                     WRHESAFKRVVAFGRLPLQLPMIRRAWRIYKTSSRR"
     misc_feature    188462..188809
                     /locus_tag="HMPREF0733_10164"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4270"
                     /db_xref="CDD:226720"
     gene            188895..189590
                     /locus_tag="HMPREF0733_10165"
                     /db_xref="GeneID:9901417"
     CDS             188895..189590
                     /locus_tag="HMPREF0733_10165"
                     /note="Pfam: PF08241; InterPro: IPR013216"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="YP_003983057.1"
                     /db_xref="GI:311111835"
                     /db_xref="GeneID:9901417"
                     /translation="MSSTRQNPAEQAKALASQLKCPMGDTGQELAHSLNLGNLPMIVS
                     ALNALGIEEDDRILEAGPGNGGLLNYVLSLAENLHYDGVEISPLMYEQARAANNVFIA
                     EGLAEYALYDGVNLPYEDGIFTKVLSVNTVYFWEEPAWLLAEMCRVLTAGGRVCLSFC
                     EKDFMKTLPFTKYGFALYDAADIVALTQELPLHTVAVQHLHDMAVAGGSARLVRRDYV
                     NLVFKKETISSTT"
     misc_feature    189060..189371
                     /locus_tag="HMPREF0733_10165"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(189072..189092,189144..189149,189204..189212,
                     189279..189281)
                     /locus_tag="HMPREF0733_10165"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            189612..190046
                     /locus_tag="HMPREF0733_10166"
                     /db_xref="GeneID:9901418"
     CDS             189612..190046
                     /locus_tag="HMPREF0733_10166"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983058.1"
                     /db_xref="GI:311111836"
                     /db_xref="GeneID:9901418"
                     /translation="MVVPFVMAGVLMALAFGAHIFVGTRETLSLRPVAHPANTENMVR
                     VPANHTELSRHWTQAMCAFQLVSIDLLLITIVTFLLAFTDLLPAKREIGLFIAAYLGA
                     WGFVWLVQLAAVKVERRTYYMLGQWMLFFLCAALMVWGSLAL"
     gene            190133..190933
                     /locus_tag="HMPREF0733_10167"
                     /db_xref="GeneID:9901419"
     CDS             190133..190933
                     /locus_tag="HMPREF0733_10167"
                     /note="Pfam: PF08241; InterPro: IPR013216"
                     /codon_start=1
                     /transl_table=11
                     /product="UbiE/COQ5 family methyltransferase"
                     /protein_id="YP_003983059.1"
                     /db_xref="GI:311111837"
                     /db_xref="GeneID:9901419"
                     /translation="MFLTADIVLDYHQSESYIMSTTLLDKLKPEFRTNPPAEENGILL
                     CLDEAQIQGDNAKYMKFYNRLASVYDLGERWFGRLAYGNEVAQMRQQFMKELEWFPGC
                     SALYVSIGTGTDLRYLPDDIEVSAIDWTGADISLGMLKKCQKIWGGRANLNLVNCAAE
                     DLPFIDQSFDVVLHVGGINFFSDKKRAIKEMIRVAKPGTKIMIADETSDYIDSQYKKN
                     VLTRKAYKNATFDLSEIEALIPEDMEDASTSLLWNDQFYCITFRVPQD"
     misc_feature    190460..190753
                     /locus_tag="HMPREF0733_10167"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(190460..190471,190514..190516,190532..190534,
                     190601..190609,190655..190657)
                     /locus_tag="HMPREF0733_10167"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(191088..191699)
                     /locus_tag="HMPREF0733_10168"
                     /db_xref="GeneID:9901420"
     CDS             complement(191088..191699)
                     /locus_tag="HMPREF0733_10168"
                     /EC_number="3.4.11.2"
                     /note="COG: COG3340; Pfam: PF03575; InterPro: IPR005320"
                     /codon_start=1
                     /transl_table=11
                     /product="S51 family peptidase"
                     /protein_id="YP_003983060.1"
                     /db_xref="GI:311111838"
                     /db_xref="GeneID:9901420"
                     /translation="MMRAFLCSYFAGVEPAFKNFLRGNPSQQQVVFIPTASTVENTTF
                     YVQDALNVFKNLGLTPDILDIAEVDSETAKLRIEQAEVLYISGGNTFYLLQQLKSKDL
                     INFIVEKVRHGMMYVGESAGAMVASPDIEYARVMDDSDAALGMFNFKALGIVDFYPAV
                     HEEEEPFVQAVRRMKSEYSDKLDLVPINNRRAIRVEGGVRFIV"
     misc_feature    complement(191091..191669)
                     /locus_tag="HMPREF0733_10168"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in peptidase E_like proteins; Region:
                     GAT1_Peptidase_E_like; cd03129"
                     /db_xref="CDD:153223"
     misc_feature    complement(order(191133..191135,191217..191219,
                     191340..191342))
                     /locus_tag="HMPREF0733_10168"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153223"
     misc_feature    complement(191340..191342)
                     /locus_tag="HMPREF0733_10168"
                     /note="active site nucleophile [active]"
                     /db_xref="CDD:153223"
     gene            complement(191851..193089)
                     /locus_tag="HMPREF0733_10169"
                     /db_xref="GeneID:9901421"
     CDS             complement(191851..193089)
                     /locus_tag="HMPREF0733_10169"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983061.1"
                     /db_xref="GI:311111839"
                     /db_xref="GeneID:9901421"
                     /translation="MEYKMSNTRFILTGVGALALLGASVVPSVPSFAAEGNAGAQTQQ
                     AISTLPGGQNTGTNNTNGNNTNINTGAKVTSVEGGPLNPLTGQNNLTITGEGIDLNKS
                     FDGLGAEVYEVDADGDFTGENLVQDGGGLVVTEDGHFRGTAKVKGDFDPQKHYVLYIM
                     SYPGHGNRTIEAKQDLPVQQVDSKDLQSSVTLTTNSSKTNMLSSHLNTNVLTLTGTHF
                     DDVKQVKIKVEGLDENGQVNETLATKDVSAEMKNGNFTTQIQIPGSKIQEGKHYRVLI
                     ESSSDDWVRAVTKDLYGDTDDEVVGIINGAPLSRSAAENHLKVAGGGFNPAAAAQNGS
                     KVRLIFTEYNVELDDPSSDEIVNTTVTPKPNGDFEGDLTIPGNKLQAGKKYVVRAYLE
                     YADGGVASDITLKTLVPTTN"
     gene            complement(193362..194450)
                     /locus_tag="HMPREF0733_10170"
                     /db_xref="GeneID:9901422"
     CDS             complement(193362..194450)
                     /locus_tag="HMPREF0733_10170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983062.1"
                     /db_xref="GI:311111840"
                     /db_xref="GeneID:9901422"
                     /translation="MEFMMAFRYSRSAMTGAAIFTLAGVTVLPLAQANAAPASPQDEA
                     RSGSTQGQPNSAAQNGQDQGQQQSANANGQDQQGANASGQNQDGATQGQQQSANGQGR
                     QQGANADAQGQQGANASDQSQNGATQGGAAQDPSQAASGGEQQQGQPSASQDQQGTNA
                     SGQGRQQGANADAQGQQAQPGATQDQQQSANANANGQGQQAQGQQQGAPASQSSSNSN
                     SASQNNQSRQSQPSAPANQNSGFIAITSVDGFIDPQNTDNVLSVETTGIDNTHRVQYE
                     PRVQELDEFGNIVNDDVSNGGGSSLGSDGSFGMYVSVDGTKINPNHQYRVYIDVFDQD
                     TLTASYAYYPIVVWNRTYIPVVPLSAAQ"
     misc_feature    complement(<193878..194384)
                     /locus_tag="HMPREF0733_10170"
                     /note="transcription termination factor Rho; Provisional;
                     Region: PRK12678"
                     /db_xref="CDD:237171"
     gene            complement(195198..195854)
                     /locus_tag="HMPREF0733_10171"
                     /db_xref="GeneID:9901423"
     CDS             complement(195198..195854)
                     /locus_tag="HMPREF0733_10171"
                     /note="Pfam: PF00440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983063.1"
                     /db_xref="GI:311111841"
                     /db_xref="GeneID:9901423"
                     /translation="MIDSSKPLRADARRTVNIVLHAAEQVLRRDPTASLEQVATVAGV
                     TRTTIHRRFASREALLAELSNIAVREFYEAFESASPETAPVMVALHRLTVNVMRVKAI
                     WLYAMAHLSDDDPAVITKQRTLLGRLGKVFERAQREGYIAADVDLIWAQRMFRAMTDE
                     AVAGITGTGMGAKAPPMPTGPDDLARLEAVVDDAELDRLTTLIMHTLFTGIGTHEPSI
                     "
     misc_feature    complement(195384..195854)
                     /locus_tag="HMPREF0733_10171"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(195666..195800)
                     /locus_tag="HMPREF0733_10171"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            195948..196307
                     /locus_tag="HMPREF0733_10172"
                     /db_xref="GeneID:9901424"
     CDS             195948..196307
                     /locus_tag="HMPREF0733_10172"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983064.1"
                     /db_xref="GI:311111842"
                     /db_xref="GeneID:9901424"
                     /translation="MTTKQTVLNYYSAIHAENWQDYISDKLAYGFNSAEQNLGKQDYL
                     QGAGNFFNSTTNVELAHLVVEGDKAAVIARYTAKSPAGDTQIFEVPEFLTVRDGKIIA
                     SSIYLDGAAFMAFIKGE"
     misc_feature    195966..196250
                     /locus_tag="HMPREF0733_10172"
                     /note="SnoaL-like domain; Region: SnoaL_2; pfam12680"
                     /db_xref="CDD:257217"
     gene            196439..197221
                     /locus_tag="HMPREF0733_10173"
                     /db_xref="GeneID:9901425"
     CDS             196439..197221
                     /locus_tag="HMPREF0733_10173"
                     /EC_number="1.-.-.-"
                     /note="COG: COG1028; Pfam: PF00106; InterPro: IPR016040"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase UcpA"
                     /protein_id="YP_003983065.1"
                     /db_xref="GI:311111843"
                     /db_xref="GeneID:9901425"
                     /translation="MNTNSALSGKNAVITGGSDGIGYGIAEEFARQGANLFLIARTPT
                     KLAEASARLSEYPVTVHTFAADLTDISEVHRAAEHALDILGSIDVLVNNAGIARFIPF
                     EQTDENAFDEHFNLNVKAPYFLAQKLLPELAKNSGNIVNISSYFSKRMLPGRPSTVYS
                     MTKGALNLFTQSLAFETGSAGVRVNAIAPGMVETPQLLRNVSAMPPEAQEQMKQNASA
                     LIPLGRIGNVDDIGRAAAFLASDAAAWVTGAVLSVDGGVTTH"
     misc_feature    196457..197212
                     /locus_tag="HMPREF0733_10173"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK07231"
                     /db_xref="CDD:235975"
     misc_feature    196472..197200
                     /locus_tag="HMPREF0733_10173"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(196484..196486,196490..196501,196556..196564,
                     196631..196639,196715..196723,196784..196786,
                     196862..196870,196913..196915,196925..196927,
                     197003..197014,197018..197023)
                     /locus_tag="HMPREF0733_10173"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(196787..196789,196868..196870,196913..196915,
                     196925..196927)
                     /locus_tag="HMPREF0733_10173"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(197344..197985)
                     /locus_tag="HMPREF0733_10174"
                     /db_xref="GeneID:9901426"
     CDS             complement(197344..197985)
                     /locus_tag="HMPREF0733_10174"
                     /note="COG: COG0693; Pfam: PF01965"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_003983066.1"
                     /db_xref="GI:311111844"
                     /db_xref="GeneID:9901426"
                     /translation="MGAMTTTSVYCLFFDGYETLDAMGPIEFLHRVPDVRMRYISVAG
                     ASENGGSLVRSAQGFTLKTEIVESLPPGSILLIPGGIGTRSLVMNNLFLQNLAKLVQQ
                     SQTCLTVCTGAALLAATGVLDGKPATTNKRAFEWVRGTRPQVGWRQKARWVSTEKFYT
                     SSGVSAGMDMTLGFIADRWGLETAQEIASRCEYLWQNDPDTDPFAHSAEFESA"
     misc_feature    complement(197392..197970)
                     /locus_tag="HMPREF0733_10174"
                     /note="Putative intracellular protease/amidase [General
                     function prediction only]; Region: ThiJ; COG0693"
                     /db_xref="CDD:223765"
     misc_feature    complement(197407..197961)
                     /locus_tag="HMPREF0733_10174"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in a subgroup of proteins similar to PfpI
                     from Pyrococcus furiosus; Region: GATase1_PfpI_2; cd03139"
                     /db_xref="CDD:153233"
     misc_feature    complement(197656..197658)
                     /locus_tag="HMPREF0733_10174"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153233"
     gene            complement(198061..198195)
                     /locus_tag="HMPREF0733_10175"
                     /db_xref="GeneID:9901427"
     CDS             complement(198061..198195)
                     /locus_tag="HMPREF0733_10175"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983067.1"
                     /db_xref="GI:311111845"
                     /db_xref="GeneID:9901427"
                     /translation="MGDGTQNNASVFNSNLYACQTVINDGFTTGTRVYFQAYKPAAHA
                     "
     gene            198252..199235
                     /locus_tag="HMPREF0733_10176"
                     /db_xref="GeneID:9901428"
     CDS             198252..199235
                     /locus_tag="HMPREF0733_10176"
                     /note="COG: COG0604; Pfam: PF08240,PF00107; InterPro:
                     IPR002085"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_003983068.1"
                     /db_xref="GI:311111846"
                     /db_xref="GeneID:9901428"
                     /translation="MTDKKEINMSLPTTMRAVQYDKFGGSDLLTINEVPVPSPRPGQV
                     LVRVQAFSVNRIDVIVREGEMRLFTGKRFPKGTGVDALGEIVSVGTGVMDYKVGDIVW
                     GFNGSISMAPTGTAAEYVLFRENRIHHAPRIQNQIDAAALPLVSLAALQVLRKNLKLQ
                     AGQRLLVVGASGGVGHAALQIGQILGAQVATVSAEENIALCRELGSIEAYDHEALPDP
                     EKVEKFDAILDCGGVVTAFYRNYLKPGGRMMTVSPDGLPAVLTSLFTNRRVGFLLATK
                     ASSEAMKWITNAVERGQLRPVIEKKYSLEELGAAQDRVAEKHTRGKLVVVM"
     misc_feature    198294..199232
                     /locus_tag="HMPREF0733_10176"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    198294..199226
                     /locus_tag="HMPREF0733_10176"
                     /note="alcohol dehydrogenase and quinone reductase-like
                     medium chain degydrogenases/reductases; Region:
                     MDR_like_2; cd05289"
                     /db_xref="CDD:176191"
     misc_feature    order(198411..198419,198426..198428,198681..198683,
                     198693..198695,198759..198776,198831..198836,
                     198840..198842,198876..198878,198939..198941,
                     199002..199007,199062..199070)
                     /locus_tag="HMPREF0733_10176"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176191"
     gene            199373..199573
                     /locus_tag="HMPREF0733_10177"
                     /db_xref="GeneID:9901429"
     CDS             199373..199573
                     /locus_tag="HMPREF0733_10177"
                     /codon_start=1
                     /transl_table=11
                     /product="phage protein"
                     /protein_id="YP_003983069.1"
                     /db_xref="GI:311111847"
                     /db_xref="GeneID:9901429"
                     /translation="MRIGMRKPSVKRMIKARTTGRAKRAVKSAVIPGYGKRGMGFVKN
                     PKRAVKGAIYRRTTFSVWDLFR"
     gene            199903..200718
                     /locus_tag="HMPREF0733_10178"
                     /db_xref="GeneID:9901430"
     CDS             199903..200718
                     /locus_tag="HMPREF0733_10178"
                     /note="COG: COG3315; Pfam: PF02409; InterPro: IPR003455"
                     /codon_start=1
                     /transl_table=11
                     /product="tetracenomycin polyketide synthesis
                     O-methyltransferase TcmP"
                     /protein_id="YP_003983070.1"
                     /db_xref="GI:311111848"
                     /db_xref="GeneID:9901430"
                     /translation="MLKIEDAISETLLIPLYMKHLASQQPDPIIKDEAAGRIVSQLDY
                     NFSKFDNIIHTVVGTAIRSDYFDRLAADFIKRQPNPVIVNVGCGLDSRRERIGEIAQN
                     VPFYSLDLPDVMTLRIKLLPPQGSEVFLGTSAFDAGWMDELNDLQPNAQFLFVIEGMM
                     MYFDRYTVRALFRDLAQRFHGSEIAFDVINSWMVTHSDQHEALKHSRARFVFGCDDDH
                     EPERWAHNLRLVSAKRLMTDFPAWKKSGALSAMIARRLPFLKESFRMLHYRID"
     misc_feature    199936..200430
                     /locus_tag="HMPREF0733_10178"
                     /note="Leucine carboxyl methyltransferase; Region: LCM;
                     pfam04072"
                     /db_xref="CDD:252349"
     gene            201065..201352
                     /locus_tag="HMPREF0733_10179"
                     /db_xref="GeneID:9901431"
     CDS             201065..201352
                     /locus_tag="HMPREF0733_10179"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="YP_003983071.1"
                     /db_xref="GI:311111849"
                     /db_xref="GeneID:9901431"
                     /translation="MTHPNRKEVSMGQLIGMIIAGAIIGALARLFMKGQQNISILWTI
                     ILGAVGAFVGGWVAGLLGVAETAGIDWIRWILSIIAAMVAISIYLSVTHKK"
     misc_feature    201143..201346
                     /locus_tag="HMPREF0733_10179"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2261"
                     /db_xref="CDD:225170"
     gene            complement(201492..201863)
                     /locus_tag="HMPREF0733_10180"
                     /db_xref="GeneID:9901432"
     CDS             complement(201492..201863)
                     /locus_tag="HMPREF0733_10180"
                     /note="COG: COG1487; Pfam: PF01850; InterPro: IPR002716"
                     /codon_start=1
                     /transl_table=11
                     /product="PilT protein domain-containing protein"
                     /protein_id="YP_003983072.1"
                     /db_xref="GI:311111850"
                     /db_xref="GeneID:9901432"
                     /translation="MILVDTNVWIDHLHRTEPELSELLMSDEICCHDLVLTELALGSL
                     KKRNEFLSALSELKQLPTVDDHEVRWFIEKRKLWGRGLSAVDVHLLASVVVVPGTTLW
                     TRDKRLRDVAQDLGCRFENDG"
     misc_feature    complement(201543..201863)
                     /locus_tag="HMPREF0733_10180"
                     /note="Predicted nucleic acid-binding protein, contains
                     PIN domain [General function prediction only]; Region:
                     VapC; COG1487"
                     /db_xref="CDD:224404"
     misc_feature    complement(order(201549..201551,201606..201608,
                     201849..201851))
                     /locus_tag="HMPREF0733_10180"
                     /note="putative active site [active]"
                     /db_xref="CDD:189022"
     gene            complement(201860..202057)
                     /locus_tag="HMPREF0733_10181"
                     /db_xref="GeneID:9901433"
     CDS             complement(201860..202057)
                     /locus_tag="HMPREF0733_10181"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983073.1"
                     /db_xref="GI:311111851"
                     /db_xref="GeneID:9901433"
                     /translation="MRITVTLDEKVVAKVAKLTGIEERSVLVREAMETLLRIENGRLL
                     AALGGSDPQAQAAPRHRNVQS"
     misc_feature    complement(201917..202057)
                     /locus_tag="HMPREF0733_10181"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2191); Region: DUF2191; pfam09957"
                     /db_xref="CDD:255659"
     gene            complement(202124..202654)
                     /locus_tag="HMPREF0733_10182"
                     /db_xref="GeneID:9901434"
     CDS             complement(202124..202654)
                     /locus_tag="HMPREF0733_10182"
                     /note="Pfam: PF08241"
                     /codon_start=1
                     /transl_table=11
                     /product="type 12 methyltransferase"
                     /protein_id="YP_003983074.1"
                     /db_xref="GI:311111852"
                     /db_xref="GeneID:9901434"
                     /translation="MLEYARSRPGASKIRWILGDSRNAPDHGFDLVVMTGNVAQHIPS
                     PQWEKTLNDLHRIMRSGGMLAFESRNPACRAWESWTTSTTTRSTRHGLISEWSEAVAP
                     DNNGQVLHRTNYHFMDSGETVVQESILTFRDKKTLGYQLQNAGFEIHAVWGDWCRTPF
                     DGTQPIMVFEAAVPTG"
     misc_feature    complement(202454..>202654)
                     /locus_tag="HMPREF0733_10182"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     gene            complement(202854..203315)
                     /locus_tag="HMPREF0733_10183"
                     /db_xref="GeneID:9901435"
     CDS             complement(202854..203315)
                     /locus_tag="HMPREF0733_10183"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983075.1"
                     /db_xref="GI:311111853"
                     /db_xref="GeneID:9901435"
                     /translation="MRFNDMNFSDGHYVQIPASWDAQEFTHRFLSATPPWVRVIMRVR
                     NRVVQKMGFTVQPATKSTQLEVAVGSSAGPFTFTEVTDEHVIGGHKDKHIEFSSKFVV
                     TAAEEGSTSARGGIETHAQPQSAVGKVYLTCIWPFHKILVPYMLRQVEIKP"
     misc_feature    complement(202878..203312)
                     /locus_tag="HMPREF0733_10183"
                     /note="Protein of unknown function (DUF2867); Region:
                     DUF2867; pfam11066"
                     /db_xref="CDD:256272"
     gene            complement(203427..203654)
                     /locus_tag="HMPREF0733_10184"
                     /db_xref="GeneID:9901436"
     CDS             complement(203427..203654)
                     /locus_tag="HMPREF0733_10184"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983076.1"
                     /db_xref="GI:311111854"
                     /db_xref="GeneID:9901436"
                     /translation="MREQHTMPKDIAAALKNAGLRTDYKARPAYQRNDYIGWINRAKT
                     PAMRIERLEQMLTELAQGGIYMGKEHKASRK"
     misc_feature    complement(203469..203639)
                     /locus_tag="HMPREF0733_10184"
                     /note="Bacteriocin-protection, YdeI or OmpD-Associated;
                     Region: OmdA; pfam13376"
                     /db_xref="CDD:257703"
     gene            complement(203881..204447)
                     /locus_tag="HMPREF0733_10185"
                     /db_xref="GeneID:9901437"
     CDS             complement(203881..204447)
                     /locus_tag="HMPREF0733_10185"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983077.1"
                     /db_xref="GI:311111855"
                     /db_xref="GeneID:9901437"
                     /translation="MNNGGGTSGNSGSGANGGAGAEQNSGNGAVQGDGGTGANGGGTQ
                     ADQGAGANGGVAGGGAQQQGAPGKTANQNPGSEGYVQVAEDGSWTATEPDGEIVRVYS
                     DGSWDRSNPATGNTDWVGADGSWITNENGLPNGSNKNSQVQPNGTYEVRMNGETSRET
                     PSGTPETPVMPNGSNAVTPKGAVQPAKR"
     gene            204452..204655
                     /locus_tag="HMPREF0733_10186"
                     /db_xref="GeneID:9901438"
     CDS             204452..204655
                     /locus_tag="HMPREF0733_10186"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983078.1"
                     /db_xref="GI:311111856"
                     /db_xref="GeneID:9901438"
                     /translation="MELPVELEARDELDEEEAEDELEESFALFEPHALKAKMPATARD
                     THAVAFLVVMIRILSPDKYQLVF"
     gene            complement(205056..205832)
                     /locus_tag="HMPREF0733_10187"
                     /db_xref="GeneID:9901439"
     CDS             complement(205056..205832)
                     /locus_tag="HMPREF0733_10187"
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter"
                     /protein_id="YP_003983079.1"
                     /db_xref="GI:311111857"
                     /db_xref="GeneID:9901439"
                     /translation="MRIMTTTKVPVYVSLAVAGIMALSACGSNSSNNASNSSPSSSSS
                     TTASKTASAGGSGTVSSGDGNSANSGSGANGGAANSGAEDGTGADQNSGTGAQSGSVT
                     GADTNGGAQANQGAEAQGGAQQQQADPGGANAANDEHNVTKNPNALTPGEYVIHREAS
                     WDYVDTTGSRYHVDGDGGWTSVGEDGTSTVAADGSWTKNYADGHTVARVEADGTYRVT
                     YDGQLSPEMPSNAVPVSPGKLPDPKAVPAVNPVQPTKPGM"
     gene            206214..206426
                     /gene="modE"
                     /locus_tag="HMPREF0733_10188"
                     /db_xref="GeneID:9901440"
     CDS             206214..206426
                     /gene="modE"
                     /locus_tag="HMPREF0733_10188"
                     /note="COG: COG3585; Pfam: PF03459; InterPro: IPR004606"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum transport regulatory protein ModE"
                     /protein_id="YP_003983080.1"
                     /db_xref="GI:311111858"
                     /db_xref="GeneID:9901440"
                     /translation="MKLSARNQLAGKVVEITEGATNGIVKIEIAPEVVISASITNESI
                     KELGLKVGETAYAVIKASNVMVGADH"
     misc_feature    206214..206420
                     /gene="modE"
                     /locus_tag="HMPREF0733_10188"
                     /note="TOBE domain; Region: TOBE; cl01440"
                     /db_xref="CDD:260939"
     gene            complement(206608..207678)
                     /locus_tag="HMPREF0733_10189"
                     /db_xref="GeneID:9901441"
     CDS             complement(206608..207678)
                     /locus_tag="HMPREF0733_10189"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983081.1"
                     /db_xref="GI:311111859"
                     /db_xref="GeneID:9901441"
                     /translation="MLLLGVASFVATALIPIVLWRAGAKQAKRDSELQAKILARQTLV
                     SQLQRRDALLGIVTQSSDARYLEVLWKEILEYKEEDRDFLLAHLRANPALALPGTSTG
                     AKAQDNLTDAAVSNYVDGFERRYAESDGYPPYPGLLKFIAEAKRQGAKIEDSRIVALV
                     TGPTAEKQCPGHFFYYDLVLALPQAVSPLLHAVERIDSQAHGGLKLNVLTGALLAVKD
                     LEKGRRGATSNADEVEKLRGGIAQALAYLLHRGVLSSFNQWEIKGSTDSVTATAAWLI
                     RAVGWVADVDGHLAMRMIEKLALAIESVPKSEGNWGTDSHDVRQGFEWISEKCPELWE
                     IYGESLETAATEVGQRKEHLSS"
     gene            complement(207855..209036)
                     /locus_tag="HMPREF0733_10190"
                     /db_xref="GeneID:9901442"
     CDS             complement(207855..209036)
                     /locus_tag="HMPREF0733_10190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983082.1"
                     /db_xref="GI:311111860"
                     /db_xref="GeneID:9901442"
                     /translation="MQNEHATYLNLEGRKGDMIMNNEPVEENSKPAVSDKSKTDVMRS
                     RSAKIHISSELLRTSNRISEIFYARKIPVLQEALKPFQGQYATHFEEALKPFREQNAA
                     RCRELIKVVQKQNWFIDSAAIQNLSLSKIDSINFEIPVFNNQFSASLDVIGEVIDNFL
                     GSVNKTIPLEVFNLFKGLPKKIPENLIEVGSSITIEQVLKVAKRDGIPLYAVPRMSTV
                     LELVEADNGASRREILVKYQESIFEDCENVLNKISSKYALEKKFFILAGLKALKNGHV
                     EAAQALFTNTLDTVHQNFWGLNKQTRTAISNHKEGDELPQLIKNMNFLDMFVFAPIWN
                     SHMKFFGHAGEEPPAEYSRHASVHGVSRRQYKLENCIQALMLVTSLLIYVDNIKKSSE
                     S"
     gene            complement(209126..209293)
                     /locus_tag="HMPREF0733_10191"
                     /db_xref="GeneID:9901443"
     CDS             complement(209126..209293)
                     /locus_tag="HMPREF0733_10191"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="YP_003983083.1"
                     /db_xref="GI:311111861"
                     /db_xref="GeneID:9901443"
                     /translation="MAVRFDGGVSYHIGGGWGTETPNPVSDAPAFVIRGTDIPRLAVG
                     DLNLMEFRFNV"
     misc_feature    complement(209588..209876)
                     /note="potential frameshift: common BLAST hit:
                     gi|119866087|ref|YP_936039.1| N-6 DNA methylase"
     gene            complement(209588..209752)
                     /locus_tag="HMPREF0733_10192"
                     /db_xref="GeneID:9901444"
     CDS             complement(209588..209752)
                     /locus_tag="HMPREF0733_10192"
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="YP_003983084.1"
                     /db_xref="GI:311111862"
                     /db_xref="GeneID:9901444"
                     /translation="MLAKGLTSDQGYRRDRPKLKDVLLRGGQKLECSTLIELMCLFVP
                     LPTQLEGDAE"
     gene            complement(209730..209876)
                     /locus_tag="HMPREF0733_10193"
                     /db_xref="GeneID:9901445"
     CDS             complement(209730..209876)
                     /locus_tag="HMPREF0733_10193"
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="YP_003983085.1"
                     /db_xref="GI:311111863"
                     /db_xref="GeneID:9901445"
                     /translation="MVESGSTRRNPATIADYRAKSVLYVSDESRLSNPFNLSEDKDVG
                     KGAD"
     gene            complement(210021..210827)
                     /locus_tag="HMPREF0733_10194"
                     /db_xref="GeneID:9901446"
     CDS             complement(210021..210827)
                     /locus_tag="HMPREF0733_10194"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983086.1"
                     /db_xref="GI:311111864"
                     /db_xref="GeneID:9901446"
                     /translation="MRVAKLLDYRLPVVACVLAVGVGLADLLWDQFRVFALGHAMITA
                     LFSMTIFAVLTTWFVNWFALRRERSKRAPVTGNAVRVTADMGWDVVTHVGMSWQNLYD
                     AQVREEVLRCLRAYNSQVAILALTPNTDTNFLELLACHDRLGAALESFFLTPPRTAQE
                     DSEKREEIRRLQAAVDAASWPYIKANMPYYWDDPGKFTPPFTEPPSWYARIPKRPERI
                     SPLGQYPEPSAEQDAPVVNLGSDEMAKMLDDECRAILFPDSEGSPIEEAE"
     gene            complement(210879..211964)
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /db_xref="GeneID:9901447"
     CDS             complement(210879..211964)
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="COG: COG0012; Pfam: PF01926,PF06071; InterPro:
                     IPR004396"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein YchF"
                     /protein_id="YP_003983087.1"
                     /db_xref="GI:311111865"
                     /db_xref="GeneID:9901447"
                     /translation="MALTIGIVGLPNVGKSTLFNALTRNTVLAANYPFATIEPNIGVV
                     NLPDARLNRLAEIFGSERILPATVSFVDIAGIVKGASEGEGLGNKFLANIREAHAIAQ
                     VVRAFDDPDVIHVDGKVDPASDMETINTELILADLQTLENAIPRLEKAVKIKKGDAAQ
                     LETYKQAQQILEDGNTIFSRAAAEKLEMAHLKELNLLTAKPFIYVFNADEGVLASEEK
                     QAELRELVAPAEAVFLDAKLEADMVELSEEEAREMLEMSGQDESGLDKLARVGFSTLG
                     LQTYLTAGPKESRAWTIYKGDTAPQAAGVIHSDFERGFIKAEVVSFDDLDAAGSMNEA
                     KARGKVRMEGKDYIMADGDVVEFRFNV"
     misc_feature    complement(210882..211964)
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="GTP-binding protein YchF; Reviewed; Region:
                     PRK09601"
                     /db_xref="CDD:236583"
     misc_feature    complement(211140..211952)
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="YchF GTPase; Region: YchF; cd01900"
                     /db_xref="CDD:206687"
     misc_feature    complement(211917..211940)
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="G1 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(order(211254..211262,211335..211337,
                     211341..211346,211914..211925,211929..211931))
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206687"
     misc_feature    complement(211848..211871)
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(211857..211859)
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="G2 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(order(211677..211706,211725..211754))
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(211740..211751)
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="G3 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(211335..211346)
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="G4 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(211254..211262)
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="G5 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(210888..211136)
                     /gene="ychF"
                     /locus_tag="HMPREF0733_10195"
                     /note="TGS_YchF_C: This subfamily represents TGS
                     domain-containing YchF GTP-binding protein, a universally
                     conserved GTPase whose function is unknown. The N-terminal
                     domain of the YchF protein belongs to the Obg-like family
                     of GTPases, and some members of the...; Region:
                     TGS_YchF_C; cd04867"
                     /db_xref="CDD:133440"
     gene            212298..213233
                     /gene="yvfR"
                     /locus_tag="HMPREF0733_10196"
                     /db_xref="GeneID:9901448"
     CDS             212298..213233
                     /gene="yvfR"
                     /locus_tag="HMPREF0733_10196"
                     /EC_number="3.6.3.-"
                     /note="COG: COG1131; Pfam: PF00005; InterPro: IPR003593"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_003983088.1"
                     /db_xref="GI:311111866"
                     /db_xref="GeneID:9901448"
                     /translation="MNTTTVIQAENLTQVFRVPGGTLTAVDNLDLTISKGEIIALLGP
                     NGAGKTTLIDMILGLTEPARGTLTVQGISPKKAVQRGDIGAVLQTGGLLKDLTVRQTL
                     EMLATLYPTRIDIDKVLASADLTELAHRKVGKCSGGQQQRIRFAIATMHDPNILILDE
                     PTTGMDVTARRTFWERMDKLAETGKTIIFATHYLEEAQNFAQRIVLMRDGAIIADGTS
                     EEIRDLTGYRHVSFLADAPLAFDDLPHQQVEITQENGKYRHRLNISDAEDFVRLLLNT
                     QVVSDLEIVKPSMDESFMLLTSDTESAASSATKES"
     misc_feature    212313..213188
                     /gene="yvfR"
                     /locus_tag="HMPREF0733_10196"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    212316..212927
                     /gene="yvfR"
                     /locus_tag="HMPREF0733_10196"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    212424..212447
                     /gene="yvfR"
                     /locus_tag="HMPREF0733_10196"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(212433..212438,212442..212450,212559..212561,
                     212772..212777,212871..212873)
                     /gene="yvfR"
                     /locus_tag="HMPREF0733_10196"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    212550..212561
                     /gene="yvfR"
                     /locus_tag="HMPREF0733_10196"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(212607..212609,212703..212729)
                     /gene="yvfR"
                     /locus_tag="HMPREF0733_10196"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    212760..212777
                     /gene="yvfR"
                     /locus_tag="HMPREF0733_10196"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    212784..212795
                     /gene="yvfR"
                     /locus_tag="HMPREF0733_10196"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    212859..212879
                     /gene="yvfR"
                     /locus_tag="HMPREF0733_10196"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            213236..213997
                     /locus_tag="HMPREF0733_10197"
                     /db_xref="GeneID:9901449"
     CDS             213236..213997
                     /locus_tag="HMPREF0733_10197"
                     /note="Pfam: PF01061"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983089.1"
                     /db_xref="GI:311111867"
                     /db_xref="GeneID:9901449"
                     /translation="MLRYTLYEIRRSVLSPSSVFYTIILPVGLYMLFGALQDYAKVKV
                     ADGNASAYVMIGMALYGAISSTVSVSGLTVVENVAGWGRQLALTPMNTGKYLFSKCCV
                     AFVMAAVPVIAVNIAARLTGIDMPLNQQIACAALSILCAMVFGFFGLAIGLLVPSESA
                     VGIANGVLVVFSFFGTLFAPLTKDLMPYARFTPLYGAAEISRYPFTQGLTIINGSGPD
                     WNMIEPLWYGVVSFAAWGALFILATMLLMRRTTRR"
     misc_feature    213257..213778
                     /locus_tag="HMPREF0733_10197"
                     /note="ABC-2 type transporter; Region: ABC2_membrane;
                     cl17235"
                     /db_xref="CDD:266576"
     misc_feature    <213377..213958
                     /locus_tag="HMPREF0733_10197"
                     /note="ABC-2 family transporter protein; Region:
                     ABC2_membrane_3; pfam12698"
                     /db_xref="CDD:257232"
     gene            214109..215335
                     /gene="tcsS"
                     /locus_tag="HMPREF0733_10198"
                     /db_xref="GeneID:9901450"
     CDS             214109..215335
                     /gene="tcsS"
                     /locus_tag="HMPREF0733_10198"
                     /EC_number="2.7.3.-"
                     /note="COG: COG4585; Pfam: PF07730,PF02518; InterPro:
                     IPR003594"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="YP_003983090.1"
                     /db_xref="GI:311111868"
                     /db_xref="GeneID:9901450"
                     /translation="MTPLKPRNKTPENRTIDWISLGFSAPWLIFLGYIYDGVLEPNAP
                     VWKHVYVIICLVIFSITDVAAYTVPWALPASSYFRRLLLWTALLFVPVCGVMLIAAIP
                     PADVLIGFTIYFVALWTFTEDIPYSTRIRGAFIIAAVFWIIYMFSDGIPINFADKSRL
                     TLSLGAPMIGIMAFSYLIQMSKNADKTQAKLDMVSERERIARDVHDVLGHSLTVITLK
                     ADLARRLLHADPDRADAELEAIAQLSRSSLAEVRSTVTRLRIPDFSGEIQASARALQT
                     ASITAKLPDAEHALSVVGVNSSLFSWVLREAVTNIVRHSQAGFCEVRLSNTGLEVLDN
                     GVGIPAEYAAGSGIKGMKSRVESAGGTLVIEDAPAHWLRAHPAGSGAADVRGTRVRVS
                     MDGNTAEIEPSGDTDD"
     misc_feature    214190..215227
                     /gene="tcsS"
                     /locus_tag="HMPREF0733_10198"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    214694..214897
                     /gene="tcsS"
                     /locus_tag="HMPREF0733_10198"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    215015..215284
                     /gene="tcsS"
                     /locus_tag="HMPREF0733_10198"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(215024..215026,215036..215038,215045..215047,
                     215099..215101,215105..215107,215111..215113,
                     215117..215122,215141..215152,215198..215200,
                     215204..215206,215264..215269,215273..215275)
                     /gene="tcsS"
                     /locus_tag="HMPREF0733_10198"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    215036..215038
                     /gene="tcsS"
                     /locus_tag="HMPREF0733_10198"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(215111..215113,215117..215119,215141..215143,
                     215147..215149)
                     /gene="tcsS"
                     /locus_tag="HMPREF0733_10198"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            215328..215960
                     /gene="tcsR"
                     /locus_tag="HMPREF0733_10199"
                     /db_xref="GeneID:9901451"
     CDS             215328..215960
                     /gene="tcsR"
                     /locus_tag="HMPREF0733_10199"
                     /EC_number="3.1.1.61"
                     /note="COG: COG2197; Pfam: PF00072,PF00196; InterPro:
                     IPR001789"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="YP_003983091.1"
                     /db_xref="GI:311111869"
                     /db_xref="GeneID:9901451"
                     /translation="MIKIMLADDQQLVREALAALLGLENDIEVVAQVGGGDEVIPAIN
                     RYHPDVVLLDIEMPGSELSSGIDVAAAIRDAKLVTLTGDPVRSLIVTTFGRPGYLRRA
                     LAAGASGFMVKDTSASQLAEGIRRVHAGMHVVDPALAAESLAYGESPLTERETEILRV
                     AGHGATARAIGEQLFLSPGTVRNHLSSAMAKLNASNRQEAIRIAADNGWL"
     misc_feature    215331..215957
                     /gene="tcsR"
                     /locus_tag="HMPREF0733_10199"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    215340..215711
                     /gene="tcsR"
                     /locus_tag="HMPREF0733_10199"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(215349..215354,215487..215489,215520..215522,
                     215598..215600,215655..215657,215664..215669)
                     /gene="tcsR"
                     /locus_tag="HMPREF0733_10199"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    215487..215489
                     /gene="tcsR"
                     /locus_tag="HMPREF0733_10199"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(215496..215501,215514..215522)
                     /gene="tcsR"
                     /locus_tag="HMPREF0733_10199"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    215664..215672
                     /gene="tcsR"
                     /locus_tag="HMPREF0733_10199"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    215775..215939
                     /gene="tcsR"
                     /locus_tag="HMPREF0733_10199"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(215778..215786,215823..215831,215853..215858,
                     215862..215867,215871..215885,215916..215918)
                     /gene="tcsR"
                     /locus_tag="HMPREF0733_10199"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(215811..215813,215817..215819,215823..215825,
                     215916..215924,215931..215933)
                     /gene="tcsR"
                     /locus_tag="HMPREF0733_10199"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(216075..217160)
                     /gene="ispH"
                     /locus_tag="HMPREF0733_10200"
                     /db_xref="GeneID:9901452"
     CDS             complement(216075..217160)
                     /gene="ispH"
                     /locus_tag="HMPREF0733_10200"
                     /EC_number="1.17.1.2"
                     /note="COG: COG0761; Pfam: PF02401; InterPro: IPR003451"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="YP_003983092.1"
                     /db_xref="GI:311111870"
                     /db_xref="GeneID:9901452"
                     /translation="MSTETISLGLPPLPRTRRSRADIEAANPVTSAKKVLLATPRGYC
                     AGVDRAVIAVEKALEHYGAPVYVRKQIVHNRHVVETLEQQGAIFVDEVDEVPEGSVTV
                     FSAHGVSPAVVSAAGDRQLNTIDATCPLVNKVHREAVRFAKQDYDILLIGHTGHEEVE
                     GTAGEAPEHIQIVNSPDEVDSVTVRDPEKVVWISQTTLSVDETLETVARLRERFPSLQ
                     DPPSDDICYATSNRQGAIKEIAPQSDLVIVVGSANSSNSVRLKEVALEYGAKRAERVD
                     FAHQVDESWFEGVATVGLTSGASVPEVLVQEVLALLAEYGYENIEEVETAKEDILFSL
                     PKELRAALKNDENTGRQLGGRGAKPTR"
     misc_feature    complement(216225..217058)
                     /gene="ispH"
                     /locus_tag="HMPREF0733_10200"
                     /note="4-hydroxy-3-methylbut-2-enyl diphosphate reductase;
                     Region: lytB_ispH; cd13944"
                     /db_xref="CDD:260116"
     misc_feature    complement(order(216483..216485,216777..216779,
                     217029..217031))
                     /gene="ispH"
                     /locus_tag="HMPREF0733_10200"
                     /note="Fe-S cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:260116"
     misc_feature    complement(order(216264..216266,216393..216404,
                     216570..216575,216687..216689,216693..216695,
                     216843..216848,216942..216947,217020..217022))
                     /gene="ispH"
                     /locus_tag="HMPREF0733_10200"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:260116"
     misc_feature    complement(order(216393..216395,216399..216401,
                     216687..216689,216693..216695))
                     /gene="ispH"
                     /locus_tag="HMPREF0733_10200"
                     /note="catalytic site [active]"
                     /db_xref="CDD:260116"
     gene            complement(217188..218432)
                     /locus_tag="HMPREF0733_10201"
                     /db_xref="GeneID:9901453"
     CDS             complement(217188..218432)
                     /locus_tag="HMPREF0733_10201"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983093.1"
                     /db_xref="GI:311111871"
                     /db_xref="GeneID:9901453"
                     /translation="MGAHDDPQPHEPKRTIKLEVPEDSPDTTRVLPEPPRDDYRVISS
                     EPHDLEGADETTTLLSAPEINQQTRVLNESFDALRPHSETPEPTGAPVANLANQKPQR
                     HVLEPTSVSKLRYALAILAASLSILCALTGSVASWVNQNLISQSGFNQLSTQLVEDQD
                     FQKRIADAAVTDVMNSDAVKRVFPESGNNFLTQILSTSRGEVKKRLSENAQRLTGTSE
                     YRTMWRQVAADTHTYNLAHPDDPAALDISAFYRELDARVGSIGIYDPDISSWGKHLIS
                     IDRDGNPVQHAVQRAQWVGSMSGALIAASIIGLVIALILLPRGRFVLLTCAFLILAAG
                     LWILSAVMAQQTPQMLGLSTDSTVGTVFLDGLVNTARPMLTGHLNSLASYSAWAAVVS
                     LLGGILAKLIALTASGTTVRTH"
     misc_feature    complement(<217200..217532)
                     /locus_tag="HMPREF0733_10201"
                     /note="Domain of unknown function DUF20; Region: UPF0118;
                     cl00465"
                     /db_xref="CDD:260441"
     gene            218513..219871
                     /gene="xseA"
                     /locus_tag="HMPREF0733_10202"
                     /db_xref="GeneID:9901454"
     CDS             218513..219871
                     /gene="xseA"
                     /locus_tag="HMPREF0733_10202"
                     /EC_number="3.1.11.6"
                     /note="COG: COG1570; Pfam: PF01336,PF02601; InterPro:
                     IPR003753"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII large subunit"
                     /protein_id="YP_003983094.1"
                     /db_xref="GI:311111872"
                     /db_xref="GeneID:9901454"
                     /translation="MTERWAKSQAVGENGVMTDFSAAHHEYPHSAPPIVPPAAERQLP
                     AKSQETTPQNPWPLALLAQNMKNYIDKVPQLWVEAQVASLNGRGGNVFIELKDLQEDF
                     SFTLALFGQAGRGLGSDVKVGARVVTLAKPSLWKNGRLSLIGRRIYAVGTGNLHEQLQ
                     ILREKLAAEGLFADARKKPLPLLPHRVGLITGRDSDAEKDVIRNASLRWPGVQFEVRN
                     VKVQGEGSASEVMAALSELDAHPEVDVIVIARGGGSFEDLLSFSDEALVRAVAAAQTP
                     VVSAIGHEADSPILDAVADVRASTPTDAGKRIVPDVAEELAVIREARARADRAVLGYL
                     NYQEQYIRQLHERPVLTQPETDLGWRSEDIFRLRERAARSVEYRVARERDAISHTIAR
                     VRALSPVETLKRGYTIVQRADGDLVRDATALSAHDKLTMRAAVGGAEVSVVKTYDSNL
                     DL"
     misc_feature    218663..219838
                     /gene="xseA"
                     /locus_tag="HMPREF0733_10202"
                     /note="exodeoxyribonuclease VII large subunit; Reviewed;
                     Region: xseA; PRK00286"
                     /db_xref="CDD:234714"
     misc_feature    218732..218965
                     /gene="xseA"
                     /locus_tag="HMPREF0733_10202"
                     /note="ExoVII_LU_OBF: A subfamily of OB folds
                     corresponding to the N-terminal OB-fold domain of
                     Escherichia coli exodeoxyribonuclease VII (ExoVII) large
                     subunit. E. coli ExoVII is composed of two non-identical
                     subunits. E. coli ExoVII is a...; Region: ExoVII_LU_OBF;
                     cd04489"
                     /db_xref="CDD:239935"
     misc_feature    order(218738..218740,218885..218887,218891..218893,
                     218897..218899,218954..218956)
                     /gene="xseA"
                     /locus_tag="HMPREF0733_10202"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239935"
     misc_feature    order(218753..218761,218786..218797,218801..218803,
                     218825..218833,218837..218839,218882..218884,
                     218903..218911,218933..218941)
                     /gene="xseA"
                     /locus_tag="HMPREF0733_10202"
                     /note="generic binding surface I; other site"
                     /db_xref="CDD:239935"
     misc_feature    <219158..>219373
                     /gene="xseA"
                     /locus_tag="HMPREF0733_10202"
                     /note="Peptidase domain in the S8 and S53 families;
                     Region: Peptidases_S8_S53; cl10459"
                     /db_xref="CDD:263972"
     gene            219894..220175
                     /gene="xseB"
                     /locus_tag="HMPREF0733_10203"
                     /db_xref="GeneID:9901455"
     CDS             219894..220175
                     /gene="xseB"
                     /locus_tag="HMPREF0733_10203"
                     /EC_number="3.1.11.6"
                     /note="COG: COG1722; Pfam: PF02609; InterPro: IPR003761"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII small subunit"
                     /protein_id="YP_003983095.1"
                     /db_xref="GI:311111873"
                     /db_xref="GeneID:9901455"
                     /translation="MSENISFHTEELGAPVETLSYEQARSELENVVRQLESGTSNLES
                     SIALWERGEALASRCEAWLEGARERLHAVRNTQDATGEEAESEGSESED"
     misc_feature    219933..220127
                     /gene="xseB"
                     /locus_tag="HMPREF0733_10203"
                     /note="exodeoxyribonuclease VII small subunit;
                     Provisional; Region: PRK00977"
                     /db_xref="CDD:179195"
     gene            complement(220289..221512)
                     /gene="aspC"
                     /locus_tag="HMPREF0733_10204"
                     /db_xref="GeneID:9901456"
     CDS             complement(220289..221512)
                     /gene="aspC"
                     /locus_tag="HMPREF0733_10204"
                     /EC_number="2.6.1.1"
                     /note="COG: COG0436; Pfam: PF00155; InterPro: IPR004839"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase"
                     /protein_id="YP_003983096.1"
                     /db_xref="GI:311111874"
                     /db_xref="GeneID:9901456"
                     /translation="MTKYRQSSKLNNVLYDIRGPILEEANRMEALGHRILKLNIGNPA
                     PFGFEAPDAIMMDIIRHLPVTQGYSDSHGLYSARTAIVQYYQNRGILDLDTNDIYLGN
                     GVSELIPMTLQALCEPGDEILVPMPDYPLWTASTTLAGGNPVHYLCDEENNWYPDIED
                     IKSKITERTRGIVVINPNNPTGAVYSREILQQIADVAREHELVVFADEIYEKITYEGA
                     EAINMATITGDDVLCMTFSGLSKAYRVCGYRAGWLAITGPKEDAKNYIEGITLLASMR
                     LCSNVPAQHAIQTALGGYQSIDELVAPGGRLYEQRTLAYRMLNEIDGITCEQADGALY
                     LFPKIDTEKFNIKSDEQFMLDLLKDQKILFSHGSAFNWHKPDHFRLVFLPDVQTLKSA
                     LERLGNFMADYKQKN"
     misc_feature    complement(220298..221512)
                     /gene="aspC"
                     /locus_tag="HMPREF0733_10204"
                     /note="aminotransferase AlaT; Validated; Region: PRK09265"
                     /db_xref="CDD:181738"
     misc_feature    complement(220322..221407)
                     /gene="aspC"
                     /locus_tag="HMPREF0733_10204"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(220766..220768,220790..220795,
                     220799..220801,220883..220885,220976..220978,
                     221126..221128,221198..221206))
                     /gene="aspC"
                     /locus_tag="HMPREF0733_10204"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(220655..220657,220664..220666,
                     220766..220774,220904..220906,221096..221098,
                     221195..221197))
                     /gene="aspC"
                     /locus_tag="HMPREF0733_10204"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(220790..220792)
                     /gene="aspC"
                     /locus_tag="HMPREF0733_10204"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(221520..222593)
                     /locus_tag="HMPREF0733_10205"
                     /db_xref="GeneID:9901457"
     CDS             complement(221520..222593)
                     /locus_tag="HMPREF0733_10205"
                     /note="Pfam: PF04069"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_003983097.1"
                     /db_xref="GI:311111875"
                     /db_xref="GeneID:9901457"
                     /translation="MISALALAPLLAACSSEDDKPKVDPSASSYGTLRVGIGALREMR
                     AVAYLYAQALRNVGYNVEVVTNEDSRSKFLDALKQTEANTPEPDTLDLVIDYSGDLLL
                     HLTNDGKLSPAQIQAERQAASASASAASAGVTLPPTPTNTPSHDASASEGATASPSGA
                     INARALNITDTVAAINRVLPEHLELLDVANAQNRDVLVTTRQNEVQHKLRSLANLADV
                     KATLSFALTSGYTSSNYGVASLKTVYKYTVENPILNENSAERVSMLSKDTAQVVLLHS
                     ADPAIEDNRFTTLEDPQTTQLNQQLLPIARRNLPDSAREAINRVSSTLDTGNLSFLLR
                     LTSGTNPIADDEAAKFLLEHPRK"
     misc_feature    complement(221532..222521)
                     /locus_tag="HMPREF0733_10205"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            complement(222632..223123)
                     /locus_tag="HMPREF0733_10206"
                     /db_xref="GeneID:9901458"
     CDS             complement(222632..223123)
                     /locus_tag="HMPREF0733_10206"
                     /note="Pfam: PF00293; InterPro: IPR000086"
                     /codon_start=1
                     /transl_table=11
                     /product="mutT/nudix family protein"
                     /protein_id="YP_003983098.1"
                     /db_xref="GI:311111876"
                     /db_xref="GeneID:9901458"
                     /translation="METRPAAYAVIIEQGKLLMTRWVPEDRAQSPLWSLPGGGMEPGE
                     QADETALRETLEETGYSVAIEDILGVHAGHFPARNGLSDSTLPFCALRIVYRAHVVTG
                     ELRAEENGSSDSACWVPIAELDTLRYGTLIDEVASMMGFQNAAAWSREYQEFLADENA
                     RKI"
     misc_feature    complement(222755..223111)
                     /locus_tag="HMPREF0733_10206"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cl00447"
                     /db_xref="CDD:260427"
     misc_feature    complement(order(222950..222976,223004..223012))
                     /locus_tag="HMPREF0733_10206"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            complement(223154..224143)
                     /locus_tag="HMPREF0733_10207"
                     /db_xref="GeneID:9901459"
     CDS             complement(223154..224143)
                     /locus_tag="HMPREF0733_10207"
                     /note="Pfam: PF03466"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003983099.1"
                     /db_xref="GI:311111877"
                     /db_xref="GeneID:9901459"
                     /translation="MSENSTNARAEEKARADELPHHIANLLYTPQALPAQVLERSELR
                     IAYVPGIMPGKWFTRWHERYGDRAPLAEIPVGEGLGIQALTIELSTSQSAEPLAHMAI
                     VRPNHEPRSRDTDEYHSIRLYEEIPVLIMPSDHVLTVLDEVSFEDLAEEFLLHDPADY
                     PAWAEASNTWRAENPRFLPEFTGDREALELVAAGIGLYIAPMSVARFYHRKDLTYRPM
                     RGLEPYPVTLTWRRAPVAHPRPEREETLIQDFIGIVRGRTASSERGSETKQSRAKRIA
                     DEKAKTKAKNRAANARREARDRKKSNAKKSGNLREYARHNAQAVRARRAGKKR"
     misc_feature    complement(223448..224020)
                     /locus_tag="HMPREF0733_10207"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(223565..223570,223574..223579,
                     223595..223612,223874..223894,223949..223951,
                     223961..223963,223970..223975,223979..223981))
                     /locus_tag="HMPREF0733_10207"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     misc_feature    complement(223427..>223894)
                     /locus_tag="HMPREF0733_10207"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     gene            complement(224210..224680)
                     /locus_tag="HMPREF0733_10208"
                     /db_xref="GeneID:9901460"
     CDS             complement(224210..224680)
                     /locus_tag="HMPREF0733_10208"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein"
                     /protein_id="YP_003983100.1"
                     /db_xref="GI:311111878"
                     /db_xref="GeneID:9901460"
                     /translation="MKEWFAALPLELAVVIMWGIGILRTSIVYALGYLAATGSARLER
                     IRNAMQTPLYTRATAMINRWGAYAVPLCFLTVGLQTAVIITTGFTKMPMRRWLPGMLL
                     GTLIWAIIYVTIGFALLAAFGFEPWMVPLIFVALILISLTASKIRTYIADKRQS"
     misc_feature    complement(224258..>224659)
                     /locus_tag="HMPREF0733_10208"
                     /note="SNARE associated Golgi protein; Region:
                     SNARE_assoc; cl00429"
                     /db_xref="CDD:260418"
     gene            complement(225172..227475)
                     /locus_tag="HMPREF0733_10209"
                     /db_xref="GeneID:9901461"
     CDS             complement(225172..227475)
                     /locus_tag="HMPREF0733_10209"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983101.1"
                     /db_xref="GI:311111879"
                     /db_xref="GeneID:9901461"
                     /translation="MTILSTSGVLVVLAVVMLLWFIPRNMRRASAADTPEQTVVNPHS
                     MTDDVLTSHSILFSEESAVPGSDPKKSNAASGNVPPLSEEETSAALSDLREASPVEPF
                     TSPVPVLEQKPWLPERLHRLGTLRLTLLGIGALVALILIFSLILSLMGWLPWSAPTVS
                     FVALAGIGGALYYLGQPKDGHEEPDAAYPETSGHNALPIEGEATEEEFAQDEAHELDV
                     EEPEETSPSRSSKASRWGSLRWNSGRASRKSTLEEESSEQGVPADHAPQIGADEFAAE
                     PHELSEEPVHEEYVEYAESYSAEDAQQHFSGTSHARRLPAQLHPKYPPQQAPEPVLYD
                     DDQGASHEASYEQAPSAHAFSASAAEEAPAQDVFVQPKNLHRAPAPQPEAQRHETRFV
                     GSASAQGQTPRRPARIPGTHLRPLERTSELFDQEVQTTPTGQIPVTPAPGNTVNAPQR
                     EGAAPRNGFLESAPANTNQTQGYSAPSGMSNTSAQDAAFGSGMQDRADDSAHSAPYRS
                     AAHNPYLAQPQNTAQNPYAAPAQGYGTHQGQGVGQHQQGMQQNQNAGQNRQAAQTGLG
                     QQSLGEQQGYGQRSFAPQNQKHQTSTAQHTNAQNSGPGFAPSRSVAEEKNLPPAGFTP
                     QGAIRPMNQEPPRSQRPMGTTTGSGAQNSRFQQGPATGSVPVGGGSGFTNTSQFDVPV
                     PLDLDDSEFEPLDIIPVVDEPGERSGSSSNASASYKRGNMPGTGASFTGVSQKTWTPT
                     QLPKPLSSLHQKKPNGSDGGPNNGEQK"
     misc_feature    complement(<226798..>227061)
                     /locus_tag="HMPREF0733_10209"
                     /note="FHIPEP family; Region: FHIPEP; cl07980"
                     /db_xref="CDD:263518"
     gene            complement(227758..228675)
                     /gene="galU"
                     /locus_tag="HMPREF0733_10210"
                     /db_xref="GeneID:9901462"
     CDS             complement(227758..228675)
                     /gene="galU"
                     /locus_tag="HMPREF0733_10210"
                     /EC_number="2.7.7.9"
                     /note="COG: COG1210; Pfam: PF00483; InterPro: IPR005835"
                     /codon_start=1
                     /transl_table=11
                     /product="UTP-glucose-1-phosphate uridylyltransferase"
                     /protein_id="YP_003983102.1"
                     /db_xref="GI:311111880"
                     /db_xref="GeneID:9901462"
                     /translation="MLIGMTKVSKSVTKAVIPAAGLGTRFLPATKATPKEMLPVVDRP
                     AIQYVVEEAIRAGLNDVLMITGRNKRALEDHFDRVPVLESQLAEQGKDALLKAVEATN
                     ELGELHYVRQGDPKGLGHAVLRGKVHVGDEPFAVLLGDDLIDEKEDLLSRMVEVQQAT
                     GGSVIALMEVPHESISAYGAAAIEAVEGQDGYVKVTGLVEKPAPEEAPSNYAVIGRYV
                     LSSKVFEVLENTAPGRGNEIQLTDALQTLAVGTGEGEGVYGVVFKGRRFDTGDKLSYL
                     KANVILASEREDLGPELREWLKEFADKNC"
     misc_feature    complement(227827..228639)
                     /gene="galU"
                     /locus_tag="HMPREF0733_10210"
                     /note="Prokaryotic UGPase catalyses the synthesis of
                     UDP-glucose; Region: UGPase_prokaryotic; cd02541"
                     /db_xref="CDD:133021"
     misc_feature    complement(227815..228636)
                     /gene="galU"
                     /locus_tag="HMPREF0733_10210"
                     /note="dTDP-glucose pyrophosphorylase [Cell envelope
                     biogenesis, outer membrane]; Region: RfbA; COG1209"
                     /db_xref="CDD:224130"
     misc_feature    complement(order(227953..227955,228037..228039,
                     228073..228078,228139..228144,228253..228258,
                     228262..228264,228322..228333,228340..228342,
                     228568..228573,228613..228624))
                     /gene="galU"
                     /locus_tag="HMPREF0733_10210"
                     /note="active site"
                     /db_xref="CDD:133021"
     misc_feature    complement(order(227833..227841,227845..227853,
                     227857..227865,227881..227883,227965..227967,
                     228145..228147,228331..228333,228337..228339,
                     228343..228348,228430..228435,228445..228447,
                     228451..228459,228463..228465,228535..228537,
                     228547..228555,228559..228567,228577..228585,
                     228589..228603,228610..228612))
                     /gene="galU"
                     /locus_tag="HMPREF0733_10210"
                     /note="tetramer interface; other site"
                     /db_xref="CDD:133021"
     gene            228852..229535
                     /gene="fthC"
                     /locus_tag="HMPREF0733_10211"
                     /db_xref="GeneID:9901463"
     CDS             228852..229535
                     /gene="fthC"
                     /locus_tag="HMPREF0733_10211"
                     /EC_number="6.3.3.2"
                     /note="COG: COG0212; Pfam: PF01812; InterPro: IPR002698"
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="YP_003983103.1"
                     /db_xref="GI:311111881"
                     /db_xref="GeneID:9901463"
                     /translation="MKPEPSTVSAPHESNDAPHSKTPEDTALDKQILRSQIRPQRLIV
                     KNARTAAEHEQMKQQYRDHILSLIPKDAQAQTIAAYLPTASEPPITAALHDLHARGHR
                     ILVPVVRPARTLAWVVWDPHVEHPLNGLGIAEPEGEEYDTQAFVAADLRLVPALAYAR
                     NGRRLGQGGGYYDRIIPALSADKLRESTVGVVFSHEVLESIPYDEWDAVLPRVLTENG
                     IEPLGDSTL"
     misc_feature    228939..229499
                     /gene="fthC"
                     /locus_tag="HMPREF0733_10211"
                     /note="5,10-methenyltetrahydrofolate synthetase; Region:
                     MTHFS_bact; TIGR02727"
                     /db_xref="CDD:233985"
     gene            229687..229893
                     /locus_tag="HMPREF0733_10212"
                     /db_xref="GeneID:9901464"
     CDS             229687..229893
                     /locus_tag="HMPREF0733_10212"
                     /note="COG: COG2331; InterPro: IPR013429"
                     /codon_start=1
                     /transl_table=11
                     /product="FmdB family regulatory protein"
                     /protein_id="YP_003983104.1"
                     /db_xref="GI:311111882"
                     /db_xref="GeneID:9901464"
                     /translation="MPVYVYQCKNCGHAFEKRQSFSEDALRTCPQCGEDTLRKRFNTV
                     GVVFKGSGFYSTDKGSSSSSSQAE"
     misc_feature    229687..>229857
                     /locus_tag="HMPREF0733_10212"
                     /note="Zinc ribbon domain; Region: Zn-ribbon_8; cl00993"
                     /db_xref="CDD:260734"
     gene            complement(229930..230205)
                     /locus_tag="HMPREF0733_10213"
                     /db_xref="GeneID:9901465"
     CDS             complement(229930..230205)
                     /locus_tag="HMPREF0733_10213"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983105.1"
                     /db_xref="GI:311111883"
                     /db_xref="GeneID:9901465"
                     /translation="MGEYSPTPKPRRGHRRASGGGALAGDEPRIAGVNAPLHAHTPTP
                     ARKEISGKSAANRGNLRHARGSAQEHLTPEERARLEWMREQKPPHWG"
     gene            complement(230252..234079)
                     /locus_tag="HMPREF0733_10214"
                     /db_xref="GeneID:9901466"
     CDS             complement(230252..234079)
                     /locus_tag="HMPREF0733_10214"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983106.1"
                     /db_xref="GI:311111884"
                     /db_xref="GeneID:9901466"
                     /translation="MNETPDTLENTAAKEPRSAEFQPEYLDPSSPAFDPSGGLERWAQ
                     QMDVYTGPDAMLDFNQVDYVHINLSDANPSGLAQLLAGRKTRLSTLIRDKSLLGHEMR
                     AARTLRTKIYELSTGHGLDAGYFVAGTASWLSHAMRDDAKASEKRFIAPILMAPLNLT
                     PHPTSDDFELQLAGSARLNPAMVRQIKQEYEIDLGTMDVAQLANSMSRLDPEPVIERM
                     RASAGRIPGMTIESKYFISTFADLKESMGELPHTAHTPLVRDLAALKVPGAQPREMNA
                     HNLQQPLNQRDPAQETLLFDADPVAQNIIDTAASGFSMTVTAAPGTEPLRTAVNIAST
                     LMGRGKSVLVVGEKRSTLASFSELLGRTGLNDLRYDLLAEHTAEDQRTEFIRAIVRNE
                     NTAEPNSTNLNRELIETRTALTDHTHALTARDPLWHISISEALQRVAELASEESAPQT
                     QVRFSRQLLDTLQDREAITADIVRFAELNGFTRATRTSPWHRARLLNEDEAADAYALV
                     ITLRSSLLSLREAMNAMNASLHLRRARTIADWDAQLAILIRIRETLKRFRAEVYDRPV
                     TDLIAATASGSWRRENRIDMSSMQRSRLRRAAKEYILPGVHIGDLHEHLKVVQTERAE
                     WIRLLDSPSTPKIPENLDALANALHSLGSELSGLEIILPDTAEGVDFVHTDLDQLEAR
                     LDALLNDREVLMSLPERDVLLGRLTNAGLSDFLDELGEREANASEVTSELELAWWQSA
                     LEELLEQHAEKILDGDELRDIEARFRRADYAHMSSAQARLLAHTARLWTERIEEFHEQ
                     ASYLKSQLRGREFDLESLLVNAPVMARTLLPLWTASPFSLARRVPMSMRFDAVILLDA
                     ESTPLAANLPAITRADQVIAVGDPHAGFPAPFIVSAPTSGAPASDSHRLESTFGALSR
                     LLPNRTLSLVHRPFDRVLFDYLNREFYGSHLREIPVSPASRKPVSTLSIEYIDTRGKV
                     SDNANLESPSVEVDRVTRLVLEHAYRRPERSLAVVTASPKHAQRIAGAVRQALNTYPQ
                     LAEFFKPGTESFRVVDVNRAGSLERDTIIFSLGVGRARLGQSSHNLGLLSGPHGREGF
                     VVGLTRARRATHIVSCVSPTDMNAQKLHEGALDLYRLMLAYEENQQQIAAQTPREDVL
                     ASNAWLETEDEPTDPVTQDWLLNDAVARLRERGVRVRPGEDEIAFIALAPQQLIHTES
                     EQESAQRMPLMVGSDVLFDYTTESVREHTRLVPERLSRTGWNYVTLNTLEVFADPEAV
                     VARILRYLGIYAD"
     misc_feature    complement(<233003..233170)
                     /locus_tag="HMPREF0733_10214"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    complement(230714..>232459)
                     /locus_tag="HMPREF0733_10214"
                     /note="Superfamily I DNA and RNA helicases and helicase
                     subunits [DNA replication, recombination, and repair];
                     Region: COG1112"
                     /db_xref="CDD:224037"
     misc_feature    complement(230786..231271)
                     /locus_tag="HMPREF0733_10214"
                     /note="AAA domain; Region: AAA_12; pfam13087"
                     /db_xref="CDD:257490"
     gene            complement(234223..234678)
                     /locus_tag="HMPREF0733_10215"
                     /db_xref="GeneID:9901467"
     CDS             complement(234223..234678)
                     /locus_tag="HMPREF0733_10215"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983107.1"
                     /db_xref="GI:311111885"
                     /db_xref="GeneID:9901467"
                     /translation="MIAILELINNPQKMRRYLFWYLIIMPLALFAWILLGAANSGLDF
                     KAAINIPFYAVAFLNGCLSILFAGLLKFAASENEHTERMIAFYTLVMLVFAGNLPGAL
                     LAFFLWWALREAPEEPFAPNYRWVFIASMIFFGLVTLLVLFANIRLWSA"
     gene            complement(234682..235581)
                     /gene="glvR"
                     /locus_tag="HMPREF0733_10216"
                     /db_xref="GeneID:9901468"
     CDS             complement(234682..235581)
                     /gene="glvR"
                     /locus_tag="HMPREF0733_10216"
                     /note="Pfam: PF01418,PF01380"
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="YP_003983108.1"
                     /db_xref="GI:311111886"
                     /db_xref="GeneID:9901468"
                     /translation="MDLQDVVNANQHRFSDTERDILAFMLENEEFVAEATINSLAHKT
                     YTSTSSIIRLTKKLNFSGFAELKYFIKSSLTKSEPYNPRFIESGREDILRTYDYLEHM
                     ELSGLLRKLHTARTIYCFGTGYAQRNAVQEFAKSMQVCGKFCHVIPARNEFESTMSAM
                     NQDDVVILVSFSGQTENMREHVKMLALRKIPMIAITAIGVNFMSSYAEYSLHYQTTPT
                     QLSTQRKPYHSFVALSVLLDYIVRRYIDHVETQQRGNSTKTAQVLESSEFSAETGALD
                     VADIRAQAGAVAIDRQHTDPSET"
     misc_feature    complement(234778..235581)
                     /gene="glvR"
                     /locus_tag="HMPREF0733_10216"
                     /note="Transcriptional regulators [Transcription]; Region:
                     RpiR; COG1737"
                     /db_xref="CDD:224651"
     misc_feature    complement(235351..235581)
                     /gene="glvR"
                     /locus_tag="HMPREF0733_10216"
                     /note="Helix-turn-helix domain, rpiR family; Region:
                     HTH_6; pfam01418"
                     /db_xref="CDD:201784"
     misc_feature    complement(234859..235257)
                     /gene="glvR"
                     /locus_tag="HMPREF0733_10216"
                     /note="RpiR-like protein. RpiR contains a SIS (Sugar
                     ISomerase) domain, which is found in many phosphosugar
                     isomerases and phosphosugar binding proteins. In E. coli,
                     rpiR negatively regulates the expression of rpiB gene.
                     Both rpiB and rpiA are ribose phosphate...; Region:
                     SIS_RpiR; cd05013"
                     /db_xref="CDD:240144"
     misc_feature    complement(order(235072..235074,235204..235206))
                     /gene="glvR"
                     /locus_tag="HMPREF0733_10216"
                     /note="putative active site [active]"
                     /db_xref="CDD:240144"
     gene            complement(235677..237320)
                     /gene="glvC"
                     /locus_tag="HMPREF0733_10217"
                     /db_xref="GeneID:9901469"
     CDS             complement(235677..237320)
                     /gene="glvC"
                     /locus_tag="HMPREF0733_10217"
                     /EC_number="2.7.1.69"
                     /note="COG: COG1263; Pfam: PF02378,PF00367; InterPro:
                     IPR010975"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system transporter subunit IIBC"
                     /protein_id="YP_003983109.1"
                     /db_xref="GI:311111887"
                     /db_xref="GeneID:9901469"
                     /translation="MMEKIQRFGSAMLAPVLLFAFAGLAVGIGTVATLPNIVGDLANE
                     DTFWYQAWTVWLDGAWTVFRQIELLFVLGLPIALAKTANARAVLEAGMVYLTFNYLVA
                     GMLNFWGQGGSGFFQLDYNTSISLDNSDSYGTGLKIIAGIKTIDTGIFGAIIISAIVV
                     WVHNRYFDKKLPDFLGIFQGTQFVYAICFFLMMPIAFIFAWLWPYAQHGIASMQGFFI
                     ASGALGVWIYTFLERILIPTGLHHFIYSPFMFGNAVTPNGIVKDWPTHISEFAKSDKP
                     LRELFPGGGFALHGNSKIFAPLGISAAFYTTARREKRKEVLALLIPVTLTAMLIGITE
                     PLEFTFLFVAPPLFAVHAVLAASMASIMYMLGLSGNMGGGLLDNFLFLNWVPLWQNHW
                     PTYLMQIGVGLSFTVIYFLLFRFLILKFDFKTPGREAEGGETKLYSKAEYKAAKAAEK
                     KGAASADDAGDADLYAPRAAGFLELLGGADNITTVNNCATRLRVSVADESLVDTSDAA
                     FKDAGALGIVRKGKAFQVIVGMDVPQVRERFETMVNTKE"
     misc_feature    complement(236031..237320)
                     /gene="glvC"
                     /locus_tag="HMPREF0733_10217"
                     /note="Phosphotransferase system IIC components,
                     glucose/maltose/N-acetylglucosamine-specific [Carbohydrate
                     transport and metabolism]; Region: PtsG; COG1263"
                     /db_xref="CDD:224183"
     misc_feature    complement(235692..237317)
                     /gene="glvC"
                     /locus_tag="HMPREF0733_10217"
                     /note="PTS system, alpha-glucoside-specific IIBC
                     component; Region: PTS-IIBC-alpha; TIGR02005"
                     /db_xref="CDD:233683"
     misc_feature    complement(235716..235916)
                     /gene="glvC"
                     /locus_tag="HMPREF0733_10217"
                     /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIB_glc; cd00212"
                     /db_xref="CDD:238130"
     misc_feature    complement(235842..235862)
                     /gene="glvC"
                     /locus_tag="HMPREF0733_10217"
                     /note="active site turn [active]"
                     /db_xref="CDD:238130"
     misc_feature    complement(235857..235859)
                     /gene="glvC"
                     /locus_tag="HMPREF0733_10217"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238130"
     gene            237677..238570
                     /gene="rgfB"
                     /locus_tag="HMPREF0733_10218"
                     /db_xref="GeneID:9901470"
     CDS             237677..238570
                     /gene="rgfB"
                     /locus_tag="HMPREF0733_10218"
                     /note="Pfam: PF03372; InterPro: IPR005135"
                     /codon_start=1
                     /transl_table=11
                     /product="RgfB protein"
                     /protein_id="YP_003983110.1"
                     /db_xref="GI:311111888"
                     /db_xref="GeneID:9901470"
                     /translation="MRFLTLNTHSWCEPHQIVKIHELARFIAHHRVDVIALQEVNQYL
                     HSPIVDMPLGYQGGASIPIREDNYALLLVRFLADLGVQYEWALTETHIGWERYDECVA
                     VLSRMPIERIEPIVMSPQYDYDRVERRSSLAVRVGTDAGSVWCASTHMSWWDFQGEPL
                     FAQEFARLSQALTECGQDAPVLMGGDFNTAAQVRGEGYDLALSSGLVDTREIAERTDG
                     EFTVHREIAGWEGQEDAKRIDFVFADRAVKVLSHAVVFRDNSPKAISDHSGVLVELDE
                     SSFEPTARMHPVQLPSQVQPG"
     misc_feature    237683..238498
                     /gene="rgfB"
                     /locus_tag="HMPREF0733_10218"
                     /note="Streptococcus agalactiae RgfB, part of a putative
                     two component signal transduction system, and related
                     proteins; Region: RgfB-like; cd09079"
                     /db_xref="CDD:197313"
     misc_feature    order(237695..237697,237791..237793,238121..238123,
                     238232..238234,238238..238240,238391..238393,
                     238472..238477)
                     /gene="rgfB"
                     /locus_tag="HMPREF0733_10218"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197313"
     misc_feature    order(237791..237793,238472..238474)
                     /gene="rgfB"
                     /locus_tag="HMPREF0733_10218"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197313"
     misc_feature    order(238121..238123,238238..238240,238475..238477)
                     /gene="rgfB"
                     /locus_tag="HMPREF0733_10218"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197313"
     gene            238631..240460
                     /gene="malL"
                     /locus_tag="HMPREF0733_10219"
                     /db_xref="GeneID:9901471"
     CDS             238631..240460
                     /gene="malL"
                     /locus_tag="HMPREF0733_10219"
                     /EC_number="3.2.1.10"
                     /note="COG: COG0366; Pfam: PF00128; InterPro: IPR013781"
                     /codon_start=1
                     /transl_table=11
                     /product="oligo-1,6-glucosidase"
                     /protein_id="YP_003983111.1"
                     /db_xref="GI:311111889"
                     /db_xref="GeneID:9901471"
                     /translation="MYSVEGQLMKTEIQWWQQPVVYQIYPRSFNDSNGDGIGDLPGIT
                     EKIPYLAKLGIDVIWLSPIYASPNDDNGYDISDYRAIMTEFGTMADFDELLATAHEHG
                     IKLMMDLVVNHTSDEHEWFRQARSAKDNPYRDYYVWRDPAGFSEDGTPIPPNNWISCF
                     SPSVWEWDEGTQQFYLHYFSVKQPDLNWENPKVREEVYDIMRFWLDKGVDGFRMDVIN
                     LISKDLSFPDDPAVTAGGLDNSLAVAANGPRVHEFLREMNREVLSKYPVMTVGETPCV
                     SVEDAALYTGFDRHELQMVFQFEHMDVDASAGGATGKWSDTRFNLVDLKKVLSHWQTG
                     LHGRGWNSLYWNNHDQPRTVSRFGNDSPEFREVSGKMLGTILHMMQGTPYIYQGEELG
                     MTNVFFDSVDDYNDLEIHDSWRKYVVESQRVSPEDMLRYISASGRDNARTPMQWDASE
                     NAGFTTGTPWLKVNPRYTDINAAEELANDDSIFYHYSDLIHLRKEHPIVLTGEYRVLN
                     PEDEQVYAYLRVNSAEDAAASGERALLVVANFTQETLSLPYADGQLASLALKNPGVLK
                     LEELAAMGEAPELISSNYRNEHGEFTDEGTTLRPYEAKVYLYR"
     misc_feature    238673..240454
                     /gene="malL"
                     /locus_tag="HMPREF0733_10219"
                     /note="alpha,alpha-phosphotrehalase; Region:
                     trehalose_treC; TIGR02403"
                     /db_xref="CDD:233851"
     misc_feature    238688..240115
                     /gene="malL"
                     /locus_tag="HMPREF0733_10219"
                     /note="Alpha amylase catalytic domain found in Sucrose
                     isomerases, oligo-1,6-glucosidase (also called isomaltase;
                     sucrase-isomaltase; alpha-limit dextrinase), dextran
                     glucosidase (also called glucan 1,6-alpha-glucosidase),
                     and related proteins; Region: AmyAc_SI_OligoGlu_DGase;
                     cd11333"
                     /db_xref="CDD:200472"
     misc_feature    order(238721..238723,238727..238729,238733..238735,
                     238745..238747)
                     /gene="malL"
                     /locus_tag="HMPREF0733_10219"
                     /note="Ca binding site [ion binding]; other site"
                     /db_xref="CDD:200472"
     misc_feature    order(238838..238840,238847..238849,238958..238960,
                     238967..238969,239108..239110,239165..239167,
                     239177..239179,239273..239275,239444..239446,
                     239939..239941)
                     /gene="malL"
                     /locus_tag="HMPREF0733_10219"
                     /note="active site"
                     /db_xref="CDD:200472"
     misc_feature    order(239273..239275,239444..239446,239675..239677)
                     /gene="malL"
                     /locus_tag="HMPREF0733_10219"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200472"
     gene            240531..242423
                     /gene="dexB"
                     /locus_tag="HMPREF0733_10220"
                     /db_xref="GeneID:9901472"
     CDS             240531..242423
                     /gene="dexB"
                     /locus_tag="HMPREF0733_10220"
                     /EC_number="3.2.1.70"
                     /note="COG: COG0366; Pfam: PF00128; InterPro: IPR013781"
                     /codon_start=1
                     /transl_table=11
                     /product="glucan 1,6-alpha-glucosidase"
                     /protein_id="YP_003983112.1"
                     /db_xref="GI:311111890"
                     /db_xref="GeneID:9901472"
                     /translation="MRLTGFPTKPHDATLNERLLMSSETTTEERAVPSYAGRQWWKEA
                     VVYQVYPRSFNDSNGDGIGDLPGITEKIPYLAKLGINVIWLSPVFDSPNVDNGYDISD
                     YFDIMSDFGTMEDFDELLATAHEHGIKILMDLVANHTSDQHPWFVQSRSSKDNPYRDY
                     YIWKDPNGFDETGSPIPPNNWASEFGGSAWEWDEATQQFYLHIFFKEQPDLNWANPKV
                     REDLYAMVRWWLDKGVDGFRLDAINIISKPEGFPDDPSTDFEKHTSSIPFVIANGTMV
                     HPWMKELNREAFSKYDVMTVGETSATSPEDAKLWAGYDAGELQMLFHFDHMGVDNDPE
                     GSLGGKWSYAPYKLTELKRILNEWQTKLEGKAWGSLYWNNHDQPRVVSRFGNDSPEFR
                     VLSAKQLATTLHFMQGTPYIYQGEELGMTNVRFESIEDYRDGDSIRFYEDMHVDHQRL
                     NHEDAMRAIYIKGRDNARTPMQWDDSANGGFTNAGVEPWLKVNPNYPQINAEAALDDQ
                     DSVFYHYQELAKLRRGELKDLMVYGSFAPVDSVEVPHAEDEAVYAYTRTGGPDGTDAN
                     QSLLVVSNFTSDSVERTFSLLDDARAAGASVELVHSNYRDDTGALTDVGTTLRPYEAK
                     VYRIVK"
     misc_feature    240648..242414
                     /gene="dexB"
                     /locus_tag="HMPREF0733_10220"
                     /note="alpha,alpha-phosphotrehalase; Region:
                     trehalose_treC; TIGR02403"
                     /db_xref="CDD:233851"
     misc_feature    240654..242099
                     /gene="dexB"
                     /locus_tag="HMPREF0733_10220"
                     /note="Alpha amylase catalytic domain found in Sucrose
                     isomerases, oligo-1,6-glucosidase (also called isomaltase;
                     sucrase-isomaltase; alpha-limit dextrinase), dextran
                     glucosidase (also called glucan 1,6-alpha-glucosidase),
                     and related proteins; Region: AmyAc_SI_OligoGlu_DGase;
                     cd11333"
                     /db_xref="CDD:200472"
     misc_feature    order(240696..240698,240702..240704,240708..240710,
                     240720..240722)
                     /gene="dexB"
                     /locus_tag="HMPREF0733_10220"
                     /note="Ca binding site [ion binding]; other site"
                     /db_xref="CDD:200472"
     misc_feature    order(240813..240815,240822..240824,240933..240935,
                     240942..240944,241083..241085,241140..241142,
                     241152..241154,241248..241250,241422..241424,
                     241920..241922)
                     /gene="dexB"
                     /locus_tag="HMPREF0733_10220"
                     /note="active site"
                     /db_xref="CDD:200472"
     misc_feature    order(241248..241250,241422..241424,241656..241658)
                     /gene="dexB"
                     /locus_tag="HMPREF0733_10220"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200472"
     gene            complement(242638..243483)
                     /locus_tag="HMPREF0733_10221"
                     /db_xref="GeneID:9901473"
     CDS             complement(242638..243483)
                     /locus_tag="HMPREF0733_10221"
                     /note="Pfam: PF00561; InterPro: IPR000073"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983113.1"
                     /db_xref="GI:311111891"
                     /db_xref="GeneID:9901473"
                     /translation="MNRISTHFLDLEGIKTAYYSTEGEGTPIVFLHGGGVDHAMLSWK
                     TIMQTWTGSQPLVALDLPGYGNSDKPELEYSLSFYTGFLKAFLDTLNAQNVTLCGLSM
                     GGAIALQYALRYPEYIGKLVLVAPWGVSASAPYSLMGRLRVRLPLNQVVYKTLQNRWL
                     AKNIIAGSLIGNREKITPEILDEVQTAAHSKDAARVFQSFQISELWGEHPVGHLIPLL
                     PQIKVPTLFIQGDKDPGVKVGDVKQAAASMPNARVEIFEHHKHWVQKESPERFADIVR
                     DFIES"
     misc_feature    complement(242641..243468)
                     /locus_tag="HMPREF0733_10221"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     misc_feature    complement(242641..243408)
                     /locus_tag="HMPREF0733_10221"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            complement(243636..244106)
                     /locus_tag="HMPREF0733_10222"
                     /db_xref="GeneID:9901474"
     CDS             complement(243636..244106)
                     /locus_tag="HMPREF0733_10222"
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenylcysteine carboxyl methyltransferase"
                     /protein_id="YP_003983114.1"
                     /db_xref="GI:311111892"
                     /db_xref="GeneID:9901474"
                     /translation="MKRLAAALEHKVPPPLIGALCASLMWLICGMPPLTGRPPLLLVP
                     ALALVVLGLTVDAAGVLSFRRARTTVNPFAPERTVNIVSSGIYRLSRNPMYLGMVCIL
                     TGWAVWLWQVQAVLGVVLFVAWITRFQIIPEERVLTQKFGTEYRQYRQRVRRWV"
     misc_feature    complement(243675..243953)
                     /locus_tag="HMPREF0733_10222"
                     /note="Phospholipid methyltransferase; Region: PEMT;
                     pfam04191"
                     /db_xref="CDD:252440"
     gene            complement(244143..244847)
                     /gene="racD"
                     /locus_tag="HMPREF0733_10223"
                     /db_xref="GeneID:9901475"
     CDS             complement(244143..244847)
                     /gene="racD"
                     /locus_tag="HMPREF0733_10223"
                     /EC_number="5.1.1.13"
                     /note="COG: COG1794; Pfam: PF01177; InterPro: IPR004380"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate racemase"
                     /protein_id="YP_003983115.1"
                     /db_xref="GI:311111893"
                     /db_xref="GeneID:9901475"
                     /translation="MKTLGIIGGMSPESTALYYRIINREVNRRLGDNHSADIVMHSVD
                     FEEVVRMQKSGDWEAAGALLAASATKLEGAGAQLLLVATNTMHKVAPAIERATTVPLL
                     HVVDATATAIQRQGLQRVGLLGTTFTMSDGFYTERMAVQGIQTIVPTESEQTDINRII
                     FEQLCLGRVEPEAVQYLQQVITGLKEQGAQGVILGCTELCLAVEADKTPLPVFDSTTI
                     HALAAVEAVLTPPLPV"
     misc_feature    complement(244158..244847)
                     /gene="racD"
                     /locus_tag="HMPREF0733_10223"
                     /note="Aspartate racemase [Cell envelope biogenesis, outer
                     membrane]; Region: RacX; COG1794"
                     /db_xref="CDD:224707"
     gene            complement(245025..245672)
                     /locus_tag="HMPREF0733_10224"
                     /db_xref="GeneID:9901476"
     CDS             complement(245025..245672)
                     /locus_tag="HMPREF0733_10224"
                     /EC_number="1.-.-.-"
                     /note="COG: COG0778; Pfam: PF00881; InterPro: IPR000415"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H nitroreductase 12C"
                     /protein_id="YP_003983116.1"
                     /db_xref="GI:311111894"
                     /db_xref="GeneID:9901476"
                     /translation="MLPMTLQDLIRDRRSTRYFDPACLISHEEIYRLINCANQAPSSN
                     NSQPWRVVIVTERHLREKLLPIAYNQQQIMTASAVLILLGDRQAYCADNLSRIHHEEY
                     IAGCFSQEICERLTRAAIEFYEPRSEQEIQKFLGLDCGLWAMTFMLAAQEAGWNTIPM
                     TGYQRAELREMLRLPSRYLDIMMIAVGSGAREGHRTLRHEAERVTVWNAPPSEQP"
     misc_feature    complement(245079..245654)
                     /locus_tag="HMPREF0733_10224"
                     /note="Nitroreductase-like family 1. A subfamily of the
                     nitroreductase family containing uncharacterized proteins
                     that are similar to nitroreductase. Nitroreductase
                     catalyzes the reduction of nitroaromatic compounds such as
                     nitrotoluenes, nitrofurans and...; Region:
                     Nitroreductase_1; cd02137"
                     /db_xref="CDD:239052"
     misc_feature    complement(order(245079..245084,245154..245159,
                     245217..245219,245226..245231,245238..245243,
                     245250..245255,245496..245510,245514..245522,
                     245532..245534,245538..245540,245553..245561,
                     245580..245582,245634..245636,245643..245648))
                     /locus_tag="HMPREF0733_10224"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239052"
     misc_feature    complement(order(245187..245201,245250..245252,
                     245457..245459,245538..245540,245544..245552,
                     245628..245630,245634..245636))
                     /locus_tag="HMPREF0733_10224"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239052"
     gene            245792..246139
                     /locus_tag="HMPREF0733_10225"
                     /db_xref="GeneID:9901477"
     CDS             245792..246139
                     /locus_tag="HMPREF0733_10225"
                     /note="COG: COG1733; Pfam: PF01638; InterPro: IPR002577"
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="YP_003983117.1"
                     /db_xref="GI:311111895"
                     /db_xref="GeneID:9901477"
                     /translation="MKKISAIEMAMNLVGGKYKCLILYHLSGGAKRTRDLLRLLEGIS
                     SKVLTEQLRQLEEDELIKRTVYAEVPPRVEYTLSTEGQTFLPVLQLMCDWGWEYDSRH
                     QGIVKPCTSRITE"
     misc_feature    245810..246076
                     /locus_tag="HMPREF0733_10225"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: COG1733"
                     /db_xref="CDD:224647"
     misc_feature    order(245885..245893,245921..245932,245936..245941,
                     245948..245953,245957..245962,245978..245980,
                     245990..245995,246008..246016)
                     /locus_tag="HMPREF0733_10225"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(245885..245887,245894..245896)
                     /locus_tag="HMPREF0733_10225"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            complement(246310..247050)
                     /gene="fabG"
                     /locus_tag="HMPREF0733_10226"
                     /db_xref="GeneID:9901478"
     CDS             complement(246310..247050)
                     /gene="fabG"
                     /locus_tag="HMPREF0733_10226"
                     /EC_number="1.1.1.100"
                     /note="COG: COG1028; Pfam: PF00106; InterPro: IPR016040"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase"
                     /protein_id="YP_003983118.1"
                     /db_xref="GI:311111896"
                     /db_xref="GeneID:9901478"
                     /translation="MKRFENKTILITGASSGIGLAGAKRLIEEGAHVIFTGRTESHVQ
                     AAAAELGDHATAVLDDVSDGNTLERIMPVVERAGALDGVWLNAAYAAGGPLEEMDQAT
                     LDQIFKVNVVAPMIQMGALSPYVKDGGSVLVTSSTAAYEGAPIVSAYAATKAAILAAA
                     RGWASELAPRNIRVNSLVPGPITSNLRSVLPDEMRAQFEERLAEAVLLKRVGDAREAA
                     AVALFLLSDEASYVTGSSYTVDGGLIMQ"
     misc_feature    complement(246325..247050)
                     /gene="fabG"
                     /locus_tag="HMPREF0733_10226"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06500"
                     /db_xref="CDD:235816"
     misc_feature    complement(246331..247026)
                     /gene="fabG"
                     /locus_tag="HMPREF0733_10226"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(246496..246501,246505..246516,
                     246592..246594,246604..246606,246643..246651,
                     246724..246726,246787..246795,246868..246876,
                     246934..246942,246997..247008,247012..247014))
                     /gene="fabG"
                     /locus_tag="HMPREF0733_10226"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(246592..246594,246604..246606,
                     246643..246645,246721..246723))
                     /gene="fabG"
                     /locus_tag="HMPREF0733_10226"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(247308..247661)
                     /locus_tag="HMPREF0733_10227"
                     /db_xref="GeneID:9901479"
     CDS             complement(247308..247661)
                     /locus_tag="HMPREF0733_10227"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983119.1"
                     /db_xref="GI:311111897"
                     /db_xref="GeneID:9901479"
                     /translation="MNPVLLTINTISALVTIASAVLALCRPGLMVHASSVDANTRFYV
                     YMYAVRAIPAGIAVLIAPFYFRGGAVVLLLATFAVIQAGDAFIGWTRKEWGMVFFPSL
                     SAAAHTVVAFSVPGI"
     gene            complement(247690..248121)
                     /locus_tag="HMPREF0733_10228"
                     /db_xref="GeneID:9901480"
     CDS             complement(247690..248121)
                     /locus_tag="HMPREF0733_10228"
                     /note="COG: COG1846; Pfam: PF01047"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_003983120.1"
                     /db_xref="GI:311111898"
                     /db_xref="GeneID:9901480"
                     /translation="MDASLLSELVVQIFRVNGTLTAWGDRFAAESGLTTARWQVLGAI
                     SMSKEPSTSPQIAERMGITRQGVQKQLNLLRDEGLVMSVENPAHKRSPRYSLTEHGEQ
                     KLAEIRKRWRQQVEQWSGSYQHESVIAALETLEVLSQHLKE"
     misc_feature    complement(247720..248067)
                     /locus_tag="HMPREF0733_10228"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(247849..248031)
                     /locus_tag="HMPREF0733_10228"
                     /note="MarR family; Region: MarR_2; pfam12802"
                     /db_xref="CDD:257309"
     misc_feature    complement(247693..>247911)
                     /locus_tag="HMPREF0733_10228"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            248514..248819
                     /locus_tag="HMPREF0733_10229"
                     /db_xref="GeneID:9901481"
     CDS             248514..248819
                     /locus_tag="HMPREF0733_10229"
                     /codon_start=1
                     /transl_table=11
                     /product="DedA family protein"
                     /protein_id="YP_003983121.1"
                     /db_xref="GI:311111899"
                     /db_xref="GeneID:9901481"
                     /translation="MLRVVAWICFVATIPWALIFIILGVAVSANLLHVTSIFIINLII
                     TLLAFLAAVSLAALPILGTIKLFKLSRKNPEQPDGGEKFAEKVFNFFGKILDGADYL"
     gene            249550..250242
                     /locus_tag="HMPREF0733_10230"
                     /db_xref="GeneID:9901482"
     CDS             249550..250242
                     /locus_tag="HMPREF0733_10230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983122.1"
                     /db_xref="GI:311111900"
                     /db_xref="GeneID:9901482"
                     /translation="MTTNKNLPKPEHGTLQAQDVHEIKKEPKADSTKKQTSFPPSLIA
                     VQTIRTVIEFILVLPLLPLLTIGLGGFLLFLPFGLHFILQAVAWSRAKKETRIAWVVG
                     INIYSLMIVAPIGAFYTWFMMELQVAAPNITGADIGLLWWSLGACVLEAVISIVMIVV
                     MNVIKRNDLRDFQGKRITVTKPRISDDVLEGSNSGAYETDGGLKPLKNHHDKSDAKVP
                     RQHINVRSQKKD"
     gene            250253..250969
                     /locus_tag="HMPREF0733_10231"
                     /db_xref="GeneID:9901483"
     CDS             250253..250969
                     /locus_tag="HMPREF0733_10231"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983123.1"
                     /db_xref="GI:311111901"
                     /db_xref="GeneID:9901483"
                     /translation="MSTDKNFPIVNDEFAIGQAQNVHEIEKESEADSTEKRNLLLSSF
                     ITVQIIRLILETMILQSVVFSLLASDFDDFEGFLLLLILFSPFIVYILLQIVACIKMI
                     RGTKTAWFLGTNIYSLLVVAPIAAFYTWFVIEMSAPNVTSADIQPLRWLLGACALEAI
                     ISVFTIIAVIIYNWKKKKLSSHNKNMDTDKRPTPDNTLSGFKNAIYETDDLKTLKKHH
                     EDPIVEIPWQRVNVRSQKKD"
     gene            250981..251703
                     /locus_tag="HMPREF0733_10232"
                     /db_xref="GeneID:9901484"
     CDS             250981..251703
                     /locus_tag="HMPREF0733_10232"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983124.1"
                     /db_xref="GI:311111902"
                     /db_xref="GeneID:9901484"
                     /translation="MSTDKNFSATDNNDPQPPVEKQSASGNNPENAHQDPKYTQLYGL
                     EGIEGKMSLEPQAGSEPQGTKKKEESHERVPKQFDIDPNTRKSLLIAQAIRNVLIIIP
                     VLVLLFIFIQAAIYIMVSERDEFSDLIFAIVAIATVVALPYMIHIFLQVVAFMRFRRS
                     VKFRWIRGANIYGLIVAPISEVTYVPFMLERILDPSSSAESSFTIVGVIVALYEVILG
                     ILMIVVTTNSIKKTTQLSGQKH"
     gene            252048..252176
                     /locus_tag="HMPREF0733_10233"
                     /db_xref="GeneID:9901485"
     CDS             252048..252176
                     /locus_tag="HMPREF0733_10233"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983125.1"
                     /db_xref="GI:311111903"
                     /db_xref="GeneID:9901485"
                     /translation="MFRFERTMAQLLYLYDHSKAARCILKAQNTPGGLPTQNWVES"
     gene            complement(252196..253788)
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /db_xref="GeneID:9901486"
     CDS             complement(252196..253788)
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /EC_number="6.3.5.2"
                     /note="COG: COG0519; Pfam: PF00117,PF03054,PF00958;
                     InterPro: IPR001674"
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="YP_003983126.1"
                     /db_xref="GI:311111904"
                     /db_xref="GeneID:9901486"
                     /translation="MTDSVHPDQLEERPVLVVDYGAQYAQLIARRVREAGIYSEIVPH
                     SMSTEKMLAKNPAAIVLSGGPSSVYADGAPRGDRALFEAGVPVFGICYGFQVMAQTLG
                     GTVAQTGSREYGATDATLCAVESSFLTGTPQTQNVWMSHGDSVTEAPAGFEVLAQTPG
                     ASVAAFVDEHRKLGGVQWHPEVKHSDYGQVALENFLYNIAGLKPTWSTDNIIEEQVAK
                     IREQVGEDRVICALSGGVDSSVAAALVHKAVGDQLTCFFIDHGLLRAGEREQVEQDYA
                     ASMGIRVITIDESERFLTALAGVSDPEQKRKIIGREFIRSFEQAERKLIEEAGEEGAQ
                     IKFLVQGTLYPDVVESGGGEGAANIKSHHNVGGLPEDLAFELVEPLRTLFKDEVRAIG
                     RQLGVPEKIVARQPFPGPGLGIRIVGEVTRENLETLRAADAIVREELTAAGQDEHIWQ
                     CPVVLLSGVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWSRLPYDLLAKISNRITNE
                     VKDVNRVVLDVTSKPPGTIEWE"
     misc_feature    complement(252199..253752)
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /note="GMP synthase; Reviewed; Region: guaA; PRK00074"
                     /db_xref="CDD:234614"
     misc_feature    complement(253201..253746)
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in GMP synthetase; Region: GATase1_GMP_Synthase;
                     cd01742"
                     /db_xref="CDD:153213"
     misc_feature    complement(order(253252..253254,253369..253371,
                     253513..253518,253594..253602,253720..253725))
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /note="AMP/PPi binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:153213"
     misc_feature    complement(order(253513..253515,253597..253599))
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /note="candidate oxyanion hole; other site"
                     /db_xref="CDD:153213"
     misc_feature    complement(order(253246..253248,253252..253254,
                     253516..253518))
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153213"
     misc_feature    complement(order(253258..253260,253366..253368,
                     253504..253506))
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /note="potential glutamine specificity residues [chemical
                     binding]; other site"
                     /db_xref="CDD:153213"
     misc_feature    complement(252202..253110)
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /note="The C-terminal domain of GMP synthetase. It
                     contains two subdomains; the ATP pyrophosphatase domain
                     which closes to the N-termial and the dimerization domain
                     at C-terminal end. The ATP-PPase is a twisted,
                     five-stranded parallel beta-sheet sandwiched...; Region:
                     GMP_synthase_C; cd01997"
                     /db_xref="CDD:238955"
     misc_feature    complement(order(252535..252579,252595..252669,
                     252682..252711,252733..252780,252820..252933,
                     252964..252996,253000..253032,253036..253110))
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /note="ATP Binding subdomain [chemical binding]; other
                     site"
                     /db_xref="CDD:238955"
     misc_feature    complement(order(252634..252636,253015..253017,
                     253021..253023,253075..253086,253090..253098))
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /note="Ligand Binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238955"
     misc_feature    complement(order(252202..252270,252274..252300,
                     252319..252366,252376..252408,252415..252417,
                     252421..252447,252472..252510))
                     /gene="guaA"
                     /locus_tag="HMPREF0733_10234"
                     /note="Dimerization subdomain; other site"
                     /db_xref="CDD:238955"
     gene            complement(253929..254513)
                     /locus_tag="HMPREF0733_10235"
                     /db_xref="GeneID:9901487"
     CDS             complement(253929..254513)
                     /locus_tag="HMPREF0733_10235"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983127.1"
                     /db_xref="GI:311111905"
                     /db_xref="GeneID:9901487"
                     /translation="MSENSEKNTKITPVERTDGRKVTLSQNASKASADGAEHAPQGGF
                     TVRKKFGGTETQIRSALTFYKWCAWISGTFLLLLVVEMITHHGMGYDLVAGAKDAATG
                     SDVSFGVLNRETGNLTGGVNISTWVLIIHGWFYIIYLFSCIRIWLLMRWGIAQLIVMA
                     LGGVVPFLSFIVEKRIHAETLAQLEANPQATKRY"
     misc_feature    complement(253977..254339)
                     /locus_tag="HMPREF0733_10235"
                     /note="Domain of unknown function (DUF3817); Region:
                     DUF3817; pfam12823"
                     /db_xref="CDD:257325"
     gene            complement(254552..255574)
                     /locus_tag="HMPREF0733_10236"
                     /db_xref="GeneID:9901488"
     CDS             complement(254552..255574)
                     /locus_tag="HMPREF0733_10236"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="YP_003983128.1"
                     /db_xref="GI:311111906"
                     /db_xref="GeneID:9901488"
                     /translation="MWKLAFTPRWLGGLLLALVFVTGFVALSSWQFNASTSQQVHSDP
                     AKDRVRPYTEILQAHQPVTNLTVDTVVQAKGKYVPGSSMLVAGRLNEGQHGYWVLSEF
                     IPEGTDKAAALGSTKPRAITVARAWIAGEDDHAPSIPAEPTGTVEVAGRVVNAQGAAP
                     YTRMAEKVLESASPAQLTNLWDSPLYDGVLTLSVEVPEDQKIPLTEQHTIAENATIIG
                     QSENLRPIRAAQATNDANINWLNIFYSLEWLIFAAFALYLWGRMLKDAAHRAAEPAEY
                     TQYFEYEGEYFVDETTGRPYYWDPADEQYYFFDEAPEEASVRMEDTPRNAPESGNPQK
                     PADTKD"
     misc_feature    complement(<255119..255553)
                     /locus_tag="HMPREF0733_10236"
                     /note="SURF1 superfamily. Surf1/Shy1 has been implicated
                     in the posttranslational steps of the biogenesis of the
                     mitochondrially-encoded Cox1 subunit of cytochrome c
                     oxidase (complex IV). Cytochrome c oxidase (complex IV),
                     the terminal electron-transferring...; Region: SURF1;
                     cl01321"
                     /db_xref="CDD:260884"
     gene            complement(255760..256119)
                     /locus_tag="HMPREF0733_10237"
                     /db_xref="GeneID:9901489"
     CDS             complement(255760..256119)
                     /locus_tag="HMPREF0733_10237"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983129.1"
                     /db_xref="GI:311111907"
                     /db_xref="GeneID:9901489"
                     /translation="MPSNKMISDFSDKPKTDSFYQAIDGYVMSLGKVKREFRAQVSYS
                     VNRKFLWMWAYEKTKDGTLYFNVTLDRQEENKNIHRVTQVSPNRWNHHVEVKSLQTAK
                     SQWLRTLIDMGFEFSTQ"
     gene            complement(256234..256941)
                     /locus_tag="HMPREF0733_10238"
                     /db_xref="GeneID:9901490"
     CDS             complement(256234..256941)
                     /locus_tag="HMPREF0733_10238"
                     /note="Pfam: PF03713; InterPro: IPR005183"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983130.1"
                     /db_xref="GI:311111908"
                     /db_xref="GeneID:9901490"
                     /translation="MTLKGSTMKRTLVLSALAVASTLALAACGKATESGNTDATTSAT
                     STATTTAETTETTTATTEADGEISADYNDADIMFAQMMIPHHQQAVEMSEMLLAKEGI
                     PAQVVEFAQGVIDAQGPEIDRMNAMLEAWGQQPVTDSGGMGTMDEMGGMDHGEMGGMS
                     GMMSQEDMTALEEAQGTEAARLYLEQMTAHHEGAVDMARDEVADGQNPHAITLAEQII
                     NDQEAEIAQMQQMLTDL"
     misc_feature    complement(256246..256719)
                     /locus_tag="HMPREF0733_10238"
                     /note="Domain of unknown function (DUF305); Region:
                     DUF305; pfam03713"
                     /db_xref="CDD:252116"
     gene            complement(256969..258993)
                     /gene="copB"
                     /locus_tag="HMPREF0733_10239"
                     /db_xref="GeneID:9901491"
     CDS             complement(256969..258993)
                     /gene="copB"
                     /locus_tag="HMPREF0733_10239"
                     /EC_number="3.6.3.4"
                     /note="COG: COG2217; Pfam: PF00122,PF00702; InterPro:
                     IPR001757"
                     /codon_start=1
                     /transl_table=11
                     /product="copper-exporting ATPase"
                     /protein_id="YP_003983131.1"
                     /db_xref="GI:311111909"
                     /db_xref="GeneID:9901491"
                     /translation="MFRDRFWWSLILSIPVVIFSPMVAHLLGYHLPAFPGSTWVPPVL
                     DTIIFVYGGTPFLKGGWKELKSRQPGMMLLIAMAITVAFVASWVTTLGLGGFDLDFWW
                     ELALLVTIMLLGHWLEMRALGGASSALDALAALLPDEAEKVIDGTTRTVATSELVVDD
                     VVLVRAGARVPADGTILDGAAEFDEAMITGESRPVFRDTGDKVVAGTVATDNTVRVRV
                     EATGGDTALAGIQRMVADAQESSSRAQALADRAAALLFWFALISALITAVVWTIIGSP
                     DDAVVRTVTVLVIACPHALGLAIPLVIAISTERAAKSGVLIKDRMALERMRTIDVVLF
                     DKTGTLTEGAHAVTGVAAAVGVTEGELLALAAAAEADSEHPVARAIVAAAAAHPEASR
                     RQIRATGFSAASGRGVRATVDGAEILVGGPNMLREFNLTTPAELTDTTSAWTGRGAGV
                     LHIVRDGQIIGAVAVEDKIRPESRAAVKALQDRGVKVAMITGDAQQVAQAVGQDLGID
                     EVFAEVLPQDKDTKVTQLQERGLSVAMVGDGVNDAPALARAEVGIAIGAGTDVAMESA
                     GVVLASDDPRAMLSMIELSQASYRKMIQNLIWASGYNILAVPLAAGVLASSGILLPPA
                     AAAVLMSLSTIVVALNAQLLRRIDLDPAHLAPTSPKEEHTTPTPASTAVH"
     misc_feature    complement(257116..258840)
                     /gene="copB"
                     /locus_tag="HMPREF0733_10239"
                     /note="copper-(or silver)-translocating P-type ATPase;
                     Region: ATPase-IB1_Cu; TIGR01511"
                     /db_xref="CDD:233445"
     misc_feature    complement(258019..258678)
                     /gene="copB"
                     /locus_tag="HMPREF0733_10239"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    complement(257326..257649)
                     /gene="copB"
                     /locus_tag="HMPREF0733_10239"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(257641..257649)
                     /gene="copB"
                     /locus_tag="HMPREF0733_10239"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(257521..257523)
                     /gene="copB"
                     /locus_tag="HMPREF0733_10239"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            259003..259248
                     /locus_tag="HMPREF0733_10240"
                     /db_xref="GeneID:9901492"
     CDS             259003..259248
                     /locus_tag="HMPREF0733_10240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983132.1"
                     /db_xref="GI:311111910"
                     /db_xref="GeneID:9901492"
                     /translation="MPGVFAVTMNLVVFVQDGVRVTVGHRLAVGVGICVVFVAGMSRV
                     VGVVCFRSGVITMVIAGMVGSAHDVPFAQPGRGRDDG"
     gene            complement(259255..259407)
                     /locus_tag="HMPREF0733_10241"
                     /db_xref="GeneID:9901493"
     CDS             complement(259255..259407)
                     /locus_tag="HMPREF0733_10241"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983133.1"
                     /db_xref="GI:311111911"
                     /db_xref="GeneID:9901493"
                     /translation="MTQALQALPQVDDVQVDLAAGGVSTVTVTGVVPPEMVRRAIEAT
                     GYTVLS"
     misc_feature    complement(259264..>259398)
                     /locus_tag="HMPREF0733_10241"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     gene            complement(260041..260820)
                     /locus_tag="HMPREF0733_10242"
                     /db_xref="GeneID:9901494"
     CDS             complement(260041..260820)
                     /locus_tag="HMPREF0733_10242"
                     /EC_number="2.7.3.-"
                     /note="COG: COG0642; Pfam: PF00672,PF00512; InterPro:
                     IPR003660"
                     /codon_start=1
                     /transl_table=11
                     /product="two component system sensor kinase"
                     /protein_id="YP_003983134.1"
                     /db_xref="GI:311111912"
                     /db_xref="GeneID:9901494"
                     /translation="MNHGPGLTFRFLAAQVLVVVISLLMAAAVATMVGPTLFHDHMLM
                     TGREDPSLELFHAEQAYRDANLITLAVALPTALISALLASLWLSRRLRTPLQDLTRAA
                     TSLTVGNYRIRVPAGEAGPEVTTLAHAFNTMADRLEHTEQVRRQMLSNLAHEMGTPLS
                     VLTVYLDGLQDGVVDWNNATHTIMADQLARLTRLMEDIDDVSRAQEHRIDLDLAEEGF
                     GDLLHTAAAAGGLMLTKASIYRSRLLRTPPGCSWTGNASAR"
     misc_feature    complement(260404..260550)
                     /locus_tag="HMPREF0733_10242"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(260410..260415,260422..260427,
                     260431..260436,260443..260448,260452..260457,
                     260506..260508,260512..260517,260524..260529,
                     260533..260538,260545..260550))
                     /locus_tag="HMPREF0733_10242"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(260212..260400)
                     /locus_tag="HMPREF0733_10242"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(260227..260229,260239..260241,
                     260248..260250,260260..260262,260269..260271,
                     260326..260328,260335..260337,260347..260349,
                     260356..260358,260368..260370,260380..260382))
                     /locus_tag="HMPREF0733_10242"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(260362..260364)
                     /locus_tag="HMPREF0733_10242"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     gene            complement(260817..261050)
                     /gene="phoP"
                     /locus_tag="HMPREF0733_10243"
                     /db_xref="GeneID:9901495"
     CDS             complement(260817..261050)
                     /gene="phoP"
                     /locus_tag="HMPREF0733_10243"
                     /note="COG: COG0745; Pfam: PF00486; InterPro: IPR001867"
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase synthesis transcriptional
                     regulator PhoP"
                     /protein_id="YP_003983135.1"
                     /db_xref="GI:311111913"
                     /db_xref="GeneID:9901495"
                     /translation="MELTRTEFELLVALALRPGQVLTRHDLVTEVWDTTWVGDERIVD
                     VHIGNLRRKLGTDTRGRGFIDTVRGVGYRVGQP"
     misc_feature    complement(260832..>261047)
                     /gene="phoP"
                     /locus_tag="HMPREF0733_10243"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(260832..>261047)
                     /gene="phoP"
                     /locus_tag="HMPREF0733_10243"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(260838..260840,260853..260855,
                     260889..260894,260916..260918,260925..260927,
                     260979..260984,261039..261041))
                     /gene="phoP"
                     /locus_tag="HMPREF0733_10243"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            261075..261791
                     /locus_tag="HMPREF0733_10244"
                     /db_xref="GeneID:9901496"
     CDS             261075..261791
                     /locus_tag="HMPREF0733_10244"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983136.1"
                     /db_xref="GI:311111914"
                     /db_xref="GeneID:9901496"
                     /translation="MGDGSVVAVSRDKTYKNTNVDFRIDPTTGEYQSASVDEYPGKES
                     VNITANTLSRFKAEDAGTAPGETKRIIDPASAPEQTRLVSDNTSEAATVSAPKTVYAG
                     QKFTIGGSDWTYGEDYLPSDITVTLDDGKSKVNGQGEMTFKLSEEETSFTRDIEVPAN
                     WKPGEEHSVTISSGKTKGDKQRSLTIKFKVEEYNPKYIDSCTVPTQDAVQATEVPFAG
                     YPKVVGEVPSLNQQPATTKD"
     gene            complement(261976..263106)
                     /locus_tag="HMPREF0733_10245"
                     /db_xref="GeneID:9901497"
     CDS             complement(261976..263106)
                     /locus_tag="HMPREF0733_10245"
                     /EC_number="1.1.1.205"
                     /note="COG: COG0516; Pfam: PF00478; InterPro: IPR013785"
                     /codon_start=1
                     /transl_table=11
                     /product="inositol-5-monophosphate dehydrogenase"
                     /protein_id="YP_003983137.1"
                     /db_xref="GI:311111915"
                     /db_xref="GeneID:9901497"
                     /translation="MSDIQIGLSKSARRTYALDDVALAPTRRTRDRRDVDTSWQIDAF
                     KFDTPIVGAPMDSVMSPATAIALGKLGGLGVLNLEGLWTRYEDPQPLLDEITELPEAD
                     PASATTRMQQIYAEPIKPELITARLEEIRDSGVIVAGSLTPQNTQEHYETVVQAGADL
                     FVIRGASVSAEHISTSHEPLNLKKFIYELDVPVMVGGVAGYTQAKHLMRTGAAGVLVG
                     FGGGSAMTTRKGLGISAPMATAIADVAAARSDYLDESGGRYVHVIADGGLSRSGDLVK
                     ALALGADAVMIGAPLARASEAPGQGWYWGNEAHSRDFPRGVRTPLGVVGTLEEVLYGP
                     SHHVDGTRNIVGALKRAMANCGYLDLKKFQKAEMTLVPEYRG"
     misc_feature    complement(262000..263106)
                     /locus_tag="HMPREF0733_10245"
                     /note="inosine 5-monophosphate dehydrogenase; Validated;
                     Region: PRK08649"
                     /db_xref="CDD:236322"
     misc_feature    complement(262003..263064)
                     /locus_tag="HMPREF0733_10245"
                     /note="TIM barrel proteins share a structurally conserved
                     phosphate binding motif and in general share an eight
                     beta/alpha closed barrel structure. Specific for this
                     family is the conserved phosphate binding site at the
                     edges of strands 7 and 8. The phosphate...; Region:
                     TIM_phosphate_binding; cl17186"
                     /db_xref="CDD:266538"
     misc_feature    complement(order(262240..262245,262306..262311))
                     /locus_tag="HMPREF0733_10245"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:240073"
     gene            complement(263308..264825)
                     /gene="guaB"
                     /locus_tag="HMPREF0733_10246"
                     /db_xref="GeneID:9901498"
     CDS             complement(263308..264825)
                     /gene="guaB"
                     /locus_tag="HMPREF0733_10246"
                     /EC_number="1.1.1.205"
                     /note="COG: COG0516; Pfam: PF00478,PF00571; InterPro:
                     IPR013785"
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-5'-monophosphate dehydrogenase"
                     /protein_id="YP_003983138.1"
                     /db_xref="GI:311111916"
                     /db_xref="GeneID:9901498"
                     /translation="MTVPTALTDDPFGFTGLTYDDVLLLPGNTDVIPSDADTSTRLSK
                     RITLGTPIISAAMDTVTDSQMAISMARLGGMGVIHRNLSIEDQAAHVDRVKRSESGMI
                     INPVTIGADATIGEYDNLCGYYKVSGLPVVTEDGKLEGIITNRDIRYLSRSDYESTLV
                     RDVMTPMPLITGSPNLTKDEAFALLSKNKIERLPLIDEAGKLAGLITLKDFVKTEQYP
                     RATKDDDGRLRVGAAIGFFGDGYERAMALVEAGVDALFVDTANGHSQGVLDMISRLKK
                     DPAAAHVDVIGGQAATREGAQAIIDAGADAVKVGVGPGSICTTRIIAGVGVPQVTAIN
                     ESAKAAIPAGVPLIADGGMQHSGEIGKALVAGADSVMLGSLLAGTAEAPGDLIFMNGK
                     QFKAYRGMGSLGAMQTRGRHKSYSKDRYFQADVSSEEKLIPEGIEGQVPFRGPLSAVL
                     HQLEGGLRQTMFYVGSRTIEELKTKGKFVRITPAGLKESHPHDITMTVEAPNYRR"
     misc_feature    complement(263314..264780)
                     /gene="guaB"
                     /locus_tag="HMPREF0733_10246"
                     /note="inosine 5'-monophosphate dehydrogenase; Reviewed;
                     Region: PRK05567"
                     /db_xref="CDD:235507"
     misc_feature    complement(263383..264780)
                     /gene="guaB"
                     /locus_tag="HMPREF0733_10246"
                     /note="IMPDH: The catalytic domain of the inosine
                     monophosphate dehydrogenase. IMPDH catalyzes the
                     NAD-dependent oxidation of inosine 5'-monophosphate (IMP)
                     to xanthosine 5' monophosphate (XMP). It is a
                     rate-limiting step in the de novo synthesis of...; Region:
                     IMPDH; cd00381"
                     /db_xref="CDD:238223"
     misc_feature    complement(order(263521..263526,263623..263631,
                     263635..263637,263704..263709,263770..263772,
                     263776..263778,263875..263883,264661..264663))
                     /gene="guaB"
                     /locus_tag="HMPREF0733_10246"
                     /note="active site"
                     /db_xref="CDD:238223"
     misc_feature    complement(264184..264522)
                     /gene="guaB"
                     /locus_tag="HMPREF0733_10246"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains in the
                     inosine 5' monophosphate dehydrogenase (IMPDH) protein.
                     IMPDH is an essential enzyme that catalyzes the first step
                     unique to GTP synthesis, playing a...; Region:
                     CBS_pair_IMPDH; cd04601"
                     /db_xref="CDD:239974"
     gene            complement(265095..266684)
                     /gene="groEL"
                     /locus_tag="HMPREF0733_10247"
                     /db_xref="GeneID:9901499"
     CDS             complement(265095..266684)
                     /gene="groEL"
                     /locus_tag="HMPREF0733_10247"
                     /note="COG: COG0459; Pfam: PF00118; InterPro: IPR002423"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroEL"
                     /protein_id="YP_003983139.1"
                     /db_xref="GI:311111917"
                     /db_xref="GeneID:9901499"
                     /translation="MAKQLEFNDAARKSLQAGVDKLADAVKVTLGPRGRNVVLDKQWG
                     APVITNDGVSIAREVELEDPYENLGAQLAKEVATKTNDVAGDGTTTATVLAQALVNEG
                     LRNVTSGAAPAEVKRGIEAAVEKVSERLLQDAREVQGPEVAHVAAISAQSDQIGELLA
                     SAFEKVGQDGVITIEDGSSTEIELDITEGMQFDKGYLSPSFVTDAERGEAVLEDSLIL
                     LYQGKISTVAEIMPLLEKVVQAKKPLTIIAEDVDGEALSTLVVNKLRGTLDVVALKAP
                     GFGDRRKAIMQDLAILTGSIVITPELGIDLAQATLEETGSARRVTVTKNTTTIVDGGG
                     SKEAVEDRVQQLRREIEAVDSEWDREKLKERLAKLAGGVGVIKVGAATEVEAKERKHR
                     IEDAVSSTRAALEEGIVSGGGSALIHASKALDGFELDSHDANVGVQIVRRALVQPLRW
                     IAENAGDDGYVVAAKVAEQPVGHGYNAKTGEYVDLFEAGVIDPVKVTRSALQNASSIA
                     ALVLTTETLVVTKPEEEDEDE"
     misc_feature    complement(265110..266684)
                     /gene="groEL"
                     /locus_tag="HMPREF0733_10247"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12850"
                     /db_xref="CDD:237231"
     misc_feature    complement(265128..266678)
                     /gene="groEL"
                     /locus_tag="HMPREF0733_10247"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(265128..265148,265155..265157,
                     265317..265319,265536..265538,265542..265544,
                     265923..265925,266007..266009,266103..266105,
                     266460..266462,266469..266471,266481..266483,
                     266505..266507,266511..266513,266541..266543,
                     266547..266552,266565..266567,266571..266582,
                     266613..266615,266664..266666,266676..266678))
                     /gene="groEL"
                     /locus_tag="HMPREF0733_10247"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(265209..265211,265215..265217,
                     265332..265334,265449..265451,265500..265502,
                     266241..266243,266415..266417,266427..266429,
                     266589..266597))
                     /gene="groEL"
                     /locus_tag="HMPREF0733_10247"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(265293..265295,265302..265307,
                     265311..265313,265338..265340,265392..265394,
                     266361..266363))
                     /gene="groEL"
                     /locus_tag="HMPREF0733_10247"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(265464..265469,265569..265571,
                     266115..266117,266136..266138,266265..266267))
                     /gene="groEL"
                     /locus_tag="HMPREF0733_10247"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            complement(266814..267101)
                     /gene="groES"
                     /locus_tag="HMPREF0733_10248"
                     /db_xref="GeneID:9901500"
     CDS             complement(266814..267101)
                     /gene="groES"
                     /locus_tag="HMPREF0733_10248"
                     /note="COG: COG0234; Pfam: PF00166; InterPro: IPR001476"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone GroES"
                     /protein_id="YP_003983140.1"
                     /db_xref="GI:311111918"
                     /db_xref="GeneID:9901500"
                     /translation="MAIKPLEDRVVVKLEQAEQTTASGLVIPETAKEKPQEARVVAVG
                     PGRVDDKGNRVPVDIAEGDVVVFSRYGGTEVKYQGEEYLILSARDVLAIVD"
     misc_feature    complement(266820..267095)
                     /gene="groES"
                     /locus_tag="HMPREF0733_10248"
                     /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
                     cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
                     to assist the folding and assembly of proteins and is
                     found in eubacterial cytosol, as well as in the matrix of
                     mitochondria and chloroplasts. It...; Region: cpn10;
                     cd00320"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(266823..266831,266877..266879,
                     266883..266885,266898..266900,266928..266930,
                     266991..266996,267075..267077,267084..267086,
                     267090..267092))
                     /gene="groES"
                     /locus_tag="HMPREF0733_10248"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(267009..267050)
                     /gene="groES"
                     /locus_tag="HMPREF0733_10248"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(266934..266936,266967..266969))
                     /gene="groES"
                     /locus_tag="HMPREF0733_10248"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            complement(267129..267320)
                     /locus_tag="HMPREF0733_10249"
                     /db_xref="GeneID:9901501"
     CDS             complement(267129..267320)
                     /locus_tag="HMPREF0733_10249"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983141.1"
                     /db_xref="GI:311111919"
                     /db_xref="GeneID:9901501"
                     /translation="MQKAWMLRQVHGALAYYPVRETPPSKRRAFLTGCRRDSKVEFST
                     RSGAVLNAQALGLNRFTNF"
     gene            267347..268795
                     /locus_tag="HMPREF0733_10250"
                     /db_xref="GeneID:9901502"
     CDS             267347..268795
                     /locus_tag="HMPREF0733_10250"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="YP_003983142.1"
                     /db_xref="GI:311111920"
                     /db_xref="GeneID:9901502"
                     /translation="MVDFVPPPPFALPPELPFTRQALDAADALFPYSQEHSLEQVTRL
                     RAQGFTPDETANILSLVKARTRALSKFGDRARTMFLTEHGAQQATRPIVAAEHAAVFA
                     RAGVRSVADLGCGIGADSLEFARASLATVSVELDPLTASFAAANLADFSGSRVVVGDV
                     TNFNPESFRDGNGKVVQGIWLDPARRDLTGVVKSRTERIFDPEAYSPPLSFVVDLART
                     GMPMGVKLGPGMPHEAIARPEDIRSEANPHPRVTAQWVEHEGSLVELVLWFNALAQEG
                     VARTVTVLRQEATGQAEDKGLRIHKTTLRSPYSAEQVTPVDEKQTRFPSPGEYLYEPS
                     GAVVRAHLVQELAQELGANLIDPHLAYLTAAKAVQSPLAQCYEVLEEIPVHEKQLKKW
                     VRERGFTALTIKKRGVDLVPEKLRATLLAGGAGKKSGKKAAKNQGYNPATLVFTRVGS
                     GQRARRIGWHVRPVDFSDAAQVSASDTKSSLV"
     misc_feature    267671..>267898
                     /locus_tag="HMPREF0733_10250"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(267680..267700,267746..267751,267818..267826,
                     267890..267892)
                     /locus_tag="HMPREF0733_10250"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            268963..270111
                     /locus_tag="HMPREF0733_10251"
                     /db_xref="GeneID:9901503"
     CDS             268963..270111
                     /locus_tag="HMPREF0733_10251"
                     /EC_number="6.3.-.-"
                     /note="COG: COG2170; Pfam: PF04107; InterPro: IPR011793"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylate-amine ligase"
                     /protein_id="YP_003983143.1"
                     /db_xref="GI:311111921"
                     /db_xref="GeneID:9901503"
                     /translation="MIPFASSAQSTLGVEWEIALIDQHTGELVARAQEVLTRVGERYP
                     ELLEPSLDHAHVTGEFLENTLEIITGVCTTVPQACQQLISVTDKIREVTDELGLDFYA
                     AGTHPTAHWQKQQVSAKKRYQRVVGRGQYWGRHMVIFGVHVHVGVDSRDKVLPLVDAL
                     TNYCAHLLGLSVSSPYWDSVDTGYGSHRTMLYQQLPSNGLPFHFENWQEYSDYLHALV
                     KTGAILEVSEDRWDVRPVPRYGTLEMRYCDGLPSIRDVAAVTALTQCLVEFFSRKIEA
                     GEKIEVLNPWHAQENKWRAARYGLDTEIIVSNEPQVRPLREDIELLVTQLEDVARDLD
                     CLPELQHVRNMLTEGTGADRQRAIYEKTGSFHEVIRDVALQSRARPIR"
     misc_feature    268966..270102
                     /locus_tag="HMPREF0733_10251"
                     /note="carboxylate-amine ligase; Provisional; Region:
                     PRK13517"
                     /db_xref="CDD:237408"
     gene            complement(270192..271313)
                     /gene="gcp"
                     /locus_tag="HMPREF0733_10252"
                     /db_xref="GeneID:9901504"
     CDS             complement(270192..271313)
                     /gene="gcp"
                     /locus_tag="HMPREF0733_10252"
                     /EC_number="3.4.24.57"
                     /note="COG: COG0533; Pfam: PF00814; InterPro: IPR000905"
                     /codon_start=1
                     /transl_table=11
                     /product="O-sialoglycoprotein endopeptidase"
                     /protein_id="YP_003983144.1"
                     /db_xref="GI:311111922"
                     /db_xref="GeneID:9901504"
                     /translation="MMTEKTLSAAAEPLVLGIESSCDETGIGIVRGTRLLTNTISSSM
                     EEHVRFGGVIPEIASRAHLDAMIPALEAALADAHVTLDDIDAIAVTAGPGLAGALMVG
                     VSAAKALATATGKPLYGINHLVAHVGVGLLDDNGTEDGSALLEHARDGGLGALLVSGG
                     HTEILQVRDITQDVRLLGATLDDAAGEAYDKVARLLGLDYPGGPAIDRAARTGNAKAF
                     VFPRGLSNRKFMGTAEAPGAHRYNFSFSGLKTAVARVIEGFEARGEEVPVADIAASFQ
                     EAVVDVITKKAVLACREQGLHTLLLGGGVAANSRLRELLSARCTSAGVRLIIPKFTLC
                     TDNGAMVAALGARLVEAGYEPSGIDFTTDSSLPVTTVCF"
     misc_feature    complement(270198..271274)
                     /gene="gcp"
                     /locus_tag="HMPREF0733_10252"
                     /note="UGMP family protein; Validated; Region: PRK09604"
                     /db_xref="CDD:236585"
     misc_feature    complement(<270951..271271)
                     /gene="gcp"
                     /locus_tag="HMPREF0733_10252"
                     /note="Inactive homolog of metal-dependent proteases,
                     putative molecular chaperone [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     COG1214; cl17884"
                     /db_xref="CDD:248438"
     gene            complement(271317..271880)
                     /gene="rimI"
                     /locus_tag="HMPREF0733_10253"
                     /db_xref="GeneID:9901505"
     CDS             complement(271317..271880)
                     /gene="rimI"
                     /locus_tag="HMPREF0733_10253"
                     /EC_number="2.3.1.128"
                     /note="COG: COG0456; Pfam: PF00583; InterPro: IPR016181"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal-protein-alanine acetyltransferase"
                     /protein_id="YP_003983145.1"
                     /db_xref="GI:311111923"
                     /db_xref="GeneID:9901505"
                     /translation="MHSKLQHPELPGALAHGARLRRADINDVPHLFTLEQELFPLDAW
                     NLDMFLAETTHPTRTYYVLERAHSGENPQENPDEKNAPNIIGYCGVMTVADTADVQTI
                     AVLPEYEGNGYGRAMLATMHRRAQDLGAQRILLEVRADNPRAQNLYLRTGYTHIHTRP
                     GYYDDGTDALIMLKDFAADASTTTETT"
     misc_feature    complement(271365..271802)
                     /gene="rimI"
                     /locus_tag="HMPREF0733_10253"
                     /note="ribosomal-protein-alanine acetyltransferase;
                     Region: rimI; TIGR01575"
                     /db_xref="CDD:233477"
     misc_feature    complement(271473..271631)
                     /gene="rimI"
                     /locus_tag="HMPREF0733_10253"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(271536..271541,271569..271577))
                     /gene="rimI"
                     /locus_tag="HMPREF0733_10253"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(271893..272678)
                     /gene="yeaZ"
                     /locus_tag="HMPREF0733_10254"
                     /db_xref="GeneID:9901506"
     CDS             complement(271893..272678)
                     /gene="yeaZ"
                     /locus_tag="HMPREF0733_10254"
                     /note="Pfam: PF00814; InterPro: IPR000905"
                     /codon_start=1
                     /transl_table=11
                     /product="universal bacterial protein YeaZ"
                     /protein_id="YP_003983146.1"
                     /db_xref="GI:311111924"
                     /db_xref="GeneID:9901506"
                     /translation="MLILALDSSATASVALARLDGENPGSTATILAARESADTRSHAE
                     VMSPFVAQVLDKAQVNGQNVDAILTGTGPGPFTGLRAGIVTARTLGFAWNKPVYGLMS
                     LTALAERAFVQDFQGKAAQMTEILVASDARRREIYSAIFTVTENGYTIKTGPQVAPAN
                     ESMPAPGSVSGQNTAGYRAYGYGAELYREQLEQSGAQISSELSQLHPNASDLVRAAAR
                     LGIKNLSTDTRALYLRDSDAKVPAAMLARQSQCASGEPVSSKG"
     misc_feature    complement(271977..272672)
                     /gene="yeaZ"
                     /locus_tag="HMPREF0733_10254"
                     /note="tRNA threonylcarbamoyl adenosine modification
                     protein YeaZ; Region: T6A_YeaZ; TIGR03725"
                     /db_xref="CDD:234332"
     misc_feature    complement(<272262..272561)
                     /gene="yeaZ"
                     /locus_tag="HMPREF0733_10254"
                     /note="Glycoprotease family; Region: Peptidase_M22;
                     pfam00814"
                     /db_xref="CDD:250152"
     gene            complement(272797..273423)
                     /locus_tag="HMPREF0733_10255"
                     /db_xref="GeneID:9901507"
     CDS             complement(272797..273423)
                     /locus_tag="HMPREF0733_10255"
                     /note="Pfam: PF02367; InterPro: IPR003442"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP/GTP binding protein"
                     /protein_id="YP_003983147.1"
                     /db_xref="GI:311111925"
                     /db_xref="GeneID:9901507"
                     /translation="MHAHPVLEVDLADLAHTRAAAHALAPLLTAGDLLLLSGELGAGK
                     TTFTRALGEGLGVREGVISPTFVLSRVHPNLLDGTRPGGPDLVHVDAYRLSSAEELDD
                     LDLEFSLEKSVTVIEWGRGKAEHLSDSRLELDFTRLTGADASIAYAAENYSPTGEGEF
                     DWDALDDREDESADASEPRLLRITAYGPRWEGEAYRSLEAAMLKLGGE"
     misc_feature    complement(272989..273315)
                     /locus_tag="HMPREF0733_10255"
                     /note="Uncharacterized P-loop hydrolase UPF0079; Region:
                     UPF0079; cl00520"
                     /db_xref="CDD:260474"
     gene            complement(273487..274800)
                     /gene="alr"
                     /locus_tag="HMPREF0733_10256"
                     /db_xref="GeneID:9901508"
     CDS             complement(273487..274800)
                     /gene="alr"
                     /locus_tag="HMPREF0733_10256"
                     /EC_number="5.1.1.1"
                     /note="COG: COG0787; Pfam: PF01168,PF00842; InterPro:
                     IPR000821"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="YP_003983148.1"
                     /db_xref="GI:311111926"
                     /db_xref="GeneID:9901508"
                     /translation="MTVPTRPLYTPNLQPGEAERTAIIDLNALEHNTRVLKDMIGERK
                     LIAVVKADAYGHGAYPVARSVLEAGADILGVVHVTEALELRSEGITAPIIAWLHTPQT
                     DFDEALEADIILGASGWDLEAIAEAANRTKKRARVHLKVDTGLGRNGSTFEDWPALVA
                     RALELEAAGLVRIEGIFSHLAVADEPERPETARQITRLNEFVTVARSAGLTPELVHLA
                     NSPGTITGASPLYNTNEAVLADAVRCGIALYGLSPLAGVSSKDLNLRPVMTLGTHVCN
                     VKEVPAGQGVSYGLRYSTDKPTTLALIPLGYADGVPRIAEGAPVRIYPRADAANPVEP
                     RTYRVVGRIAMDQLVVDLEEPGLADPARGILGGSAVLFGSGDNPPVEEWAAAAQTINY
                     EIVTRISPRVIRIYRGGAWVEREVDGLHALGSLFGLDDEQTPETV"
     misc_feature    complement(273580..274740)
                     /gene="alr"
                     /locus_tag="HMPREF0733_10256"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Alanine Racemase; Region: PLPDE_III_AR; cd00430"
                     /db_xref="CDD:143481"
     misc_feature    complement(273580..274740)
                     /gene="alr"
                     /locus_tag="HMPREF0733_10256"
                     /note="alanine racemase; Reviewed; Region: alr; PRK00053"
                     /db_xref="CDD:234600"
     misc_feature    complement(order(273625..273627,273766..273771,
                     273880..273882,273937..273939,274063..274074,
                     274141..274146,274264..274266,274360..274362,
                     274381..274383,274513..274515,274639..274641,
                     274651..274653,274657..274659))
                     /gene="alr"
                     /locus_tag="HMPREF0733_10256"
                     /note="active site"
                     /db_xref="CDD:143481"
     misc_feature    complement(order(273625..273627,274063..274074,
                     274141..274146,274264..274266,274360..274362,
                     274513..274515,274639..274641,274651..274653,
                     274657..274659))
                     /gene="alr"
                     /locus_tag="HMPREF0733_10256"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143481"
     misc_feature    complement(order(273598..273600,273622..273627,
                     273634..273639,273760..273765,273862..273864,
                     273880..273882,273895..273897,273934..273942,
                     273946..273951,273961..273963,273967..273978,
                     274258..274260,274264..274266,274357..274368,
                     274447..274452,274561..274566,274573..274575,
                     274648..274653))
                     /gene="alr"
                     /locus_tag="HMPREF0733_10256"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143481"
     misc_feature    complement(order(273625..273627,273766..273771,
                     273880..273882,273937..273939,274264..274266,
                     274360..274362,274639..274641,274651..274653))
                     /gene="alr"
                     /locus_tag="HMPREF0733_10256"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143481"
     misc_feature    complement(order(273937..273939,274651..274653))
                     /gene="alr"
                     /locus_tag="HMPREF0733_10256"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143481"
     gene            275035..276351
                     /gene="mshA"
                     /locus_tag="HMPREF0733_10257"
                     /db_xref="GeneID:9901509"
     CDS             275035..276351
                     /gene="mshA"
                     /locus_tag="HMPREF0733_10257"
                     /EC_number="2.4.1.-"
                     /note="COG: COG0438; Pfam: PF00534; InterPro: IPR001296"
                     /codon_start=1
                     /transl_table=11
                     /product="1L-myo-inositol-1-phosphate
                     1-alpha-D-N-acetylglucosaminyltransferase"
                     /protein_id="YP_003983149.1"
                     /db_xref="GI:311111927"
                     /db_xref="GeneID:9901509"
                     /translation="MVKIPESSQSRLPQPVVHVYSLHTDPFAQPGRGDAGGMNVYIAR
                     SIAAMLAADDTLRVEVFTLLTDPDCEHAKPGVQVPTLLNSYRDRVRVHQVLIPQALGA
                     RKNQLAEFTTEFAAQCVSLACWHPQVIHAHYWLSGVAALGAAQTYAAEGTVVPVVFTP
                     HTTAAAKDARRSPDEPEEPHARYESEHRVLEHAALTIVNTSLEGQQLQDYYGADSARM
                     RVIAPGVDTGIFHPLPGVHAEHEGSDTHARVVFAGRPQPLKGPHILVEALALLPADLH
                     VELDIIGKSSSGYELDLLARARDLGIADRVHLRSPVPADILADIFRRADIVASPSSSE
                     SFGLVALEAQASGAAVLATDADGLRFAIENHKTGLLVAPRTPQRWAVAIERLVRAPRL
                     RLTLGANAAARARSFSWEATARKTLCVYSEAITGRHLAQERAEGSA"
     misc_feature    275080..276285
                     /gene="mshA"
                     /locus_tag="HMPREF0733_10257"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     misc_feature    275083..276309
                     /gene="mshA"
                     /locus_tag="HMPREF0733_10257"
                     /note="D-inositol-3-phosphate glycosyltransferase; Region:
                     mycothiol_MshA; TIGR03449"
                     /db_xref="CDD:132490"
     gene            276444..277229
                     /locus_tag="HMPREF0733_10258"
                     /db_xref="GeneID:9901510"
     CDS             276444..277229
                     /locus_tag="HMPREF0733_10258"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983150.1"
                     /db_xref="GI:311111928"
                     /db_xref="GeneID:9901510"
                     /translation="MSFAMTRDEFAAYLDSARITGDVATPRENNLSHIQGFLDHNEHL
                     EFGVTWSKDWTYDEVFEVMVRRVGLNPDRSHVQGQDTIGAAQCIDALEEYARIFGDAV
                     RARQKILFATGHPAGLFPIYAELARVAERAGATVLRIEQGERFLDGDIRQIMGVVMFE
                     QYGNLQHTHFPGPMRIALAQLRERGELPDLVVSDHGMAGYAASQQKLLTLGIADCNDP
                     GLFIAAEQGDLPVCVPMDDNVPPNRYEPLIDFLVNHASLKQFR"
     misc_feature    277692..279018
                     /note="potential frameshift: common BLAST hit:
                     gi|283457590|ref|YP_003362174.1| sugar transferase"
     gene            277692..278672
                     /locus_tag="HMPREF0733_10259"
                     /db_xref="GeneID:9901511"
     CDS             277692..278672
                     /locus_tag="HMPREF0733_10259"
                     /EC_number="2.7.8.6"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl-phosphate galactose
                     phosphotransferase"
                     /protein_id="YP_003983151.1"
                     /db_xref="GI:311111929"
                     /db_xref="GeneID:9901511"
                     /translation="MKAKERLKKVWGTTYVAKREWHPQVLKSLYLGDLIAIAISIFAA
                     HFIRFGFVNADLPPVNVWPLNLLDPSVAPIDYIFLDIGMIIIWWLTLQVNGSRNIRVL
                     GMGTDEYRMVTRGSTYFFCTLVIVAFFLKIDLTRMYLLIAYPLGLGLIMIERWLLRQR
                     LVQKRLQGYSLTRVMIISDVPTGKHLYKSLSGAVASGLSPAAFYLPGIYAGTTIADVD
                     LPILGYSTNPDDIMQAVQENNIQMVAISNGHQLTPEQMRMLGWRLADAHIALIMAPAT
                     TDIAGPRMHIQPLNGLPLVHVSTPHITGIAAPANRAQIAHGTERRQRGAL"
     misc_feature    278013..278426
                     /locus_tag="HMPREF0733_10259"
                     /note="CoA binding domain; Region: CoA_binding; cl17356"
                     /db_xref="CDD:266646"
     gene            278638..279018
                     /gene="cpsE"
                     /locus_tag="HMPREF0733_10260"
                     /db_xref="GeneID:9901512"
     CDS             278638..279018
                     /gene="cpsE"
                     /locus_tag="HMPREF0733_10260"
                     /note="COG: COG2148; Pfam: PF02397; InterPro: IPR003362"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase CpsE"
                     /protein_id="YP_003983152.1"
                     /db_xref="GI:311111930"
                     /db_xref="GeneID:9901512"
                     /translation="MEQNEGNGVLFKMVNDPRITPIGRFIRKFSIDELPQLWNVFIGD
                     MSLVGPRPPLAEEVDLYEDIMYRRLLVKPGITGLWQVSGRSDLSWDESVRLDLYYVEN
                     WSMTTDFIILLRTVRAVFAKEGAY"
     misc_feature    <278680..279015
                     /gene="cpsE"
                     /locus_tag="HMPREF0733_10260"
                     /note="Bacterial sugar transferase; Region: Bac_transf;
                     pfam02397"
                     /db_xref="CDD:251270"
     gene            complement(279117..280718)
                     /locus_tag="HMPREF0733_10261"
                     /db_xref="GeneID:9901513"
     CDS             complement(279117..280718)
                     /locus_tag="HMPREF0733_10261"
                     /note="COG: COG0063; Pfam: PF03853,PF01256; InterPro:
                     IPR000631"
                     /codon_start=1
                     /transl_table=11
                     /product="YjeF family protein"
                     /protein_id="YP_003983153.1"
                     /db_xref="GI:311111931"
                     /db_xref="GeneID:9901513"
                     /translation="MKLVYTGTQIRNAERPYLEAPDYDGYLMQRAADALAAEAHDMLA
                     DAGQHSQYTRILLLVGPGNNGADTVYAGTRLHQQGYRIEAVLFDPTGNNLELLARESG
                     EGTRVLDTAQSLRDIASYSLIIDGILGTGAKGAARGEAGEYLAKLRAVQIDGKLPPVL
                     ACDAPTGLDSERGTLHEPSLAAARTVTFIGRKLPAGTHIAEHCGTIKLYDLGVPEALK
                     GYKPMLRVMEREDYRDLLEKPSVFSHKYNRGVLGMLTGSRDYPGAALMSVRAALNTGV
                     GMVRFNGKDDTLRTLMLGQNPETVCFTGPPAHEHVHAWAGGSGTGPETLDHNRYLLNA
                     PEPAILDAGAVDLAADYLMAGHSLGEHKILTPHAGELERFLRRIHEHSPQRWEEMLDG
                     ALVPSREDINAEPFRWVRAACELSGATVMLKGSTTLIAAPVGATYSVHGATGWLATAG
                     SGDTLTGILGALLAQYMAAAQEHHEQVEGCTYASLAALAVYLHNRAALASLEGRKGPV
                     PPSRVAAYLPQAIAGLLDEKAVLDD"
     misc_feature    complement(279219..280691)
                     /locus_tag="HMPREF0733_10261"
                     /note="putative carbohydrate kinase; Provisional; Region:
                     PRK10565"
                     /db_xref="CDD:182554"
     misc_feature    complement(280140..280559)
                     /locus_tag="HMPREF0733_10261"
                     /note="YjeF-related protein N-terminus; Region: YjeF_N;
                     pfam03853"
                     /db_xref="CDD:252206"
     misc_feature    complement(279165..279992)
                     /locus_tag="HMPREF0733_10261"
                     /note="B.subtilis YXKO protein of unknown function and
                     related proteins. Based on the conservation of the ATP
                     binding site, the substrate binding site and the
                     Mg2+binding site and structural homology this group is a
                     member of the ribokinase-like superfamily; Region:
                     YXKO-related; cd01171"
                     /db_xref="CDD:238576"
     misc_feature    complement(order(279360..279362,279369..279371,
                     279921..279923))
                     /locus_tag="HMPREF0733_10261"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238576"
     misc_feature    complement(order(279237..279239,279354..279356,
                     279363..279368,279450..279452,279618..279620))
                     /locus_tag="HMPREF0733_10261"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238576"
     gene            complement(280759..281193)
                     /gene="acpS"
                     /locus_tag="HMPREF0733_10262"
                     /db_xref="GeneID:9901514"
     CDS             complement(280759..281193)
                     /gene="acpS"
                     /locus_tag="HMPREF0733_10262"
                     /EC_number="2.7.8.7"
                     /note="COG: COG0736; Pfam: PF01648; InterPro: IPR002582"
                     /codon_start=1
                     /transl_table=11
                     /product="holo-[acyl-carrier-protein] synthase"
                     /protein_id="YP_003983154.1"
                     /db_xref="GI:311111932"
                     /db_xref="GeneID:9901514"
                     /translation="MIIGIGVDTVNIERFERIVTETPAFVRRVFTPNERTRNIRSQAV
                     RFAAKEAVAKVLGAPDGLNWQDCEVASSESGQPYLILTGTIAERARTLGINRLHLSLT
                     HDEPVAVAIATAEYLSATELAHLKRFDPESYSMTVLAEDPTD"
     misc_feature    complement(280849..281193)
                     /gene="acpS"
                     /locus_tag="HMPREF0733_10262"
                     /note="4'-phosphopantetheinyl transferase; Provisional;
                     Region: acpS; PRK00070"
                     /db_xref="CDD:234610"
     gene            complement(281394..283277)
                     /gene="glmS"
                     /locus_tag="HMPREF0733_10263"
                     /db_xref="GeneID:9901515"
     CDS             complement(281394..283277)
                     /gene="glmS"
                     /locus_tag="HMPREF0733_10263"
                     /EC_number="2.6.1.16"
                     /note="COG: COG0449; Pfam: PF00310,PF01380; InterPro:
                     IPR005855"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine-fructose-6-phosphate transaminase"
                     /protein_id="YP_003983155.1"
                     /db_xref="GI:311111933"
                     /db_xref="GeneID:9901515"
                     /translation="MCGIVGYVGLDAAPDGNKFDHDAYKVVIEGLRRQEYRGYDSAGV
                     ALVCPDGIEFRKKAGKLINLEHEVEDAPLTESQIGIGHTRWATHGGPTDNNAHPHVVD
                     HGRLAVVHNGIIENFAELRAELLAEGVEFQSQTDTEVAAALIASIYNKLGTKDLTEAV
                     REASNRMEGAFTILAVHADHPDRVVATRRNSPLVIGLGENENFLGSDVSAFIDHTKEA
                     VEMGQDQIVTITGTDYSIIDFAGNPAEGKPFHIEWDAAAAEKGGYNSFMEKEIHEQPT
                     AVEQTLMGRMDEKGNLVLDELNIDDSVLRSIDKIIVVACGTAAYAGQVARYAIEHWCR
                     IPTEVELAHEFRYRDPIVNEKTLIVALSQSGETMDTLMAVRHAREQGAKVISICNTHG
                     STLPRESDAALYTHAGPEIAVASTKAFLAQITAAYLLGLYLAQLRGNKYKDEISAILG
                     ELQKMPAKIQKVIDNDTLVKELGAEMKDTSSVIFLGRHVGFPVALEGALKLKEISYIH
                     AEGFAAGELKHGPIALIEEGQPVIIIVPSAHGRESLHGKVVSNIQEVRARGAFTIVIA
                     EEGDEAVKEYADRLITVPAAPSLLQPLLATVPLQIFACALAEAKGLDVDQPRNLAKSV
                     TVE"
     misc_feature    complement(281397..283277)
                     /gene="glmS"
                     /locus_tag="HMPREF0733_10263"
                     /note="glucosamine--fructose-6-phosphate aminotransferase;
                     Reviewed; Region: PRK00331"
                     /db_xref="CDD:234729"
     misc_feature    complement(282591..283274)
                     /gene="glmS"
                     /locus_tag="HMPREF0733_10263"
                     /note="Glutamine amidotransferases class-II
                     (Gn-AT)_GFAT-type. This domain is found at the N-terminus
                     of glucosamine-6P synthase (GlmS, or GFAT in humans).  The
                     glutaminase domain catalyzes amide nitrogen transfer from
                     glutamine to the appropriate substrate. In...; Region:
                     GFAT; cd00714"
                     /db_xref="CDD:238366"
     misc_feature    complement(order(282867..282872,282942..282947,
                     282987..282989,283014..283019,283023..283028,
                     283167..283169,283272..283274))
                     /gene="glmS"
                     /locus_tag="HMPREF0733_10263"
                     /note="glutaminase active site [active]"
                     /db_xref="CDD:238366"
     misc_feature    complement(281976..282353)
                     /gene="glmS"
                     /locus_tag="HMPREF0733_10263"
                     /note="SIS (Sugar ISomerase) domain repeat 1 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_1; cd05008"
                     /db_xref="CDD:240141"
     misc_feature    complement(order(282171..282173,282237..282239,
                     282246..282248,282258..282260,282264..282266,
                     282285..282290,282297..282302,282330..282335))
                     /gene="glmS"
                     /locus_tag="HMPREF0733_10263"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240141"
     misc_feature    complement(order(282186..282194,282324..282329))
                     /gene="glmS"
                     /locus_tag="HMPREF0733_10263"
                     /note="active site"
                     /db_xref="CDD:240141"
     misc_feature    complement(281403..281873)
                     /gene="glmS"
                     /locus_tag="HMPREF0733_10263"
                     /note="SIS (Sugar ISomerase) domain repeat 2 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_2; cd05009"
                     /db_xref="CDD:240142"
     misc_feature    complement(order(281406..281408,281421..281426,
                     281616..281621,281625..281627,281637..281639,
                     281652..281654,281703..281714,281718..281726,
                     281730..281732,281742..281744,281748..281750,
                     281754..281756,281760..281762,281772..281774,
                     281814..281816))
                     /gene="glmS"
                     /locus_tag="HMPREF0733_10263"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240142"
     misc_feature    complement(order(281769..281771,281778..281780))
                     /gene="glmS"
                     /locus_tag="HMPREF0733_10263"
                     /note="active site"
                     /db_xref="CDD:240142"
     gene            283463..284419
                     /gene="coaA"
                     /locus_tag="HMPREF0733_10264"
                     /db_xref="GeneID:9901516"
     CDS             283463..284419
                     /gene="coaA"
                     /locus_tag="HMPREF0733_10264"
                     /EC_number="2.7.1.33"
                     /note="COG: COG1072; Pfam: PF00485; InterPro: IPR004566"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="YP_003983156.1"
                     /db_xref="GI:311111934"
                     /db_xref="GeneID:9901516"
                     /translation="MSSSNFSAASSRFVELERSRWSRLATEISVPLSEEELDALRGLG
                     EPVDFDEVRQIYLPISRLLNLYVNAASSLNHMTNDFLQASHRRVPFIIGVAGSVAVGK
                     STTARLLQALLRRWPSTPKVQLVTTDGFLYPNAELQRRGIMHRKGFPESYDRRALLQF
                     VSDIKSGVPVVRAPKYSHLYYDILPDEQIEVTTPDVLILEGLNVLAPAGTEGPETSDL
                     TLSDFFDFSIYVDANTKDIQRWYVNRFLTLRSSAFTNPDSYFKRYAELSDDQAIELAT
                     GIWKTVNEPNLVQNVLPTRARAHLILQKGSDHKVAQVLLRKN"
     misc_feature    283733..284407
                     /gene="coaA"
                     /locus_tag="HMPREF0733_10264"
                     /note="Pantothenate kinase (PanK) catalyzes the
                     phosphorylation of pantothenic acid to form
                     4'-phosphopantothenic, which is the first of five steps in
                     coenzyme A (CoA) biosynthetic pathway. The reaction
                     carried out by this enzyme is a key regulatory point...;
                     Region: PanK; cd02025"
                     /db_xref="CDD:238983"
     misc_feature    order(283757..283759,283766..283777,284180..284182,
                     284192..284194,284372..284374,284384..284386)
                     /gene="coaA"
                     /locus_tag="HMPREF0733_10264"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    order(283766..283771,283781..283783,283994..283996,
                     284192..284194,284204..284206,284384..284386)
                     /gene="coaA"
                     /locus_tag="HMPREF0733_10264"
                     /note="CoA-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    order(283769..283771,284060..284062)
                     /gene="coaA"
                     /locus_tag="HMPREF0733_10264"
                     /note="Mg2+-binding site [ion binding]; other site"
                     /db_xref="CDD:238983"
     gene            complement(284561..284776)
                     /locus_tag="HMPREF0733_10265"
                     /db_xref="GeneID:9901517"
     CDS             complement(284561..284776)
                     /locus_tag="HMPREF0733_10265"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983157.1"
                     /db_xref="GI:311111935"
                     /db_xref="GeneID:9901517"
                     /translation="MASGLAFSDGFVSGVFSFAVGDALGFIVGFDGVELFVTFGVAVG
                     EDDTLAGEVVPVALGVVEAVADVFPLV"
     gene            284967..285455
                     /gene="vanYB"
                     /locus_tag="HMPREF0733_10266"
                     /db_xref="GeneID:9901518"
     CDS             284967..285455
                     /gene="vanYB"
                     /locus_tag="HMPREF0733_10266"
                     /EC_number="3.4.16.4"
                     /note="COG: COG1876; Pfam: PF02557; InterPro: IPR003709"
                     /codon_start=1
                     /transl_table=11
                     /product="serine-type D-Ala-D-Ala carboxypeptidase"
                     /protein_id="YP_003983158.1"
                     /db_xref="GI:311111936"
                     /db_xref="GeneID:9901518"
                     /translation="MPFYGQQLRAEAAAAAQSMMDAAARDGVTLTVSSAYRSFAAQKQ
                     TYQHWVQVNGQKTADTLSARPGYSEHQTGLAIDFGSPEGCLLQECYQDTRAGQWLAKN
                     APDFGFILRFPKNQQHVTGYIFEPWHYRYLGVGLTQEYSASGAKTLEEFFGTGAAPDY
                     LG"
     misc_feature    285039..285368
                     /gene="vanYB"
                     /locus_tag="HMPREF0733_10266"
                     /note="D-alanyl-D-alanine carboxypeptidase; Region: VanY;
                     pfam02557"
                     /db_xref="CDD:251373"
     gene            285658..286026
                     /gene="mscL"
                     /locus_tag="HMPREF0733_10267"
                     /db_xref="GeneID:9901519"
     CDS             285658..286026
                     /gene="mscL"
                     /locus_tag="HMPREF0733_10267"
                     /note="COG: COG1970; Pfam: PF01741; InterPro: IPR001185"
                     /codon_start=1
                     /transl_table=11
                     /product="large conductance mechanosensitive channel
                     protein"
                     /protein_id="YP_003983159.1"
                     /db_xref="GI:311111937"
                     /db_xref="GeneID:9901519"
                     /translation="MLKGFKDFLIRGNVIDLAVGIIMGTAFTAVVTALVQSVLMPAIS
                     MLVQSPNFDSFLVIGQIKIGVFLTAVVNFLLIAAAVYFAVVLPVQKLNERATRNKGEE
                     EEEETELTLLKEIRDSLAKK"
     misc_feature    285658..>285939
                     /gene="mscL"
                     /locus_tag="HMPREF0733_10267"
                     /note="Large-conductance mechanosensitive channel, MscL;
                     Region: MscL; cl00860"
                     /db_xref="CDD:260664"
     gene            complement(286234..287592)
                     /gene="glmM"
                     /locus_tag="HMPREF0733_10268"
                     /db_xref="GeneID:9901520"
     CDS             complement(286234..287592)
                     /gene="glmM"
                     /locus_tag="HMPREF0733_10268"
                     /EC_number="5.4.2.10"
                     /note="COG: COG1109; Pfam:
                     PF02878,PF02879,PF02880,PF00408; InterPro: IPR006352"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="YP_003983160.1"
                     /db_xref="GI:311111938"
                     /db_xref="GeneID:9901520"
                     /translation="MTERLFGTDGVRGLANEIITPALALELAQAAALVLGHEQVAEGT
                     RPRAVIANDSRASADFIVSAMKAGFTSAGVDVLDAGIVPTPAAAYLVAYTDADFGVMI
                     SASHNPAADNGIKFLARGGQKLEDATEDAIERVYREKNFRYPTGGEVGSICALENGTE
                     AYVKHLVSTLEDEKPLTGLKIVLDCANGAAYAASPAAFTRLGAEVIALAAEPNGTNIN
                     DGVGSTHPQTLQAAVVEHGATLGIAHDGDSDRCQAVDEQGNLVDGDQIMAILALAAHR
                     AGHLSQNTLVATVMSSLGLELYLREHGISLVRTAVGDRYVLEEMREHGYNLGGEQSGH
                     VIMSDYATTGDGVLTGIQLAAEVARSGEKLSVLASRMQPTPQRLINVKGVDRAGVSTN
                     AALNAAVADAEKGLGESGRVLLRASGTEPLVRVMVEAATQEQADSVAQHLADVVAKEL
                     AL"
     misc_feature    complement(286240..287583)
                     /gene="glmM"
                     /locus_tag="HMPREF0733_10268"
                     /note="phosphoglucosamine mutase; Provisional; Region:
                     glmM; PRK14318"
                     /db_xref="CDD:237672"
     misc_feature    complement(286264..287580)
                     /gene="glmM"
                     /locus_tag="HMPREF0733_10268"
                     /note="GlmM is a bacterial phosphoglucosamine mutase
                     (PNGM) that belongs to the alpha-D-phosphohexomutase
                     superfamily. It is required for the interconversion of
                     glucosamine-6-phosphate and glucosamine-1-phosphate in the
                     biosynthetic pathway of...; Region: GlmM; cd05802"
                     /db_xref="CDD:100095"
     misc_feature    complement(order(286321..286323,286336..286344,
                     286348..286350,286591..286593,286597..286599,
                     286603..286605,286654..286662,286723..286725,
                     286843..286848,286852..286854,286858..286860,
                     287248..287250,287272..287280,287557..287559,
                     287566..287568,287572..287574))
                     /gene="glmM"
                     /locus_tag="HMPREF0733_10268"
                     /note="active site"
                     /db_xref="CDD:100095"
     misc_feature    complement(order(286321..286323,286336..286344,
                     286348..286350,286591..286593,286597..286599,
                     286603..286605,286654..286656,286660..286662,
                     286723..286725,286843..286845,287278..287280,
                     287566..287568))
                     /gene="glmM"
                     /locus_tag="HMPREF0733_10268"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100095"
     misc_feature    complement(order(286846..286848,286852..286854,
                     286858..286860,287278..287280))
                     /gene="glmM"
                     /locus_tag="HMPREF0733_10268"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100095"
     gene            complement(287694..288749)
                     /gene="ppk"
                     /locus_tag="HMPREF0733_10269"
                     /db_xref="GeneID:9901521"
     CDS             complement(287694..288749)
                     /gene="ppk"
                     /locus_tag="HMPREF0733_10269"
                     /EC_number="2.7.4.-"
                     /note="COG: COG2326; Pfam: PF03976; InterPro: IPR005660"
                     /codon_start=1
                     /transl_table=11
                     /product="PPK2 family polyphosphate:nucleotide
                     phosphotransferase"
                     /protein_id="YP_003983161.1"
                     /db_xref="GI:311111939"
                     /db_xref="GeneID:9901521"
                     /translation="MTEKNLQPATEQVESTVPETAPQSSDVADPAVSEKKHAIKEALK
                     PQVRRTSVVEDYAAELDEMASLTHALSGNKKSSRGDAWKIGYPYDEKLGRKAYEKEKR
                     ALQIELLKLQLWAKSTGQKILIIFEGRDAAGKGGSIKRFTEHLNPRGARVVALEKPTD
                     IEQTQWYFQRYIKHLPSGGEIVMMDRSWYNRAGVERVMGYCTQAQYFEFMREVPDLER
                     MLVNSGIKLIKFWFSVTKQEQLARFTSRRTDPVRQWKLSPTDLASLDKWDDYTAAKEA
                     MFFYTHTGDAPWTVIKSNDKKRARLEAMRYVLSQFDYTSKDREVVGTCDPLIVRSATD
                     VFEEEGGSDPEGFPVIQ"
     misc_feature    complement(287790..288479)
                     /gene="ppk"
                     /locus_tag="HMPREF0733_10269"
                     /note="polyphosphate kinase 2, PA0141 family; Region:
                     PPK2_P_aer; TIGR03707"
                     /db_xref="CDD:213852"
     gene            complement(288919..289416)
                     /gene="rpsI"
                     /locus_tag="HMPREF0733_10270"
                     /db_xref="GeneID:9901522"
     CDS             complement(288919..289416)
                     /gene="rpsI"
                     /locus_tag="HMPREF0733_10270"
                     /note="COG: COG0103; Pfam: PF00380; InterPro: IPR000754"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="YP_003983162.1"
                     /db_xref="GI:311111940"
                     /db_xref="GeneID:9901522"
                     /translation="MAQNEEQIVVEEELTSYTSESAAPVAAAAQTSRPALTVAGAAVG
                     RRKEAVARVRVVPGSGNWTINGRSLDSYFPNKLHQQDVNQPFKILELEGAYDVIARIS
                     GGGPSGQAGALRLGIARALNEIDRENNRPALKKAGFLTRDARVIERKKAGLKKARKAS
                     QFSKR"
     misc_feature    complement(288922..289293)
                     /gene="rpsI"
                     /locus_tag="HMPREF0733_10270"
                     /note="30S ribosomal protein S9; Reviewed; Region: rpsI;
                     PRK00132"
                     /db_xref="CDD:178888"
     gene            complement(289450..289893)
                     /gene="rplM"
                     /locus_tag="HMPREF0733_10271"
                     /db_xref="GeneID:9901523"
     CDS             complement(289450..289893)
                     /gene="rplM"
                     /locus_tag="HMPREF0733_10271"
                     /note="COG: COG0102; Pfam: PF00572; InterPro: IPR005823"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="YP_003983163.1"
                     /db_xref="GI:311111941"
                     /db_xref="GeneID:9901523"
                     /translation="MRTYTPKPGEVERQWHIIDATDVVLGRLASQTAILLRGKHKPTF
                     TPNVDTGDFVIIVNAEKVALTGAKLEQKRAYRHSGYPGGLKSVNYAELLETNPVRAVE
                     KAVKGMLPKNKLAAQQIKKLKVYAGPEHPHAAQQPKTYEFNQVAQ"
     misc_feature    complement(289510..289851)
                     /gene="rplM"
                     /locus_tag="HMPREF0733_10271"
                     /note="Ribosomal protein L13.  Protein L13, a large
                     ribosomal subunit protein, is one of five proteins
                     required for an early folding intermediate of 23S rRNA in
                     the assembly of the large subunit. L13 is situated on the
                     bottom of the large subunit, near the...; Region:
                     Ribosomal_L13; cd00392"
                     /db_xref="CDD:238230"
     misc_feature    complement(order(289522..289527,289534..289536,
                     289546..289548,289552..289554,289558..289566,
                     289570..289578,289582..289590,289606..289611,
                     289693..289695,289699..289701,289783..289785,
                     289795..289797,289804..289806,289813..289818,
                     289822..289824))
                     /gene="rplM"
                     /locus_tag="HMPREF0733_10271"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238230"
     misc_feature    complement(289606..289608)
                     /gene="rplM"
                     /locus_tag="HMPREF0733_10271"
                     /note="L3 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238230"
     gene            complement(290158..291141)
                     /gene="truA"
                     /locus_tag="HMPREF0733_10272"
                     /db_xref="GeneID:9901524"
     CDS             complement(290158..291141)
                     /gene="truA"
                     /locus_tag="HMPREF0733_10272"
                     /EC_number="5.4.99.12"
                     /note="COG: COG0101; Pfam: PF01416; InterPro: IPR001406"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="YP_003983164.1"
                     /db_xref="GI:311111942"
                     /db_xref="GeneID:9901524"
                     /translation="MSDQLQEPVPQASQINLDSQPSSGDGDVVLGTQRVRIDCAYEGT
                     WFSGWARQPNLVTVQGVLEDALELVLRAHHRVTVAGRTDAGVHAQAQTIHLDIAAETW
                     QKLTGRDGLADPAESLKRKVSGALKRTLAQAEHTLGIPERMRGLLQGSLVLHQVQPVP
                     QDFDARFSATGRRYTYRILDGQGSSPDPLRRAYAWCIPESLDLEDLNKAAHELTGLHD
                     FLSFCKPREGATTIRELRRIYLTRHDDGVIEATVEADAFCHHMVRSLIGALVLYGTGK
                     RTQTWLRERLENPQRDASLIMAPPHGLALAHIDYPAPEEYGLQARATRAMR"
     misc_feature    complement(290212..291048)
                     /gene="truA"
                     /locus_tag="HMPREF0733_10272"
                     /note="tRNA pseudouridine synthase A; Validated; Region:
                     truA; PRK00021"
                     /db_xref="CDD:234577"
     misc_feature    complement(290212..291033)
                     /gene="truA"
                     /locus_tag="HMPREF0733_10272"
                     /note="Eukaryotic and bacterial pseudouridine synthases
                     similar to E.  coli TruA; Region: PseudoU_synth_EcTruA;
                     cd02570"
                     /db_xref="CDD:211337"
     misc_feature    complement(order(290680..290703,290773..290775,
                     291022..291024))
                     /gene="truA"
                     /locus_tag="HMPREF0733_10272"
                     /note="dimerization interface 3.5A [polypeptide binding];
                     other site"
                     /db_xref="CDD:211337"
     misc_feature    complement(order(290353..290355,290893..290904))
                     /gene="truA"
                     /locus_tag="HMPREF0733_10272"
                     /note="active site"
                     /db_xref="CDD:211337"
     gene            complement(291274..291993)
                     /gene="rplQ"
                     /locus_tag="HMPREF0733_10273"
                     /db_xref="GeneID:9901525"
     CDS             complement(291274..291993)
                     /gene="rplQ"
                     /locus_tag="HMPREF0733_10273"
                     /note="COG: COG0203; Pfam: PF01196; InterPro: IPR000456"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="YP_003983165.1"
                     /db_xref="GI:311111943"
                     /db_xref="GeneID:9901525"
                     /translation="MPTPTKGPRLGGSPTHERLMLNNLSAQLFQHKRITTTLTKAKRM
                     RPVAERFITFGKKGDLAARRRVLRSITDKSVVHELFTVIAPAMAERPGGYTRITKIGN
                     RKGDNAPMAVIELVMEPVETKGAVAEATKVTEKAAEAPKAEAKKAKAEKAEPKEEAKP
                     AKSEGTEGLPAGAHAPLESGEAPEGFEVKGNADSMKYHVPGSRWYANTIAEIWFDSAE
                     SAEAAGYAPAGGAAAQKVSAE"
     misc_feature    complement(291646..291984)
                     /gene="rplQ"
                     /locus_tag="HMPREF0733_10273"
                     /note="50S ribosomal protein L17; Validated; Region: rplQ;
                     PRK05591"
                     /db_xref="CDD:235522"
     misc_feature    complement(291340..>291456)
                     /gene="rplQ"
                     /locus_tag="HMPREF0733_10273"
                     /note="Ribosomal protein L4/L1 family; Region:
                     Ribosomal_L4; cl00325"
                     /db_xref="CDD:260356"
     gene            complement(292094..293086)
                     /gene="rpoA"
                     /locus_tag="HMPREF0733_10274"
                     /db_xref="GeneID:9901526"
     CDS             complement(292094..293086)
                     /gene="rpoA"
                     /locus_tag="HMPREF0733_10274"
                     /EC_number="2.7.7.6"
                     /note="COG: COG0202; Pfam: PF01193,PF01000,PF03118;
                     InterPro: IPR011773"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="YP_003983166.1"
                     /db_xref="GI:311111944"
                     /db_xref="GeneID:9901526"
                     /translation="MLIAQRPTLTEEVVAPNRSRFTIEPLEPGFGYTMGNSLRRTLLS
                     SIPGAAVTSVRIDGVLHEFSTVPGVTEDVTEIILNVKKLSISSENDEPVVAYLRKQGE
                     GELTAADIEVPAGVEIHNPELHIATLNAKANFNAELIIERGRGYVSAAQNKTGDAEIG
                     RIPVDSIYSPVLKVTFSVNATRVEQRTDFDSLTLDVETKEAIAPRDAVASAGSTLVEL
                     FGLARELNVAAEGIEVGPSPADESMAADLALPIEDLNMSVRSYNCLKREGIHTVGELV
                     TRSEADLMDIRNFGAKSIDEVKAKLHELGLALKDSPPGFEPVARAYDDEDGSGE"
     misc_feature    complement(292157..293086)
                     /gene="rpoA"
                     /locus_tag="HMPREF0733_10274"
                     /note="DNA-directed RNA polymerase subunit alpha;
                     Provisional; Region: PRK05182"
                     /db_xref="CDD:235359"
     misc_feature    complement(292430..293041)
                     /gene="rpoA"
                     /locus_tag="HMPREF0733_10274"
                     /note="N-terminal domain of the Alpha subunit of Bacterial
                     RNA polymerase; Region: RNAP_alpha_NTD; cd06928"
                     /db_xref="CDD:132904"
     misc_feature    complement(order(292502..292504,292508..292510,
                     292517..292519,292547..292558,292562..292570,
                     292586..292588,292592..292594,292649..292651,
                     292700..292702,292844..292846,292862..292864,
                     292877..292888,292892..292894,292898..292900,
                     292904..292906,292967..292972,292979..292981,
                     292991..292993,293027..293029))
                     /gene="rpoA"
                     /locus_tag="HMPREF0733_10274"
                     /note="alphaNTD - beta interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:132904"
     misc_feature    complement(order(292430..292435,292439..292444,
                     292451..292453,292952..292954,292964..292969,
                     292976..292978,292988..292990,292997..293005,
                     293009..293011,293018..293020))
                     /gene="rpoA"
                     /locus_tag="HMPREF0733_10274"
                     /note="alphaNTD homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132904"
     misc_feature    complement(order(292541..292543,292568..292573,
                     292586..292588,292643..292645,292649..292654,
                     292841..292846,292853..292855,292862..292864,
                     292898..292900))
                     /gene="rpoA"
                     /locus_tag="HMPREF0733_10274"
                     /note="alphaNTD - beta' interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:132904"
     misc_feature    complement(292178..292354)
                     /gene="rpoA"
                     /locus_tag="HMPREF0733_10274"
                     /note="Bacterial RNA polymerase, alpha chain C terminal
                     domain; Region: RNA_pol_A_CTD; pfam03118"
                     /db_xref="CDD:251738"
     gene            complement(293224..293628)
                     /gene="rpsK"
                     /locus_tag="HMPREF0733_10275"
                     /db_xref="GeneID:9901527"
     CDS             complement(293224..293628)
                     /gene="rpsK"
                     /locus_tag="HMPREF0733_10275"
                     /note="COG: COG0100; Pfam: PF00411; InterPro: IPR001971"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="YP_003983167.1"
                     /db_xref="GI:311111945"
                     /db_xref="GeneID:9901527"
                     /translation="MPPKTRAAAARKTRRKVSKNIVAGQAHIKSTFNNTIVSITDPTG
                     AVISWSSAGDMGFKGSRKSTPYAAQLAAETAANRAKEHGVRKVDVFVKGPGSGRETAI
                     RSLQAAGLEVGSIQDVTPVAHNGCRPPKRRRV"
     misc_feature    complement(293227..293580)
                     /gene="rpsK"
                     /locus_tag="HMPREF0733_10275"
                     /note="30S ribosomal protein S11; Validated; Region:
                     PRK05309"
                     /db_xref="CDD:180007"
     gene            complement(293697..294158)
                     /gene="rpsM"
                     /locus_tag="HMPREF0733_10276"
                     /db_xref="GeneID:9901528"
     CDS             complement(293697..294158)
                     /gene="rpsM"
                     /locus_tag="HMPREF0733_10276"
                     /note="COG: COG0099; Pfam: PF00416; InterPro: IPR001892"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="YP_003983168.1"
                     /db_xref="GI:311111946"
                     /db_xref="GeneID:9901528"
                     /translation="MRIPPDSEAGDRANTRAVMLQTSGKQQGEASMARLAGVDIPREK
                     RVEVALTYIYGVGKTRAHETLAATGVNPDTRVKDLTDQELVALRDFIEGNYKVEGDLR
                     REVAADIRRKVEIGSYQGLRHRRGLPVHGQRTKTNARTRKGPKRTVAGKKK"
     misc_feature    complement(293700..294065)
                     /gene="rpsM"
                     /locus_tag="HMPREF0733_10276"
                     /note="30S ribosomal protein S13; Validated; Region: rpsM;
                     PRK05179"
                     /db_xref="CDD:235358"
     gene            complement(294239..294439)
                     /locus_tag="HMPREF0733_10277"
                     /db_xref="GeneID:9901529"
     CDS             complement(294239..294439)
                     /locus_tag="HMPREF0733_10277"
                     /note="COG: COG0257; Pfam: PF00444; InterPro: IPR000473"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="YP_003983169.1"
                     /db_xref="GI:311111947"
                     /db_xref="GeneID:9901529"
                     /translation="MFIGINSSSGCPVRTSYLASYQVAIKRNAMKVKPSVKPICDKCK
                     VIRRHGVVMVICENPRHKQRQG"
     misc_feature    complement(294242..294352)
                     /locus_tag="HMPREF0733_10277"
                     /note="50S ribosomal protein L36; Reviewed; Region: rpmJ;
                     PRK00465"
                     /db_xref="CDD:179039"
     gene            complement(294479..294700)
                     /gene="infA"
                     /locus_tag="HMPREF0733_10278"
                     /db_xref="GeneID:9901530"
     CDS             complement(294479..294700)
                     /gene="infA"
                     /locus_tag="HMPREF0733_10278"
                     /note="COG: COG0361; Pfam: PF01176; InterPro: IPR012340"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="YP_003983170.1"
                     /db_xref="GI:311111948"
                     /db_xref="GeneID:9901530"
                     /translation="MAKKDGVIEIEGSVVEALPNAMFRVELDNGHKVLAHISGKMRQH
                     YIRILPEDRVVVELSPYDLSRGRIVYRYK"
     misc_feature    complement(294488..294679)
                     /gene="infA"
                     /locus_tag="HMPREF0733_10278"
                     /note="S1_IF1: Translation Initiation Factor IF1, S1-like
                     RNA-binding domain. IF1 contains an S1-like RNA-binding
                     domain, which is found in a wide variety of RNA-associated
                     proteins. Translation initiation includes a number of
                     interrelated steps preceding the...; Region: S1_IF1;
                     cd04451"
                     /db_xref="CDD:239898"
     misc_feature    complement(order(294500..294502,294506..294508,
                     294557..294568,294581..294586,294593..294595,
                     294629..294631,294647..294655))
                     /gene="infA"
                     /locus_tag="HMPREF0733_10278"
                     /note="rRNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239898"
     misc_feature    complement(order(294488..294490,294581..294583,
                     294593..294595))
                     /gene="infA"
                     /locus_tag="HMPREF0733_10278"
                     /note="predicted 30S ribosome binding site; other site"
                     /db_xref="CDD:239898"
     gene            complement(294909..296138)
                     /locus_tag="HMPREF0733_10279"
                     /db_xref="GeneID:9901531"
     CDS             complement(294909..296138)
                     /locus_tag="HMPREF0733_10279"
                     /note="COG: COG0820; Pfam: PF04055; InterPro: IPR004383"
                     /codon_start=1
                     /transl_table=11
                     /product="cfr family radical SAM enzyme"
                     /protein_id="YP_003983171.1"
                     /db_xref="GI:311111949"
                     /db_xref="GeneID:9901531"
                     /translation="MSETLTGCAAASTDSTSRSTKVPVEISSVRPEPGKIALKAPRRT
                     KPPKHIADFDMAGRREFLKELGYQPFRASQLSKHYFERLVNDPAQMTDLPAQDRDEIV
                     SRAMPQLLTPVRTLEADGGDTLKVVHRLFDGALIESVIMRYDNRVTMCISSQAGCGMN
                     CPFCATGQQGLTRNLSTAEIVEQVVAGARYLKQMKGLDKADGGSEDTRPLRVSNIVFM
                     GMGEALANYKSTMGAVHRLIDPAPEGLGISARGLTMSTVGLVPGIRKFELEKLPITLA
                     LSLHAPDDELRDELIPINQRWKVDETLDAAYDYYRTTGRRISIEYALIRDINDQGWRA
                     DLLGKKLAQRGRGWVHVNPIPLNPTPGSKWTASRKGVEQNFVERLRAHGIPTTIRDTR
                     GSDIDGACGQLAAKEEE"
     misc_feature    complement(294918..296000)
                     /locus_tag="HMPREF0733_10279"
                     /note="Predicted Fe-S-cluster redox enzyme [General
                     function prediction only]; Region: COG0820"
                     /db_xref="CDD:223890"
     misc_feature    complement(295053..295673)
                     /locus_tag="HMPREF0733_10279"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(295071..295076,295173..295175,
                     295305..295307,295368..295376,295473..295478,
                     295482..295484,295644..295652,295656..295658,
                     295662..295664,295668..295670))
                     /locus_tag="HMPREF0733_10279"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(296219..297055)
                     /gene="map"
                     /locus_tag="HMPREF0733_10280"
                     /db_xref="GeneID:9901532"
     CDS             complement(296219..297055)
                     /gene="map"
                     /locus_tag="HMPREF0733_10280"
                     /EC_number="3.4.11.18"
                     /note="COG: COG0024; Pfam: PF00557; InterPro: IPR002467"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="YP_003983172.1"
                     /db_xref="GI:311111950"
                     /db_xref="GeneID:9901532"
                     /translation="MARVEIKTNAQLHHMSRAGIITSRALDAAVAAAKPGVSTAELNK
                     VFERSLEEQGGISNFYGYYDYPASICTSVNHEVVHGIPGDYILQDGDIISIDGGAYII
                     DPATKKQWHGDSARTVLVGHTSQARRDLSDITREALWHGIAALAHAKKIGEVGIAIEE
                     FVRSETGDTYGIIEDYVGHGIGTQMHMAPDVLNYAARDLGPKIKPGMAFAIEPMLVMG
                     NTDTTVLEDDWTVITTDRSDACQWEHSVAVHRDGLWVLTAEDGGASELARFGIIPVPI
                     PK"
     misc_feature    complement(296285..297013)
                     /gene="map"
                     /locus_tag="HMPREF0733_10280"
                     /note="Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also
                     known as methionyl aminopeptidase and Peptidase M.
                     Catalyzes release of N-terminal amino acids,
                     preferentially methionine, from peptides and arylamides;
                     Region: MetAP1; cd01086"
                     /db_xref="CDD:238519"
     misc_feature    complement(order(296327..296329,296420..296422,
                     296519..296521,296717..296719,296768..296770,
                     296819..296821))
                     /gene="map"
                     /locus_tag="HMPREF0733_10280"
                     /note="active site"
                     /db_xref="CDD:238519"
     gene            complement(297173..297736)
                     /gene="adk"
                     /locus_tag="HMPREF0733_10281"
                     /db_xref="GeneID:9901533"
     CDS             complement(297173..297736)
                     /gene="adk"
                     /locus_tag="HMPREF0733_10281"
                     /EC_number="2.7.4.3"
                     /note="COG: COG0563; Pfam: PF00406; InterPro: IPR006259"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="YP_003983173.1"
                     /db_xref="GI:311111951"
                     /db_xref="GeneID:9901533"
                     /translation="MNRLLIIGPPGAGKGTQAVKIAEELKIPAISTGDIFRKNIKEET
                     ELGKEAKSYIDSGNLVPDSVTNNMVRARLDEADVAHGFLLDGYPRNIAQVHELDAILA
                     DKNQQIDRVLLLVADDDELVARLLNRAAEQGRTDDNEEVIRHRLKVYEEETAPLVAKY
                     RERGIVKEVDGLGEIADVTERILKALS"
     misc_feature    complement(297176..297730)
                     /gene="adk"
                     /locus_tag="HMPREF0733_10281"
                     /note="adenylate kinase; Reviewed; Region: adk; PRK00279"
                     /db_xref="CDD:234711"
     misc_feature    complement(297203..297730)
                     /gene="adk"
                     /locus_tag="HMPREF0733_10281"
                     /note="Adenylate kinase (ADK) catalyzes the reversible
                     phosphoryl transfer from adenosine triphosphates (ATP) to
                     adenosine monophosphates (AMP) and to yield adenosine
                     diphosphates (ADP). This enzyme is required for the
                     biosynthesis of ADP and is essential for...; Region: ADK;
                     cd01428"
                     /db_xref="CDD:238713"
     misc_feature    complement(order(297458..297460,297470..297475,
                     297479..297484,297557..297559,297626..297628,
                     297641..297643))
                     /gene="adk"
                     /locus_tag="HMPREF0733_10281"
                     /note="AMP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238713"
     misc_feature    complement(order(297290..297292,297302..297304,
                     297353..297355,297470..297472,297482..297484,
                     297626..297628))
                     /gene="adk"
                     /locus_tag="HMPREF0733_10281"
                     /note="ATP-AMP (Ap5A)-binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238713"
     gene            complement(297733..299040)
                     /gene="secY"
                     /locus_tag="HMPREF0733_10282"
                     /db_xref="GeneID:9901534"
     CDS             complement(297733..299040)
                     /gene="secY"
                     /locus_tag="HMPREF0733_10282"
                     /note="COG: COG0201; Pfam: PF00344; InterPro: IPR002208"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="YP_003983174.1"
                     /db_xref="GI:311111952"
                     /db_xref="GeneID:9901534"
                     /translation="MLSAFGRVIKTADLRRKLLFTLGMIVLYRMGTFIPAPGISYGTV
                     QQCLNANQTHGGAYDIINLFSGGALLQLSIFALGVMPYITASIIIQLLRVVIPRFQEL
                     HDEGAQGQAKLTQYTRYLTIALALLNATTIVSMARSGVLLGNCPGIIPQDDVLHILVI
                     IITLCAGTGVIMWMGEQITERGVGNGMSLLIFTSIASSFPNALGSILEQQGPFVFWSV
                     CLVGLAVMLAVVYVEQSVRRVPVQYAKRMIGRRTIGGTSTYIPLKVNMAGVIPIIFAS
                     SLLTLPGIIAQFNTPQGGAAPPEWVNWVNTYLTRGDHPLYIALYFLLILGFTYFYVAV
                     TFDPVEVADNMKKYGGFIPGVRAGKPTERYLSYVLTRITLPGSLYLAVVSMIPLVALV
                     LFNANQNFPFGGASLLIVVGVGLDTLKQVSAQLQQRNYEGLLR"
     misc_feature    complement(297739..299040)
                     /gene="secY"
                     /locus_tag="HMPREF0733_10282"
                     /note="preprotein translocase subunit SecY; Reviewed;
                     Region: secY; PRK09204"
                     /db_xref="CDD:236412"
     misc_feature    complement(297784..298824)
                     /gene="secY"
                     /locus_tag="HMPREF0733_10282"
                     /note="SecY translocase; Region: SecY; pfam00344"
                     /db_xref="CDD:249786"
     gene            complement(299313..299759)
                     /gene="rplO"
                     /locus_tag="HMPREF0733_10283"
                     /db_xref="GeneID:9901535"
     CDS             complement(299313..299759)
                     /gene="rplO"
                     /locus_tag="HMPREF0733_10283"
                     /note="COG: COG0200; Pfam: PF01305,PF00256; InterPro:
                     IPR005749"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="YP_003983175.1"
                     /db_xref="GI:311111953"
                     /db_xref="GeneID:9901535"
                     /translation="MADAIKIHDLRPAPGAHKAKTRVGRGEGSKGKTAGRGTKGTKAR
                     YQVRPGFEGGQLPLHMRLPKLRGFKNPFRTEYQVVNLKRIQELFPEGGEVTVEALVAK
                     GAVRKNELVKVLGDGDITVKVNVVVDKASASAISKIEAAGGSVTVK"
     misc_feature    complement(299319..299747)
                     /gene="rplO"
                     /locus_tag="HMPREF0733_10283"
                     /note="50S ribosomal protein L15; Reviewed; Region: rplO;
                     PRK05592"
                     /db_xref="CDD:235523"
     gene            complement(299761..299967)
                     /gene="rpmD"
                     /locus_tag="HMPREF0733_10284"
                     /db_xref="GeneID:9901536"
     CDS             complement(299761..299967)
                     /gene="rpmD"
                     /locus_tag="HMPREF0733_10284"
                     /note="Pfam: PF00327; InterPro: IPR005996"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="YP_003983176.1"
                     /db_xref="GI:311111954"
                     /db_xref="GeneID:9901536"
                     /translation="MAKRIQPSDAKLEITQVKSYVGQKQNMRDTLRSLGLKRPGNKVV
                     RTADPVTVGMVNTVAHLVKVEEVK"
     misc_feature    complement(299773..299934)
                     /gene="rpmD"
                     /locus_tag="HMPREF0733_10284"
                     /note="Ribosomal protein L30, which is found in eukaryotes
                     and prokaryotes but not in archaea, is one of the smallest
                     ribosomal proteins with a molecular mass of about 7kDa.
                     L30 binds the 23SrRNA as well as the 5S rRNA and is one of
                     five ribosomal proteins that...; Region: Ribosomal_L30;
                     cd01658"
                     /db_xref="CDD:100100"
     misc_feature    complement(order(299806..299811,299815..299823,
                     299830..299835,299848..299850,299857..299859,
                     299863..299871,299878..299883,299890..299898,
                     299902..299907,299911..299916))
                     /gene="rpmD"
                     /locus_tag="HMPREF0733_10284"
                     /note="23S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100100"
     gene            complement(299967..300638)
                     /gene="rpsE"
                     /locus_tag="HMPREF0733_10285"
                     /db_xref="GeneID:9901537"
     CDS             complement(299967..300638)
                     /gene="rpsE"
                     /locus_tag="HMPREF0733_10285"
                     /note="COG: COG0098; Pfam: PF00333,PF03719; InterPro:
                     IPR000851"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="YP_003983177.1"
                     /db_xref="GI:311111955"
                     /db_xref="GeneID:9901537"
                     /translation="MSEQNVKETQVSEAVAAETAETSKQREERRNNRGERRGRGDRKN
                     RAREEEKDKYIERVVTINRVSKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAKEVPAA
                     IAKGVEEAKKNFFRVPRIENRTIPHRVQGEEAAGVVMLRPATAGTGVIAGGPVRAVLE
                     AAGIHDVLSKSLGSSNQINIVHATVAALKQLEEPLAVAARRGLPNDEVIPSYLRNTKS
                     DKAGA"
     misc_feature    complement(300009..300515)
                     /gene="rpsE"
                     /locus_tag="HMPREF0733_10285"
                     /note="30S ribosomal protein S5; Validated; Region: rpsE;
                     PRK00550"
                     /db_xref="CDD:234790"
     misc_feature    complement(300282..300473)
                     /gene="rpsE"
                     /locus_tag="HMPREF0733_10285"
                     /note="Ribosomal protein S5, N-terminal domain; Region:
                     Ribosomal_S5; pfam00333"
                     /db_xref="CDD:144065"
     misc_feature    complement(300033..300254)
                     /gene="rpsE"
                     /locus_tag="HMPREF0733_10285"
                     /note="Ribosomal protein S5, C-terminal domain; Region:
                     Ribosomal_S5_C; pfam03719"
                     /db_xref="CDD:252121"
     gene            complement(300638..301000)
                     /gene="rplR"
                     /locus_tag="HMPREF0733_10286"
                     /db_xref="GeneID:9901538"
     CDS             complement(300638..301000)
                     /gene="rplR"
                     /locus_tag="HMPREF0733_10286"
                     /note="COG: COG0256; Pfam: PF00861; InterPro: IPR005484"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="YP_003983178.1"
                     /db_xref="GI:311111956"
                     /db_xref="GeneID:9901538"
                     /translation="MAIKSKASQRARRHARIRKYVSGTAARPRLCVTRSSRHMFVQVI
                     DDVKGVTLASASTMEAELRAATDLDKTAKAKRVGELVAERAKAAGIETVVFDRGGNKY
                     HGRVAAVADGAREGGLAL"
     misc_feature    complement(300647..300952)
                     /gene="rplR"
                     /locus_tag="HMPREF0733_10286"
                     /note="Ribosomal L18/L5e:  L18 (L5e) is a ribosomal
                     protein found in the central protuberance (CP) of the
                     large subunit. L18 binds 5S rRNA and induces a
                     conformational change that stimulates the binding of L5 to
                     5S rRNA. Association of 5S rRNA with 23S rRNA...; Region:
                     Ribosomal_L18_L5e; cd00432"
                     /db_xref="CDD:238246"
     misc_feature    complement(order(300659..300661,300707..300709,
                     300716..300718,300938..300943,300950..300952))
                     /gene="rplR"
                     /locus_tag="HMPREF0733_10286"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238246"
     misc_feature    complement(300950..300952)
                     /gene="rplR"
                     /locus_tag="HMPREF0733_10286"
                     /note="L21e interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    complement(order(300686..300688,300719..300721,
                     300839..300841,300848..300856,300875..300877,
                     300881..300883,300887..300904,300914..300916,
                     300929..300931,300935..300940,300944..300946))
                     /gene="rplR"
                     /locus_tag="HMPREF0733_10286"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    complement(order(300932..300937,300944..300946))
                     /gene="rplR"
                     /locus_tag="HMPREF0733_10286"
                     /note="L27 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    complement(300701..300703)
                     /gene="rplR"
                     /locus_tag="HMPREF0733_10286"
                     /note="L5 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     gene            complement(301003..301539)
                     /gene="rplF"
                     /locus_tag="HMPREF0733_10287"
                     /db_xref="GeneID:9901539"
     CDS             complement(301003..301539)
                     /gene="rplF"
                     /locus_tag="HMPREF0733_10287"
                     /note="COG: COG0097; Pfam: PF00347; InterPro: IPR000702"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="YP_003983179.1"
                     /db_xref="GI:311111957"
                     /db_xref="GeneID:9901539"
                     /translation="MSRIGRLPISVPAGVEVKVDGNLVTVKGSKGELSHQVASPITVA
                     LNDNEIAVSRPNDERVSRSLHGLTRTLIQNMIIGVTNGYEKKLEIVGTGYRVTAKGND
                     LEFALGYSHPISVSAPEGVSFAVEGANKLTISGIDKQLVGQVAANIRGLRKPDPYKGK
                     GVRYAGEHIRRKVGKAGK"
     misc_feature    complement(301006..301539)
                     /gene="rplF"
                     /locus_tag="HMPREF0733_10287"
                     /note="50S ribosomal protein L6; Validated; Region: rplF;
                     PRK05498"
                     /db_xref="CDD:235495"
     misc_feature    complement(301294..301509)
                     /gene="rplF"
                     /locus_tag="HMPREF0733_10287"
                     /note="Ribosomal protein L6; Region: Ribosomal_L6;
                     pfam00347"
                     /db_xref="CDD:249789"
     misc_feature    complement(301048..301272)
                     /gene="rplF"
                     /locus_tag="HMPREF0733_10287"
                     /note="Ribosomal protein L6; Region: Ribosomal_L6;
                     pfam00347"
                     /db_xref="CDD:249789"
     gene            complement(301567..301965)
                     /gene="rpsH"
                     /locus_tag="HMPREF0733_10288"
                     /db_xref="GeneID:9901540"
     CDS             complement(301567..301965)
                     /gene="rpsH"
                     /locus_tag="HMPREF0733_10288"
                     /note="COG: COG0096; Pfam: PF00410; InterPro: IPR000630"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="YP_003983180.1"
                     /db_xref="GI:311111958"
                     /db_xref="GeneID:9901540"
                     /translation="MTMTDPVADMLTRLRNANSAYHDTVSMPYSKLKARIAEILKAEG
                     YIADVKEEEAKVGKTLTLVLKYGPSRERSIAGVRRISKPGLRTYAKSTNLPRVLGGLG
                     TAILSTSSGLLTDKQAAKKGVGGEVLAYIW"
     misc_feature    complement(301570..301962)
                     /gene="rpsH"
                     /locus_tag="HMPREF0733_10288"
                     /note="30S ribosomal protein S8; Validated; Region: rpsH;
                     PRK00136"
                     /db_xref="CDD:234658"
     gene            complement(302039..302599)
                     /gene="rplE"
                     /locus_tag="HMPREF0733_10289"
                     /db_xref="GeneID:9901541"
     CDS             complement(302039..302599)
                     /gene="rplE"
                     /locus_tag="HMPREF0733_10289"
                     /note="COG: COG0094; Pfam: PF00281,PF00673; InterPro:
                     IPR002132"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="YP_003983181.1"
                     /db_xref="GI:311111959"
                     /db_xref="GeneID:9901541"
                     /translation="MSETKITPRFKTKYAEVVVPALQEEFKYQNVMQTPKFVKVVVNM
                     GVGEAARDAKLMDGAIRDLTAITGQKPVVTRAKKSIAQFKLREGMPIGAHVTLRGDRM
                     WEFLDRLVTLALPRIRDFRGLSDRQFDGNGNYTFGLTEQSMFHEIDQDSIDRVRGMDI
                     TVVTSAKTDDEGRAMLKALGFPFKTN"
     misc_feature    complement(302048..302581)
                     /gene="rplE"
                     /locus_tag="HMPREF0733_10289"
                     /note="50S ribosomal protein L5; Validated; Region: rplE;
                     PRK00010"
                     /db_xref="CDD:178791"
     misc_feature    complement(302342..302512)
                     /gene="rplE"
                     /locus_tag="HMPREF0733_10289"
                     /note="Ribosomal protein L5; Region: Ribosomal_L5;
                     pfam00281"
                     /db_xref="CDD:109342"
     misc_feature    complement(302048..302332)
                     /gene="rplE"
                     /locus_tag="HMPREF0733_10289"
                     /note="ribosomal L5P family C-terminus; Region:
                     Ribosomal_L5_C; pfam00673"
                     /db_xref="CDD:250045"
     gene            complement(302599..302934)
                     /gene="rplX"
                     /locus_tag="HMPREF0733_10290"
                     /db_xref="GeneID:9901542"
     CDS             complement(302599..302934)
                     /gene="rplX"
                     /locus_tag="HMPREF0733_10290"
                     /note="COG: COG0198; Pfam: PF00467; InterPro: IPR003256"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="YP_003983182.1"
                     /db_xref="GI:311111960"
                     /db_xref="GeneID:9901542"
                     /translation="MAKIKSGDLVQVISGADKGKQGKVLKVIPKENRVIVEGVKVVTK
                     HTKANPVTGAAGGIQKVEAPIHVSNVAIVDPETEKPTRVGFREETVERNGKQRTVRVR
                     VAKRSGKDI"
     misc_feature    complement(302719..302916)
                     /gene="rplX"
                     /locus_tag="HMPREF0733_10290"
                     /note="KOW motif of Ribosomal Protein L26; Region:
                     KOW_RPL26; cd06089"
                     /db_xref="CDD:240513"
     misc_feature    complement(order(302731..302736,302803..302808,
                     302851..302853,302887..302895))
                     /gene="rplX"
                     /locus_tag="HMPREF0733_10290"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240513"
     gene            complement(302938..303372)
                     /gene="rplN"
                     /locus_tag="HMPREF0733_10291"
                     /db_xref="GeneID:9901543"
     CDS             complement(302938..303372)
                     /gene="rplN"
                     /locus_tag="HMPREF0733_10291"
                     /note="COG: COG0093; Pfam: PF00238; InterPro: IPR005745"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="YP_003983183.1"
                     /db_xref="GI:311111961"
                     /db_xref="GeneID:9901543"
                     /translation="MFRKAGSRLKASRNRRDDRRNMIQQESRLKVADNTGAKEILTIR
                     VLGGSSRRYAGIGDIIVATVKDAIPGGTVKKGDVVKAVVVRTKKATRRADGSYIKFDE
                     NSAVILKNTDGDPRGTRIFGPVGRELRDKKFMKIVSLAPEVL"
     misc_feature    complement(302941..303309)
                     /gene="rplN"
                     /locus_tag="HMPREF0733_10291"
                     /note="50S ribosomal protein L14; Validated; Region: rplN;
                     PRK05483"
                     /db_xref="CDD:180117"
     gene            complement(303775..304089)
                     /locus_tag="HMPREF0733_10292"
                     /db_xref="GeneID:9901544"
     CDS             complement(303775..304089)
                     /locus_tag="HMPREF0733_10292"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983184.1"
                     /db_xref="GI:311111962"
                     /db_xref="GeneID:9901544"
                     /translation="MRILSSIKLGPILKLISFFVSGSFKHARTRGNAVATTARVNPNT
                     LVSRRLQNDRLHWMSIFKRQGSTTCKAHMVRYSITATVMFGWAAQTLSVMVYAHDNFS
                     PV"
     gene            complement(304763..306679)
                     /locus_tag="HMPREF0733_10293"
                     /db_xref="GeneID:9901545"
     CDS             complement(304763..306679)
                     /locus_tag="HMPREF0733_10293"
                     /note="Pfam: PF01436,PF00395; InterPro: IPR015943"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983185.1"
                     /db_xref="GI:311111963"
                     /db_xref="GeneID:9901545"
                     /translation="MASLSAMPASFANEQQPAPHDNSSGCRNIAITADRYQGLPGEYQ
                     LAYSNYTRNLYTTFSNGRPPVYTGGIGVWTTYGEIPTLDEVMLPGTVDFVPSGQTEAT
                     SKQLASPDGIAIDDAHGTIWVTQTRTNSVTVYDLYTKKELWTSYDAQNPENGSVSRPR
                     EVKVDAKSGKAFVSGSGGVTVFDLKSHQVIQKINFTSSDGSADTGMNMELDSEGGRLY
                     VPSLNSGTLKAINTETLAVEQTIELHKDVADAQLRPSDVTIDKSLGEIYVSSQGDMDR
                     ETKVSKGNSGITVYDLKTGEYKKSINFGKQTLAITADEEHDVVYATDFATGKIGVIDG
                     RTGSITHEVSTGAEGGANDVLVTPEGEVYAVVRDKFADNVTTGYTLDPTTGKFKEAAS
                     AEPKGENGADTPITVNSLVKITPTFTAVPNIPQCDPVQTQQVVATTSTAGAVYPRGTS
                     TVPVQTKTDTPVFSDVPEGSPFYADIQWLAHQRLSFGWADGTYRPQQTVDRGAMAAYF
                     YRLAGSPEVALPEISPFKDVDSSHPFYKEIVWMSQQGITTGYEDGTYRPGISVDRGAM
                     AAFFFRYAKVTNYEVPQTPQFKDVDRNNPFYREISWFKDQHITTGWGDGTFRPNEPIQ
                     RAAMAAFIHRFAVK"
     misc_feature    complement(<305609..306559)
                     /locus_tag="HMPREF0733_10293"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3391"
                     /db_xref="CDD:225926"
     misc_feature    complement(305165..305293)
                     /locus_tag="HMPREF0733_10293"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    complement(304979..305110)
                     /locus_tag="HMPREF0733_10293"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    complement(304793..304924)
                     /locus_tag="HMPREF0733_10293"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            complement(307064..307336)
                     /gene="rpsQ"
                     /locus_tag="HMPREF0733_10294"
                     /db_xref="GeneID:9901546"
     CDS             complement(307064..307336)
                     /gene="rpsQ"
                     /locus_tag="HMPREF0733_10294"
                     /note="COG: COG0186; Pfam: PF00366; InterPro: IPR000266"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="YP_003983186.1"
                     /db_xref="GI:311111964"
                     /db_xref="GeneID:9901546"
                     /translation="MSEVKNEERGYRKSRRGYVVSDKMDKTVVVEVEDRVKHALYGKV
                     MRRSSKIKAHDEQNVCGVGDYVLLAETRPLSATKRWRVVEILEKAK"
     misc_feature    complement(307067..307318)
                     /gene="rpsQ"
                     /locus_tag="HMPREF0733_10294"
                     /note="30S ribosomal protein S17; Reviewed; Region: rpsQ;
                     PRK05610"
                     /db_xref="CDD:235532"
     gene            complement(307333..307572)
                     /gene="rpmC"
                     /locus_tag="HMPREF0733_10295"
                     /db_xref="GeneID:9901547"
     CDS             complement(307333..307572)
                     /gene="rpmC"
                     /locus_tag="HMPREF0733_10295"
                     /note="COG: COG0255; Pfam: PF00831; InterPro: IPR001854"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="YP_003983187.1"
                     /db_xref="GI:311111965"
                     /db_xref="GeneID:9901547"
                     /translation="MAVGSKDLSIDKLAELSNEELAAKLSESKKELFNIRFQEVTGQA
                     NAGRRRTIKRDIARIYTVLRERELGIRPATEGESK"
     misc_feature    complement(307375..307536)
                     /gene="rpmC"
                     /locus_tag="HMPREF0733_10295"
                     /note="Ribosomal L29 protein/HIP.  L29 is a protein of the
                     large ribosomal Subunit. A homolog, called heparin/heparan
                     sulfate interacting protein (HIP), has also been
                     identified in mammals.  L29 is located on the surface of
                     the large ribosomal subunit, where it...; Region:
                     Ribosomal_L29_HIP; cd00427"
                     /db_xref="CDD:238243"
     misc_feature    complement(order(307384..307386,307393..307398,
                     307405..307410,307417..307419,307429..307431,
                     307438..307440,307459..307464,307471..307473,
                     307480..307485,307492..307497,307504..307509,
                     307513..307518,307528..307530,307534..307536))
                     /gene="rpmC"
                     /locus_tag="HMPREF0733_10295"
                     /note="putative translocon interaction site; other site"
                     /db_xref="CDD:238243"
     misc_feature    complement(order(307378..307380,307390..307395,
                     307399..307404,307432..307434,307531..307533))
                     /gene="rpmC"
                     /locus_tag="HMPREF0733_10295"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238243"
     misc_feature    complement(order(307417..307419,307459..307461,
                     307471..307473,307480..307482,307492..307494))
                     /gene="rpmC"
                     /locus_tag="HMPREF0733_10295"
                     /note="signal recognition particle (SRP54) interaction
                     site; other site"
                     /db_xref="CDD:238243"
     misc_feature    complement(order(307462..307467,307474..307476))
                     /gene="rpmC"
                     /locus_tag="HMPREF0733_10295"
                     /note="L23 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238243"
     misc_feature    complement(307450..307455)
                     /gene="rpmC"
                     /locus_tag="HMPREF0733_10295"
                     /note="trigger factor interaction site; other site"
                     /db_xref="CDD:238243"
     gene            complement(307578..307994)
                     /gene="rplP"
                     /locus_tag="HMPREF0733_10296"
                     /db_xref="GeneID:9901548"
     CDS             complement(307578..307994)
                     /gene="rplP"
                     /locus_tag="HMPREF0733_10296"
                     /note="COG: COG0197; Pfam: PF00252; InterPro: IPR000114"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="YP_003983188.1"
                     /db_xref="GI:311111966"
                     /db_xref="GeneID:9901548"
                     /translation="MLIPRRVKFRKQHHPKRHGLAKGGTEVSFGEWGIQALSPAYVTN
                     RQIEAARIAMTRHIKRGGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRV
                     MFEIAGVSEEVAREALRLAIHKLPMKARVVRREGGE"
     misc_feature    complement(307599..307925)
                     /gene="rplP"
                     /locus_tag="HMPREF0733_10296"
                     /note="Ribosomal_L16_L10e: L16 is an essential protein in
                     the large ribosomal subunit of bacteria, mitochondria, and
                     chloroplasts. Large subunits that lack L16 are defective
                     in peptidyl transferase activity, peptidyl-tRNA hydrolysis
                     activity, association with...; Region: Ribosomal_L16_L10e;
                     cd01433"
                     /db_xref="CDD:238714"
     misc_feature    complement(order(307623..307628,307635..307640,
                     307692..307694,307734..307748,307767..307772,
                     307782..307784,307788..307790,307794..307802,
                     307818..307820,307827..307829,307839..307841,
                     307848..307850,307857..307862,307908..307910,
                     307917..307922))
                     /gene="rplP"
                     /locus_tag="HMPREF0733_10296"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238714"
     misc_feature    complement(307878..307883)
                     /gene="rplP"
                     /locus_tag="HMPREF0733_10296"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    complement(order(307827..307832,307839..307847))
                     /gene="rplP"
                     /locus_tag="HMPREF0733_10296"
                     /note="putative antibiotic binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    complement(order(307674..307676,307800..307802,
                     307806..307811,307818..307820))
                     /gene="rplP"
                     /locus_tag="HMPREF0733_10296"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    complement(order(307737..307742,307749..307754))
                     /gene="rplP"
                     /locus_tag="HMPREF0733_10296"
                     /note="L27 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238714"
     gene            complement(307995..308792)
                     /gene="rpsC"
                     /locus_tag="HMPREF0733_10297"
                     /db_xref="GeneID:9901549"
     CDS             complement(307995..308792)
                     /gene="rpsC"
                     /locus_tag="HMPREF0733_10297"
                     /note="COG: COG0092; Pfam: PF00417,PF07650,PF00189;
                     InterPro: IPR005704"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="YP_003983189.1"
                     /db_xref="GI:311111967"
                     /db_xref="GeneID:9901549"
                     /translation="MGQKIHPNGFRLGITTEHVSKWFADSNKPGERYADFVREDVKIR
                     ELLAKNLDRAGVAKVEIERTRDRVRVDIHTARPGIVIGRRGAEADRIRGELEKLTGKQ
                     IQLNILEVSNPDLSAQLVAQSIAEQLAARVAFRRAMKKAIQSAQRAGAKGIRIQCSGR
                     LGGAEMSRSEFYREGRVPLHTLRANIDYGFFEAKTTFGRIGVKVWIYKGDLTDKELAA
                     QQAANNRRGNRRDGDRRRSGGRGPRRERRNENASANTEAKTAENGEA"
     misc_feature    complement(308127..308792)
                     /gene="rpsC"
                     /locus_tag="HMPREF0733_10297"
                     /note="30S ribosomal protein S3; Reviewed; Region: rpsC;
                     PRK00310"
                     /db_xref="CDD:234722"
     misc_feature    complement(308454..308789)
                     /gene="rpsC"
                     /locus_tag="HMPREF0733_10297"
                     /note="K homology RNA-binding (KH) domain of the
                     prokaryotic 30S small ribosomal subunit protein S3. S3  is
                     part of the head region of the 30S ribosomal subunit and
                     is believed to interact with mRNA as it threads its way
                     from the latch into the channel.  The KH...; Region:
                     30S_S3_KH; cd02412"
                     /db_xref="CDD:239095"
     misc_feature    complement(308538..308549)
                     /gene="rpsC"
                     /locus_tag="HMPREF0733_10297"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239095"
     misc_feature    complement(308175..308426)
                     /gene="rpsC"
                     /locus_tag="HMPREF0733_10297"
                     /note="Ribosomal protein S3, C-terminal domain; Region:
                     Ribosomal_S3_C; pfam00189"
                     /db_xref="CDD:249666"
     gene            complement(308793..309158)
                     /gene="rplV"
                     /locus_tag="HMPREF0733_10298"
                     /db_xref="GeneID:9901550"
     CDS             complement(308793..309158)
                     /gene="rplV"
                     /locus_tag="HMPREF0733_10298"
                     /note="COG: COG0091; Pfam: PF00237; InterPro: IPR001063"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="YP_003983190.1"
                     /db_xref="GI:311111968"
                     /db_xref="GeneID:9901550"
                     /translation="MEAKASARFVRVTPMKARRVVNLIRGKQAEEALAILKFAPQGAS
                     EPVYKIVASAIANARQKATQEGLPFREEELFVSEAFVNEGPTMKRIQPRAQGRAYRIN
                     KRTSHITVVVATPEKEEDR"
     misc_feature    complement(308823..309152)
                     /gene="rplV"
                     /locus_tag="HMPREF0733_10298"
                     /note="Ribosomal protein L22/L17e.  L22 (L17 in
                     eukaryotes) is a core protein of the large ribosomal
                     subunit.  It is the only ribosomal protein that interacts
                     with all six domains of 23S rRNA, and is one of the
                     proteins important for directing the proper...; Region:
                     Ribosomal_L22; cd00336"
                     /db_xref="CDD:238205"
     misc_feature    complement(order(308823..308828,308922..308939,
                     308979..308996,309057..309062,309066..309071,
                     309075..309083,309147..309152))
                     /gene="rplV"
                     /locus_tag="HMPREF0733_10298"
                     /note="putative translocon binding site; other site"
                     /db_xref="CDD:238205"
     misc_feature    complement(order(308847..308864,308898..308900,
                     308907..308909,308913..308921,308925..308927,
                     308979..308981,308988..308990,309000..309002,
                     309084..309086,309093..309095,309105..309107,
                     309114..309122,309126..309128,309135..309137,
                     309141..309143))
                     /gene="rplV"
                     /locus_tag="HMPREF0733_10298"
                     /note="protein-rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238205"
     gene            complement(309217..309498)
                     /gene="rpsS"
                     /locus_tag="HMPREF0733_10299"
                     /db_xref="GeneID:9901551"
     CDS             complement(309217..309498)
                     /gene="rpsS"
                     /locus_tag="HMPREF0733_10299"
                     /note="COG: COG0185; Pfam: PF00203; InterPro: IPR002222"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="YP_003983191.1"
                     /db_xref="GI:311111969"
                     /db_xref="GeneID:9901551"
                     /translation="MPRSLKKGPFVDQHLYLKVAAQNEKGTKNVIKTWSRRSMIIPDM
                     LGHTIAVYDGRKHVPVFITESMVGHKLGEFAPTRTFRSHVKDDRKGKRR"
     misc_feature    complement(309223..309498)
                     /gene="rpsS"
                     /locus_tag="HMPREF0733_10299"
                     /note="30S ribosomal protein S19; Reviewed; Region: rpsS;
                     PRK00357"
                     /db_xref="CDD:178985"
     gene            complement(309511..310347)
                     /gene="rplB"
                     /locus_tag="HMPREF0733_10300"
                     /db_xref="GeneID:9901552"
     CDS             complement(309511..310347)
                     /gene="rplB"
                     /locus_tag="HMPREF0733_10300"
                     /note="COG: COG0090; Pfam: PF00181,PF03947; InterPro:
                     IPR005880"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="YP_003983192.1"
                     /db_xref="GI:311111970"
                     /db_xref="GeneID:9901552"
                     /translation="MGIRKYKPTTPGRRGSSVADFVEITRSTPEKSLLRPLHKTGGRN
                     NTGRITTRHKGGGHKRQYRLIDFRRHDKDGVNARVAHIEYDPNRTARIALLHYFDGSK
                     RYIIAPNRLSQGDIVESGPSADIKPGNNLPLRNIPVGTVLHCVELRPGGGAKLARSAG
                     ASVQLVAKEGKYGQLRLPSGEIRNVDVRCRATVGEVGNAEQSNINWGKAGRNRWKGIR
                     PTVRGVVMNPVDHPHGGGEGKTSGGRHPVNPNGKPEGRTRRPNKESDKLIVRRRRTGK
                     KR"
     misc_feature    complement(309523..310347)
                     /gene="rplB"
                     /locus_tag="HMPREF0733_10300"
                     /note="50S ribosomal protein L2; Validated; Region: rplB;
                     PRK09374"
                     /db_xref="CDD:236488"
     misc_feature    complement(309991..310224)
                     /gene="rplB"
                     /locus_tag="HMPREF0733_10300"
                     /note="Ribosomal Proteins L2, RNA binding domain; Region:
                     Ribosomal_L2; pfam00181"
                     /db_xref="CDD:249659"
     misc_feature    complement(309589..309975)
                     /gene="rplB"
                     /locus_tag="HMPREF0733_10300"
                     /note="Ribosomal Proteins L2, C-terminal domain; Region:
                     Ribosomal_L2_C; pfam03947"
                     /db_xref="CDD:202823"
     gene            complement(310390..310692)
                     /gene="rplW"
                     /locus_tag="HMPREF0733_10301"
                     /db_xref="GeneID:9901553"
     CDS             complement(310390..310692)
                     /gene="rplW"
                     /locus_tag="HMPREF0733_10301"
                     /note="COG: COG0089; Pfam: PF00276; InterPro: IPR012677"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="YP_003983193.1"
                     /db_xref="GI:311111971"
                     /db_xref="GeneID:9901553"
                     /translation="MSVSTKSVYDVIIAPVVSEKSYGQIDEDKYTFEVAPDSNKLEIK
                     QAIETIWDVKVASINTMNRKGKRKRTRFGWGSRKDTKRAIVTLKEGRIDIFGGPQA"
     misc_feature    complement(310402..310668)
                     /gene="rplW"
                     /locus_tag="HMPREF0733_10301"
                     /note="50S ribosomal protein L23; Reviewed; Region: rplW;
                     PRK05738"
                     /db_xref="CDD:235586"
     gene            complement(310692..311309)
                     /gene="rplD"
                     /locus_tag="HMPREF0733_10302"
                     /db_xref="GeneID:9901554"
     CDS             complement(310692..311309)
                     /gene="rplD"
                     /locus_tag="HMPREF0733_10302"
                     /note="COG: COG0088; Pfam: PF00573; InterPro: IPR002136"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L4/L1 family protein"
                     /protein_id="YP_003983194.1"
                     /db_xref="GI:311111972"
                     /db_xref="GeneID:9901554"
                     /translation="MAVKTLKVDLPAEIFDAQASVPLLHQVVVAQLAAARQGTHKTKN
                     RGEVSGAGRKPFKQKGTGNARQGSIRAPHMTGGGVVHGPTPRNYAQRTPKKMIAAALR
                     GALSDRARHDRIHVVENFISGETPSTKAAKAAFAELTDRKNVLFVIDRAEDVLALSAR
                     NLQKVHVLYADQLNTYDVLVSDDVVFTKAAYDAFVAANQKKEGAK"
     misc_feature    complement(310719..311300)
                     /gene="rplD"
                     /locus_tag="HMPREF0733_10302"
                     /note="50S ribosomal protein L4; Provisional; Region:
                     rplD; PRK05319"
                     /db_xref="CDD:235404"
     gene            complement(311316..311972)
                     /gene="rplC"
                     /locus_tag="HMPREF0733_10303"
                     /db_xref="GeneID:9901555"
     CDS             complement(311316..311972)
                     /gene="rplC"
                     /locus_tag="HMPREF0733_10303"
                     /note="COG: COG0087; Pfam: PF00297; InterPro: IPR000597"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="YP_003983195.1"
                     /db_xref="GI:311111973"
                     /db_xref="GeneID:9901555"
                     /translation="MTNKFERQVKGLLGTKLGMTQVWDEDGKVVPVTVVKADSNVITQ
                     IRNQETDGYHAVQIGFGSIDSRKVTKPLAGHFEKAGVTPRRHLVELRTADAAEYSLGQ
                     ELTVEMFEPGQKVDVVGKTKGKGFAGVMKRHGFKGVGASHGQHKNHRKPGSIGGASYP
                     ARVFKGMRMAGRMGAARHTTLNLTIQGVDAENNVLLIKGAIPGPKGGVVLVRTAVKGA
                     "
     misc_feature    complement(311319..311945)
                     /gene="rplC"
                     /locus_tag="HMPREF0733_10303"
                     /note="50S ribosomal protein L3; Validated; Region: rplC;
                     PRK00001"
                     /db_xref="CDD:234564"
     gene            complement(311986..312294)
                     /gene="rpsJ"
                     /locus_tag="HMPREF0733_10304"
                     /db_xref="GeneID:9901556"
     CDS             complement(311986..312294)
                     /gene="rpsJ"
                     /locus_tag="HMPREF0733_10304"
                     /note="COG: COG0051; Pfam: PF00338; InterPro: IPR005731"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="YP_003983196.1"
                     /db_xref="GI:311111974"
                     /db_xref="GeneID:9901556"
                     /translation="MAGQKIRIRLKSYDHEVIDSSARKIVETVKGAGATVVGPVPLPT
                     EKNVYCVIRSPHKYKDSREHFEMRTHKRLIDVVDPTPKAVDALMRLDLPADVNIEIKL
                     "
     misc_feature    complement(311989..312294)
                     /gene="rpsJ"
                     /locus_tag="HMPREF0733_10304"
                     /note="30S ribosomal protein S10; Reviewed; Region: rpsJ;
                     PRK00596"
                     /db_xref="CDD:179076"
     gene            312512..312703
                     /locus_tag="HMPREF0733_10305"
                     /db_xref="GeneID:9901557"
     CDS             312512..312703
                     /locus_tag="HMPREF0733_10305"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983197.1"
                     /db_xref="GI:311111975"
                     /db_xref="GeneID:9901557"
                     /translation="MWAYLEQINAFTTSSILSKLTISRKQIQRLLLKTQLLARIHAFA
                     SQSCLTLMLRFIILFFHIV"
     gene            312759..312890
                     /locus_tag="HMPREF0733_10306"
                     /db_xref="GeneID:9901558"
     CDS             312759..312890
                     /locus_tag="HMPREF0733_10306"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983198.1"
                     /db_xref="GI:311111976"
                     /db_xref="GeneID:9901558"
                     /translation="MRLFRIQDSLILFPETSMPNKASNQRIYAPHSSMVKIGKSSKE"
     gene            313055..316333
                     /locus_tag="HMPREF0733_10307"
                     /db_xref="GeneID:9901559"
     CDS             313055..316333
                     /locus_tag="HMPREF0733_10307"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983199.1"
                     /db_xref="GI:311111977"
                     /db_xref="GeneID:9901559"
                     /translation="MQAPQQTTRSLTRRRAEDLFLNVLLYLGSLLLIGSAALFITSIT
                     SQDRTSVILRVAGLGLGSLLFYSAGLITYKTVARLRIASYSFTATGLALLPLTGIATY
                     VLGLWNDGSLIWLLVSLVGTAAIILACSFMRNRVMAYVLISFFVSDALAATNVAALPF
                     VWYFVALTVLAIILGLLIRLNSRLVPTGLREGLLESSRIFVPVTAIVVLFFIPQMSSS
                     DMGIVFSVMSAHAFVFTALERKLDYYIQARLYPFIALISFGWGLERPITVTIVLMGLY
                     ALHLLAVLVGYPLMQREMKANLPKHPIMRWDVRIDTYISIIFAAFVTFIEMPHALLTN
                     IDSFPTGLEFMLLVHLDGVTFPRAWVFAVLCVGIIVAYRKYLLAQEYVYLITGISSGL
                     SLILLGQHESAFYLYFVTAGILMLTARKLQLPQLLVSSTTKIFLFLGTMHLLFTLQLG
                     WGVRGILLAGALTITALGLFAALRYEMLPQKRSLTAFWEILVYLVMAVVFFLLRSIFT
                     WTPREIVDPTLDTSLYVVALLAVLALGFLTLRASSAYKDQKIVPLICIYLTLCGLGIA
                     ATSMNYLFPAGDWWAVGVLVLTSIYMFGMSYIVPQETSERHIMFMTSRFPMLWSVIVL
                     WASNSIASDQVFLTASGLLLIQGLLSGILYMTRRQPRERIVFYIIFYTACLPGFIAPF
                     AYSDNALFTAIFCPLAVLVLWGLGEAANLAMLRVCASIALLLTGYTVTNHMLNLNHAR
                     FSEYVIYQGLAAALCSAVLYGLTTLLKREIPGKYDSLQPLNVQLENSAKVIQLPLHGP
                     ARSSKNYLVSQRNDSTRFYGPHNTFLMVPAIIAIAFWTLASIASEDTVQSALLWGLTA
                     LSFASVSTKRMLPTAIVAAPVAFTTRILLDFSVTGFFQSLLEAAILILLAVVASKILR
                     NLIEKHPAQQGISAALLYTAIGLQGLLTIMAWGTGYLQQGAVIMLLGILLTALVSVVL
                     DRIWVFVSAALVTVDLALLLNGLNPLTLMIISVLLIAGVVWRLLARDQGPSADKRAPA
                     LPQNPYQGAPAGFVPPNGASAPYGQAPWAGQQPYQGYNQPNGQAQYPGYSQQHNNPNG
                     NSQA"
     misc_feature    <316112..>316327
                     /locus_tag="HMPREF0733_10307"
                     /note="Proline-rich; Region: Pro-rich; pfam15240"
                     /db_xref="CDD:259374"
     misc_feature    316154..>316327
                     /locus_tag="HMPREF0733_10307"
                     /note="YppG-like protein; Region: YppG; pfam14179"
                     /db_xref="CDD:258379"
     gene            complement(316754..317944)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /db_xref="GeneID:9901560"
     CDS             complement(316754..317944)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="COG: COG0050; Pfam: PF00009,PF03144,PF03143;
                     InterPro: IPR004541"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor Tu"
                     /protein_id="YP_003983200.1"
                     /db_xref="GI:311111978"
                     /db_xref="GeneID:9901560"
                     /translation="MAKAKFERSKPHVNVGTIGHVDHGKTTLTAAISKVLADKYPDLN
                     EQRDFGMIDSAPEERQRGITINIAHIEYQTEKRHYAHVDAPGHADYVKNMITGAAQMD
                     GAILVVAATDGPMAQTREHVLLARQVGVPTLLVALNKADMVDDEELLDLVEMEVRDLL
                     SSQEFDGDDAPVIRVSALKALEGDPEWVAKVEELMEAVDTYIPDPVRETDKPFLMPIE
                     DVFTITGRGTVVTGRAERGTLKINSEVEIVGIRPIQKTTVTGIEMFHKQLDEAWAGEN
                     CGLLLRGLKRDDVERGQVVVEPGSITPHTEFEANVYILSKDEGGRHNPFYSNYRPQFY
                     FRTTDVTGVIKLPEGTEMVMPGDNTEMSVELIQPIAMEEGLGFAIREGGRTVGSGRVT
                     KIIK"
     misc_feature    complement(316757..317944)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="elongation factor Tu; Reviewed; Region: PRK00049"
                     /db_xref="CDD:234596"
     misc_feature    complement(317330..317914)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="Elongation Factor Tu (EF-Tu) GTP-binding proteins;
                     Region: EF_Tu; cd01884"
                     /db_xref="CDD:206671"
     misc_feature    complement(317867..317890)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="G1 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    complement(order(317399..317404,317480..317482,
                     317492..317494,317585..317587,317594..317605,
                     317609..317614,317681..317686,317738..317743,
                     317831..317833,317843..317848,317855..317857,
                     317864..317869,317879..317881,317885..317887))
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="GEF interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    complement(order(317411..317419,317522..317524,
                     317528..317533,317798..317800,317864..317881))
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206671"
     misc_feature    complement(317741..317773)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206671"
     misc_feature    complement(317753..317755)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="G2 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    complement(317687..317698)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="G3 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    complement(317636..317692)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206671"
     misc_feature    complement(317522..317533)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="G4 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    complement(317411..317419)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="G5 box; other site"
                     /db_xref="CDD:206671"
     misc_feature    complement(317048..317308)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="EFTU_II: Elongation factor Tu domain II. Elongation
                     factors Tu (EF-Tu) are three-domain GTPases with an
                     essential function in the elongation phase of mRNA
                     translation. The GTPase center of EF-Tu is in the
                     N-terminal domain (domain I), also known as the...;
                     Region: EFTU_II; cd03697"
                     /db_xref="CDD:239668"
     misc_feature    complement(316772..317041)
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="Domain III of elongation factor (EF) Tu. Ef-Tu
                     consists of three structural domains, designated I, II and
                     III. Domain III adopts a beta barrel structure. Domain III
                     is involved in binding to both charged tRNA and binding to
                     elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707"
                     /db_xref="CDD:239678"
     misc_feature    complement(order(316781..316783,316811..316819,
                     316937..316939,316991..316999,317003..317005))
                     /gene="tuf"
                     /locus_tag="HMPREF0733_10308"
                     /note="Antibiotic Binding Site [chemical binding]; other
                     site"
                     /db_xref="CDD:239678"
     gene            complement(318150..320264)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /db_xref="GeneID:9901561"
     CDS             complement(318150..320264)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="COG: COG0480; Pfam:
                     PF00009,PF03144,PF03764,PF00679; InterPro: IPR004540"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="YP_003983201.1"
                     /db_xref="GI:311111979"
                     /db_xref="GeneID:9901561"
                     /translation="MAHDVYTDLNKVRNIGIMAHIDAGKTTTTERILFYTGINHKIGE
                     THDGASTMDWMAQEQERGITITSAAITCFWKDNQINIIDTPGHVDFTVEVERSLRVLD
                     GAVAVFDGKEGVEPQSETVWRQADKYDVPRICFVNKMDKMGADFYFTVQTIVDRLGAK
                     PLVMQLPIGAESDFVGVVDLLEMKAYVWPGDSKGDVTMGAEYETREIPADLQAKAEEY
                     RAELIEAVAESSEELMEKYLEGEELTIDELKAGIRQLTINGEAFPVLCGSAFKNRGVQ
                     PMLDAVIDYLPSPLDVPDVEGSSPSNEEEKLTRKASSDEPFAALAYKVAAHPFYGQLI
                     YTRVYSGHAAQGQQVLNSTKGKKERLGKLFQMQSNKENPVDEITAGHIYAAIGLKDTT
                     TGDTLCDPANPIVLETMTFPAPVIFVAIEPKTKGDQEKMSTAIQKLSAEDPTFTVSLN
                     EETGQTEIGGMGELHLDIIVDRMKREFKVEANVGKPQVAYRETIKKTVEKVDYTHKKQ
                     TGGSGQFAKVQVSFEPLPLDGEELYEFEDKVTGGRVPREYIPSVDAGIQDAMKFGVLA
                     GYPMVGVKATLIDGAYHDVDSSEMAFKIAGSMVFKEGAKRANPVLLEPLMDVEVRTPE
                     EYMGDVIGDLNSRRGHVRSMEDASGVKIVKALVPLTEMFGYIGDLRGKTQGRAVFSMA
                     FDSYGEVPKNVADEIIQKSRGE"
     misc_feature    complement(318156..320264)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="elongation factor G; Reviewed; Region: PRK00007"
                     /db_xref="CDD:234569"
     misc_feature    complement(319398..320225)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="Elongation factor G (EF-G) family involved in both
                     the elongation and ribosome recycling phases of protein
                     synthesis; Region: EF-G; cd01886"
                     /db_xref="CDD:206673"
     misc_feature    complement(320187..320210)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="G1 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(order(319809..319811,319821..319823,
                     319929..319934,320001..320006,320058..320063,
                     320163..320168,320175..320177,320184..320189,
                     320199..320201,320205..320207))
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(order(319455..319463,319845..319847,
                     319851..319856,320184..320195,320199..320201))
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206673"
     misc_feature    complement(320061..320120)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(320073..320075)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="G2 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(320007..320018)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="G3 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(319956..320012)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(319845..319856)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="G4 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(319455..319463)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="G5 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    complement(319068..319316)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="EFG_mtEFG_II: this subfamily represents the domain
                     II of elongation factor G (EF-G) in bacteria and, the
                     C-terminus of mitochondrial Elongation factor G1 (mtEFG1)
                     and G2 (mtEFG2)_like proteins found in eukaryotes. During
                     the process of peptide synthesis...; Region: EFG_mtEFG_II;
                     cd04088"
                     /db_xref="CDD:239755"
     misc_feature    complement(318813..319034)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="Elongation Factor G, domain II; Region: EFG_II;
                     pfam14492"
                     /db_xref="CDD:258632"
     misc_feature    complement(318441..318797)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="EFG_mtEFG1_IV: domains similar to domain IV of the
                     bacterial translational elongation factor (EF) EF-G.
                     Included in this group is a domain of mitochondrial
                     Elongation factor G1 (mtEFG1) proteins homologous to
                     domain IV of EF-G. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG1_IV; cd01434"
                     /db_xref="CDD:238715"
     misc_feature    complement(318195..318428)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_10309"
                     /note="EFG_mtEFG_C: domains similar to the C-terminal
                     domain of the bacterial translational elongation factor
                     (EF) EF-G.  Included in this group is the C-terminus of
                     mitochondrial Elongation factor G1 (mtEFG1) and G2
                     (mtEFG2) proteins. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG_C; cd03713"
                     /db_xref="CDD:239683"
     gene            complement(320337..320807)
                     /gene="rpsG"
                     /locus_tag="HMPREF0733_10310"
                     /db_xref="GeneID:9901562"
     CDS             complement(320337..320807)
                     /gene="rpsG"
                     /locus_tag="HMPREF0733_10310"
                     /note="COG: COG0049; Pfam: PF00177; InterPro: IPR000235"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="YP_003983202.1"
                     /db_xref="GI:311111980"
                     /db_xref="GeneID:9901562"
                     /translation="MPRKGPAPKRPLVNDPVYGSALVTQLINKVLLDGKKSVAERIVY
                     GALEGVEKKTGSDPVVTLKKAMDNIKPSLEVRSRRVGGATYQVPVEVRPGRSTALALR
                     WLVGFSKQRREKTMTERLMNEILDASNGLGAAVKRREDTHKMAESNKAFAHYRW"
     misc_feature    complement(320340..320807)
                     /gene="rpsG"
                     /locus_tag="HMPREF0733_10310"
                     /note="30S ribosomal protein S7; Validated; Region:
                     PRK05302"
                     /db_xref="CDD:235398"
     gene            complement(320807..321181)
                     /gene="rpsL"
                     /locus_tag="HMPREF0733_10311"
                     /db_xref="GeneID:9901563"
     CDS             complement(320807..321181)
                     /gene="rpsL"
                     /locus_tag="HMPREF0733_10311"
                     /note="COG: COG0048; Pfam: PF00164; InterPro: IPR005679"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="YP_003983203.1"
                     /db_xref="GI:311111981"
                     /db_xref="GeneID:9901563"
                     /translation="MPTIQQLVRKGRTPKVVKTKAPALKGNPMKRGVCTRVYTTTPKK
                     PNSALRKVARVKLNGGIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGAL
                     DTQGVKGRGQARSRYGAKKEKK"
     misc_feature    complement(320852..321175)
                     /gene="rpsL"
                     /locus_tag="HMPREF0733_10311"
                     /note="S12-like family, 30S ribosomal protein S12
                     subfamily; S12 is located at the interface of the large
                     and small ribosomal subunits of prokaryotes, chloroplasts
                     and mitochondria, where it plays an important role in both
                     tRNA and ribosomal subunit...; Region: Ribosomal_S12;
                     cd03368"
                     /db_xref="CDD:239466"
     misc_feature    complement(order(321146..321151,321158..321163,
                     321167..321172))
                     /gene="rpsL"
                     /locus_tag="HMPREF0733_10311"
                     /note="S17 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239466"
     misc_feature    complement(321170..321172)
                     /gene="rpsL"
                     /locus_tag="HMPREF0733_10311"
                     /note="S8 interaction site; other site"
                     /db_xref="CDD:239466"
     misc_feature    complement(order(320852..320854,320915..320920,
                     320930..320935,320972..320977,320984..320986,
                     321008..321010,321029..321037,321041..321046,
                     321089..321091,321095..321100,321104..321106,
                     321140..321148))
                     /gene="rpsL"
                     /locus_tag="HMPREF0733_10311"
                     /note="16S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    complement(order(320918..320920,321050..321055))
                     /gene="rpsL"
                     /locus_tag="HMPREF0733_10311"
                     /note="streptomycin interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    complement(321047..321052)
                     /gene="rpsL"
                     /locus_tag="HMPREF0733_10311"
                     /note="23S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    complement(order(320948..320974,321032..321049))
                     /gene="rpsL"
                     /locus_tag="HMPREF0733_10311"
                     /note="aminoacyl-tRNA interaction site (A-site)
                     [nucleotide binding]; other site"
                     /db_xref="CDD:239466"
     gene            complement(321727..325632)
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /db_xref="GeneID:9901564"
     CDS             complement(321727..325632)
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /EC_number="2.7.7.6"
                     /note="COG: COG0086; Pfam:
                     PF04997,PF00623,PF04983,PF05000,PF04998; InterPro:
                     IPR012754"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta prime"
                     /protein_id="YP_003983204.1"
                     /db_xref="GI:311111982"
                     /db_xref="GeneID:9901564"
                     /translation="MSNESSLGLMRIGLATADDIRRWSYGEVKKPETINYRTLKPEKE
                     GLFDERIFGPTKDWECYCGKYKRVRFKGIVCERCGVEVTRSKVRRERMGHIELAAPVT
                     HIWYFKGVPSRLGYLLDLAPKDLEKVIYFAAYMITSVDEEARHEDLPNLQAAHDREKR
                     ELESQRDADIAAISREVEQELARIEAEGGKKTAEKRKLRDNAERQMASVRKRADREIE
                     HLEKVWDRFKNLKVADLEGDEALYRSMIDKYGLYFEGAMGAEAIKKRLETFDLEAEAE
                     ALKEVIQTGKGQKKTRALKRLKVVNAFLTTNNSPLGMVLDVVPVIPPELRPMVQLDGG
                     RFATSDLNDLYRRVINRNNRLKRLLELGAPEIIVNNEKRMLQEAVDSLFDNGRRGRPV
                     TGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLEMHQCGLPKQMAL
                     ELFKPFVMKRLVELSHAQNIKSAKRMVERFRPQVWDVLEEIITEHPVLLNRAPTLHRL
                     GIQAFEPKLVEGKAIQLHPLVCSAFNADFDGDQMAVHLPLSPEAQAEARILMLSSNNI
                     LKPSDGRPVAVPSQDMIIGLYHLTTTREGEKNEGHAFSSIAEALMAMDRHDIELYTKI
                     KVRLSGDEFVAPEGWEAPEGYTPGDPILLECTVGQILFNQTLPKDYPWFSGIADKKGL
                     GKLINDLAEKYPMDIVARTLDNLKNAGFYWASRSGVTVAVSDIATPATKPAIMERYEK
                     QASAIEDEFDVGMIGDDERREELIKIWTEATDTVAEAMRENLSDNGGLNTIYRMVTSG
                     ARGNWMQVRQIAGIRGLVSNPKGEIMPRPIKSSYREGLSVLEYFIATHGARKGLADTA
                     LRTANSGYLTRRLVDVSQDVIVREHDCGTRRGLVLPLIDADGNLHPDVETSIHGRTLA
                     IDVKDSDGNVIASAGEDVSDVLIEKLFKAGVKELRVRSVLTCESSIGVCALCYGRSMA
                     SNVLVDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVASADDITQGLPRIQELFEARTP
                     KGVAPISEVSGRVTIEDTEKSYKIVVTPDDGSEPQSYTVLRRAASKLQTGDHVQVGDQ
                     LAAGAVDPKEVLRIRGPREAQKHLVSEVQGVYKSQGVEIHDKHVEVIVRQMLRRVTVI
                     ESGDTELLPGELVDNIVFQKANRKALVEGKKPAAGRPEMMGITKASLATESWLSAASF
                     QETTRVLTQAAMEAKTDPLLGLKENVIIGKLVPAGTGLARYNDIEVEPSQKAREEQMQ
                     AFDGFGYQSAFTQLGEDPYPYANSGYMAVPLDEYGRGLE"
     misc_feature    complement(321856..325605)
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="DNA-directed RNA polymerase subunit beta';
                     Provisional; Region: PRK00566"
                     /db_xref="CDD:234794"
     misc_feature    complement(322987..325605)
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="Largest subunit (beta') of bacterial DNA-dependent
                     RNA polymerase (RNAP), N-terminal domain; Region:
                     RNAP_beta'_N; cd01609"
                     /db_xref="CDD:259845"
     misc_feature    complement(order(323023..323025,323032..323034,
                     323062..323067,323071..323079,323083..323091,
                     323095..323100,323107..323112,323116..323139,
                     323155..323157,323176..323181,323194..323196,
                     323206..323211,323218..323220,323233..323235,
                     323251..323253,323269..323271,323461..323496,
                     323500..323505,323854..323856,323869..323871,
                     323881..323883,323890..323898,323938..323940,
                     323953..323958,323968..323970,323977..324000,
                     324010..324012,324019..324027,324052..324054,
                     324067..324072,324100..324105,324109..324114,
                     324121..324123,324133..324135,324211..324213,
                     324256..324261,324265..324270,324277..324282,
                     324289..324294,324328..324330,324334..324396,
                     324412..324417,324424..324426,324484..324486,
                     324634..324639,324646..324648,324652..324654,
                     324658..324663,324670..324672,324676..324678,
                     324688..324690,325318..325320,325324..325326,
                     325357..325368,325372..325377,325432..325434,
                     325465..325467,325516..325518,325522..325524,
                     325558..325569,325576..325578,325588..325590,
                     325594..325605))
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="beta and beta' interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259845"
     misc_feature    complement(order(324205..324210,324214..324216,
                     324400..324405,324430..324432,324439..324441,
                     324469..324471,324502..324504,324511..324516,
                     324520..324546,324556..324567,324571..324573,
                     324580..324585,324595..324597,324604..324606,
                     324613..324630,324640..324642,324649..324654,
                     325240..325245,325378..325380,325426..325428,
                     325432..325434,325462..325464,325468..325470,
                     325525..325527,325531..325539))
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="beta' and sigma factor interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    complement(order(325399..325401,325408..325410,
                     325447..325449,325453..325455))
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="Zn-binding [ion binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    complement(<324982..>325317)
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="F0F1 ATP synthase subunit B; Provisional; Region:
                     PRK14471; cl17192"
                     /db_xref="CDD:266543"
     misc_feature    complement(order(323041..323046,323053..323058,
                     324013..324015,324019..324021,324025..324027,
                     324124..324132,324349..324351,324367..324369,
                     324388..324390,324403..324405,324472..324474,
                     325300..325302))
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="active site region [active]"
                     /db_xref="CDD:259845"
     misc_feature    complement(order(324013..324015,324019..324021,
                     324025..324027))
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="catalytic site [active]"
                     /db_xref="CDD:259845"
     misc_feature    complement(321907..322707)
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="Largest subunit (beta') of Bacterial DNA-dependent
                     RNA polymerase (RNAP), C-terminal domain; Region:
                     RNAP_beta'_C; cd02655"
                     /db_xref="CDD:132721"
     misc_feature    complement(order(321913..321915,322690..322692,
                     322696..322701))
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="Rpb1 (beta') - Rpb6 (omega) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    complement(order(321913..321915,321925..321930,
                     321937..321939,321955..321957,321973..321975,
                     322666..322668,322678..322680))
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="Rpb1 (beta') - Rpb2 (beta) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     misc_feature    complement(322609..322635)
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="G-loop; other site"
                     /db_xref="CDD:132721"
     misc_feature    complement(order(322015..322020,322063..322065,
                     322549..322551))
                     /gene="rpoC"
                     /locus_tag="HMPREF0733_10312"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:132721"
     gene            complement(325733..329311)
                     /gene="rpoB"
                     /locus_tag="HMPREF0733_10313"
                     /db_xref="GeneID:9901565"
     CDS             complement(325733..329311)
                     /gene="rpoB"
                     /locus_tag="HMPREF0733_10313"
                     /EC_number="2.7.7.6"
                     /note="COG: COG0085; Pfam:
                     PF04563,PF04561,PF04565,PF00562,PF04560; InterPro:
                     IPR010243"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="YP_003983205.1"
                     /db_xref="GI:311111983"
                     /db_xref="GeneID:9901565"
                     /translation="MMSYGSVAGRQIANRHVCGRIPILVASSTFNHDAANGAENNSDR
                     RISFAKISEPLKVPNLLAIQTDSFDRLVGNERWAKRLENAQATGDTSVPEKSGLAEIF
                     EEISPIRDFQETMQLSFSDPEFSDPKYTMEECKDRDATYAAPLYVKAEFMNLTTGEVK
                     QQTLFMGDFPLMTESGTFVINGTERVVVSQLVRSPGAYFEKAPDRTSDKDIYSARVIP
                     SRGAWFELEIDKRDQVGVRLDRKRKQSVTVLLKALGWTEAKILAEFGNYDSIRATLEK
                     DSVSTRDEALLDIYRKLRPGEPPTVEAAQALLDNMYFTPRRYDLAKVGRYKVNRKLGV
                     DVPLDSPEASVLSQDDIAQMIHYLCALHAQESSIPGKRDGKEISVKIDIDDIDHFGNR
                     RIRTVGELIENQIRTGLSRMERVVRERMTTQDVDSITPQSLVNIRPVVAAIKEFFGTS
                     QLSQFMDQNNPLAGLTHKRRLSALGPGGLSRDRAGMEVRDVHPSHYGRMCPIETPEGP
                     NIGLIGSLATYGRINSYGFIETPYRVVEDGKVTDKVRYLTADDEKSVIIAQANAPLTN
                     ERTFAEDEVLCRAGDGSGEAVLVAPGAVQYMDVSPRQMVSVATALIPYLEHDDANRAL
                     MGANMQRQAVPLLESEAPVVGTGMEKYAALDSGDSVLAKKAGVVSEVSADLVLVRNDD
                     GTTSSYPIMKFSRSNPGNCYNQRVVVKAGQRVEERDVIADGPSTDGGELALGKNLLVA
                     YMPWEGLNYEDAIILSQRMVSEDVLTSIHIEEHEIDARDTKLGPEEITRDIPNVSEEV
                     LSALDDRGIIHIGAEVEAGDILVGKVTPKGETELTPEERLLRAIFGEKSREVRDTSLK
                     VPHGESGTVIGVRIFDRESDDEDDLPPGVNKLVRVYVAQKRKITDGDKLAGRHGNKGV
                     ISKILPVEDMPFLEDGTPVDVILNPLGVPGRMNIGQVLEVHTGWLAKQGWKIEGDPAW
                     LKNMPNFPKESGPTRLATPVFDGAHEDELFDLMDHANPNRDGDRLITRSGKARLIDGR
                     SGEPFPDPISVGYQYILKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEME
                     VWALEAYGAAYTLQEILTVKSDDVAGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQS
                     LCLNVEVLSTDGKTIEMSDSEEEGFRAAEDMGVSLTHEEPSSVDEL"
     misc_feature    complement(325835..329179)
                     /gene="rpoB"
                     /locus_tag="HMPREF0733_10313"
                     /note="DNA-directed RNA polymerase subunit beta; Reviewed;
                     Region: rpoB; PRK00405"
                     /db_xref="CDD:234749"
     misc_feature    complement(325853..329134)
                     /gene="rpoB"
                     /locus_tag="HMPREF0733_10313"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cd00653"
                     /db_xref="CDD:238353"
     misc_feature    complement(order(326873..326875,326879..326887,
                     326897..326899,326903..326905,327014..327016,
                     328901..328903))
                     /gene="rpoB"
                     /locus_tag="HMPREF0733_10313"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    complement(order(325856..325858,325862..325873,
                     325877..325879,325883..325888,325892..325894,
                     325898..325900,325910..325912,325979..325981,
                     325991..326008,326012..326029,326033..326035,
                     326039..326044,326048..326050,326060..326068,
                     326129..326134,326138..326146,326153..326155,
                     326192..326194,326198..326206,326228..326230,
                     326333..326335,326447..326449,326459..326461,
                     326474..326476,326483..326485,326492..326494,
                     326498..326500,326564..326566,326570..326572,
                     326576..326578,327059..327067,327071..327073,
                     327080..327091,327452..327454,327458..327466,
                     327518..327520,327809..327811,327824..327826,
                     327833..327835,327839..327847,327851..327853))
                     /gene="rpoB"
                     /locus_tag="HMPREF0733_10313"
                     /note="RPB1 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    complement(327512..327718)
                     /gene="rpoB"
                     /locus_tag="HMPREF0733_10313"
                     /note="RNA polymerase beta subunit external 1 domain;
                     Region: RNA_pol_Rpb2_45; pfam10385"
                     /db_xref="CDD:255954"
     misc_feature    complement(order(326189..326191,326240..326242,
                     326408..326410,326414..326416,326429..326431,
                     326510..326512,326549..326551,327026..327028,
                     327035..327037,327098..327100,327104..327106,
                     327389..327394))
                     /gene="rpoB"
                     /locus_tag="HMPREF0733_10313"
                     /note="RPB10 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    complement(<327149..327343)
                     /gene="rpoB"
                     /locus_tag="HMPREF0733_10313"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     misc_feature    complement(order(326222..326224,326552..326554,
                     327029..327031,327071..327073))
                     /gene="rpoB"
                     /locus_tag="HMPREF0733_10313"
                     /note="RPB11 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    complement(order(326198..326200,326204..326227,
                     326525..326530,326534..326536,326543..326551,
                     326624..326626,326630..326632,327014..327016,
                     327026..327031))
                     /gene="rpoB"
                     /locus_tag="HMPREF0733_10313"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            complement(329589..330116)
                     /locus_tag="HMPREF0733_10314"
                     /db_xref="GeneID:9901566"
     CDS             complement(329589..330116)
                     /locus_tag="HMPREF0733_10314"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983206.1"
                     /db_xref="GI:311111984"
                     /db_xref="GeneID:9901566"
                     /translation="MAMKPNNTHDPNIINFNYDADEEFYVSDPVDVPALKKASVTFSF
                     DTKTLDSAGWQRIRAAIDNLRSPDTDIFAQATPYVYQFYRMYFDMADEYGWEQYLPDI
                     PESQVWTLVDPIWDRCTVAWDNNNVLIVVEAETEWDVEHGMMMVLQDGTKLVKVGMVV
                     ESYTNPDGSIFLREE"
     gene            complement(330173..331051)
                     /locus_tag="HMPREF0733_10315"
                     /db_xref="GeneID:9901567"
     CDS             complement(330173..331051)
                     /locus_tag="HMPREF0733_10315"
                     /note="COG: COG0583; Pfam: PF00126,PF03466; InterPro:
                     IPR005119"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003983207.1"
                     /db_xref="GI:311111985"
                     /db_xref="GeneID:9901567"
                     /translation="MELRYLESFEAVVRCGGFTKAAADLHLAQPAISAHVKRLEKELG
                     VTLLNRSRTVTLSAAGEQFLPYARLALANLDEGKRLMQSFHSVSAGHVRVAVTPLTGN
                     FDVAGLLSRFRARYPQVTISLSTGLIAELLGKLEAGQVDVVIGPAGAADKRQGWQRTE
                     ITSERLVLITPLAGRGHVSTLADVAHEPFVCLPSDSGLRHLLNEAFGVIGVEPRVDFE
                     THSPASIREMVAANLGCAIIAQSIVEKQGAAVRVHHIPGLPPHPPISVMSEEEPAPPT
                     ARFLEELEATIREHTR"
     misc_feature    complement(330176..331051)
                     /locus_tag="HMPREF0733_10315"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(330869..331045)
                     /locus_tag="HMPREF0733_10315"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(330203..330781)
                     /locus_tag="HMPREF0733_10315"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(330359..330364,330368..330373,
                     330389..330406,330677..330697,330701..330703,
                     330713..330715,330722..330727,330731..330736))
                     /locus_tag="HMPREF0733_10315"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            331212..332144
                     /gene="plr1"
                     /locus_tag="HMPREF0733_10316"
                     /db_xref="GeneID:9901568"
     CDS             331212..332144
                     /gene="plr1"
                     /locus_tag="HMPREF0733_10316"
                     /EC_number="1.1.1.65"
                     /note="COG: COG0667; Pfam: PF00248; InterPro: IPR001395"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxine 4-dehydrogenase"
                     /protein_id="YP_003983208.1"
                     /db_xref="GI:311111986"
                     /db_xref="GeneID:9901568"
                     /translation="MGLSQGYGSADDTESIAAIHAALDAGVTLLDTAISYGQGHNEAL
                     VGRAVASSGMPRNNLQIATKFGIVRGEHGVHLDAHPDRIAGYCDESLRRLGTETIDLY
                     YLHRVDPQVPIEESIGAMSELVSQGKVRHLGVSEVTADQLRRAHAIHPIAAVQFEWSL
                     MWREPEVNIVPAARQLGVGLVPYSPLGRGLLGGSLNTTSVAESPFRANDPRFNGSSLT
                     ANMRQVDALASFAQSRSMTVAQLALAWLLAQGDDVVPIPGTRNAQRAQENAAAMRYHL
                     EAEDLAALESMVPTNGWVGDRQSFAVPVTTRPVF"
     misc_feature    331212..332069
                     /gene="plr1"
                     /locus_tag="HMPREF0733_10316"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    order(331215..331223,331302..331304,331317..331319,
                     331401..331403,331524..331529,331614..331619,
                     331674..331676,331758..331766,331809..331814,
                     331818..331820,331926..331928,331977..331988,
                     332001..332003,332010..332015)
                     /gene="plr1"
                     /locus_tag="HMPREF0733_10316"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(331302..331304,331317..331319,331401..331403,
                     331524..331526)
                     /gene="plr1"
                     /locus_tag="HMPREF0733_10316"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(332230..333726)
                     /gene="sdaA"
                     /locus_tag="HMPREF0733_10317"
                     /db_xref="GeneID:9901569"
     CDS             complement(332230..333726)
                     /gene="sdaA"
                     /locus_tag="HMPREF0733_10317"
                     /EC_number="4.3.1.17"
                     /note="COG: COG1760; Pfam: PF03315,PF03313; InterPro:
                     IPR004644"
                     /codon_start=1
                     /transl_table=11
                     /product="L-serine ammonia-lyase"
                     /protein_id="YP_003983209.1"
                     /db_xref="GI:311111987"
                     /db_xref="GeneID:9901569"
                     /translation="MALDTGVPSSVQKQAEALEYDISVFELFSIGIGPSSSHTVGPMR
                     ASNRFIAELIDTNLLSRITKVHIDLYGSLAATGAGHGTMSAALKGLCGHVPETICLTE
                     ADSMIERNSVDGTLPLAGYPSSMYGATAPSGEEGKVYGPVLNYRELDITLRPLTVLPR
                     HTNGIKIAAFEGEKMLLERTYFSIGGGFIVEGDEPATGGASLEHPPYPFGSGAELLDM
                     ANEAGMSIAQLKMTNECSLRSEAEVRQGILHIYKVMKECIGSSLSRVGYLPGPLKVRC
                     RAGAWHRDLMTEDPNKSPEYAIDWVNLIALAVNEENAFGGRVVTAPTNGASGIIPAVL
                     HYAMNYTPGIRHCGRGKREDAVIDFFLAAAAIGVLYKKRASISGAEVGCQGEVGSASS
                     MAAAGLAQVLGGTNEQIENAAEIAMEHNLGLTCDPVGGLVQIPCIERNAMAASNAVTA
                     ARMALRGDGAHRVSLDQVIETMRQTGMDMSHRYKETSMGGLAVNVVEC"
     misc_feature    complement(332242..333663)
                     /gene="sdaA"
                     /locus_tag="HMPREF0733_10317"
                     /note="L-serine dehydratase, iron-sulfur-dependent, single
                     chain form; Region: sda_mono; TIGR00720"
                     /db_xref="CDD:188076"
     misc_feature    complement(333145..333639)
                     /gene="sdaA"
                     /locus_tag="HMPREF0733_10317"
                     /note="Serine dehydratase beta chain; Region: SDH_beta;
                     pfam03315"
                     /db_xref="CDD:251868"
     misc_feature    complement(332245..333066)
                     /gene="sdaA"
                     /locus_tag="HMPREF0733_10317"
                     /note="Serine dehydratase alpha chain; Region: SDH_alpha;
                     pfam03313"
                     /db_xref="CDD:251866"
     gene            complement(334085..335203)
                     /gene="gcvT"
                     /locus_tag="HMPREF0733_10318"
                     /db_xref="GeneID:9901570"
     CDS             complement(334085..335203)
                     /gene="gcvT"
                     /locus_tag="HMPREF0733_10318"
                     /EC_number="2.1.2.10"
                     /note="COG: COG0404; Pfam: PF01571,PF08669; InterPro:
                     IPR006223"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system T protein"
                     /protein_id="YP_003983210.1"
                     /db_xref="GI:311111988"
                     /db_xref="GeneID:9901570"
                     /translation="MSPKKTALYPVHEKLGAAFTDFGGWDMPLKYANDVAEHQAVRTR
                     AGIFDLSHMGEFRITGPDAAAFLDYALVSNMSVLKPGRAKYSILANDKGGVIDDLITY
                     RLGDEEFLVVPNAANIDNDFAAMSERLGNFDVKFVNESDDTSLIAVQGPRAEEILLAA
                     GASDEDAVRELKYYASVPVTIAGVDVLLARTGYTGEDGFELFVPNANAVKLWDALAAA
                     GESFGLTPAGLAARDSLRLEAGMPLYGHELGLDITPFESGLGRLVEIALEKKTVDFVG
                     RTALTELAKSPSERILVGLKAQAKRPARAGSILVDAEGNQIGEVTSGIPSPTLGYPIA
                     MALVKREFSEVGSEVDVDIRGKRATFDVVSLPFYKREK"
     misc_feature    complement(334088..335200)
                     /gene="gcvT"
                     /locus_tag="HMPREF0733_10318"
                     /note="glycine cleavage system aminomethyltransferase T;
                     Reviewed; Region: gcvT; PRK00389"
                     /db_xref="CDD:234742"
     misc_feature    complement(334418..335065)
                     /gene="gcvT"
                     /locus_tag="HMPREF0733_10318"
                     /note="Aminomethyltransferase folate-binding domain;
                     Region: GCV_T; pfam01571"
                     /db_xref="CDD:250713"
     misc_feature    complement(334109..334387)
                     /gene="gcvT"
                     /locus_tag="HMPREF0733_10318"
                     /note="Glycine cleavage T-protein C-terminal barrel
                     domain; Region: GCV_T_C; pfam08669"
                     /db_xref="CDD:254962"
     gene            complement(335398..338250)
                     /gene="gcvP"
                     /locus_tag="HMPREF0733_10319"
                     /db_xref="GeneID:9901571"
     CDS             complement(335398..338250)
                     /gene="gcvP"
                     /locus_tag="HMPREF0733_10319"
                     /EC_number="1.4.4.2"
                     /note="COG: COG1003; Pfam: PF02347; InterPro: IPR003437"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine dehydrogenase"
                     /protein_id="YP_003983211.1"
                     /db_xref="GI:311111989"
                     /db_xref="GeneID:9901571"
                     /translation="MSFIDRHLGPRSADAEQMLKALGYDSLGALMDDAVPPQIRLHGE
                     LDLPDPLTEQDALAKIAEYAAENKVYTQMIGEGYYDAVTPAVLRRNILENPGFYTSYT
                     PYQAEISQGRLEALLNFQNVVMELTGLDIANASLLDEASAVAEAVVMMHRANRKVKNG
                     FFAIDSRCLPQVLAVVRGRAELLDIPFVVTDFSEGLPEGDLYGVVLAYPASDGEIRDI
                     EPLVKAAKERNALVTVDADLLALTLLKSPGELGADIAVGNTQRFGLPFFFGGPHAAYM
                     AVHKGMERTMPGRLVGVSQDSAGKPSYRLSLQTREQHIRREKATSNICTAQALLAIVA
                     GAYAVYHGPEGLRAIAERLHTNAARVATALESAGFGIAYEHFFDTVVIDASARADELV
                     AKALEAGINIRRINENRVGISVGESHDDRVLERLVKAFGAELPSEADAKFSIPTDLLR
                     TDEYMKHPVFHKYRSETEMMRYLRHLSDKDLALDRTMIPLGSCTMKLNAAAEMEPISW
                     PEFANIHPLVPADQAQGWHKLIKELSDWLVAITGYDVVSLQPNSGATGEYGGLRAIRA
                     YHEANGDHERDTVLIPLSAHGTNAASAALAGLKVAGVATASDGSIDVDDLKAKIEKYG
                     DKIAGIMITYPSTHGVFEPQVSEVCELVHAAGGQVYVDGANLNAQMGFAQPGKFGGDI
                     SHLNLHKTFSIPHGGGGPGVGPLAAREHLAKYLPGDAATADAEGKLPSGAALPIAQAF
                     FGSAGVLPISWMYIAMSGAEGLKKSSEYAVLNANYVAKKLNDKFPVLYTGNANLVGHE
                     CILDIRELTDRSHVTAEDVCKRLMDFGFHAPTLAFPVPGTLMMEPTESESKEELDRFI
                     EAMETIYGEILEVAEGKVAVEDSVLRNAPHTVDVVSADEWDRPYSRTQAAFPVPSLRA
                     NKYFTPVGRIDGAGGDRHFVCECPPVEAFDLEAHAE"
     misc_feature    complement(335422..338247)
                     /gene="gcvP"
                     /locus_tag="HMPREF0733_10319"
                     /note="glycine dehydrogenase; Provisional; Region:
                     PRK05367"
                     /db_xref="CDD:235432"
     misc_feature    complement(336952..338244)
                     /gene="gcvP"
                     /locus_tag="HMPREF0733_10319"
                     /note="Glycine cleavage system protein P
                     (pyridoxal-binding), N-terminal domain [Amino acid
                     transport and metabolism]; Region: GcvP; COG0403"
                     /db_xref="CDD:223480"
     misc_feature    complement(order(337468..337470,337477..337479,
                     337537..337539,337546..337548,337630..337632,
                     337816..337818,337825..337830))
                     /gene="gcvP"
                     /locus_tag="HMPREF0733_10319"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(337468..337470)
                     /gene="gcvP"
                     /locus_tag="HMPREF0733_10319"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     misc_feature    complement(335503..336957)
                     /gene="gcvP"
                     /locus_tag="HMPREF0733_10319"
                     /note="Glycine cleavage system protein P
                     (pyridoxal-binding), C-terminal domain [Amino acid
                     transport and metabolism]; Region: GcvP; COG1003"
                     /db_xref="CDD:223935"
     misc_feature    complement(order(336184..336186,336193..336195,
                     336256..336258,336265..336267,336352..336354,
                     336580..336582,336589..336594))
                     /gene="gcvP"
                     /locus_tag="HMPREF0733_10319"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(336184..336186)
                     /gene="gcvP"
                     /locus_tag="HMPREF0733_10319"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(338743..339987)
                     /gene="narK"
                     /locus_tag="HMPREF0733_10320"
                     /db_xref="GeneID:9901572"
     CDS             complement(338743..339987)
                     /gene="narK"
                     /locus_tag="HMPREF0733_10320"
                     /note="COG: COG2223; Pfam: PF07690; InterPro: IPR011701"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite extrusion protein NarK"
                     /protein_id="YP_003983212.1"
                     /db_xref="GI:311111990"
                     /db_xref="GeneID:9901572"
                     /translation="MSAPTAESYDLKKGQLFNLLLVTFASTVGFWAWTIVGPLAKYYA
                     KPDQMHLNPGTTSLLVAMPIFIGAIGRIPIGGLTDKYGGRIMMSLVLAVSAPLVLLVG
                     VAGSMKSFPLMLVFSFLLGIAGTVFAVGIPFSSAWYPPARKGFATGVFGAGMVGTALS
                     AFFTPRLMNLVGYMNTHYIIAALCAVTAVISFLFLRDSPATANREVTPLMPKIIRAFK
                     VKSTWQLCFLYSVVFGGFVAFSNYLPTYLNNIYSFNPEDAGARAAGFAAAAVVARPFG
                     GILADKFGPKIITFIALGGVSVLALVTAFQPDAEHVYGPIFLTMAALLGLGSGSVFGW
                     VGRAADPKNVGAVSGVIAAAGALGGFFPPLVMGATYDAAHRNYFIGLTLLAVTAAVAF
                     ASAFLVKHGGKPEHHRADAAAK"
     misc_feature    complement(338791..339957)
                     /gene="narK"
                     /locus_tag="HMPREF0733_10320"
                     /note="Nitrate/nitrite transporter [Inorganic ion
                     transport and metabolism]; Region: NarK; COG2223"
                     /db_xref="CDD:225133"
     misc_feature    complement(338791..339933)
                     /gene="narK"
                     /locus_tag="HMPREF0733_10320"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(338911..338913,338920..338925,
                     338932..338937,338944..338949,338980..338982,
                     338989..338994,339004..339006,339013..339018,
                     339025..339027,339169..339171,339181..339183,
                     339190..339192,339202..339204,339214..339216,
                     339256..339258,339265..339270,339277..339282,
                     339289..339291,339517..339519,339532..339537,
                     339544..339549,339583..339585,339592..339597,
                     339604..339609,339616..339618,339763..339768,
                     339772..339777,339787..339789,339796..339801,
                     339808..339810,339865..339870,339874..339882,
                     339889..339891))
                     /gene="narK"
                     /locus_tag="HMPREF0733_10320"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(340023..340856)
                     /gene="narI"
                     /locus_tag="HMPREF0733_10321"
                     /db_xref="GeneID:9901573"
     CDS             complement(340023..340856)
                     /gene="narI"
                     /locus_tag="HMPREF0733_10321"
                     /EC_number="1.7.99.4"
                     /note="COG: COG2181; Pfam: PF02665; InterPro: IPR003816"
                     /codon_start=1
                     /transl_table=11
                     /product="respiratory nitrate reductase subunit gamma"
                     /protein_id="YP_003983213.1"
                     /db_xref="GI:311111991"
                     /db_xref="GeneID:9901573"
                     /translation="MYALASEHAAHAVPVGEPGIVDTLLWGVLPYVTILVLIGGTIWR
                     YRTDQFSWTTRSSQIYESKMLRLGSPLFHYGLAAVFMGHVGGLVVPKMLTDLVVDDHT
                     YHIVALVGGSAAAAATILGLFLLLWRRRRNAQVFSATTMNDKFMYFVLVAVILAGTAA
                     TLISAFDPSGGLPPVNGHEVEFNYRTSIAVWFRSIFYFHPEVALMVNVPVAFKIHIIV
                     AMVLFIIWPFTRLVHALTVPLHYLFRPYTIYRSRGNERVGARRGWDNPQEALPRERVN
                     R"
     misc_feature    complement(340101..340793)
                     /gene="narI"
                     /locus_tag="HMPREF0733_10321"
                     /note="Nitrate reductase gamma subunit; Region:
                     Nitrate_red_gam; pfam02665"
                     /db_xref="CDD:251457"
     gene            complement(340880..341602)
                     /gene="narJ"
                     /locus_tag="HMPREF0733_10322"
                     /db_xref="GeneID:9901574"
     CDS             complement(340880..341602)
                     /gene="narJ"
                     /locus_tag="HMPREF0733_10322"
                     /EC_number="1.7.99.4"
                     /note="COG: COG2180; Pfam: PF02613; InterPro: IPR003765"
                     /codon_start=1
                     /transl_table=11
                     /product="respiratory nitrate reductase subunit delta"
                     /protein_id="YP_003983214.1"
                     /db_xref="GI:311111992"
                     /db_xref="GeneID:9901574"
                     /translation="MGKADSGNTPESAQAAHDNIDPFDRDYGAGEDRDSVIYQVSGML
                     LSYPTEETLDLLPEFTRLAQATENPDFVQAVQTVADWLTARELEEVQSDYVQEYDLSR
                     RHALHLSYWTDGDTRRRGETLLRFKKMYRDSGMLTRLNGELPDYLPLVLEFAALVDRR
                     QGRAALQAYRPSLELLRLALRDGDLPHYGLLQSICNTLPGVSPETQEQVQQMAGYGPP
                     VETVGLSGYADPRLTQVNPNNI"
     misc_feature    complement(340970..341506)
                     /gene="narJ"
                     /locus_tag="HMPREF0733_10322"
                     /note="Nitrate reductase delta subunit; Region:
                     Nitrate_red_del; cl00958"
                     /db_xref="CDD:260720"
     gene            complement(341630..343243)
                     /gene="narH"
                     /locus_tag="HMPREF0733_10323"
                     /db_xref="GeneID:9901575"
     CDS             complement(341630..343243)
                     /gene="narH"
                     /locus_tag="HMPREF0733_10323"
                     /EC_number="1.7.99.4"
                     /note="COG: COG1140; InterPro: IPR006547"
                     /codon_start=1
                     /transl_table=11
                     /product="respiratory nitrate reductase subunit beta"
                     /protein_id="YP_003983215.1"
                     /db_xref="GI:311111993"
                     /db_xref="GeneID:9901575"
                     /translation="MRVMAQVAMVMALDKCIGCHTCSVTCKQAWTNRSGTEYVWFNNV
                     ETRPGQGYPRRYEDQEKWKGGWVLNKRGRLELKSGNRFQKLFSIFASPIQPELSDYYE
                     PWTYDYQNLTTAPLGDDFPAAKPVSMITGQDTKIQWGLNWDDNLGGAPEHGHLDPLVE
                     KVRKKAEDKIKFEFEQTFMFYLPRICEHCLNPSCMAACPSGAIYKRAEDGIVLVDQDR
                     CRGWRQCITGCPYKKVYFNHKTGKAEKCTFCYPRIEAGIPTVCAETCVGRMRYIGIFL
                     YDADRVTEAASVADEKDLYESQLSLMLDPSDPEIIRLARENDIPEAWITAAQKSPVYK
                     LAKEWKVALPLHPEYRTMPMVWYVPPLSPIVDLLKDQGHDAENSQNLFGAIEALRIPV
                     EYLAELFTAGDTEVVTFVLKRLAAMRAYMRDINLGGEGNEEIANSVGMTGAQMYEMYR
                     LMAIAKYNERYVIPPAHMEDAHNLEEMGCSLSVDGGPGMYGDAFNDMEGRPTPVSTGV
                     YESSNKVSLFSWDGNSRPDGLFPNTTGKK"
     misc_feature    complement(341666..343243)
                     /gene="narH"
                     /locus_tag="HMPREF0733_10323"
                     /note="Nitrate reductase beta subunit [Energy production
                     and conversion]; Region: NarY; COG1140"
                     /db_xref="CDD:224063"
     misc_feature    complement(342425..342715)
                     /gene="narH"
                     /locus_tag="HMPREF0733_10323"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     misc_feature    complement(<342275..>342445)
                     /gene="narH"
                     /locus_tag="HMPREF0733_10323"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cl00470"
                     /db_xref="CDD:260445"
     misc_feature    complement(341915..342163)
                     /gene="narH"
                     /locus_tag="HMPREF0733_10323"
                     /note="Respiratory nitrate reductase beta C-terminal;
                     Region: Nitr_red_bet_C; pfam14711"
                     /db_xref="CDD:258848"
     gene            complement(343243..346965)
                     /locus_tag="HMPREF0733_10324"
                     /db_xref="GeneID:9901576"
     CDS             complement(343243..346965)
                     /locus_tag="HMPREF0733_10324"
                     /EC_number="1.7.99.4"
                     /note="COG: COG5013; Pfam: PF00384,PF01568; InterPro:
                     IPR006468"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="YP_003983216.1"
                     /db_xref="GI:311111994"
                     /db_xref="GeneID:9901576"
                     /translation="MEQASQTKGPDGPLTDQLIKFGKFFSRWDETDDGRAVFREGGRK
                     GDTFYRDRWSHDKEVRSTHGVNCTGSCSWKVYVKDGIITWEAQQTDYPTVGPDRPEYE
                     PRGCPRGAAFSWYTYSPTRVKYPYVRGLLLEMYREAKALHSDPVEAFHSIVSDPVKRN
                     RYVSARGKGGLVRSTWAEALEIVAAAHVHTIKYYGPDRCTGFTPIPAMSMVSFSAGVR
                     FIQLIGGVMTSFYDWYADLPVASPQVFGDQTDVPESGDWWDASYLIMWGSNIPVTRTP
                     DAHWVAEVRYRGTKVVSVSPDYADNTKFADEWLPAQAGTDAALAMAMGHVILKENYVD
                     QRVEFFEDFALTYTDLPFLVTLETREDGTKVPSKFLTAASLAGEQHQENADFKTAMMD
                     RETGEVFVPNGTMGHRYSESDQGKWNLELDGRKPILSIRDLPQGESAAVEIKMPTFDN
                     PKGHGDIMTRGVPVTYVEGQEVTTVFDLMLATYGIGRPGLPGDWAKDYEDWSIQNTPA
                     WQEQITSVPPEAVIRVAREFAQNAIDSHGRSMIIFGAGICQWYHADTTYRAILALLNL
                     TGCQGRNGGGWAHYVGQEKARPLTGLTNMANALDWSRPPRHMIGTGFWYMHTDQFRQD
                     GYSTDYLQSPLGTGELKGVHTADVVARSTRMGWMPFYPQFPENSLDLADKAEAAVARG
                     EAKDNADYVAQRLNSGDLEFSVEDVDNPVNWPRTLMLWRSNLFGSSAKGESYFLKHLV
                     GSMDNVQGADHEESIPREVTWYQEAPQGKLDLLVTSDFRMTTTTLLSDVVLPTATWYE
                     KHDISSTDMHPFLHAFSPAIDPPWEARTDHDTFKALSYEFTRQAKKHLGTRKDIVSVP
                     LLHDTPGQIKQPGGHAPDWKSTPGMLGVPGKNMPNFMTVERDYSAMYDMYTSVGPLFD
                     KVGATTKYVTYDLKDEVAQMAKEFGVMDSGKGAGRPALDTDTKLAESILRISGTSNGE
                     VALKGFKELEKQTGLHLMDLAEGNEERKITFPMTQAAPQPVMTSPEWSGSETGGRRYA
                     PFTVNIEKKKPFHTLTGRMHFFLDHDWMHEMGEALPIYRPPLDMTGLFKEPEIGTTDG
                     VSVAVRYLTPHNKWAIHSQYFDNQHMLTLFRGGQTAWMSPQDAEKIGVKDGEWIECVN
                     TNGVFVGRAVVSHRMPEGVCYVHHAQERMMTPKTETTGKRGGIHNSMTRILLKPTHMI
                     GGYAHQAFAFNYLGPTGNQRDIVSYIRRRKSQEVTF"
     misc_feature    complement(343264..346902)
                     /locus_tag="HMPREF0733_10324"
                     /note="Nitrate reductase alpha subunit [Energy production
                     and conversion]; Region: NarG; COG5013"
                     /db_xref="CDD:227346"
     misc_feature    complement(344461..346800)
                     /locus_tag="HMPREF0733_10324"
                     /note="Respiratory nitrate reductase A (NarGHI), alpha
                     chain (NarG) and related proteins. Under anaerobic
                     conditions in the presence of nitrate, E. coli synthesizes
                     the cytoplasmic membrane-bound quinol-nitrate
                     oxidoreductase (NarGHI), which reduces nitrate to...;
                     Region: MopB_Nitrate-R-NarG-like; cd02750"
                     /db_xref="CDD:239151"
     misc_feature    complement(order(346648..346650,346747..346749,
                     346753..346755,346765..346767,346777..346779))
                     /locus_tag="HMPREF0733_10324"
                     /note="[4Fe-4S] binding site [ion binding]; other site"
                     /db_xref="CDD:239151"
     misc_feature    complement(order(344485..344487,344569..344571,
                     344578..344580,344629..344640,344782..344787,
                     344797..344805,345223..345225,345316..345321,
                     345325..345336,346018..346020,346024..346026,
                     346069..346071,346075..346080,346084..346086,
                     346147..346152,346159..346161,346165..346167,
                     346258..346260,346264..346266,346354..346356,
                     346642..346644,346768..346770,346774..346776))
                     /locus_tag="HMPREF0733_10324"
                     /note="molybdopterin cofactor binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239151"
     misc_feature    complement(343273..343689)
                     /locus_tag="HMPREF0733_10324"
                     /note="Respiratory nitrate reductase A (NarGHI), alpha
                     chain (NarG) and related proteins. Under anaerobic
                     conditions in the presence of nitrate, E. coli synthesizes
                     the cytoplasmic membrane-bound quinol-nitrate
                     oxidoreductase (NarGHI), which reduces nitrate to...;
                     Region: MopB_CT_Nitrate-R-NarG-like; cd02776"
                     /db_xref="CDD:239177"
     misc_feature    complement(order(343294..343299,343393..343395,
                     343456..343458,343645..343659,343666..343677))
                     /locus_tag="HMPREF0733_10324"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239177"
     gene            complement(347045..348253)
                     /locus_tag="HMPREF0733_10325"
                     /db_xref="GeneID:9901577"
     CDS             complement(347045..348253)
                     /locus_tag="HMPREF0733_10325"
                     /note="COG: COG0476; Pfam: PF00899,PF05237,PF00581;
                     InterPro: IPR016040"
                     /codon_start=1
                     /transl_table=11
                     /product="dinucleotide-utilizing enzyme involved in
                     molybdopterin and thiamine biosynthesis family 2"
                     /protein_id="YP_003983217.1"
                     /db_xref="GI:311111995"
                     /db_xref="GeneID:9901577"
                     /translation="MSFIPDPETTPEPVTQLSAAERAFYARQLILPEIGMAGQLKLKA
                     ARVAVLGAGGLGAPALLYLAGAGVGEIIIIDDDSIEVSNLHRQVIHTYARSGNSKAES
                     ASETMRALNPFITVTVARERLTDTNALNLLTGADAVLDGSDNFEARYAVSAAAQQLGI
                     PHIWAAILGFDAQLSVFWAGHGPVYEDLYPQAPAPGSVPSCSTAGIIGALAGVVGSAM
                     AMEAIKVITGSGKPLLGEVGLYSALTGKWEYIPLLASMQAKPKKSVETHPQESQDTKN
                     HLIFRHNSGKLTGNHHTQKLEDITPVQARQLSQHEKMTLIDVREAIEFSSFAIDGAIN
                     LPLTEILEAAREGSLAARIREKVDPASKYLVVYCTGYTRALEAARDIAAVTDIPVRVL
                     VGGISGWLTV"
     misc_feature    complement(347054..348202)
                     /locus_tag="HMPREF0733_10325"
                     /note="molybdopterin biosynthesis protein MoeB; Validated;
                     Region: PRK05597"
                     /db_xref="CDD:235526"
     misc_feature    complement(347498..348181)
                     /locus_tag="HMPREF0733_10325"
                     /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved
                     in molybdopterin and thiamine biosynthesis family. The
                     common reaction mechanism catalyzed by MoeB and ThiF, like
                     other E1 enzymes, begins with a nucleophilic attack of the
                     C-terminal carboxylate of MoaD...; Region:
                     ThiF_MoeB_HesA_family; cd00757"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(347813..347815,347831..347833,
                     347957..347959,347996..347998,348023..348025,
                     348029..348031,348089..348091,348095..348097,
                     348101..348103))
                     /locus_tag="HMPREF0733_10325"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(347501..347506,347510..347512,
                     347531..347533,347543..347545,347735..347737,
                     347741..347743,347753..347758,347810..347812,
                     347822..347830,348089..348091))
                     /locus_tag="HMPREF0733_10325"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    complement(347057..347347)
                     /locus_tag="HMPREF0733_10325"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    complement(347150..347152)
                     /locus_tag="HMPREF0733_10325"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            complement(348291..348779)
                     /gene="moaE"
                     /locus_tag="HMPREF0733_10326"
                     /db_xref="GeneID:9901578"
     CDS             complement(348291..348779)
                     /gene="moaE"
                     /locus_tag="HMPREF0733_10326"
                     /note="COG: COG0314; Pfam: PF02391; InterPro: IPR003448"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein large
                     subunit"
                     /protein_id="YP_003983218.1"
                     /db_xref="GI:311111996"
                     /db_xref="GeneID:9901578"
                     /translation="MTTKPQGLDHSGAHGAEPTGSVVIFTDITEEALEPLAAAAKAQV
                     MTEAMGALVVFDGIVRNHDHGSAVRGLSYSAHPQAKEYIARVVQSVADELEGVRLWAV
                     HRVGPIAIGESALTVLAAAAHRGRAFEACEAVADRVKAQVPIWKEQELTDGSTEWVGI
                     DT"
     misc_feature    complement(348306..348650)
                     /gene="moaE"
                     /locus_tag="HMPREF0733_10326"
                     /note="MoaE family. Members of this family are involved in
                     biosynthesis of the molybdenum cofactor (Moco), an
                     essential cofactor for a diverse group of redox enzymes.
                     Moco biosynthesis is an evolutionarily conserved pathway
                     present in eubacteria, archaea and...; Region: MoaE;
                     cd00756"
                     /db_xref="CDD:238385"
     misc_feature    complement(order(348372..348374,348384..348386,
                     348408..348410,348414..348416,348441..348443,
                     348600..348602,348606..348608,348612..348626,
                     348630..348632,348645..348647))
                     /gene="moaE"
                     /locus_tag="HMPREF0733_10326"
                     /note="MoaE homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238385"
     misc_feature    complement(order(348309..348311,348342..348350,
                     348354..348356,348360..348365,348471..348473,
                     348525..348527,348537..348539,348552..348554,
                     348558..348560))
                     /gene="moaE"
                     /locus_tag="HMPREF0733_10326"
                     /note="MoaD interaction [polypeptide binding]; other site"
                     /db_xref="CDD:238385"
     misc_feature    complement(order(348342..348344,348363..348365))
                     /gene="moaE"
                     /locus_tag="HMPREF0733_10326"
                     /note="active site residues [active]"
                     /db_xref="CDD:238385"
     gene            complement(348769..349347)
                     /gene="moaB"
                     /locus_tag="HMPREF0733_10327"
                     /db_xref="GeneID:9901579"
     CDS             complement(348769..349347)
                     /gene="moaB"
                     /locus_tag="HMPREF0733_10327"
                     /note="COG: COG0521; Pfam: PF00994; InterPro: IPR001453"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin cofactor biosynthesis protein
                     MoaB"
                     /protein_id="YP_003983219.1"
                     /db_xref="GI:311111997"
                     /db_xref="GeneID:9901579"
                     /translation="MLFCEAQRKTYEQQHEREHIVSAEEIQLPENLTGLVIVASTRAA
                     RGIYEDKSGPIAVEWLRSRGFKTPDAVVIEDRQIIDYFNSLIADGKKNNNLPTFILTS
                     GGTGLNTDDQTVEAVRPHLDKEIPGIMHAFWANGLQNVSSAVLSRGVAGVIDKTFVMT
                     LPGSRGGVKDGVKTLDPLVEHICRQMEDYHDH"
     misc_feature    complement(348790..349254)
                     /gene="moaB"
                     /locus_tag="HMPREF0733_10327"
                     /note="MogA_MoaB family. Members of this family are
                     involved in biosynthesis of the molybdenum cofactor (MoCF)
                     an essential cofactor of a diverse group of redox enzymes.
                     MoCF biosynthesis is an evolutionarily conserved pathway
                     present in eubacteria, archaea; Region: MogA_MoaB;
                     cd00886"
                     /db_xref="CDD:238451"
     misc_feature    complement(order(348838..348840,348847..348849,
                     348859..348864,348940..348942,349030..349038))
                     /gene="moaB"
                     /locus_tag="HMPREF0733_10327"
                     /note="MPT binding site; other site"
                     /db_xref="CDD:238451"
     misc_feature    complement(order(348790..348792,348907..348909,
                     348916..348918,348946..348951,348958..348960,
                     348973..348981,349003..349005,349015..349017,
                     349021..349026,349030..349032))
                     /gene="moaB"
                     /locus_tag="HMPREF0733_10327"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238451"
     gene            complement(349359..349865)
                     /gene="moaC"
                     /locus_tag="HMPREF0733_10328"
                     /db_xref="GeneID:9901580"
     CDS             complement(349359..349865)
                     /gene="moaC"
                     /locus_tag="HMPREF0733_10328"
                     /note="COG: COG0315; Pfam: PF01967; InterPro: IPR002820"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein C"
                     /protein_id="YP_003983220.1"
                     /db_xref="GI:311111998"
                     /db_xref="GeneID:9901580"
                     /translation="MTEKNLRSDAAQPAQDLTHVRADGSAHMVDVTLKDVTTRTALAE
                     GTVHTRADVIAKIFDADLPKGDALPVARVAGIMGAKRTPDIIPLCHPLPLGKITLDFE
                     RGEDFVRIVASVKTRGVTGVEMEALTAVSTAALTIFDMIKAVDKYAVISNIRVLEKSG
                     GKSGDWAV"
     misc_feature    complement(349371..349784)
                     /gene="moaC"
                     /locus_tag="HMPREF0733_10328"
                     /note="MoaC family, prokaryotic and eukaryotic. Members of
                     this family are involved in molybdenum cofactor (Moco)
                     biosynthesis, an essential cofactor of a diverse group of
                     redox enzymes. MoaC, a small hexameric protein, converts,
                     together with MoaA, a guanosine...; Region: MoaC_PE;
                     cd01420"
                     /db_xref="CDD:238708"
     misc_feature    complement(order(349383..349418,349566..349586,
                     349593..349670,349773..349784))
                     /gene="moaC"
                     /locus_tag="HMPREF0733_10328"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238708"
     misc_feature    complement(order(349425..349433,349608..349622,
                     349668..349676))
                     /gene="moaC"
                     /locus_tag="HMPREF0733_10328"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238708"
     misc_feature    complement(order(349440..349442,349449..349451,
                     349482..349484,349491..349499,349506..349508,
                     349596..349601,349605..349607,349626..349628,
                     349674..349676))
                     /gene="moaC"
                     /locus_tag="HMPREF0733_10328"
                     /note="putative active site [active]"
                     /db_xref="CDD:238708"
     gene            complement(349911..351290)
                     /gene="moeA"
                     /locus_tag="HMPREF0733_10329"
                     /db_xref="GeneID:9901581"
     CDS             complement(349911..351290)
                     /gene="moeA"
                     /locus_tag="HMPREF0733_10329"
                     /note="COG: COG0303; Pfam: PF03453,PF00994,PF03454;
                     InterPro: IPR001453"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein MoeA"
                     /protein_id="YP_003983221.1"
                     /db_xref="GI:311111999"
                     /db_xref="GeneID:9901581"
                     /translation="MHKPQFDGTPSTEEYRAYLALLLRDTFIGRAENLPLARATDRIL
                     AQDVLARLDVPSFDNSQMDGYALTAEGASRENRIFTVGREIPAGRPLQRSRASDDLTY
                     PIMTGAPIPKGYVAVVPVEHSERIEYPDLPESFGRPSEKIRLPKAPKGQFIRRRGEDV
                     VAGQIMARSGERVTPALLGTLAAQGYTRVTVACGPRVLVCTGGDEIRPTLTEDGDDTA
                     TELAYGQIYDANGPMLTSMLVEDGAVVRRISIGDDPELLIEHLREEYETFAPDIIITS
                     GGISHGKYEVVRNAIAMAPSLGLPIPLSWFGHVSQQPGGPQGVNVLDFNGHRLPMISF
                     PGNPVSTLISYVLMLRPYLRAGGPYGTPHEVASRMATLENAPRGVLVIDKPLTAPANK
                     RQFLRGNLAMVETEPGTYQVELYPDVLPGSHLLHHAATADVLIELAPGTTYTGGEAVR
                     YHRIRLTDN"
     misc_feature    complement(349923..351254)
                     /gene="moeA"
                     /locus_tag="HMPREF0733_10329"
                     /note="Molybdopterin biosynthesis enzyme [Coenzyme
                     metabolism]; Region: MoeA; COG0303"
                     /db_xref="CDD:223380"
     misc_feature    complement(349935..351242)
                     /gene="moeA"
                     /locus_tag="HMPREF0733_10329"
                     /note="MoeA family. Members of this family are involved in
                     biosynthesis of the molybdenum cofactor (MoCF), an
                     essential cofactor of a diverse group of redox enzymes.
                     MoCF biosynthesis is an evolutionarily conserved pathway
                     present in eubacteria, archaea and...; Region: MoeA;
                     cd00887"
                     /db_xref="CDD:238452"
     misc_feature    complement(order(349941..349943,350022..350024,
                     350151..350153,350595..350597,350604..350606,
                     350610..350612,350736..350738,350742..350747,
                     350754..350756,350760..350771,350814..350816,
                     351180..351182))
                     /gene="moeA"
                     /locus_tag="HMPREF0733_10329"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238452"
     misc_feature    complement(order(350457..350459,350535..350537,
                     350676..350678,350682..350687))
                     /gene="moeA"
                     /locus_tag="HMPREF0733_10329"
                     /note="putative functional site; other site"
                     /db_xref="CDD:238452"
     misc_feature    complement(order(350262..350264,350271..350273,
                     350283..350288,350451..350459))
                     /gene="moeA"
                     /locus_tag="HMPREF0733_10329"
                     /note="putative MPT binding site; other site"
                     /db_xref="CDD:238452"
     gene            complement(351321..352211)
                     /gene="modB"
                     /locus_tag="HMPREF0733_10330"
                     /db_xref="GeneID:9901582"
     CDS             complement(351321..352211)
                     /gene="modB"
                     /locus_tag="HMPREF0733_10330"
                     /note="COG: COG4149; Pfam: PF00528; InterPro: IPR000515"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter permease"
                     /protein_id="YP_003983222.1"
                     /db_xref="GI:311112000"
                     /db_xref="GeneID:9901582"
                     /translation="MRFLQEAAVSPQIPKDVPVKKHTAFTAVPRYFVVPALLGFLLIL
                     GPLVGLLYNIPWMRLHDIIDKEVLDAARLSLTTASISTLICGLLGAPLALVLSKVLSR
                     SRLKKFGGVLYAIIYTPVILSPVVSGLGLLFFWGRKGMIGEHLYHLGIIIPFTPTAVI
                     LAQTFVALPFFVATAVTTLQAIPEEYEQIARVEGAKSSEITYRVLLPLAAPGIATAFL
                     LSFARALGEFGATVTFAGNVQGKTETIPLGIELAIAGGSMSSALGNALMLISLYVCIF
                     GLLGLFSVVKKLRAKAFYNS"
     misc_feature    complement(351375..352118)
                     /gene="modB"
                     /locus_tag="HMPREF0733_10330"
                     /note="ABC-type sulfate transport system, permease
                     component [Posttranslational modification, protein
                     turnover, chaperones]; Region: CysU; COG0555"
                     /db_xref="CDD:223629"
     misc_feature    complement(351405..352001)
                     /gene="modB"
                     /locus_tag="HMPREF0733_10330"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(351405..351410,351417..351422,
                     351426..351431,351438..351443,351471..351476,
                     351513..351518,351525..351536,351555..351557,
                     351564..351569,351609..351611,351660..351662,
                     351669..351674,351684..351686,351690..351695,
                     351702..351704,351711..351713,351717..351722,
                     351816..351818,351822..351827,351834..351863,
                     351867..351878,351921..351923,351936..351941,
                     351948..351953))
                     /gene="modB"
                     /locus_tag="HMPREF0733_10330"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(351519..351536,351816..351860))
                     /gene="modB"
                     /locus_tag="HMPREF0733_10330"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(351441..351443,351471..351473,
                     351480..351482,351516..351518,351735..351737,
                     351816..351818))
                     /gene="modB"
                     /locus_tag="HMPREF0733_10330"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(351588..351590,351600..351605,
                     351621..351659))
                     /gene="modB"
                     /locus_tag="HMPREF0733_10330"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(352265..353086)
                     /gene="modA"
                     /locus_tag="HMPREF0733_10331"
                     /db_xref="GeneID:9901583"
     CDS             complement(352265..353086)
                     /gene="modA"
                     /locus_tag="HMPREF0733_10331"
                     /note="COG: COG0725; Pfam: PF01547; InterPro: IPR006059"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum (Mo2+) ABC transporter"
                     /protein_id="YP_003983223.1"
                     /db_xref="GI:311112001"
                     /db_xref="GeneID:9901583"
                     /translation="MKTSLKVASASAALFASVAMTGCGSNSSNTDASASASSAASGSV
                     SGKVEVYAAASLRNAGTELKEAFEKENPGVEITYSFEGSSKLVQKIEQGASPDLLITA
                     DTQNMDKAAKLDEFKDAKREVIATNKLVLVTAEGNPGKINSLDDLKNSEGVVAVCKVN
                     VPCGTLADEELKKHHIELKNATTEGNVSEVATKVTTGNADAGFIYTTDLAAAKKDGKN
                     LGSVDLPDVPRNEYPAALTTKGSSSDAAKKFNEWLSSDEAQKILAKYDFESPQAN"
     misc_feature    complement(352292..352903)
                     /gene="modA"
                     /locus_tag="HMPREF0733_10331"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(352472..352474,352589..352591,
                     352760..352762,352838..352840))
                     /gene="modA"
                     /locus_tag="HMPREF0733_10331"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(352493..352495,352511..352513,
                     352523..352525))
                     /gene="modA"
                     /locus_tag="HMPREF0733_10331"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(352382..352399)
                     /gene="modA"
                     /locus_tag="HMPREF0733_10331"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            353268..354491
                     /gene="moaA"
                     /locus_tag="HMPREF0733_10332"
                     /db_xref="GeneID:9901584"
     CDS             353268..354491
                     /gene="moaA"
                     /locus_tag="HMPREF0733_10332"
                     /note="COG: COG2896; Pfam: PF04055,PF06463; InterPro:
                     IPR013483"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein A"
                     /protein_id="YP_003983224.1"
                     /db_xref="GI:311112002"
                     /db_xref="GeneID:9901584"
                     /translation="MAYTAGSGRTQLIAGPVLRTLASEQDANTAFVTPENSGDAQKPL
                     HKPARKTPYITNRGPLLDRWGRIATDLRISLIDKCNLRCIYCMPAEGLEWLPKNNLLT
                     SAEIARLADIAIRELGVEEIRFTGGEPLVRADLVDIIGRIHREHPTIPLAITTNGIGL
                     EKRAQALADAGLSRINVSLDTICPETFAELTRRDKLGSVLKGIDGAAAAGLKPIKINA
                     VLMPGINDAQAPELLQWALDGGYQLRFIEQMPLDADHKWTREGTITAAQIRTMLSEHF
                     VLGTVAEKRGDSPAQLWEVYPLGTALDSAGFPREATASLGRVGIIASVTESFCGACTR
                     TRLTADGKIRSCLFSDSETDLLDLLRSGASDREIALRWREGMWFKPRAHGKEDADFDI
                     EEFAQASRSMSAIGG"
     misc_feature    353439..354488
                     /gene="moaA"
                     /locus_tag="HMPREF0733_10332"
                     /note="molybdenum cofactor biosynthesis protein A;
                     Reviewed; Region: moaA; PRK00164"
                     /db_xref="CDD:234672"
     misc_feature    353484..>353945
                     /gene="moaA"
                     /locus_tag="HMPREF0733_10332"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(353502..353504,353508..353510,353514..353516,
                     353520..353528,353640..353642,353646..353651,
                     353727..353735,353799..353801,353928..353930)
                     /gene="moaA"
                     /locus_tag="HMPREF0733_10332"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    353988..354419
                     /gene="moaA"
                     /locus_tag="HMPREF0733_10332"
                     /note="Molybdenum Cofactor Synthesis C; Region:
                     Mob_synth_C; pfam06463"
                     /db_xref="CDD:115139"
     gene            354495..354761
                     /locus_tag="HMPREF0733_10333"
                     /db_xref="GeneID:9901585"
     CDS             354495..354761
                     /locus_tag="HMPREF0733_10333"
                     /note="Pfam: PF02597"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983225.1"
                     /db_xref="GI:311112003"
                     /db_xref="GeneID:9901585"
                     /translation="MQIHFFAAARAASGVAETQMSLTDLAEPTLRALVEKLGEAFTGK
                     TASGMTLAQVMHQCSFLIDGTRSELDAALTDNARVDVLPPFAGG"
     misc_feature    354495..354758
                     /locus_tag="HMPREF0733_10333"
                     /note="Ubiquitin-like proteins; Region: UBQ; cl00155"
                     /db_xref="CDD:260222"
     misc_feature    order(354594..354596,354669..354671,354744..354746)
                     /locus_tag="HMPREF0733_10333"
                     /note="charged pocket; other site"
                     /db_xref="CDD:176352"
     misc_feature    order(354675..354686,354738..354743)
                     /locus_tag="HMPREF0733_10333"
                     /note="hydrophobic patch; other site"
                     /db_xref="CDD:176352"
     gene            354758..355558
                     /locus_tag="HMPREF0733_10334"
                     /db_xref="GeneID:9901586"
     CDS             354758..355558
                     /locus_tag="HMPREF0733_10334"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein"
                     /protein_id="YP_003983226.1"
                     /db_xref="GI:311112004"
                     /db_xref="GeneID:9901586"
                     /translation="MNSDLWAVVRFWRLLHVFRQDAHHATLAAIIPEGLTSVHTPHDP
                     LRAPDNGTRTQHSVTRAAQIPAFCAIIVAGGKSSRLNHTPKAGLSNGSQTLLERALDA
                     AGQAQQRVVVGPGTLPVPSDTLHTREDPPYSGPAAALHAGLEKIAAAYAAREKAPPAW
                     CLILGVDTPQIAPAVQKLLAHTIDASTETLGYWGVAGGIFQPLIGIYRFAPLREAFAE
                     GSTNASVRSFVKRLAPVAVELDPAHTADVDTWEQAHELGYSTPRWLDY"
     misc_feature    354962..355513
                     /locus_tag="HMPREF0733_10334"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    order(354971..354973,354977..354979,355091..355093,
                     355250..355252,355256..355258)
                     /locus_tag="HMPREF0733_10334"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            355587..356855
                     /gene="moeA2"
                     /locus_tag="HMPREF0733_10335"
                     /db_xref="GeneID:9901587"
     CDS             355587..356855
                     /gene="moeA2"
                     /locus_tag="HMPREF0733_10335"
                     /note="COG: COG0303; Pfam: PF03453,PF00994,PF03454;
                     InterPro: IPR001453"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein MoeA"
                     /protein_id="YP_003983227.1"
                     /db_xref="GI:311112005"
                     /db_xref="GeneID:9901587"
                     /translation="MSHHHPPAVSWHEARELLHTAASALTPTLSTEALPLQATIGRYV
                     AEDLTARMPVPHYSSSAMDGYAVAGAPPWRLVSPDYPEDARTNVHRLAVPIAAGEATP
                     ILTGGLLPEGTEAIVREEHSHRYEGAGALGSGIHYLDMAEGYTVPKPGTDIRYAGAEL
                     SPGAILSSRGDLITAQRAAFLGVNGFDELPVLKNVPVRCAFTGNEVITFGMPSPGQVR
                     DAFGGFLEVSLAGAGCEVRPSARLADIAEEFHTFVTTSTARILIFTGGSSTSGVDMVR
                     QTLADIGAEYIFESVRVRPGHPALAAKIPAPKEGMNAGQERLVLGLPGNPLAAYTALY
                     SYLPVILAGLRGLPIPALDRAELATDIPPLRKRSQHRLMPVRVSEGKAYPLDALASHM
                     LSGLAQATHFALVDATGQQAGTHAILVPVF"
     misc_feature    355611..356828
                     /gene="moeA2"
                     /locus_tag="HMPREF0733_10335"
                     /note="Molybdopterin biosynthesis enzyme [Coenzyme
                     metabolism]; Region: MoeA; COG0303"
                     /db_xref="CDD:223380"
     misc_feature    355623..356849
                     /gene="moeA2"
                     /locus_tag="HMPREF0733_10335"
                     /note="MoeA family. Members of this family are involved in
                     biosynthesis of the molybdenum cofactor (MoCF), an
                     essential cofactor of a diverse group of redox enzymes.
                     MoCF biosynthesis is an evolutionarily conserved pathway
                     present in eubacteria, archaea and...; Region: MoeA;
                     cd00887"
                     /db_xref="CDD:238452"
     misc_feature    order(355695..355697,356061..356063,356106..356117,
                     356121..356123,356130..356135,356139..356141,
                     356238..356240,356244..356246,356253..356255,
                     356757..356759,356844..356846)
                     /gene="moeA2"
                     /locus_tag="HMPREF0733_10335"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238452"
     misc_feature    order(356190..356195,356199..356201,356316..356318,
                     356382..356384)
                     /gene="moeA2"
                     /locus_tag="HMPREF0733_10335"
                     /note="putative functional site; other site"
                     /db_xref="CDD:238452"
     misc_feature    order(356382..356390,356553..356558,356568..356570,
                     356577..356579)
                     /gene="moeA2"
                     /locus_tag="HMPREF0733_10335"
                     /note="putative MPT binding site; other site"
                     /db_xref="CDD:238452"
     gene            357040..358062
                     /gene="scrR"
                     /locus_tag="HMPREF0733_10336"
                     /db_xref="GeneID:9901588"
     CDS             357040..358062
                     /gene="scrR"
                     /locus_tag="HMPREF0733_10336"
                     /note="COG: COG1609; Pfam: PF00356,PF00532; InterPro:
                     IPR001761"
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose operon repressor ScrR"
                     /protein_id="YP_003983228.1"
                     /db_xref="GI:311112006"
                     /db_xref="GeneID:9901588"
                     /translation="MAQPKLGDVAARAGVSPTTVSRVLNNRGYLSQKTRDKVFAAIRE
                     LGYRPNAIARSLQERRSHIIGLIFPTVAHPFYGEMVYRLESRLANAGYRVILCNSDEQ
                     PELEHRYLDMLFAHQVDGVITGSHSQVVAQLPQVQAPLVAIDRPETGPYPNIRSDNYA
                     GARQATEHLIGTGARRILHITSTLSEQNLRQRGYTDALTAAGLSPDFLELGFHESAEH
                     QRNMLYEYLDEHRGAQPVEAVFASNDTYASLALAWAQSRRVRVPEEFQVIGFDGTDTV
                     RTLLPELASVVQPIDALADRAVQRLTEAIAAETEEDAEPADARGGEDVLPVTLRLGGT
                     VRPARD"
     misc_feature    357049..358056
                     /gene="scrR"
                     /locus_tag="HMPREF0733_10336"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    357061..357207
                     /gene="scrR"
                     /locus_tag="HMPREF0733_10336"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(357082..357096,357100..357105,357112..357114,
                     357127..357132,357139..357141,357178..357180,
                     357187..357189,357196..357201,357205..357207)
                     /gene="scrR"
                     /locus_tag="HMPREF0733_10336"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    357178..357207
                     /gene="scrR"
                     /locus_tag="HMPREF0733_10336"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    357226..358044
                     /gene="scrR"
                     /locus_tag="HMPREF0733_10336"
                     /note="Ligand binding domain of the lacI-like
                     transcription regulator from a novel metal-reducing
                     bacterium Alkaliphilus Metalliredigens (strain Qymf) and
                     its close homologs; Region: PBP1_Qymf_like; cd06291"
                     /db_xref="CDD:107286"
     misc_feature    order(357250..357252,357268..357270,357280..357282,
                     357289..357291,357319..357321,357325..357327,
                     357364..357366,357373..357375,357385..357387,
                     357793..357795,357805..357807)
                     /gene="scrR"
                     /locus_tag="HMPREF0733_10336"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107286"
     misc_feature    order(357256..357258,357262..357264,357412..357414,
                     357469..357471,357607..357609,357766..357768,
                     357850..357852,357901..357903)
                     /gene="scrR"
                     /locus_tag="HMPREF0733_10336"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107286"
     misc_feature    order(357730..357732,357829..357831)
                     /gene="scrR"
                     /locus_tag="HMPREF0733_10336"
                     /note="sodium binding site [ion binding]; other site"
                     /db_xref="CDD:107286"
     gene            complement(358224..358928)
                     /locus_tag="HMPREF0733_10337"
                     /db_xref="GeneID:9901589"
     CDS             complement(358224..358928)
                     /locus_tag="HMPREF0733_10337"
                     /note="COG: COG0454; Pfam: PF00583; InterPro: IPR016181"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983229.1"
                     /db_xref="GI:311112007"
                     /db_xref="GeneID:9901589"
                     /translation="MNTTPYTVRQARPEEVSQVLDTLTEAFLNDPYMYKVLGEKPQED
                     KLRARFEVQLEGTYMPRGCVDVAVDLDGKILGTALWLSPENQQTDVKQELRDNAKFMR
                     ILGPRTMRHVMAENRELHKYRPKFKHWYLHTIAVRKAAQGLGVGTELLRHAIDRFDGT
                     AAYLEASTPRSAALYERLGFIPMGTFASGDPYMGMLYPMNLETAQDDEHSVSVREEDS
                     HDEGHFMMRELVGSSS"
     misc_feature    complement(358458..>358574)
                     /locus_tag="HMPREF0733_10337"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(358488..358493,358521..358529))
                     /locus_tag="HMPREF0733_10337"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            358899..359255
                     /gene="rpsF"
                     /locus_tag="HMPREF0733_10338"
                     /db_xref="GeneID:9901590"
     CDS             358899..359255
                     /gene="rpsF"
                     /locus_tag="HMPREF0733_10338"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="YP_003983230.1"
                     /db_xref="GI:311112008"
                     /db_xref="GeneID:9901590"
                     /translation="MADGVRGGIHDDHLSCGWVLAIGWVGFSSPLNLCIFMQKTLTYI
                     TLSNSPEANKEVRHISLQRHTPFNVTRNSAKPLSPQRKTWHPIRDFHDGVPLTLCTSE
                     RKFMSRSVKSMPMFSL"
     gene            complement(359233..361230)
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /db_xref="GeneID:9901591"
     CDS             complement(359233..361230)
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /EC_number="2.7.1.69"
                     /note="COG: COG1263; Pfam: PF00367,PF02378,PF00358;
                     InterPro: IPR010973"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS family beta-glucosides transporter subunit
                     IIABC"
                     /protein_id="YP_003983231.1"
                     /db_xref="GI:311112009"
                     /db_xref="GeneID:9901591"
                     /translation="MDHKSVAERVLQDVGGVDNIRAAAHCATRLRLVLKNQDSVDQSA
                     IDNDEDLKGSFLNAGQFQIIVGPGDVNEVFKHMVASGAPEVSKDDLKSIAANQGNIFS
                     RFIKTIADIFIPLIPVLVGGGMLMALDNVLRAKNIFGPKPLIEMYPAWEGFADIVNLL
                     SAAPFAFLPVLVGYSATKVFGGNPYLGLTMGAAMVSPALMNGYKVAASLAHTEGTDPM
                     KYWDLFGLQVQQAGYQGTVLPILLVSFILANIERFFHKILKGTIDFIFTPTLTLLITG
                     FVTFLLVGPPMFQLGTWLGEGVNWLYTAAGPIGGLIFGVLYAPIVITGLHQSFPPIET
                     SLWASGGSFIFVIASISNVAQGAAAAGVALTTKNKKIKGVASASAPSAFLGITEPALF
                     GVNLVLRWPFYIAITSAGLGGALSAILGVKASALGSAGYLGIPSVNPQVGAGWLGFIT
                     CLLVTTALAFAASYFWGLKVARSEASSPDVAVLAADGASKTDTVAAAAQEPEIEGEKT
                     ELTTHLAGTVVPLAEVKDATFSSGALGDGTAVEPTEGKLLAPADGKITVAFPTGHAYG
                     MRTEDGLDLLMHIGMDTVELDGKHFTPKVAKGDTVKRGDVLAEFDIPAIKDAGYVLVT
                     PLVITNAKKLTTAVRDAQTSGASVAAGDNLLQVGLKEKTSA"
     misc_feature    complement(359833..361227)
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /note="PTS system, sucrose-specific IIBC component;
                     Region: PTS-II-BC-sucr; TIGR01996"
                     /db_xref="CDD:131051"
     misc_feature    complement(360997..361212)
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIB_glc; cd00212"
                     /db_xref="CDD:238130"
     misc_feature    complement(361138..361158)
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /note="active site turn [active]"
                     /db_xref="CDD:238130"
     misc_feature    complement(361153..361155)
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238130"
     misc_feature    complement(359776..360951)
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /note="Phosphotransferase system IIC components,
                     glucose/maltose/N-acetylglucosamine-specific [Carbohydrate
                     transport and metabolism]; Region: PtsG; COG1263"
                     /db_xref="CDD:224183"
     misc_feature    complement(359251..359721)
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /note="Phosphotransferase system IIA components
                     [Carbohydrate transport and metabolism]; Region: NagE;
                     COG2190"
                     /db_xref="CDD:225101"
     misc_feature    complement(order(359344..359346,359440..359442,
                     359476..359481,359485..359487,359497..359499,
                     359503..359511,359527..359535,359551..359556,
                     359560..359565,359629..359634,359644..359655))
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /note="HPr interaction site; other site"
                     /db_xref="CDD:238128"
     misc_feature    complement(order(359344..359346,359470..359472,
                     359476..359481,359485..359487,359497..359499,
                     359503..359505,359542..359544,359554..359556,
                     359560..359562,359629..359634,359638..359640,
                     359644..359649,359653..359655))
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /note="glycerol kinase (GK) interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238128"
     misc_feature    complement(order(359491..359493,359497..359499,
                     359542..359544,359548..359550))
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /note="active site"
                     /db_xref="CDD:238128"
     misc_feature    complement(359497..359499)
                     /gene="scrA"
                     /locus_tag="HMPREF0733_10339"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238128"
     gene            complement(361419..363044)
                     /gene="scrB"
                     /locus_tag="HMPREF0733_10340"
                     /db_xref="GeneID:9901592"
     CDS             complement(361419..363044)
                     /gene="scrB"
                     /locus_tag="HMPREF0733_10340"
                     /EC_number="3.2.1.26"
                     /note="COG: COG1621; Pfam: PF00251; InterPro: IPR006232"
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose-6-phosphate hydrolase"
                     /protein_id="YP_003983232.1"
                     /db_xref="GI:311112010"
                     /db_xref="GeneID:9901592"
                     /translation="MITLEPPLRGILPTGGGAEHRYLRVGKIETMSPKKTKTSKKASK
                     ARPERDLALEAQDVLDTFGAAVRSDRDYPALHLAPPVGRLNDPNGLVYDGHNYHAFYQ
                     YSPLHPERKVYWRHAVSTNLVDWKDVGTALVPNTRYDSHGCYSGSGIRVKGGFEFFYT
                     GNVKDSKNKRESYQILATAGKDGNPVRQLPPLISGPHDGYTAHYRDPHVFERDGKWWM
                     VIGAQRKDKTGAVVVYTSKDRRDWKFKGELGIKAKELEKCYMFECPSLLQLRDEVTGE
                     MRDVLIFSPQGLKPMGERYLNIYQSGYIVGKFNPKTLKFKVETPFTELDAGFEFYAPQ
                     TISGTGISAAKDAPHEETVMIAWFGNAEQDDQPSWSKRWVHMMTFPRELHLRDGKLYQ
                     HPVPQLDEAMPLQPIEPDEKGRLKELKDARVFRLRGRVNVADERVKIKIKDTHGVALS
                     IVLDQDFVQMDRGGTRYTEGGSLRRRTLKRAKTRQFELLVDGSAAELFVGGKLAASLG
                     AEVFSARTFFKGEKRRVRLTGGKVLSLEYARKN"
     misc_feature    complement(361494..362870)
                     /gene="scrB"
                     /locus_tag="HMPREF0733_10340"
                     /note="sucrose-6-phosphate hydrolase; Region: scrB_fam;
                     TIGR01322"
                     /db_xref="CDD:233357"
     misc_feature    complement(361857..362801)
                     /gene="scrB"
                     /locus_tag="HMPREF0733_10340"
                     /note="Glycosyl hydrolase family 32, beta-fructosidases;
                     Region: GH32_B_Fructosidase; cd08996"
                     /db_xref="CDD:185737"
     misc_feature    complement(order(362259..362261,362427..362432,
                     362610..362615,362739..362741,362787..362792))
                     /gene="scrB"
                     /locus_tag="HMPREF0733_10340"
                     /note="substrate binding [chemical binding]; other site"
                     /db_xref="CDD:185737"
     misc_feature    complement(order(362259..362261,362427..362429,
                     362787..362789))
                     /gene="scrB"
                     /locus_tag="HMPREF0733_10340"
                     /note="active site"
                     /db_xref="CDD:185737"
     gene            complement(363273..363650)
                     /gene="rplL"
                     /locus_tag="HMPREF0733_10341"
                     /db_xref="GeneID:9901593"
     CDS             complement(363273..363650)
                     /gene="rplL"
                     /locus_tag="HMPREF0733_10341"
                     /note="COG: COG0222; Pfam: PF00542; InterPro: IPR000206"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L7/L12"
                     /protein_id="YP_003983233.1"
                     /db_xref="GI:311112011"
                     /db_xref="GeneID:9901593"
                     /translation="MAKLSIEELIAAFKELSLVEVSEFVKAFEEEFDVTAAAPVAVVA
                     GGAGGGDAAEEKSEFDVILESAGDKKIAVIKEVRALTSLGLKEAKDLVDGAPKPILEG
                     ASKEDAEKAKEQLEGAGATVTLK"
     misc_feature    complement(363279..363641)
                     /gene="rplL"
                     /locus_tag="HMPREF0733_10341"
                     /note="Ribosomal protein L7/L12. Ribosomal protein L7/L12
                     refers to the large ribosomal subunit proteins L7 and L12,
                     which are identical except that L7 is acetylated at the N
                     terminus. It is a component of the L7/L12 stalk, which is
                     located at the surface of...; Region: Ribosomal_L7_L12;
                     cd00387"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(363330..363332,363339..363341,
                     363345..363350,363390..363395,363399..363401,
                     363405..363410,363414..363416,363477..363482,
                     363510..363518,363564..363566,363573..363575,
                     363582..363587,363594..363602,363639..363641))
                     /gene="rplL"
                     /locus_tag="HMPREF0733_10341"
                     /note="core dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(363555..363557,363570..363572,
                     363609..363611,363621..363623,363630..363632))
                     /gene="rplL"
                     /locus_tag="HMPREF0733_10341"
                     /note="peripheral dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(363555..363557,363564..363566,
                     363576..363581,363588..363590))
                     /gene="rplL"
                     /locus_tag="HMPREF0733_10341"
                     /note="L10 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(363384..363386,363393..363398,
                     363417..363419,363426..363431,363438..363443))
                     /gene="rplL"
                     /locus_tag="HMPREF0733_10341"
                     /note="L11 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(363384..363386,363393..363398,
                     363417..363419,363426..363428,363438..363440))
                     /gene="rplL"
                     /locus_tag="HMPREF0733_10341"
                     /note="putative EF-Tu interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(363417..363419,363426..363431,
                     363438..363440))
                     /gene="rplL"
                     /locus_tag="HMPREF0733_10341"
                     /note="putative EF-G interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     gene            complement(363767..364297)
                     /gene="rplJ"
                     /locus_tag="HMPREF0733_10342"
                     /db_xref="GeneID:9901594"
     CDS             complement(363767..364297)
                     /gene="rplJ"
                     /locus_tag="HMPREF0733_10342"
                     /note="COG: COG0244; Pfam: PF00466; InterPro: IPR001790"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="YP_003983234.1"
                     /db_xref="GI:311112012"
                     /db_xref="GeneID:9901594"
                     /translation="MATQEKIAAVSELKELFEASNAVILTEYRGLTVAQLKELRRALG
                     AETEYAVVKNTLAAIAAKEVGINSFEGQLQGPSALAFIKGDLVDAAKGLRDFAKANPQ
                     LIVKTGYYEGETLTEDDVKRYADLESREVLLSKVAGGAKAAIARVAQAVDALRVKLEE
                     QEGAAPAAAEEASEEA"
     misc_feature    complement(363827..364288)
                     /gene="rplJ"
                     /locus_tag="HMPREF0733_10342"
                     /note="Ribosomal protein L10 family, L10 subfamily;
                     composed of bacterial 50S ribosomal protein and eukaryotic
                     mitochondrial 39S ribosomal protein, L10. L10 occupies the
                     L7/L12 stalk of the ribosome. The N-terminal domain (NTD)
                     of L10 interacts with L11 protein...; Region:
                     Ribosomal_L10; cd05797"
                     /db_xref="CDD:240223"
     misc_feature    complement(order(364121..364123,364130..364141,
                     364268..364270,364277..364282))
                     /gene="rplJ"
                     /locus_tag="HMPREF0733_10342"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240223"
     misc_feature    complement(order(363827..363829,363833..363838,
                     363842..363847,363854..363862,363866..363883,
                     363887..363892,363899..363904,363911..363913,
                     363959..363961,363968..363970,364037..364039))
                     /gene="rplJ"
                     /locus_tag="HMPREF0733_10342"
                     /note="Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240223"
     gene            complement(364735..365862)
                     /locus_tag="HMPREF0733_10343"
                     /db_xref="GeneID:9901595"
     CDS             complement(364735..365862)
                     /locus_tag="HMPREF0733_10343"
                     /EC_number="3.6.3.20"
                     /note="COG: COG3839; Pfam: PF00005; InterPro: IPR003593"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="YP_003983235.1"
                     /db_xref="GI:311112013"
                     /db_xref="GeneID:9901595"
                     /translation="MTTQGSTPQPSSTTTHGGLQIRGVAKSFGADTYVLREIDLEVEP
                     GEMVSLVGASGTGKSTLLRIIAGLEEANAGRITYAGQPLSAGQVGFVFQHPILYPHLS
                     VRKNILFPTTLRGYRQKVDKNYYTDLMDALQIGELQHRKPQELSGGQAQRVGIARALI
                     RKAPVVLFDEPLASVDEELSASIRADIARLHVEYKFTGLYVTHDQNEALQLGQRVAVM
                     DAGYLVQVDTPEHLLANPHTLQAARLTASPALNELTLTEGQHLPAGASLYVRATSLRR
                     VEVKAENPVENTIPVQVQGVLPQVGGTLYHAVTQAEATLYTASHDGSARVPLQVSGGQ
                     TLEFFEPDALALPVLTSGERVQVQVPPHHCFIFADGMRHYL"
     misc_feature    complement(364756..365808)
                     /locus_tag="HMPREF0733_10343"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    complement(365182..365808)
                     /locus_tag="HMPREF0733_10343"
                     /note="ATP-binding cassette domain of the carbohydrate and
                     solute transporters-like; Region: ABC_Carb_Solutes_like;
                     cd03259"
                     /db_xref="CDD:213226"
     misc_feature    complement(365686..365709)
                     /locus_tag="HMPREF0733_10343"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(order(365254..365256,365353..365358,
                     365584..365586,365683..365691,365695..365700))
                     /locus_tag="HMPREF0733_10343"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(365584..365595)
                     /locus_tag="HMPREF0733_10343"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(365401..365430)
                     /locus_tag="HMPREF0733_10343"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(365353..365370)
                     /locus_tag="HMPREF0733_10343"
                     /note="Walker B; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(365335..365346)
                     /locus_tag="HMPREF0733_10343"
                     /note="D-loop; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(365248..365268)
                     /locus_tag="HMPREF0733_10343"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213226"
     gene            complement(365945..366928)
                     /gene="tehA"
                     /locus_tag="HMPREF0733_10344"
                     /db_xref="GeneID:9901596"
     CDS             complement(365945..366928)
                     /gene="tehA"
                     /locus_tag="HMPREF0733_10344"
                     /note="COG: COG1275; Pfam: PF03595; InterPro: IPR004695"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein TehA"
                     /protein_id="YP_003983236.1"
                     /db_xref="GI:311112014"
                     /db_xref="GeneID:9901596"
                     /translation="MSTAAAHPVPLGTPTTTKPFPIPTSYFSVALGTSALGLSWRYGA
                     TANLVPSWVGESILALASATWLALIAAFAVKLITRRDALQSELRDLVMCCFLALVPVT
                     TIEVGISAYPYAALLGYALILIGVLGQLAFSMYRTAGLWRGTHTVAATTPVIYLPTVA
                     ANFASASGLGALGHRDWAMLFFGMGLLSWFSVEAAILGRLRTEPALDPAVRGIIGVQL
                     APPFVGGNAYLAANGGHVDWVFLVLTGYGVLQLLFLLRLVPWVLKAGYTMSLWGFSFG
                     LGAMAGTGIHLVAVSQLVQLGWALWILGTALIAVLWLGMLMLAIRGRLLVR"
     misc_feature    complement(365969..366862)
                     /gene="tehA"
                     /locus_tag="HMPREF0733_10344"
                     /note="Tellurite-resistance/Dicarboxylate Transporter
                     (TDT) family includes TehA protein; Region: TDT_TehA;
                     cd09324"
                     /db_xref="CDD:187764"
     misc_feature    complement(366104..366106)
                     /gene="tehA"
                     /locus_tag="HMPREF0733_10344"
                     /note="gating phenylalanine in ion channel; other site"
                     /db_xref="CDD:187764"
     gene            complement(367298..368002)
                     /gene="rplA"
                     /locus_tag="HMPREF0733_10345"
                     /db_xref="GeneID:9901597"
     CDS             complement(367298..368002)
                     /gene="rplA"
                     /locus_tag="HMPREF0733_10345"
                     /note="COG: COG0081; Pfam: PF00687; InterPro: IPR005878"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="YP_003983237.1"
                     /db_xref="GI:311112015"
                     /db_xref="GeneID:9901597"
                     /translation="MAKRSKAYKAAEAKIEEGKLYTPAEAVALAKETSSAKTDSTVEV
                     ALRLSVDPRKADQMVRGTVNLPHGTGKTARVVVIAAGDKAAAAEAAGADFVGSDELIA
                     KIAGGWTDFDAAVATPDMMGKVGRLGKVLGPRNLMPNPKTGTVTMDVAKAVADIKGGK
                     IDFRVDRNSNLHFIIGKASFSAEQLEENFNTALEEINRLKPSSAKGRYISKATVATTF
                     GPGIPVDPASVVSAAA"
     misc_feature    complement(367331..367930)
                     /gene="rplA"
                     /locus_tag="HMPREF0733_10345"
                     /note="Ribosomal protein L1.  The L1 protein, located near
                     the E-site of the ribosome, forms part of the L1 stalk
                     along with 23S rRNA.  In bacteria and archaea, L1
                     functions both as a ribosomal protein that binds rRNA, and
                     as a translation repressor that binds...; Region:
                     Ribosomal_L1; cd00403"
                     /db_xref="CDD:238235"
     misc_feature    complement(order(367340..367342,367346..367351,
                     367487..367489,367493..367495,367499..367501,
                     367862..367864,367868..367870,367874..367876,
                     367880..367882,367889..367897))
                     /gene="rplA"
                     /locus_tag="HMPREF0733_10345"
                     /note="mRNA/rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238235"
     gene            complement(368125..368553)
                     /gene="rplK"
                     /locus_tag="HMPREF0733_10346"
                     /db_xref="GeneID:9901598"
     CDS             complement(368125..368553)
                     /gene="rplK"
                     /locus_tag="HMPREF0733_10346"
                     /note="COG: COG0080; Pfam: PF03946,PF00298; InterPro:
                     IPR006519"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="YP_003983238.1"
                     /db_xref="GI:311112016"
                     /db_xref="GeneID:9901598"
                     /translation="MAPKKKVTGLIKLQIQAGAANPAPPVGPALGSHGVNIMEFCKAY
                     NAATESQRGNVIPVEITVYEDRSFTFITKTPPAAELIKKAAGVAKGSAVPHTTKVGSI
                     TEAQAREIAETKMPDLNANDLDAATKIVAGTARSMGITVE"
     misc_feature    complement(368128..368544)
                     /gene="rplK"
                     /locus_tag="HMPREF0733_10346"
                     /note="50S ribosomal protein L11; Validated; Region: rplK;
                     PRK00140"
                     /db_xref="CDD:234661"
     misc_feature    complement(368131..368523)
                     /gene="rplK"
                     /locus_tag="HMPREF0733_10346"
                     /note="Ribosomal protein L11. Ribosomal protein L11,
                     together with proteins L10 and L7/L12, and 23S rRNA, form
                     the L7/L12 stalk on the surface of the large subunit of
                     the ribosome. The homologous eukaryotic cytoplasmic
                     protein is also called 60S ribosomal...; Region:
                     Ribosomal_L11; cd00349"
                     /db_xref="CDD:100101"
     misc_feature    complement(order(368143..368151,368155..368160,
                     368167..368172,368179..368181,368191..368199,
                     368212..368214,368287..368289,368308..368310,
                     368320..368328,368458..368460,368518..368520))
                     /gene="rplK"
                     /locus_tag="HMPREF0733_10346"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100101"
     misc_feature    complement(order(368194..368199,368206..368211,
                     368341..368346,368350..368352,368362..368373,
                     368377..368379,368518..368520))
                     /gene="rplK"
                     /locus_tag="HMPREF0733_10346"
                     /note="L7/L12 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     misc_feature    complement(order(368458..368460,368470..368472))
                     /gene="rplK"
                     /locus_tag="HMPREF0733_10346"
                     /note="putative thiostrepton binding site; other site"
                     /db_xref="CDD:100101"
     misc_feature    complement(order(368260..368262,368269..368271))
                     /gene="rplK"
                     /locus_tag="HMPREF0733_10346"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     gene            complement(368964..369509)
                     /locus_tag="HMPREF0733_10347"
                     /db_xref="GeneID:9901599"
     CDS             complement(368964..369509)
                     /locus_tag="HMPREF0733_10347"
                     /note="Pfam: PF01510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983239.1"
                     /db_xref="GI:311112017"
                     /db_xref="GeneID:9901599"
                     /translation="MSYELLTNRKTENRHKNYRKVDDIFFLVVHWWDDKKGLSFDSNV
                     NFLCKNNNKVSAHYVSEGGRVAQIAENEDVALHAGNWNMNVASIGVENRPEADSDDFA
                     TLAELIVDIETKIGHTLYIIGHRDVVSRLCPGVYYPRIPELINRVNTIKSQRGNAPAP
                     LTEEQRADMLSRLQNIKNNPG"
     misc_feature    complement(369102..369434)
                     /locus_tag="HMPREF0733_10347"
                     /note="Peptidoglycan recognition proteins (PGRPs) are
                     pattern recognition receptors that bind, and in certain
                     cases, hydrolyze peptidoglycans (PGNs) of bacterial cell
                     walls. PGRPs have been divided into three classes: short
                     PGRPs (PGRP-S), that are small (20...; Region: PGRP;
                     cd06583"
                     /db_xref="CDD:133475"
     misc_feature    complement(order(369114..369116,369120..369122,
                     369138..369140,369342..369344,369420..369422))
                     /locus_tag="HMPREF0733_10347"
                     /note="amidase catalytic site [active]"
                     /db_xref="CDD:133475"
     misc_feature    complement(order(369114..369116,369138..369140,
                     369420..369422))
                     /locus_tag="HMPREF0733_10347"
                     /note="Zn binding residues [ion binding]; other site"
                     /db_xref="CDD:133475"
     misc_feature    complement(order(369114..369122,369126..369128,
                     369138..369140,369258..369260,369279..369284,
                     369303..369305,369342..369344,369354..369356,
                     369414..369419))
                     /locus_tag="HMPREF0733_10347"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133475"
     gene            complement(369741..370469)
                     /gene="nusG"
                     /locus_tag="HMPREF0733_10348"
                     /db_xref="GeneID:9901600"
     CDS             complement(369741..370469)
                     /gene="nusG"
                     /locus_tag="HMPREF0733_10348"
                     /note="COG: COG0250; Pfam: PF02357; InterPro: IPR001062"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination factor
                     NusG"
                     /protein_id="YP_003983240.1"
                     /db_xref="GI:311112018"
                     /db_xref="GeneID:9901600"
                     /translation="MSEQEQVPELEETESVEAAVDTESVEAETADAPVAAENASDEST
                     VSPLEEFKAKLRRQIGDWYVVHTYSGYENKVKTGIETRIQNLEAEDEIFEVQVPMETV
                     VEYKNTVKKTIRRVRVPGYVLVRMDLTDHSWGVVRHTPGVTGFVGQDAYNPVPLRMDE
                     VFDMLLPVFEEEQQSKGLPTPQPVVESDYTVGENVRVKSGPFEGMDATISEIKPESQQ
                     VVTLISVFERDTPVTLEFNQIEKI"
     misc_feature    complement(369744..370307)
                     /gene="nusG"
                     /locus_tag="HMPREF0733_10348"
                     /note="transcription antitermination protein NusG;
                     Validated; Region: nusG; PRK05609"
                     /db_xref="CDD:180161"
     misc_feature    complement(369966..370286)
                     /gene="nusG"
                     /locus_tag="HMPREF0733_10348"
                     /note="Bacterial N-Utilization Substance G (NusG)
                     N-terminal (NGN) domain, subgroup 1; Region: NGN_Bact_1;
                     cd09891"
                     /db_xref="CDD:193580"
     misc_feature    complement(order(369978..369980,370002..370004,
                     370101..370103,370107..370109,370116..370118,
                     370176..370178,370278..370280))
                     /gene="nusG"
                     /locus_tag="HMPREF0733_10348"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193580"
     misc_feature    complement(369747..369914)
                     /gene="nusG"
                     /locus_tag="HMPREF0733_10348"
                     /note="NusG contains an NGN domain at its N-terminus and
                     KOW motif at its C-terminus; Region: KOW_NusG; cd06091"
                     /db_xref="CDD:240515"
     misc_feature    complement(order(369756..369761,369771..369782,
                     369786..369794,369819..369821,369855..369857,
                     369864..369878))
                     /gene="nusG"
                     /locus_tag="HMPREF0733_10348"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     misc_feature    complement(369867..369878)
                     /gene="nusG"
                     /locus_tag="HMPREF0733_10348"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     gene            complement(370562..370843)
                     /gene="secE"
                     /locus_tag="HMPREF0733_10349"
                     /db_xref="GeneID:9901601"
     CDS             complement(370562..370843)
                     /gene="secE"
                     /locus_tag="HMPREF0733_10349"
                     /note="Pfam: PF00584; InterPro: IPR005807"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase"
                     /protein_id="YP_003983241.1"
                     /db_xref="GI:311112019"
                     /db_xref="GeneID:9901601"
                     /translation="MAKTATVKTTDTDISDDVQPGVFGRMFRFLREVISELKKVTTPT
                     RKELAIYFFGVLFFVVFMILFISGLDWVFGQGSFWVFGNGTLSPNQGGR"
     misc_feature    complement(370604..370777)
                     /gene="secE"
                     /locus_tag="HMPREF0733_10349"
                     /note="preprotein translocase subunit SecE; Reviewed;
                     Region: secE; PRK07597"
                     /db_xref="CDD:236066"
     gene            complement(370910..370985)
                     /locus_tag="HMPREF0733_t10002"
                     /db_xref="GeneID:9901602"
     tRNA            complement(370910..370985)
                     /locus_tag="HMPREF0733_t10002"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:9901602"
     gene            371371..372570
                     /gene="aspC2"
                     /locus_tag="HMPREF0733_10350"
                     /db_xref="GeneID:9901603"
     CDS             371371..372570
                     /gene="aspC2"
                     /locus_tag="HMPREF0733_10350"
                     /EC_number="2.6.1.1"
                     /note="COG: COG0436; Pfam: PF00155; InterPro: IPR004839"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate transaminase"
                     /protein_id="YP_003983242.1"
                     /db_xref="GI:311112020"
                     /db_xref="GeneID:9901603"
                     /translation="MARISSRIGAIAPSATLIVDSKAKALKAAGRPVIGFGAGEPDFP
                     TPAHIVDAARDALNDPKNFRYSPASGLPELKQAIADKTLRDSGVKVDPSQVLITNGGK
                     QAVYEAFATVIDDGDDVLLPAPYWTTYPECIRLAGGNPIEVFAGSDQDYKVTVEQLEA
                     AYTPATKALIFVSPSNPTGAVYTEEETRAIGQWALEKGVFVLTDEIYEHLTYDGIDSV
                     SILKVVPELADTCVILNGVAKTYAMTGWRVGWLIGPEDVVKAASNLQSHLTSNVNNIA
                     QRAALKALTGSQNDVEEMHAAFNRRRTKIVDGLNAIDGVHCPSPKGAFYAYPDVRGLL
                     GKEIAGKRPQTSAELAELILEEAEVAVVPGEAFGPSGYLRLSYALSDDDLAEGIARLQ
                     KLLGSAR"
     misc_feature    371371..372567
                     /gene="aspC2"
                     /locus_tag="HMPREF0733_10350"
                     /note="aspartate aminotransferase; Provisional; Region:
                     PRK05764"
                     /db_xref="CDD:235596"
     misc_feature    371470..372549
                     /gene="aspC2"
                     /locus_tag="HMPREF0733_10350"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(371668..371676,371746..371748,371896..371898,
                     371989..371991,372076..372078,372082..372087,
                     372109..372111)
                     /gene="aspC2"
                     /locus_tag="HMPREF0733_10350"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(371677..371679,371776..371778,371968..371970,
                     372103..372111,372196..372198,372205..372207)
                     /gene="aspC2"
                     /locus_tag="HMPREF0733_10350"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    372085..372087
                     /gene="aspC2"
                     /locus_tag="HMPREF0733_10350"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            373119..374150
                     /gene="pfkA"
                     /locus_tag="HMPREF0733_10351"
                     /db_xref="GeneID:9901604"
     CDS             373119..374150
                     /gene="pfkA"
                     /locus_tag="HMPREF0733_10351"
                     /EC_number="2.7.1.11"
                     /note="COG: COG0205; Pfam: PF00365; InterPro: IPR012829"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="YP_003983243.1"
                     /db_xref="GI:311112021"
                     /db_xref="GeneID:9901604"
                     /translation="MKIGLLTSGGDCPGLNAVIRGAVLNGVKKYGYEFVGFRDGWRGV
                     VEGDFMDLPRQKVRGLASRGGTIIGTSRTNPFDGPNGGPENIEIMMERHGIDAIIAIG
                     GEGTLAGAKRLADAGLPVVGVPKTIDNDLRATDYTFGFDTAVSIATEAMDRIRTTGES
                     HHRCMVAEVMGRHVGWIALHSGMAAGAHAILIPEVKVSMDEICHWVKEVHDRGRSPLV
                     VVAEGFIPEGFDEVLANKGTEKDGRPRLGGIGEYLTQEIEERTGIETRNTILGHIQRG
                     GAPTGYDRVLATRLGMGAVDMVHEKKWGMMVSVQGTEIKYVPLEEALDGLKSVPRERW
                     DEAAVLFGR"
     misc_feature    373122..374084
                     /gene="pfkA"
                     /locus_tag="HMPREF0733_10351"
                     /note="phosphofructokinase; Region: PFK_mixed; TIGR02483"
                     /db_xref="CDD:233887"
     misc_feature    order(373146..373148,373239..373241,373332..373334,
                     373428..373436,373440..373445,373494..373496,
                     373500..373502,373506..373508,373626..373634,
                     373782..373784,373932..373934,373941..373943)
                     /gene="pfkA"
                     /locus_tag="HMPREF0733_10351"
                     /note="active site"
                     /db_xref="CDD:238216"
     misc_feature    order(373146..373148,373239..373241,373332..373334,
                     373428..373436,373440..373445)
                     /gene="pfkA"
                     /locus_tag="HMPREF0733_10351"
                     /note="ADP/pyrophosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238216"
     misc_feature    order(373176..373178,373188..373190,373278..373280,
                     373293..373295,373302..373304,373524..373526,
                     373560..373562,373572..373574,373581..373583,
                     373665..373670,373674..373676,373968..373973,
                     373983..373985,374004..374006,374049..374051,
                     374133..374135)
                     /gene="pfkA"
                     /locus_tag="HMPREF0733_10351"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238216"
     misc_feature    order(373176..373178,373188..373190,373278..373283,
                     373290..373295,373581..373583,373674..373676,
                     373680..373682,373752..373754,373758..373763)
                     /gene="pfkA"
                     /locus_tag="HMPREF0733_10351"
                     /note="allosteric effector site; other site"
                     /db_xref="CDD:238216"
     misc_feature    order(373494..373496,373500..373502,373506..373508,
                     373605..373607,373626..373634,373782..373784,
                     373914..373916,373932..373934,373941..373943)
                     /gene="pfkA"
                     /locus_tag="HMPREF0733_10351"
                     /note="fructose-1,6-bisphosphate binding site; other site"
                     /db_xref="CDD:238216"
     gene            complement(374250..375458)
                     /gene="ygfZ"
                     /locus_tag="HMPREF0733_10352"
                     /db_xref="GeneID:9901605"
     CDS             complement(374250..375458)
                     /gene="ygfZ"
                     /locus_tag="HMPREF0733_10352"
                     /note="COG: COG0354; Pfam: PF01571,PF08669"
                     /codon_start=1
                     /transl_table=11
                     /product="folate-binding protein YgfZ"
                     /protein_id="YP_003983244.1"
                     /db_xref="GI:311112022"
                     /db_xref="GeneID:9901605"
                     /translation="MSTAENTATDAPEYTPTLSPLMQVHGAFAADGPDAGIAAHYGNP
                     LAEQRSLAHDRGATTGEPVVVDRSSLGVVRVSGPDRASWLTSLASQILTDMNPGDSRE
                     FLLLSPQGRIEYAPATVEDGQALWLIVEGAQAEPLTDYLNRMKFMLRVDIENMSGDYA
                     VIETARNPRGEQGAIHPSFADALIWRDPWTALVEGGYHYSATPDAHPGIDYERYLSII
                     PREKLATLTEGAQLAGVWAAEALRIEAWRPRAGTEIDNKTIPQELDYTRTAVHFEKGC
                     YKGQETVARVHNLGHPPRRLVFLDLDGSEHTLPAAGSELFVEGKPRAVGRITSVALHH
                     EAGPIALAVIKRAVDPAAPLRAVDTSEASTDEAPAPATEYAAAQTLIVSPEAGEIARK
                     SLAGQDFLKR"
     misc_feature    complement(374385..375278)
                     /gene="ygfZ"
                     /locus_tag="HMPREF0733_10352"
                     /note="Predicted aminomethyltransferase related to GcvT
                     [General function prediction only]; Region: COG0354"
                     /db_xref="CDD:223431"
     misc_feature    complement(374655..375269)
                     /gene="ygfZ"
                     /locus_tag="HMPREF0733_10352"
                     /note="Aminomethyltransferase folate-binding domain;
                     Region: GCV_T; pfam01571"
                     /db_xref="CDD:250713"
     misc_feature    complement(374556..374744)
                     /gene="ygfZ"
                     /locus_tag="HMPREF0733_10352"
                     /note="folate-binding protein YgfZ; Region:
                     ygfZ_signature; TIGR03317"
                     /db_xref="CDD:234167"
     misc_feature    complement(<374418..374636)
                     /gene="ygfZ"
                     /locus_tag="HMPREF0733_10352"
                     /note="Glycine cleavage T-protein C-terminal barrel
                     domain; Region: GCV_T_C; pfam08669"
                     /db_xref="CDD:254962"
     gene            complement(375569..376246)
                     /locus_tag="HMPREF0733_10353"
                     /db_xref="GeneID:9901606"
     CDS             complement(375569..376246)
                     /locus_tag="HMPREF0733_10353"
                     /note="Pfam: PF08768; InterPro: IPR014878"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983245.1"
                     /db_xref="GI:311112023"
                     /db_xref="GeneID:9901606"
                     /translation="MAIEIPTNLTPELVPFAWLLGTWEGTGTMWYEGQENTPFGQIIN
                     FTQDGLPYLEYRAESFLLDDNGQKLRPITIETGFWQIDRPLTDADGGFGLVPKDIVPA
                     FADAESVETLRNEDDGFNLIATIAHPGGISENYVGMIKGPVVRMQTGNLLRDEISHDY
                     AGSVRLWGLVNGNLMWDWEIADQEGNLHKHASAELRKTSSMTGDSLGTGMFGSLDDGA
                     EEGSAEN"
     misc_feature    complement(375656..376210)
                     /locus_tag="HMPREF0733_10353"
                     /note="nitrobindin heme-binding domain; Region:
                     nitrobindin; cd07828"
                     /db_xref="CDD:143652"
     misc_feature    complement(order(375674..375679,375701..375703,
                     375707..375709,375713..375715,375752..375754,
                     375758..375760,375866..375868,376028..376033,
                     376070..376072,376130..376132,376136..376138,
                     376145..376150))
                     /locus_tag="HMPREF0733_10353"
                     /note="heme-binding site [chemical binding]; other site"
                     /db_xref="CDD:143652"
     gene            376739..377443
                     /gene="glnR"
                     /locus_tag="HMPREF0733_10354"
                     /db_xref="GeneID:9901607"
     CDS             376739..377443
                     /gene="glnR"
                     /locus_tag="HMPREF0733_10354"
                     /note="COG: COG0745; Pfam: PF00486; InterPro: IPR011991"
                     /codon_start=1
                     /transl_table=11
                     /product="GlnR family transcriptional regulator"
                     /protein_id="YP_003983246.1"
                     /db_xref="GI:311112024"
                     /db_xref="GeneID:9901607"
                     /translation="MYRIALLSDAPRAQELIPALSLLSHRVIELPLDSPLSTIGTEHD
                     IVILDARQNLLKARNTAQLLKTAGITIPLMIVLTEGGMAAVSASWQVDDIVLDQASPS
                     EMDARLRLLVTAPELKDTDDRSQQIIRIGNLVIDAQTYSAHLNGAALNLTFKEFELLK
                     FVAQHPGRVFSRAQLLSEVWGYDSYYGGTRTVDVHVRRLRSKLGSEHEQMITTVRNVG
                     YSFHAQNTHHDPSAED"
     misc_feature    376742..377407
                     /gene="glnR"
                     /locus_tag="HMPREF0733_10354"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    377120..377401
                     /gene="glnR"
                     /locus_tag="HMPREF0733_10354"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(377192..377194,377249..377254,377309..377311,
                     377318..377320,377342..377347,377375..377377,
                     377390..377392)
                     /gene="glnR"
                     /locus_tag="HMPREF0733_10354"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            377568..378707
                     /gene="mshD"
                     /locus_tag="HMPREF0733_10355"
                     /db_xref="GeneID:9901608"
     CDS             377568..378707
                     /gene="mshD"
                     /locus_tag="HMPREF0733_10355"
                     /EC_number="2.3.1.-"
                     /note="COG: COG0456; Pfam: PF00583"
                     /codon_start=1
                     /transl_table=11
                     /product="mycothiol biosynthesis acetyltransferase"
                     /protein_id="YP_003983247.1"
                     /db_xref="GI:311112025"
                     /db_xref="GeneID:9901608"
                     /translation="MAASPENFTLDSGHYENMPLNAELLEHFTQFARAVQKHDGTPAF
                     SEQTLVELSKAVHGESLVKPQVFAFTPAADNSELQAVLVAVPSPEDSNEPGVLEAAVH
                     PQVRGQGLGPAFFTRVIQDLGSEAANYNLWVHGSATDTGIESPANELAEAAGFTPVRV
                     LYKMVLPLDEQTRENLAELSDARTLPNSLELRTFTPADENPWLRVNAEAFAEHPEQGR
                     LTLADLRERTGSDWFRPEGFFIISEREDPHNIAAFTWTKIPTAQTEPGQPLDDLVPAG
                     EIYVVGVSPNAQGGGLGRTVTLRALAYLALASDENGEPLHAIELYVDADNAPALKLYE
                     SLGFAVATVDRMYAPERGSGKSSSNGVDAGVLSAVTTAVISTGSI"
     misc_feature    377625..378608
                     /gene="mshD"
                     /locus_tag="HMPREF0733_10355"
                     /note="mycothiol synthase; Region: mycothiol_MshD;
                     TIGR03448"
                     /db_xref="CDD:132489"
     misc_feature    378369..378581
                     /gene="mshD"
                     /locus_tag="HMPREF0733_10355"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:249979"
     gene            378835..381087
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /db_xref="GeneID:9901609"
     CDS             378835..381087
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /EC_number="2.7.4.1"
                     /note="COG: COG0855; Pfam: PF02503; InterPro: IPR003414"
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase 1"
                     /protein_id="YP_003983248.1"
                     /db_xref="GI:311112026"
                     /db_xref="GeneID:9901609"
                     /translation="MAPHPHTKKNTEPAPMTGLIHIGNDISKIERADTRADRIEAGEK
                     LDLPNIEGDFGAERFLDRESSWLDFNSRVLELAEDPDLYLLERLNFLSIVASNLDEFF
                     MVRVAGLKRRIATGLAVPSAAGLSPDEQMEAISTAAHSLQKRHAQVFHEQILPELKKQ
                     NIHIVGWDDLDADAKTRLRQEFLRDIFPILTPLAVDPAHPFPYISGLSLNLAVLVRNP
                     QTGKELFARVKVPDQLDRMISVDGPRAANTTGKESRYIPLEVIIAEHLDTLFPGMEVV
                     EHHVFRVTRNEDLEVEEDDAENLLQALEKELLRRRFGPPVRLEVEDTINPTILDLLIS
                     ELNIDDSEVYKLPAPLDLRGMGAIVRANRPALHYPKHIAHTSRWLNAAETAKEADVFA
                     ATRDHDVLLHHPYDSFATSVQAFLAQAAADPKVQAIKQTLYRTSGDSPIVDALIEAAE
                     AGKQVVALVEIKARFDEEANISWARKLERAGVHVVYGLVGLKTHCKLSLVVRREGNQL
                     RRYAHIGTGNYHPSTARFYEDLGIITCDEQICEDVSRLFNQLSGYAPKTTYKSLLVAP
                     RSLRSGLIECINREIENHKAGKEARIQIKCNSMVDEAIIDSLYRASQAGVPVDVVVRG
                     ICALRPGVPGLSENIRVRSVLGRFLEHSRVFAFENAGEPIVYIGSADMMHRNLDRRIE
                     ALVRVKDPRHIKYLLDMFTVYMSDESRTWHLSGDGTWKRFDTDADGNPLRDVQSYYLR
                     SRSRKNHDKI"
     misc_feature    379003..381081
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /note="polyphosphate kinase; Provisional; Region:
                     PRK05443"
                     /db_xref="CDD:235469"
     misc_feature    379006..379329
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /note="Polyphosphate kinase N-terminal domain; Region:
                     PP_kinase_N; pfam13089"
                     /db_xref="CDD:257492"
     misc_feature    379357..379971
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /note="Polyphosphate kinase middle domain; Region:
                     PP_kinase; pfam02503"
                     /db_xref="CDD:251338"
     misc_feature    379999..380493
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /note="Catalytic C-terminal domain, first repeat, of
                     Pseudomonas aeruginosa polyphosphate kinase 1 and similar
                     proteins; Region: PLDc_PaPPK1_C1_like; cd09165"
                     /db_xref="CDD:197262"
     misc_feature    order(379999..380001,380008..380013,380029..380040,
                     380044..380058,380065..380067,380074..380076,
                     380302..380319,380323..380325,380374..380382,
                     380404..380424,380428..380430,380440..380442,
                     380446..380451,380458..380463,380467..380472,
                     380476..380484)
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /note="putative domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197262"
     misc_feature    order(380131..380136,380224..380226,380314..380316,
                     380320..380322,380380..380382,380386..380388,
                     380413..380415,380419..380421)
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /note="putative active site [active]"
                     /db_xref="CDD:197262"
     misc_feature    380314..380316
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197262"
     misc_feature    380509..380997
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /note="Catalytic C-terminal domain, second repeat, of
                     Pseudomonas aeruginosa polyphosphate kinase 1 and similar
                     proteins; Region: PLDc_PaPPK1_C2_like; cd09168"
                     /db_xref="CDD:197265"
     misc_feature    order(380512..380520,380776..380796,380833..380841,
                     380869..380883,380887..380889,380896..380898,
                     380905..380910,380917..380922,380929..380931)
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /note="putative domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197265"
     misc_feature    order(380701..380703,380779..380781,380785..380787,
                     380791..380793,380839..380841,380845..380847,
                     380872..380874,380878..380880)
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /note="putative active site [active]"
                     /db_xref="CDD:197265"
     misc_feature    380785..380787
                     /gene="ppk2"
                     /locus_tag="HMPREF0733_10356"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197265"
     gene            381335..382333
                     /gene="mutT"
                     /locus_tag="HMPREF0733_10357"
                     /db_xref="GeneID:9901610"
     CDS             381335..382333
                     /gene="mutT"
                     /locus_tag="HMPREF0733_10357"
                     /EC_number="3.6.1.-"
                     /note="COG: COG0494; Pfam: PF00293,PF00300; InterPro:
                     IPR000086"
                     /codon_start=1
                     /transl_table=11
                     /product="mutT/nudix family protein"
                     /protein_id="YP_003983249.1"
                     /db_xref="GI:311112027"
                     /db_xref="GeneID:9901610"
                     /translation="MTTESTYYSAHVYDNSLAITRTRENTAPVVAAGALVWRLHGEKL
                     EVLMIHRPRYNDWSWPKGKQDAGESLVETAIREVGEEVTLRITLGVPLAVTSYMVSGR
                     PKDVFYWAAQLPVGEHPRADEGEVDEIRWVTPKEARKLLSNSTDHEPLDALVAHHKAG
                     TLHTRPVVIMRHAKAKPRSNWTAADDERPLAGTGKRQALAHSRLLEAYSPTRLLSSPW
                     LRCMQTVAPYANDHAIAIKEKKSLSESGAAGHPKRTAKVTESLFVKEVPSLLCTHRPV
                     LPLVFKALKGHLMKGSAKILPTEDPYMEPGDAVILQVSTAEHGGIVSVETIRPVID"
     misc_feature    381419..381790
                     /gene="mutT"
                     /locus_tag="HMPREF0733_10357"
                     /note="Diadenosine hexaphosphate (Ap6A) hydrolase is a
                     member of the Nudix hydrolase superfamily. Ap6A hydrolase
                     specifically hydrolyzes diadenosine polyphosphates, but
                     not ATP or diadenosine triphosphate, and it generates ATP
                     as the product. Ap6A, the most...; Region: Ap6A_hydrolase;
                     cd03673"
                     /db_xref="CDD:239645"
     misc_feature    order(381485..381487,381500..381502,381515..381517,
                     381521..381523,381563..381565,381623..381625,
                     381629..381634,381644..381646,381761..381763,
                     381767..381769)
                     /gene="mutT"
                     /locus_tag="HMPREF0733_10357"
                     /note="active site"
                     /db_xref="CDD:239645"
     misc_feature    order(381485..381487,381500..381502,381515..381517,
                     381521..381523,381623..381625,381629..381634,
                     381644..381646,381761..381763,381767..381769)
                     /gene="mutT"
                     /locus_tag="HMPREF0733_10357"
                     /note="Ap6A binding site [chemical binding]; other site"
                     /db_xref="CDD:239645"
     misc_feature    381518..381586
                     /gene="mutT"
                     /locus_tag="HMPREF0733_10357"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239645"
     misc_feature    381563..381565
                     /gene="mutT"
                     /locus_tag="HMPREF0733_10357"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239645"
     misc_feature    381833..382315
                     /gene="mutT"
                     /locus_tag="HMPREF0733_10357"
                     /note="Histidine phosphatase domain found in
                     phosphoglycerate mutases and related proteins, mostly
                     phosphatases; contains a His residue which is
                     phosphorylated during the reaction; Region: HP_PGM_like;
                     cd07067"
                     /db_xref="CDD:132718"
     misc_feature    order(381845..381850,381992..381994,382151..382156)
                     /gene="mutT"
                     /locus_tag="HMPREF0733_10357"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     gene            382566..389558
                     /locus_tag="HMPREF0733_10358"
                     /db_xref="GeneID:9901611"
     CDS             382566..389558
                     /locus_tag="HMPREF0733_10358"
                     /note="Pfam: PF05593,PF00545"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983250.1"
                     /db_xref="GI:311112028"
                     /db_xref="GeneID:9901611"
                     /translation="MGEYDNMHVLERDVEFDFNHADILLSIFRYLKRKLEIQLPERQR
                     YIGIAQREFKGHFARVFDQNCKYSISECKNLITALGDAATDLQKYIDAAHQENENRKK
                     FREAMANWEEEKRKIRDNIENDNRNTFISFQKDPAAHYPPQPQPNLDNEGPKFDERAP
                     IIKSRNTGRNAEVIGRNRTHRAEKRARDAAQDATETTSAIPGNLVTFAQKNSKSDQRI
                     AELYSNITKSYSSFAEHTSWGVFDAVSLFNSIAKWVDANQSDVRWILTVAEAFATAGS
                     QGMLGPIYSEADFLDYPQYLNTGYIRNYLKEQKISTDRPSIDVSRATITGAVYSAGYA
                     LDPVNVATGNFIEHECDLSFEHAPAASLIKLERMYNSVAVTYPEEAPSGIFGLGWSST
                     LDTQLTLSNTGAVWHTPDGRTLAFPRMGDGFGRVPSESYWLSKTVPGDELYSYVSTAT
                     TKAIKTAENAGRKVSAPTAPAYYWVVYNSKHVRYFYDPSGAWTGVMEGHYATLTLPLY
                     SSDSATGALELTDIVHPASGRGLQIRYGNSPRYNRIRPESASTYLIDHDVQILDTVTY
                     IYDDDDLLAAVNRPDGIRRYTHNAKRLIEEVWDVNGHREVTNTYDGQGRVVHQLTEHS
                     REVSFVYAPGIMTIVADAITGDSSNIWRSDEHGRLSSMTAADGSRQVMRYDKFGNRIS
                     VTERDGSTISRSYDSHSRLAKQLTPEGALSKYTWDEHNRLLTTSVCDFRDRLNPGDPV
                     VVSYTYESTGANPNPITMTDGNGHTTEYSWDEYGNLLSVTDPTGVRTTYTYNARQELI
                     SITNGVGDTVHLEYDKHGRIVQVRDALGHVTSTHWNSAGQLASVTDAAGSRWSLTYPE
                     LAPEELDVPAFVRQNLTSSSTHCIHNTSRPMGQLPVSLTDPYGHVTHFEYNNGNQITA
                     VTDPLGRTNRAVFDAWGNMVKTINALGAVTNYEYDGLSQLIAVTDPLGARSEFDYDLA
                     GEISQITDATGVVTHRTVDRRTGKETTSSGGILGSSFRHVDYLGRVIIEGENNPQNFT
                     SSQPVRRASQNSKSPSASPRNSETVTEFTAYDAAGNPVETLDAHGGLTRRTYDAANRL
                     IREVSAAGRTQTFDYDQAGRLRRIGVGLSVPEQKPTVGENVEWEEPTAWAYTTLTYDA
                     ASRIIARTYPDGTTEHTTYDALGRIVRVQHGARTATYAYDRCSRLIRMSDNSAGTRRF
                     IYDAAGQLVTAVDALGYRTHFEYDAAGQMVRTLDATGQVTTYIYDAAGQLIRTIKGAG
                     STAEITSTYTYDAAGRLLSENNGERTRAYSYDYQGGGLLASLSVNGVCAAEYSYSSGT
                     SSIGHRTVTVRDYASASALRDRDSSAFAGIEKPYLEHRFVYDSSDRLISRSRSGFLRS
                     DDQSNAHADDDIHERLHALNTFIKTGAYTLTYSYDADGYLITSVTPYAKSTRTVDGAG
                     RTVAVTTHATGQPAHDVISSVFSYDPLGRLTRIRVGDMVSSWTHERTTGLISDYVREQ
                     VLADVRGFEESKVLERTQVIRDHNGRVIGLDSTGSDTSPDGLVLYSYDYAGQLVGARS
                     ASHVWEWEYTAGVMMRERVFALDSSNGSERSAAGSRVLEGERIFTHNEANQLVAVEAR
                     AYAGARGGAGELAAHTITDYSYNLAGERSGEVTTDKLTGASYSREYSWGAYGGLTSVT
                     DSVSSRVGISRTSLISDAVGEVSAVSDGEGITVPLMWDARSDIPHLLGAGATSAPSSD
                     GGFSQAGIPGGMMPWHTLNVPGLTGSTLDSALGSTPGLPTDWGVPSASATPVPGMPTG
                     FEFTGAGSLRVAGLDMLGARVYDSPSRRFLSTDPKAAIAGSSWFADVYAYAGNNPLEY
                     VDPRGERPMTVADYRKYQSQEGERFVQQSLRFLALVGVIGSLFIAPTSILLAGGVGFI
                     SGAANGAADGMDFHTPDGNIDWDKVQAYALQEGGKEALTAALIGMLFKAGPPVARATG
                     NQAMKVPVISRTVDRVKTSPVVIKTQNTVNAVKTRINGIQDRIATWTRTSLLGIEHVV
                     PKVHPTPHNSPHQIDIPNGPKPTHTGSLAHRTSGTVHEPNVQLKPVEEPKVENLPPAK
                     GVASDSPSLEKPATDGKHASWVEHPPGSKLQNGDQTATYLAGDDFKKTLVKNTKDSSR
                     YVPAEEPGTYSVYGFDEAKKLEREYYIKLNGGNSPADLSKGKPEFALWRPEVGEPNLD
                     TAMTSFRDVTRHGNTVEAQVGSHKFMVTNLDEYTGTIPDDVVPTAKSLYETGEVHWTG
                     RDYKPEGFGNVPDPLPFDNKEARILPTHDYAGNEIDYTKYRVRRLARTANQVNDPGAE
                     RLIVGSNGSMYYTPDHYKTFVRIF"
     misc_feature    384249..>386408
                     /locus_tag="HMPREF0733_10358"
                     /note="Rhs family protein [Cell envelope biogenesis, outer
                     membrane]; Region: RhsA; COG3209"
                     /db_xref="CDD:225750"
     misc_feature    384525..384635
                     /locus_tag="HMPREF0733_10358"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    384873..384986
                     /locus_tag="HMPREF0733_10358"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    384999..385112
                     /locus_tag="HMPREF0733_10358"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    385344..385457
                     /locus_tag="HMPREF0733_10358"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    385407..385520
                     /locus_tag="HMPREF0733_10358"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    385740..>387224
                     /locus_tag="HMPREF0733_10358"
                     /note="Rhs family protein [Cell envelope biogenesis, outer
                     membrane]; Region: RhsA; COG3209"
                     /db_xref="CDD:225750"
     misc_feature    385746..385859
                     /locus_tag="HMPREF0733_10358"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    385995..386108
                     /locus_tag="HMPREF0733_10358"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    386175..>386540
                     /locus_tag="HMPREF0733_10358"
                     /note="Uncharacterized protein conserved in Bacteroidetes;
                     Region: Bacuni_01323_like; cd12871"
                     /db_xref="CDD:214015"
     misc_feature    386181..386294
                     /locus_tag="HMPREF0733_10358"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    386244..386357
                     /locus_tag="HMPREF0733_10358"
                     /note="RHS Repeat; Region: RHS_repeat; pfam05593"
                     /db_xref="CDD:253268"
     misc_feature    387888..388106
                     /locus_tag="HMPREF0733_10358"
                     /note="RHS repeat-associated core domain; Region:
                     Rhs_assc_core; TIGR03696"
                     /db_xref="CDD:234316"
     misc_feature    <389331..389552
                     /locus_tag="HMPREF0733_10358"
                     /note="ribonuclease; Region: Ribonuclease; pfam00545"
                     /db_xref="CDD:249947"
     misc_feature    order(389358..389360,389424..389426,389484..389486,
                     389529..389531)
                     /locus_tag="HMPREF0733_10358"
                     /note="active site"
                     /db_xref="CDD:238228"
     gene            389567..390328
                     /locus_tag="HMPREF0733_10359"
                     /db_xref="GeneID:9901612"
     CDS             389567..390328
                     /locus_tag="HMPREF0733_10359"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983251.1"
                     /db_xref="GI:311112029"
                     /db_xref="GeneID:9901612"
                     /translation="MMTYEKKYKDGFIVPVFTQESGYWEKVMKPRLQDQGWYIAEVDC
                     ANVEDIEDCGTRLLRELNFKVPEHGYINAMGVKDNITDIYGINIRKGLFVFYKNFEDI
                     FSTHPDLHQGYGAEFMLQLIEHMVYHYSDLRGYIYEEFPVVVGYGVGLPTSYIPQFED
                     VMGAENVMIAGEGVRYPWSDFEEEQRRNFPNGAPDPLYDKYGELFGVTTHSSQTTGIY
                     VADPRYYPESPLYDPVLASKVHLVHSEFTEPDPSI"
     gene            390334..391086
                     /locus_tag="HMPREF0733_10360"
                     /db_xref="GeneID:9901613"
     CDS             390334..391086
                     /locus_tag="HMPREF0733_10360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983252.1"
                     /db_xref="GI:311112030"
                     /db_xref="GeneID:9901613"
                     /translation="MKYKCEYKDEFIVPVFTRESGYWEKVMKPRLQEQGWFIVEVNCA
                     GVDSSHELGRRLLRALGFNIAPDQWVNGFWVMNAVTEADWNDMRQGLFVFYKNFEDLF
                     SVQESCSPFYAPEYALQLAENMVHHYSKFRGNIYEQYPVVVGYGVGLPTSYLPQLEDV
                     MGAENVMIAGEGVRYPWSDFEEEQRRNFPNGAPDPLYDKDGIVYGFTIDDKDSTGVYV
                     EDPRYYPESPLYDPELASKVHLVHSEDVDDTE"
     gene            391216..391710
                     /locus_tag="HMPREF0733_10361"
                     /db_xref="GeneID:9901614"
     CDS             391216..391710
                     /locus_tag="HMPREF0733_10361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983253.1"
                     /db_xref="GI:311112031"
                     /db_xref="GeneID:9901614"
                     /translation="MGFYTDEWDDVFFPVVYVREDGVLERQLELLRQAGWKIIELSCE
                     KLLESSGSAEASVMVFEAIEFPEEIPDMPDDWIHEYLEDLHWLDLSQGFFFALKNYDA
                     LFQSPHDPHYYMAKWAAQLLQTVDTELRYRYSEDEDGEYDPANILYGMEVSQEHLDQV
                     LEFF"
     gene            391901..392509
                     /locus_tag="HMPREF0733_10362"
                     /db_xref="GeneID:9901615"
     CDS             391901..392509
                     /locus_tag="HMPREF0733_10362"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983254.1"
                     /db_xref="GI:311112032"
                     /db_xref="GeneID:9901615"
                     /translation="MVFYTDEWDDVFFPVIYVREDGVLERQLELLRQAGWKIIELSCE
                     KLLESSGSAEASVMVFEAIEFPEEIPDMPDDWIHEYLEDLHWLDLSQGFFFALKNYDA
                     LFQSPHDPHYYMAKWAAQLLQTVDTELRYRYSEDEDGEYDPANILYGMEVSQEHLDQV
                     LEFFEGRAIVIPDFDENDPGAEHPLYVKNKDEVLENWKYESK"
     gene            392955..393629
                     /locus_tag="HMPREF0733_10363"
                     /db_xref="GeneID:9901616"
     CDS             392955..393629
                     /locus_tag="HMPREF0733_10363"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983255.1"
                     /db_xref="GI:311112033"
                     /db_xref="GeneID:9901616"
                     /translation="MPYEALYSKPFNIPVFIRDNNYWENYMLPSLRQEGWHVVIVDCA
                     GVVDAYDFAIRFMNAISFDWSSFPHKFDLKWAEEYAEDIDWLDMRQGLFVYYKNFEDV
                     LSMADGLNMEGYVRYSVDILYIMNAYYPRRPMWRDDEYEVLFGYGLEVSKDSLPRVEE
                     YFGGHEIICAGPDTEYPWSQQEERKKKYFPNGFPDPRYDENGTEWINDPDEYPESTSY
                     TGSKDS"
     gene            393735..394034
                     /locus_tag="HMPREF0733_10364"
                     /db_xref="GeneID:9901617"
     CDS             393735..394034
                     /locus_tag="HMPREF0733_10364"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983256.1"
                     /db_xref="GI:311112034"
                     /db_xref="GeneID:9901617"
                     /translation="MPYQHNLSKPFIAPIFIEEDGYWQNCMKPYLEREGWYIAEVDCA
                     GVVDARDFGRRLLTALDFDWDSFLHEFDTEWAYEYATAVDWLDLRQGLFVYYKKL"
     gene            394048..394434
                     /locus_tag="HMPREF0733_10365"
                     /db_xref="GeneID:9901618"
     CDS             394048..394434
                     /locus_tag="HMPREF0733_10365"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983257.1"
                     /db_xref="GI:311112035"
                     /db_xref="GeneID:9901618"
                     /translation="MADRLGNDSYAIYAVHMVDYMRLVYPMRPSPRPRSGDDYEVTLG
                     YGFGVSRASLPRVEQFFAGNNEILIAGPEVVEYPWTWHEERKKKYFPQGFPAPRCDER
                     GEWIFDPERYPESPAFTGDAGYPVDE"
     gene            394440..394748
                     /locus_tag="HMPREF0733_10366"
                     /db_xref="GeneID:9901619"
     CDS             394440..394748
                     /locus_tag="HMPREF0733_10366"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983258.1"
                     /db_xref="GI:311112036"
                     /db_xref="GeneID:9901619"
                     /translation="MRFSLYPHNSTGTGFENQSIDQAWVQAYEFDMVKAVQTFTDWSL
                     ENFMLTLTASKEPSLQQYRFSSYAESRLLSAALCSVMDSVDKAGITEIVRSSITYLAD
                     "
     gene            394949..395710
                     /locus_tag="HMPREF0733_10367"
                     /db_xref="GeneID:9901620"
     CDS             394949..395710
                     /locus_tag="HMPREF0733_10367"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983259.1"
                     /db_xref="GI:311112037"
                     /db_xref="GeneID:9901620"
                     /translation="MVYEKEYKDEFVVPVFTRESGYWEKVMKPRLQQQGWYIAEVDCA
                     NVEDIEDCGTRLLRELNFKVPEHGYINAMAVKGNLRDIYGINMRKGLFVFYKNFEDIF
                     STHPDLYNGYGAEFMLQLIEDIVYYYSTLRGYIYEEFPVVVGYGVGLPISYIPQLEEL
                     MGAENVMVAGKGTRYPWSDFEEEQRRNFPNGAPDPLYDKTGQLFGGVINHDPQATGIY
                     VADPRYYPESPFYDPELASKVHLVHSEFTEPDPSI"
     gene            395716..396465
                     /locus_tag="HMPREF0733_10368"
                     /db_xref="GeneID:9901621"
     CDS             395716..396465
                     /locus_tag="HMPREF0733_10368"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983260.1"
                     /db_xref="GI:311112038"
                     /db_xref="GeneID:9901621"
                     /translation="MGYKYDYKDEFIVPVFTQESGYWEKIMKPRLQQQRWYIAEVDCV
                     GVEDIVDFGRRLLRALNFSVGDNEYISPIWYENLVGEISGVSMRQGFFIYYKNFGDFL
                     SMHHDADPESSAIYAIKLLENMSYHYSDLRGYIYEQYPVVVGYGVGLPTSYIPQFEEL
                     MGAENVMIAGEGVRYPWSDFEEEQRRNFPNGAPDPLYDKYGELFGVTTHSSQTTGIYV
                     DDPRYYPESPLYDPVLASKVHLVHSEFDDPE"
     gene            396623..396793
                     /locus_tag="HMPREF0733_10369"
                     /db_xref="GeneID:9901622"
     CDS             396623..396793
                     /locus_tag="HMPREF0733_10369"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983261.1"
                     /db_xref="GI:311112039"
                     /db_xref="GeneID:9901622"
                     /translation="MDFMAPQPKIGENGRVELKPNGKPETTRGDDRLIVGSNGSIYYS
                     PDHYHTFILLAE"
     misc_feature    <396704..396778
                     /locus_tag="HMPREF0733_10369"
                     /note="microbial_RNases. Ribonucleases (RNAses) cleave
                     phosphodiester bonds in RNA and are essential  for both
                     non-specific RNA degradation and for numerous forms of RNA
                     processing. The alignment contains fungal RNases (U2, T1,
                     F1, Th,  Pb, N1, and Ms) and...; Region: microbial_RNases;
                     cl00212"
                     /db_xref="CDD:260265"
     misc_feature    order(396716..396718,396761..396763)
                     /locus_tag="HMPREF0733_10369"
                     /note="active site"
                     /db_xref="CDD:238228"
     gene            396808..397458
                     /locus_tag="HMPREF0733_10370"
                     /db_xref="GeneID:9901623"
     CDS             396808..397458
                     /locus_tag="HMPREF0733_10370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983262.1"
                     /db_xref="GI:311112040"
                     /db_xref="GeneID:9901623"
                     /translation="MAYKQVRSAEGFIAPLFIREDGYWENHMLPYLEAEGWKVIVVDC
                     AGVETTLDFAYRLVASIESVYAIPDDFNLRWASEDACLINWFDMRQGLFVLYKNFDDL
                     FVMDDEDVSLCVNILEEMEVYYATRQLHGSGLYEVLVGYGFDISRESLPRVKEFFNDS
                     IVIAADGAKYPWSRVERFKKLFFPNGFPDPLYEDGDDWINDPDECSESTSYTGGNS"
     misc_feature    <396880..>397185
                     /locus_tag="HMPREF0733_10370"
                     /note="Predicted ATPase involved in chromosome
                     partitioning [Cell division and chromosome partitioning];
                     Region: ArsA; COG0003"
                     /db_xref="CDD:223082"
     gene            397490..398101
                     /locus_tag="HMPREF0733_10371"
                     /db_xref="GeneID:9901624"
     CDS             397490..398101
                     /locus_tag="HMPREF0733_10371"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983263.1"
                     /db_xref="GI:311112041"
                     /db_xref="GeneID:9901624"
                     /translation="MGFYKNESDDTFFPAIYITEDKVLERQTQALRDQGWAVIEIHCK
                     NILASQDPQAGALEIIRAVNLPHKLPDDNYMTWTQEIISDLDWLDLSKGVFVILKDYD
                     VLFTPWNSPDHSEAKWMARHLQTVDDNLRYRHSQFAYGDYDPPYVLYGMEVSQEKLDT
                     VLEFFEGRATIIEDFDKDNPGAEYPPLVEYRHKVVRSWQHKNN"
     gene            398223..399131
                     /gene="thyA"
                     /locus_tag="HMPREF0733_10372"
                     /db_xref="GeneID:9901625"
     CDS             398223..399131
                     /gene="thyA"
                     /locus_tag="HMPREF0733_10372"
                     /EC_number="2.1.1.45"
                     /note="COG: COG0207; Pfam: PF00303; InterPro: IPR000398"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="YP_003983264.1"
                     /db_xref="GI:311112042"
                     /db_xref="GeneID:9901625"
                     /translation="MSTPAHHASGQQSIPTPYEDLLREILDENRDAIAADAQRADRTG
                     TGTFGVFGRQMRFDLRDSFPLITTKRVHFKSVAVELLWFLRGSSNIRWLQERGVTIWD
                     EWADENGDLGPVYGVQWRSWPTPDGGTIDQIAKVIESLKTNPSSRRHIVSAWNPAEVD
                     EMALPPCHAMFQFYVHERPDGVKELSCQLYQRSADMFLGVPFNIASYALLTYLIAHEV
                     GMEPGEFIWTGGDCHIYSNHLEQVKKQLGYGNDPEGNPYPPREPYPYPKLVIKTKKPS
                     VFDYEYEDFELVDYKHHPGISAPIAV"
     misc_feature    398274..398951
                     /gene="thyA"
                     /locus_tag="HMPREF0733_10372"
                     /note="Thymidylate synthase and pyrimidine
                     hydroxymethylase: Thymidylate synthase (TS) and
                     deoxycytidylate hydroxymethylase (dCMP-HMase) are homologs
                     that catalyze analogous alkylation of C5 of pyrimidine
                     nucleotides. Both enzymes are involved in the...; Region:
                     TS_Pyrimidine_HMase; cd00351"
                     /db_xref="CDD:238211"
     misc_feature    order(398310..398312,398343..398345,398367..398369,
                     398373..398375,398661..398666,398685..398690,
                     398730..398732,398736..398738,398748..398750,
                     398790..398792,398796..398801,398910..398915)
                     /gene="thyA"
                     /locus_tag="HMPREF0733_10372"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238211"
     misc_feature    order(398346..398348,398457..398459,398523..398525,
                     398532..398534,398565..398567,398721..398726,
                     398793..398801,398805..398807,398826..398831,
                     398919..398921,398925..398927)
                     /gene="thyA"
                     /locus_tag="HMPREF0733_10372"
                     /note="active site"
                     /db_xref="CDD:238211"
     gene            399140..399826
                     /gene="folA"
                     /locus_tag="HMPREF0733_10373"
                     /db_xref="GeneID:9901626"
     CDS             399140..399826
                     /gene="folA"
                     /locus_tag="HMPREF0733_10373"
                     /EC_number="1.5.1.3"
                     /note="COG: COG0262; Pfam: PF00186; InterPro: IPR001796"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="YP_003983265.1"
                     /db_xref="GI:311112043"
                     /db_xref="GeneID:9901626"
                     /translation="MREYESPSLARPCLGAIWAQTDAGIIGRDGTMPWRAPEDLAHFK
                     TVTVGKPVIMGRRTWESFPPRFRPLPERTNIVISRSITGGSAAPLKRDGAFWVPSLDA
                     ALTLASNTPLTPNDNQHPDSPHQQVDAWIIGGGSVYAEALSREDLPSFGRVEIIERTF
                     FYCQEGNEITGDTYAPELAVEGFVAADEPARWRILGESAWEKSERGYLLDASGGKNPM
                     YYSFQTLARL"
     misc_feature    399179..399814
                     /gene="folA"
                     /locus_tag="HMPREF0733_10373"
                     /note="Dihydrofolate reductase (DHFR). Reduces
                     7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH
                     as a cofactor. This is an essential step in the
                     biosynthesis of deoxythymidine phosphate since
                     5,6,7,8-tetrahydrofolate is required to regenerate 5;
                     Region: DHFR; cd00209"
                     /db_xref="CDD:238127"
     misc_feature    order(399188..399190,399239..399241,399254..399256,
                     399353..399355,399533..399535,399551..399553)
                     /gene="folA"
                     /locus_tag="HMPREF0733_10373"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     misc_feature    order(399194..399196,399215..399217,399305..399313,
                     399374..399376,399536..399547)
                     /gene="folA"
                     /locus_tag="HMPREF0733_10373"
                     /note="NADP+ binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     gene            399991..401178
                     /gene="asd"
                     /locus_tag="HMPREF0733_10374"
                     /db_xref="GeneID:9901627"
     CDS             399991..401178
                     /gene="asd"
                     /locus_tag="HMPREF0733_10374"
                     /EC_number="1.2.1.11"
                     /note="COG: COG0136; Pfam: PF01118,PF02774; InterPro:
                     IPR011534"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="YP_003983266.1"
                     /db_xref="GI:311112044"
                     /db_xref="GeneID:9901627"
                     /translation="MTLFHAICGTRGRLEIMNFNPGDSVGFVGWRGMVGSVLMKRMLE
                     ENDFKDISPVFFTTSNVGGEAPTFDGTLEPSTLKDAYDLNELRQHKIIVTAQGGDYTK
                     EIHPKLRESGWEGLWIDAASALRMNDDAIIVLDPINRDVIDRGLESGVKDFIGGNCTV
                     SCLLMGLGGLFKQGLVEWTTSMTYQAASGGGARHMREVLGQFRDLGNEVSAELNDPAA
                     AILEIDRKVLAKQRSGELDTAQFGVPLSGSLIPWIDSDLGNGQSREEWKSDAETNKIL
                     GLEGDNRVIMDGLCVRIAAMRSHSQALTMKLTEDLPVAEIERIIAEDNQWAQVVPNTK
                     DATMEGLTPVAASGSLNIPVGRIRKLAMGPQYISAFTVGDQLLWGAAEPVRRMLKIAV
                     GKL"
     misc_feature    400063..401169
                     /gene="asd"
                     /locus_tag="HMPREF0733_10374"
                     /note="aspartate-semialdehyde dehydrogenase; Reviewed;
                     Region: PRK06598"
                     /db_xref="CDD:235839"
     misc_feature    400063..400419
                     /gene="asd"
                     /locus_tag="HMPREF0733_10374"
                     /note="Semialdehyde dehydrogenase, NAD binding domain;
                     Region: Semialdhyde_dh; pfam01118"
                     /db_xref="CDD:250373"
     misc_feature    400489..401124
                     /gene="asd"
                     /locus_tag="HMPREF0733_10374"
                     /note="Semialdehyde dehydrogenase, dimerization domain;
                     Region: Semialdhyde_dhC; pfam02774"
                     /db_xref="CDD:251521"
     gene            complement(401419..401763)
                     /locus_tag="HMPREF0733_10375"
                     /db_xref="GeneID:9901628"
     CDS             complement(401419..401763)
                     /locus_tag="HMPREF0733_10375"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983267.1"
                     /db_xref="GI:311112045"
                     /db_xref="GeneID:9901628"
                     /translation="MKTLEDEVTESETSKFHLWLEKKKARMHAHPVLKHLYKPLVIAV
                     GGFCFIAGLIMLVTPGPGWLFIFIGLGIWGTEFAWAHRLNQRLKKLVISLWHRYIAWR
                     EKRKAQKAARKA"
     misc_feature    complement(401497..401652)
                     /locus_tag="HMPREF0733_10375"
                     /note="Putative transmembrane protein (PGPGW); Region:
                     PGPGW; pfam09656"
                     /db_xref="CDD:150350"
     gene            402042..402854
                     /locus_tag="HMPREF0733_10376"
                     /db_xref="GeneID:9901629"
     CDS             402042..402854
                     /locus_tag="HMPREF0733_10376"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983268.1"
                     /db_xref="GI:311112046"
                     /db_xref="GeneID:9901629"
                     /translation="MEKLSYTTEFTLWPVPHARPLIDGKPEPGAHPAEYLHPGKLHLE
                     TSDDNYVDLYIVPPLFKPGYPPGYQFYADLIFSNIYIAQDLQFYYRAFHDELQFAVSS
                     DTIWQNRDHQYAVAIVDKDLNLSWTLRDSDPLRMEFIETVINTIHASMFKMPPILAEG
                     EYMEFMNERNILDSAHLCCGDRVLRAIDVKAHTNDPVRVLTETDYSAVIRGTVYPSAR
                     LIWSVPLEDARYWHNAYNVLTVDPVIGAKIPADVRAILEHLPAAPAYTQGHS"
     gene            402895..403098
                     /locus_tag="HMPREF0733_10377"
                     /db_xref="GeneID:9901630"
     CDS             402895..403098
                     /locus_tag="HMPREF0733_10377"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983269.1"
                     /db_xref="GI:311112047"
                     /db_xref="GeneID:9901630"
                     /translation="MRDGLPVGRDVLAHCQVSQDAVPHAATTRDADNTPQAPLLTWDI
                     VDTNHDRMAYIRAVLRVSPGSRG"
     gene            403281..404609
                     /gene="yceI"
                     /locus_tag="HMPREF0733_10378"
                     /db_xref="GeneID:9901631"
     CDS             403281..404609
                     /gene="yceI"
                     /locus_tag="HMPREF0733_10378"
                     /note="COG: COG0477; Pfam: PF07690; InterPro: IPR011701"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator family transporter"
                     /protein_id="YP_003983270.1"
                     /db_xref="GI:311112048"
                     /db_xref="GeneID:9901631"
                     /translation="MAKTSLTARLETLPFTKKHTKLLGVTGIGWALDAMDVGLISFIM
                     AALTKQWALSPTETSWLGSIGFLGMALGATVGGLLADRFGRRYIFAATLLIYGLATGA
                     SALAGSLAVLMVFRFIVGLGLGAELPVASTLMSEFSPRAIRGRVVVILEAFWALGWIL
                     AALIGTFVVPNPNGWRWALAIGVIPALYSLIIRWGTPESVRFLESKGRIDEAERVVAE
                     FESSAALSTRTHANETNRDNAPEAPANDTQEAASIWSAPLRKRTLALCTVWFCINLSY
                     YGAFIWIPSLLSAQGFSLVKSFAFTLIMTLAQLPGYAVAAYLIEKWGRRATLAVFLAG
                     SAGAAVCYGLSHSDFFIILSGCFLSFFNLGAWGALYAISPEVFPTRLRGTGTGTAAGL
                     GRIASILAPLIVPPLISFGGTGVLFAVFAAAFLLAAVTTFALPEKRGKSL"
     misc_feature    403296..404504
                     /gene="yceI"
                     /locus_tag="HMPREF0733_10378"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    403347..404522
                     /gene="yceI"
                     /locus_tag="HMPREF0733_10378"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(403389..403391,403398..403406,403410..403415,
                     403464..403466,403473..403478,403485..403487,
                     403497..403502,403506..403511,403647..403652,
                     403659..403664,403671..403676,403683..403685,
                     403719..403724,403731..403736,403752..403754,
                     404097..404099,404106..404111,404118..404123,
                     404130..404132,404169..404171,404181..404183,
                     404193..404195,404202..404204,404214..404216,
                     404355..404357,404364..404369,404376..404378,
                     404388..404393,404400..404402,404433..404438,
                     404445..404450,404457..404462,404469..404471)
                     /gene="yceI"
                     /locus_tag="HMPREF0733_10378"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            404911..406665
                     /locus_tag="HMPREF0733_10379"
                     /db_xref="GeneID:9901632"
     CDS             404911..406665
                     /locus_tag="HMPREF0733_10379"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983271.1"
                     /db_xref="GI:311112049"
                     /db_xref="GeneID:9901632"
                     /translation="MAETPAVTYIPWPIAHTPAPLENGEPVAGRHPAEYLGPGVLHYI
                     GSEFHLMAELNPYPFDPENPHRFRGELVHRYTYFSGNITFSFKADEDYLYFTAHVFLT
                     WQEPSDRTYARARVDRNFAFHWEQHDDDPQRSVYIEAVFMALYRSLSVQHLELGDGEF
                     FDLNEDRQYHSYHMRQGDDIIRLAYVTKCSSRTYLDVTTDYRATVLSYCHPPARLAWS
                     VPTEDARYTFEHTDPLIYPPDTGEDIPEYVRRILPYLPTAPYRRAKRTYAPASAYRAT
                     FTPWPMTVQQGETIHNAQYPWQRLVSGEFLIESRQNTPFSMYLNACEFSMYLDACEFS
                     MYLDACEPDWDSMKGDRQVYAELMPNVGGRRPWFGTDFTLCMRRWQNNLVFSAEHLTK
                     WRAIDWETCAIAILDAEGSLTWELRDEVAGRGSYIEALVGHIVDSLGTEPPVLAPGEG
                     KVLYDQDGQVSSVHVNTGETMLRALITRIWYGVNPATGERAPYLYEARVKDQFDEDSD
                     GGFSTIAWSSLEKFYYWSWDRVPGFVPAVTDPEILRRDEVDLLIPHLPVAPGVPSQEN
                     EDDVAVPWFYEASTATKE"
     gene            complement(406689..407063)
                     /locus_tag="HMPREF0733_10380"
                     /db_xref="GeneID:9901633"
     CDS             complement(406689..407063)
                     /locus_tag="HMPREF0733_10380"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein"
                     /protein_id="YP_003983272.1"
                     /db_xref="GI:311112050"
                     /db_xref="GeneID:9901633"
                     /translation="MTGFPLHNNGWMLIIGCITIGLILGVACGMTTAVYTQNRQIYAR
                     AGGWAVVFWLVGMSGRLVFGLYAEHGGAEQIYRFSLDCSIPMDAWASALIMMALCEVM
                     SRTFVLAWKLIHARQALPAAAS"
     gene            407265..407702
                     /locus_tag="HMPREF0733_10381"
                     /db_xref="GeneID:9901634"
     CDS             407265..407702
                     /locus_tag="HMPREF0733_10381"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983273.1"
                     /db_xref="GI:311112051"
                     /db_xref="GeneID:9901634"
                     /translation="MTLGELYQLARMLRDITITAGSLTHMSVHPSEAMVFEDIVQHPN
                     TTINQVAERTHLAQSRVSTMVNAMITEGAVTVSTDSQDQRRKTLQASPQLLQDIKAID
                     YNKAIRQAIHRLYPSLSEHQIADVTQHLDHIFTLLSADSRRES"
     misc_feature    407280..407654
                     /locus_tag="HMPREF0733_10381"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    407352..407633
                     /locus_tag="HMPREF0733_10381"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            407706..408242
                     /locus_tag="HMPREF0733_10382"
                     /db_xref="GeneID:9901635"
     CDS             407706..408242
                     /locus_tag="HMPREF0733_10382"
                     /note="Pfam: PF08002; InterPro: IPR012545"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopentomutase"
                     /protein_id="YP_003983274.1"
                     /db_xref="GI:311112052"
                     /db_xref="GeneID:9901635"
                     /translation="MQYILLLRSVNLGKLRKVSMPELKKRLAALGYENVTSYINSGNL
                     LFVSSRDKTTVAQEITDLLAKHYDFEIPFSLLTADEYRKDAHNLPEWWNEDMPRLDAM
                     FFTIDADRDALAAELETLDVPDEVLHIGTCAVYFGNYSTPDYKKAQYGKFMSKKAFAN
                     QLTLRNAKTYNKILDLLD"
     misc_feature    407712..408110
                     /locus_tag="HMPREF0733_10382"
                     /note="Protein of unknown function (DUF1697); Region:
                     DUF1697; pfam08002"
                     /db_xref="CDD:254576"
     gene            complement(408362..409471)
                     /gene="murB"
                     /locus_tag="HMPREF0733_10383"
                     /db_xref="GeneID:9901636"
     CDS             complement(408362..409471)
                     /gene="murB"
                     /locus_tag="HMPREF0733_10383"
                     /EC_number="1.1.1.158"
                     /note="COG: COG0812; Pfam: PF01565,PF02873; InterPro:
                     IPR003170"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate dehydrogenase"
                     /protein_id="YP_003983275.1"
                     /db_xref="GI:311112053"
                     /db_xref="GeneID:9901636"
                     /translation="MTEKLLSEITTAQVGGPARTYIRATTEAEIVEAVSSADAANEPV
                     LIVGGGSNLLVSDAGFDGTVVHIASTGVEELPIPACGGANVRVQAGTVWDDFVQLSIE
                     KEWSGPAALSGIPGTVGATPVQNVGAYGVEVGEFIASVRTWDRETGKFKTFANADLRF
                     GYRDSILKQNMVNGSPRYVVLTVDFQFTLGSLSSPIKYGELAKSLGVQVGKRAESALV
                     RDKVLALRASKGMVLDASDRDTFSTGSFFTNPIVPVSVLDSLPEDAPRFPVVTRTGVF
                     GTEQQESEEYVKLSAAWLIQHAGFEKGFGLEGDAREIAGGRASLSTKHTLAITNRGDA
                     TAEDIFAIARAVRAGVAEKFGVELVPEPVVVNGKI"
     misc_feature    complement(408407..409456)
                     /gene="murB"
                     /locus_tag="HMPREF0733_10383"
                     /note="UDP-N-acetylenolpyruvoylglucosamine reductase;
                     Provisional; Region: murB; PRK13903"
                     /db_xref="CDD:237552"
     misc_feature    complement(409013..409411)
                     /gene="murB"
                     /locus_tag="HMPREF0733_10383"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    complement(408407..408820)
                     /gene="murB"
                     /locus_tag="HMPREF0733_10383"
                     /note="UDP-N-acetylenolpyruvoylglucosamine reductase,
                     C-terminal domain; Region: MurB_C; pfam02873"
                     /db_xref="CDD:251582"
     gene            complement(409610..410071)
                     /locus_tag="HMPREF0733_10384"
                     /db_xref="GeneID:9901637"
     CDS             complement(409610..410071)
                     /locus_tag="HMPREF0733_10384"
                     /note="COG: COG2030; Pfam: PF01575; InterPro: IPR002539"
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC family protein"
                     /protein_id="YP_003983276.1"
                     /db_xref="GI:311112054"
                     /db_xref="GeneID:9901637"
                     /translation="MSVNFAELEKGQEIGSRTIDISRASLVRYAGASGDFNPIHWNER
                     FAQSVGLSGVIAHGMLTMGTAVQLVSDWAGDPGAIVDYQTRFTKPVPVPDAPGGDNPD
                     TPTNALTITGKVGAVDEDARTVRIDLTVTADDGEGNQQKVLMKTQAVVKFA"
     misc_feature    complement(409670..410041)
                     /locus_tag="HMPREF0733_10384"
                     /note="SAV4209_like.  Similar in sequence to the
                     Streptomyces avermitilis SAV4209 protein, with a hot dog
                     fold that is similar to those of (R)-specific enoyl-CoA
                     hydratase, the peroxisomal
                     Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the
                     fatty acid...; Region: SAV4209_like; cd03453"
                     /db_xref="CDD:239537"
     misc_feature    complement(order(409895..409900,409907..409909,
                     409952..409954,409961..409963,409967..409969,
                     409982..409984))
                     /locus_tag="HMPREF0733_10384"
                     /note="active site"
                     /db_xref="CDD:239537"
     misc_feature    complement(order(409898..409900,409952..409954,
                     409961..409963,409967..409969))
                     /locus_tag="HMPREF0733_10384"
                     /note="catalytic site [active]"
                     /db_xref="CDD:239537"
     gene            complement(410071..410703)
                     /locus_tag="HMPREF0733_10385"
                     /db_xref="GeneID:9901638"
     CDS             complement(410071..410703)
                     /locus_tag="HMPREF0733_10385"
                     /note="Pfam: PF01575"
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC like domain-containing protein"
                     /protein_id="YP_003983277.1"
                     /db_xref="GI:311112055"
                     /db_xref="GeneID:9901638"
                     /translation="MRIIGARGHKIKDRERDRHDGSFQNEKSTLLGYAPYAHGYLHVR
                     GKRRQLRHQPDRLVGMSINPDIVGRVYPAEGTYAVGREKIREFARAVHAENPLHHDVE
                     AARAAGYADLIAPPTFAIILSQAADAALIGDKSAGIDFSRVVHADQRFTHHRPIVAGD
                     ELRTEVHVDSVRVMGAGAMLTTREEITDADGKPVTTCISSLLVRADEEGE"
     misc_feature    complement(410098..410490)
                     /locus_tag="HMPREF0733_10385"
                     /note="(R)-hydratase [(R)-specific enoyl-CoA hydratase].
                     Catalyzes the hydration of trans-2-enoyl CoA to
                     (R)-3-hydroxyacyl-CoA as part of the PHA
                     (polyhydroxyalkanoate) biosynthetic pathway.  The
                     structure of the monomer includes a five-strand
                     antiparallel...; Region: R_hydratase_like; cd03441"
                     /db_xref="CDD:239525"
     misc_feature    complement(order(410353..410358,410365..410367,
                     410410..410412,410419..410421,410425..410427,
                     410440..410442))
                     /locus_tag="HMPREF0733_10385"
                     /note="active site"
                     /db_xref="CDD:239525"
     misc_feature    complement(order(410356..410358,410410..410412,
                     410419..410421,410425..410427))
                     /locus_tag="HMPREF0733_10385"
                     /note="catalytic site [active]"
                     /db_xref="CDD:239525"
     gene            410647..411642
                     /locus_tag="HMPREF0733_10386"
                     /db_xref="GeneID:9901639"
     CDS             410647..411642
                     /locus_tag="HMPREF0733_10386"
                     /EC_number="1.14.14.3"
                     /note="COG: COG2141; Pfam: PF00296; InterPro: IPR011251"
                     /codon_start=1
                     /transl_table=11
                     /product="luciferase family monooxygenase"
                     /protein_id="YP_003983278.1"
                     /db_xref="GI:311112056"
                     /db_xref="GeneID:9901639"
                     /translation="MSIPFSVLDLMPTRPDDSHPQTMRKTVQAAQAAERFGFNRFWVA
                     EHHNAGSLLSSATVVVMAELAAATERIRVGSGGIMLPNHAPYVVAEQFGTLEAFHPGR
                     IDLGLGRAPGTDPMTAQALRRDNSAAMNFPAEVEEIQRYLGDPSPMRRVHAIPGQGSN
                     VPLYILGSSTFGASLAAKLGLPFSFASHFAPAALQDALNVYRNNFTPSQTLDKPYVIV
                     GAGSLVAETDEQAQRLFTTAQQHALGIIRGRPQFSPPVDDMEKLWSPAEKRHISSMLQ
                     EAVVGSPQTVQSKLEDLVARTGADEVIITSTPWEFEDRIRSYELLSELPIFQKTE"
     misc_feature    410659..411618
                     /locus_tag="HMPREF0733_10386"
                     /note="luciferase family oxidoreductase, group 1; Region:
                     oxido_grp_1; TIGR03558"
                     /db_xref="CDD:234256"
     gene            complement(411891..411962)
                     /locus_tag="HMPREF0733_t10003"
                     /db_xref="GeneID:9901640"
     tRNA            complement(411891..411962)
                     /locus_tag="HMPREF0733_t10003"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:9901640"
     gene            complement(411964..412037)
                     /locus_tag="HMPREF0733_t10004"
                     /db_xref="GeneID:9901641"
     tRNA            complement(411964..412037)
                     /locus_tag="HMPREF0733_t10004"
                     /product="tRNA-Met"
                     /db_xref="GeneID:9901641"
     gene            complement(412067..412138)
                     /locus_tag="HMPREF0733_t10005"
                     /db_xref="GeneID:9901642"
     tRNA            complement(412067..412138)
                     /locus_tag="HMPREF0733_t10005"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:9901642"
     gene            412197..412349
                     /locus_tag="HMPREF0733_10387"
                     /db_xref="GeneID:9901643"
     CDS             412197..412349
                     /locus_tag="HMPREF0733_10387"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983279.1"
                     /db_xref="GI:311112057"
                     /db_xref="GeneID:9901643"
                     /translation="MTLCFSPKNRRFYTVYSRMRPPVFPSTIPAGASRFYEITKRLIL
                     RLTFTD"
     gene            complement(412346..414433)
                     /gene="deaD"
                     /locus_tag="HMPREF0733_10388"
                     /db_xref="GeneID:9901644"
     CDS             complement(412346..414433)
                     /gene="deaD"
                     /locus_tag="HMPREF0733_10388"
                     /EC_number="3.6.1.-"
                     /note="COG: COG0513; Pfam: PF00270,PF00271,PF03880;
                     InterPro: IPR014001"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase DeaD"
                     /protein_id="YP_003983280.1"
                     /db_xref="GI:311112058"
                     /db_xref="GeneID:9901644"
                     /translation="MWLECVGESERRRKACARTPQQNEEKVTENIPAENAEQGATLGN
                     TEETLSVEKTVEESSLETGEKPTNEKADAAESMTAEPREDNAATKKNTEDNTHESHEE
                     GTRFTDLGLDPRVLSALEEVGYEKPSPIQEQTIPLLLDGKDVVGLAQTGTGKTAAFAL
                     PALSRMAELADINGVSRDTQVLVLAPTRELALQVAEAFSSYATHMEDFTVLPIYGGSP
                     YGPQLAGLRRGAQVVVGTPGRVIDHLEKGSLDLSNLQYLVLDEADEMLRMGFAEDVET
                     ILEGTPDAKQVALFSATMPNSIRKIAQQYLNDPTEVRVKTKTTTGANIRQRYMQVMHS
                     HKLDAMTRVLEVENYDGIIVFVRTKKETEEVADKLKARGFQAAAINGDIPQQLRERTV
                     DALRDGRIDILVATDVAARGLDVERISLVVNYDIPHDTESYVHRIGRTGRAGRDGEAI
                     LFVTPREKYMLRQIEKATRQKVEPMHMPTAQDVNSSRKQRFAEQITETIETEDLNFFR
                     KIIEDYENEHDTTAEDIAAALAVIAQQGRAFFLDENDDIARKSRAFADDTKDCGKRGP
                     KKGRNHSDEGMVNYKLNVGRASRVKASAIVGALANEGGIKGSQIGSIDIRQHFTIVGL
                     PEDLPKGFFDRLRDTKVAGEFINIRKDRGPQGGGGRGFRRNDRRDGGFRSRRDDHRGG
                     RDDRRGKSHGKRY"
     misc_feature    complement(412352..414124)
                     /gene="deaD"
                     /locus_tag="HMPREF0733_10388"
                     /note="ATP-dependent RNA helicase DeaD; Provisional;
                     Region: PRK11634"
                     /db_xref="CDD:236941"
     misc_feature    complement(413495..414118)
                     /gene="deaD"
                     /locus_tag="HMPREF0733_10388"
                     /note="DEAD-box helicases. A diverse family of proteins
                     involved in ATP-dependent RNA unwinding, needed in a
                     variety of cellular processes including splicing, ribosome
                     biogenesis and RNA degradation. The name derives from the
                     sequence of the Walker  B motif; Region: DEADc; cd00268"
                     /db_xref="CDD:238167"
     misc_feature    complement(413969..413983)
                     /gene="deaD"
                     /locus_tag="HMPREF0733_10388"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(413645..413656)
                     /gene="deaD"
                     /locus_tag="HMPREF0733_10388"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(413555..413563)
                     /gene="deaD"
                     /locus_tag="HMPREF0733_10388"
                     /note="motif III; other site"
                     /db_xref="CDD:238167"
     misc_feature    complement(413078..413467)
                     /gene="deaD"
                     /locus_tag="HMPREF0733_10388"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(413210..413218,413291..413296,
                     413354..413365))
                     /gene="deaD"
                     /locus_tag="HMPREF0733_10388"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(413108..413110,413117..413119,
                     413129..413131,413192..413194))
                     /gene="deaD"
                     /locus_tag="HMPREF0733_10388"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    complement(412484..412696)
                     /gene="deaD"
                     /locus_tag="HMPREF0733_10388"
                     /note="RNA recognition motif (RRM) superfamily; Region:
                     RRM_SF; cl17169"
                     /db_xref="CDD:266524"
     gene            complement(414898..416652)
                     /locus_tag="HMPREF0733_10389"
                     /db_xref="GeneID:9901645"
     CDS             complement(414898..416652)
                     /locus_tag="HMPREF0733_10389"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983281.1"
                     /db_xref="GI:311112059"
                     /db_xref="GeneID:9901645"
                     /translation="MAAEVSAPDSEPTEKSAKTSASQHTGAHRSVTAGRVLVAIMLAL
                     AVFALYCYYSVQQLKHWITPSWDLAIFTQMAQAYSHFGIPIVQIKGTDFNLWGDHFHP
                     ILVLLGPVYAVSPSPLTLLVVQNFMIAASVYMMVRFTQRACAFSSNTKPEPVGTFVGV
                     LLGAAFALSYGVQQAVAAQFHEVAFALPFLCGALGNLVLAGRINADERSRYIIRACLW
                     AAPLAFVKEDMGVTAAMIGIVAFIRTGWIRKGLDELFPQNPEGKPLPRGERIRNTFNS
                     WVKTRGAAESTMLILWGLFWSYAAVALILPLFNANGQFDYGDKVDVYGAFADPLGSAI
                     TIFNYDQKVWTILLLLFCGAIIWVASPFAIVILPTLLWRLLSNTEAYWLSTWHYSLVL
                     MPVAFLALLEVILNLRYGKVLAHPKPLAEDEESEDEPAETGDKPIGWVENLRQSVRRV
                     PLWFFPAVALLVSVIPTVTPTSDQPLADLTKSSFISNRLTASETNRMQAVEAVPQDVS
                     VAADLSTLTQLIPGRTVYWIGHAGEPAPDYVVIDKRGSAWGGNPPQNTAQYAADRYGH
                     PYAQVGTYGSLEVVRKIS"
     misc_feature    complement(415000..416466)
                     /locus_tag="HMPREF0733_10389"
                     /note="Dolichyl-phosphate-mannose-protein
                     mannosyltransferase; Region: PMT_2; cl19158"
                     /db_xref="CDD:267511"
     gene            416872..418011
                     /locus_tag="HMPREF0733_10390"
                     /db_xref="GeneID:9901646"
     CDS             416872..418011
                     /locus_tag="HMPREF0733_10390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983282.1"
                     /db_xref="GI:311112060"
                     /db_xref="GeneID:9901646"
                     /translation="MPTESVSDAAYRIELSRLPMRTSALTARITVGIQALIYPHVPVH
                     VGQTLGRLQRGPTDPTFHRLRAPRSERSRTADDTLWIGARTPSLQLPATLYFTRRFEG
                     ATSALNAPVQVCLWAESSPATPDDAFPTEQVYSELEDFASLIPAWLGLHDPREEFAKL
                     PAFEHLPLKIRRAYRENPGLRLSASGQLTRHMLAAIVEQRVTQPEAFDALRWIIMRYG
                     ESAPFSGNPAQPPYLRIYPTAQVLATIPSWDWHRARVDSARYSTVYRFTQRADALKRL
                     GATGRIAHLAAALDDIPGVGPWSVAETLQGFCGHPDAVSVGDYHLAHTVGFAFTGERT
                     DDAGMLRLLAPYAGHRQRVVRLIQEAGIHKPRYGARISIPDYRDF"
     misc_feature    <417388..417981
                     /locus_tag="HMPREF0733_10390"
                     /note="3-methyladenine DNA glycosylase/8-oxoguanine DNA
                     glycosylase [DNA replication, recombination, and repair];
                     Region: AlkA; COG0122"
                     /db_xref="CDD:223200"
     misc_feature    <417724..417903
                     /locus_tag="HMPREF0733_10390"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cl19066"
                     /db_xref="CDD:267419"
     misc_feature    417745..417768
                     /locus_tag="HMPREF0733_10390"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    417823..417825
                     /locus_tag="HMPREF0733_10390"
                     /note="active site"
                     /db_xref="CDD:238013"
     gene            complement(418113..418478)
                     /gene="trxA"
                     /locus_tag="HMPREF0733_10391"
                     /db_xref="GeneID:9901647"
     CDS             complement(418113..418478)
                     /gene="trxA"
                     /locus_tag="HMPREF0733_10391"
                     /EC_number="1.8.1.9"
                     /note="COG: COG0526; Pfam: PF00085; InterPro: IPR012335"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="YP_003983283.1"
                     /db_xref="GI:311112061"
                     /db_xref="GeneID:9901647"
                     /translation="MATIEITQQNLTSTVEGNDIVFLDFWADWCGPCKQFAPVYEAAS
                     EKYSDIVFGKVDTEDQSQLAQAAGITSIPTIMGFRGGILVFSQPGALNESQFEQVITS
                     IRELDMDKVREEMATAEQN"
     misc_feature    complement(418179..418454)
                     /gene="trxA"
                     /locus_tag="HMPREF0733_10391"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    complement(order(418380..418382,418389..418391))
                     /gene="trxA"
                     /locus_tag="HMPREF0733_10391"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            complement(418654..418738)
                     /locus_tag="HMPREF0733_t10006"
                     /db_xref="GeneID:9901648"
     tRNA            complement(418654..418738)
                     /locus_tag="HMPREF0733_t10006"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:9901648"
     gene            complement(418884..419240)
                     /locus_tag="HMPREF0733_10392"
                     /db_xref="GeneID:9901649"
     CDS             complement(418884..419240)
                     /locus_tag="HMPREF0733_10392"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983284.1"
                     /db_xref="GI:311112062"
                     /db_xref="GeneID:9901649"
                     /translation="MATQYSSTTGSVNREEARDAETLLFLDLYSSIGSEPENIPEAER
                     VDAVQSEDSSDVVEPPAFEGIGSTLTDPKLVARFEGVRRDLAREIRSEMCTVEQALRY
                     LEHLEITLLMEQDGDL"
     gene            419390..419881
                     /gene="trpF"
                     /locus_tag="HMPREF0733_10393"
                     /db_xref="GeneID:9901650"
     CDS             419390..419881
                     /gene="trpF"
                     /locus_tag="HMPREF0733_10393"
                     /EC_number="5.3.1.24"
                     /note="COG: COG1666; Pfam: PF04461; InterPro: IPR007551"
                     /codon_start=1
                     /transl_table=11
                     /product="N-(5'phosphoribosyl)anthranilate isomerase"
                     /protein_id="YP_003983285.1"
                     /db_xref="GI:311112063"
                     /db_xref="GeneID:9901650"
                     /translation="MASDSSFDIVSKVDKQEVSNALHQAQKEVSQRYDFRGVGAEIDF
                     SGEKILIKANAQERALAVLDVFQSKLVKRGISLKSLDAGDPYASGKETRIECSIKEGI
                     AQDQAKKISKLIRDEGPKGVKATIQGDELRVSSKSRDDLQSVISLLKGADLDIDLQFV
                     NYR"
     misc_feature    419402..419878
                     /gene="trpF"
                     /locus_tag="HMPREF0733_10393"
                     /note="Proteins similar to Escherichia coli YajQ; Region:
                     YajQ_like; cd11740"
                     /db_xref="CDD:213038"
     gene            complement(419988..420869)
                     /gene="htpX"
                     /locus_tag="HMPREF0733_10394"
                     /db_xref="GeneID:9901651"
     CDS             complement(419988..420869)
                     /gene="htpX"
                     /locus_tag="HMPREF0733_10394"
                     /EC_number="3.4.24.-"
                     /note="COG: COG0501; Pfam: PF01435; InterPro: IPR001915"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein HtpX"
                     /protein_id="YP_003983286.1"
                     /db_xref="GI:311112064"
                     /db_xref="GeneID:9901651"
                     /translation="MHKHYNGLKTALLLGGMVGLLMLIGGGLSTYFRSSIFIWGFALV
                     SLGTVAYSYWNSDKLALRSMNAYAVTREEVPVLYDIVEELSSRAGQPMPRLYVAPTQT
                     PNAFATGRNPRNAAVCCTEGILQLLDEREMRGVLGHELMHVYNRDILTSSVAAGIATL
                     ITAAAQIVGFGSMMGGNRERGGGNFLSIILMSLLAPIATAVIQMAISRTREYDADEDG
                     AKLTGDPIALASALNKLEKGVSLYPMDPKNQQVVNTSASMIANPFGGLKNLMSTHPPM
                     DKRIARLQQMARDNGQL"
     misc_feature    complement(419994..420869)
                     /gene="htpX"
                     /locus_tag="HMPREF0733_10394"
                     /note="Peptidase family M48; Region: Peptidase_M48;
                     cl12018"
                     /db_xref="CDD:264511"
     gene            420898..421017
                     /locus_tag="HMPREF0733_10395"
                     /db_xref="GeneID:9901652"
     CDS             420898..421017
                     /locus_tag="HMPREF0733_10395"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983287.1"
                     /db_xref="GI:311112065"
                     /db_xref="GeneID:9901652"
                     /translation="MNVLDYSIRDIYEADIQIRHQRVFRILAPTGSSNASKVT"
     gene            421162..421740
                     /gene="fur2"
                     /locus_tag="HMPREF0733_10396"
                     /db_xref="GeneID:9901653"
     CDS             421162..421740
                     /gene="fur2"
                     /locus_tag="HMPREF0733_10396"
                     /note="COG: COG0735; Pfam: PF01475; InterPro: IPR002481"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulation protein"
                     /protein_id="YP_003983288.1"
                     /db_xref="GI:311112066"
                     /db_xref="GeneID:9901653"
                     /translation="MTEPLDTNAHPEPEHPLHGCSHTGVLPLAAESATGLLTESWSQN
                     LRAKGRRVTKQRLAVLRAVQAHPHANAEEIVTAVRQEIPTITVQSVYVILTDLTNIDM
                     LRKFEPPGTPGLYETRTGDNHHHAFCIRCGKVQDVDCAVGSAPCLTPSDFHGMAIISA
                     DVLYRGVCADCQTEAEAELAKSQVQAAASVQH"
     misc_feature    421321..421665
                     /gene="fur2"
                     /locus_tag="HMPREF0733_10396"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    order(421363..421365,421507..421509,421528..421530,
                     421534..421536,421567..421569)
                     /gene="fur2"
                     /locus_tag="HMPREF0733_10396"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    421417..421461
                     /gene="fur2"
                     /locus_tag="HMPREF0733_10396"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(421525..421527,421531..421533,421588..421590,
                     421639..421641)
                     /gene="fur2"
                     /locus_tag="HMPREF0733_10396"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    order(421540..421548,421594..421599,421624..421632,
                     421636..421662)
                     /gene="fur2"
                     /locus_tag="HMPREF0733_10396"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(421543..421545,421552..421554,421663..421665)
                     /gene="fur2"
                     /locus_tag="HMPREF0733_10396"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            421869..423359
                     /gene="katA"
                     /locus_tag="HMPREF0733_10397"
                     /db_xref="GeneID:9901654"
     CDS             421869..423359
                     /gene="katA"
                     /locus_tag="HMPREF0733_10397"
                     /EC_number="1.11.1.6"
                     /note="COG: COG0753; Pfam: PF00199; InterPro: IPR011614"
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="YP_003983289.1"
                     /db_xref="GI:311112067"
                     /db_xref="GeneID:9901654"
                     /translation="MYQTPQNPIHPGSYTTTSTGTPVASDDHSLTVGADGPIVLHDAY
                     AVEKLAQFNRERVPERVVHAKGTGAYGYFETTEDVSQYTRAALFQPGVKTELLIRFST
                     VAGESGSPDTWRDPRGFAVKFYTTEGNYDLVGNNTPIFFIRDAIKFPDFIHSQKRMPG
                     SGLRDHDMQWDFWSLNPATAHQVTWLMGDRGLPRTLRHMDGFGSHTYQWINTEGERFW
                     VKYHFKTEQGNEFFTQAQADEMAGKDADFHRRDLREAIERGDYPAWTLYVQIMPYEDA
                     KTYRINPFDLTKIWPHSDYPLVKVGRMVLDRNPQNFFAEIEQAAFSPSNFVPGIAASP
                     DKMLLGRIFSYPDAHRYRIGTNFAQLPVNAPHAAPVNNYSHDGSMRYNFNDPSVPTYA
                     PNSLGGPHADAERAGEGSWESDGELVRTAYTLRPDDDDFSQARTLYEVTMNDEERERL
                     ISNISGHVSAVRSDEIRERAFQYWDNVHPELGSRVREAVSAAASGS"
     misc_feature    421932..423344
                     /gene="katA"
                     /locus_tag="HMPREF0733_10397"
                     /note="Catalase [Inorganic ion transport and metabolism];
                     Region: KatE; COG0753"
                     /db_xref="CDD:223824"
     misc_feature    422034..423335
                     /gene="katA"
                     /locus_tag="HMPREF0733_10397"
                     /note="Clade 3 of the heme-binding enzyme catalase;
                     Region: catalase_clade_3; cd08156"
                     /db_xref="CDD:163712"
     misc_feature    order(422034..422036,422049..422051,422190..422195,
                     422250..422255,422298..422312,422316..422318,
                     422325..422327,422343..422360,422370..422372,
                     422379..422381,422571..422573,422580..422582,
                     422589..422594,422604..422606,422613..422618,
                     422625..422627,422694..422699,422712..422714,
                     422718..422720,422796..422798,422802..422807,
                     422811..422813,422820..422822,422841..422846,
                     422868..422870,422874..422876,422883..422885,
                     422892..422900,422907..422912,422919..422927,
                     422931..422936,422940..422951,422961..422963,
                     422976..422981,422985..422987,422994..422996,
                     423000..423008,423036..423053,423243..423248,
                     423252..423254,423261..423263,423273..423275)
                     /gene="katA"
                     /locus_tag="HMPREF0733_10397"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163712"
     misc_feature    order(422055..422057,422169..422171,422271..422273,
                     422286..422288,422310..422312,422889..422891,
                     422901..422903)
                     /gene="katA"
                     /locus_tag="HMPREF0733_10397"
                     /note="heme binding pocket [chemical binding]; other site"
                     /db_xref="CDD:163712"
     misc_feature    order(422280..422282,422409..422411,422421..422423,
                     422430..422432,422436..422438,422466..422468,
                     422532..422534,422538..422540,422733..422744,
                     423165..423167,423174..423179)
                     /gene="katA"
                     /locus_tag="HMPREF0733_10397"
                     /note="NADPH binding site [chemical binding]; other site"
                     /db_xref="CDD:163712"
     gene            complement(423470..424831)
                     /locus_tag="HMPREF0733_10398"
                     /db_xref="GeneID:9901655"
     CDS             complement(423470..424831)
                     /locus_tag="HMPREF0733_10398"
                     /note="Pfam: PF02687"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983290.1"
                     /db_xref="GI:311112068"
                     /db_xref="GeneID:9901655"
                     /translation="MMVKVAVKQLRRTWRVWVGALVMVIVGATGITAVRLHLATASTM
                     PSEKARAIFSLAYGEVAFLIVASVAMLASTARYAVAATRAEYARLQLVGVLPRQVFTI
                     VLVQLLAVGVIGVVFGCGLGIVCAQPMLDYTVHQTTLQQTVPVVYLAHSIVISALIVL
                     VVTLFSGVRSARAASLMPALWALRETEETPAVKFSCGRLILTLVLAGCTIALAVGIQF
                     VRIDPHQERVGVVISGVIGLGILLGLCLISLLAALAPLLSTGFISVWSAIIPMRLSAS
                     WSIARRFIQHSGGRSAATLTPVLIAVGLPGILYTVYDTIATGMSSGSGPNTGGLSVIL
                     SPALLTATIGSATIIFMGSLSRSRDFALLVLTGVSRAVIARIVVFESLMYALSSFLLA
                     LGVMAVVGFSVSSRFPAETKVTSALGWDVAAVSAGCAWVILCLANLAPVLRYNRLKLV
                     STT"
     misc_feature    complement(424304..424654)
                     /locus_tag="HMPREF0733_10398"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            complement(424828..425598)
                     /gene="macB"
                     /locus_tag="HMPREF0733_10399"
                     /db_xref="GeneID:9901656"
     CDS             complement(424828..425598)
                     /gene="macB"
                     /locus_tag="HMPREF0733_10399"
                     /EC_number="3.6.3.-"
                     /note="COG: COG1136; Pfam: PF00005; InterPro: IPR003593"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_003983291.1"
                     /db_xref="GI:311112069"
                     /db_xref="GeneID:9901656"
                     /translation="MMAFPHTAEEIITGAGIYKSFPSAGSREQLSVLKGIDLQIQRGS
                     FTGIVGPSGSGKSTLLNCLAGLEPLTSGTVTIGGTDISSLRGNKLVAFRRDHLGFVFQ
                     SYNLIPALTAYENVLLPAQLAGLRHAHRRAREALHAVHMLDFSRSLPNRLSGGQAQRV
                     AIARALASGAELIFADEPTGALDTKTGNLVLDILRHLVDEEHRTIVMVTHDLEAASRT
                     DIVYVMRDGTLHETLESPHTPEILAALDRAAAYETDAS"
     misc_feature    complement(424903..425568)
                     /gene="macB"
                     /locus_tag="HMPREF0733_10399"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    complement(424912..425565)
                     /gene="macB"
                     /locus_tag="HMPREF0733_10399"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    complement(425428..425451)
                     /gene="macB"
                     /locus_tag="HMPREF0733_10399"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(order(424969..424971,425068..425073,
                     425293..425295,425425..425433,425437..425442))
                     /gene="macB"
                     /locus_tag="HMPREF0733_10399"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(425293..425304)
                     /gene="macB"
                     /locus_tag="HMPREF0733_10399"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(425116..425145)
                     /gene="macB"
                     /locus_tag="HMPREF0733_10399"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(425068..425085)
                     /gene="macB"
                     /locus_tag="HMPREF0733_10399"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(425050..425061)
                     /gene="macB"
                     /locus_tag="HMPREF0733_10399"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(424963..424983)
                     /gene="macB"
                     /locus_tag="HMPREF0733_10399"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            complement(425786..427141)
                     /locus_tag="HMPREF0733_10400"
                     /db_xref="GeneID:9901657"
     CDS             complement(425786..427141)
                     /locus_tag="HMPREF0733_10400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983292.1"
                     /db_xref="GI:311112070"
                     /db_xref="GeneID:9901657"
                     /translation="MTDTRRSEPTSRAARTQDALNRIGSWLLDVVKAEPGWSEMILDV
                     KPLAGQVYIRVREFRDGEEYIGSVGPLKEDSPVLPDLRKLQRAAYDGNRGTWFTASVV
                     VAANNWPEPKFSVGASYNRDEEPENWGTEGTLSASDVREHLHMFPRDSERIPAWATER
                     MHGRARDVSGLHKETDYEVPNPYLAAALEAFKKDVKERTLINVVRTMLGGDLLVDASG
                     STIVPAGHLDIGPESQLRYQVIRLENGMQALCVFSSAEYVSKSYMRENSDDDELILRE
                     PAVKIFMDFLSNPDLDLIAIDPGSNHECYIERAQVQWVVNSPRNDGAKMALINDNMQQ
                     LLGSLVAPNSILVVAIDPKSEVQGPAFVPDDEGNPTNMLAFTSPIEVAAIDPAIEVRV
                     AHAIEVLTLAEQLNAPGIQINYFNPSAVLDIKQIRELLDIVREQEAVFGASPAGAGAP
                     A"
     misc_feature    complement(426200..426592)
                     /locus_tag="HMPREF0733_10400"
                     /note="SseB protein N-terminal domain; Region: SseB;
                     pfam07179"
                     /db_xref="CDD:254092"
     gene            427396..428901
                     /locus_tag="HMPREF0733_10401"
                     /db_xref="GeneID:9901658"
     CDS             427396..428901
                     /locus_tag="HMPREF0733_10401"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983293.1"
                     /db_xref="GI:311112071"
                     /db_xref="GeneID:9901658"
                     /translation="MTNSLQDLIDASIFISTEYQARLAELIGSADYDVNFAEQSLTFK
                     AADPVSFQPYLLGTESENRGTWIWSWQQLGYFPDSVVSAALQARDTGERDSVLELSTD
                     EIPLSEGLARRLTLATKTVTGLYAHYPLPSGSVRAWCLIDSPELTLDAPTYKGVGRVI
                     AKALQSEDIHDHPLAINSYARQRGFHTAWDTEATVVLTMTDGALRLWFDEGRISGIER
                     AKPEVTAQELEQLASEAEQYRAELAAERAEVEQAAAAEAAEQVALREQQSAERAAARA
                     EAEQAPTAQKPEAAQVAESTPAQENAQQEEAAPAQPQAPAAAAEQAVPAGTAQKPVAG
                     VRTTENLYPDTEAPFDQDPREDSEHGRVTVNTLPGDVVPNAAAAQKTGAPAGQAKSAN
                     PGASETSKSRTSITPRAAGKPGASASQGQTTPQPGAQKPAAAGAQQQPKQAPKPAASG
                     TDASAPQTENTPATAIPVIKPSEQKADQPEEQEQAQETGKKKGFFSRFFGL"
     misc_feature    <428551..428697
                     /locus_tag="HMPREF0733_10401"
                     /note="UL14 tegument protein; Provisional; Region:
                     PHA03185"
                     /db_xref="CDD:177553"
     gene            429147..430256
                     /gene="rarD"
                     /locus_tag="HMPREF0733_10402"
                     /db_xref="GeneID:9901659"
     CDS             429147..430256
                     /gene="rarD"
                     /locus_tag="HMPREF0733_10402"
                     /note="COG: COG2962; Pfam: PF00892; InterPro: IPR004626"
                     /codon_start=1
                     /transl_table=11
                     /product="DMT superfamily drug/metabolite transporter
                     RarD"
                     /protein_id="YP_003983294.1"
                     /db_xref="GI:311112072"
                     /db_xref="GeneID:9901659"
                     /translation="MAQHAHSATASTSAPGTAAHAAQTRNGFICLFTTYAIWGMLPLY
                     FYLMASSSALEIVLSRVIFSLAFCAVLLPIFRLTKPFNQAVRTPRTMGILTVASLLIG
                     ANWMIYVYSTTHGHTIDMSLGYFINPLVSVVLGVVFLHERLRKVQWLAIGISTVAVLI
                     MSVVYGQIPWLGLGVAFTFGTYGLLKARVGSSVHPVVSLSLETFILLPVALVVLWWMN
                     TQGQLTLFSQGPGHFWLLASTGIVTVTPLVLFSAAARALPLSVIGMVQYMGPTIQFFL
                     ALFVLHDRITPDKWIGLSLIWVAIVIFTVDAMRASRTSRPSKLTAVETGMIPIVQISQ
                     SSEGGEDREQNYLLDAVQLSPEDTEDSAASARDKS"
     misc_feature    429207..430082
                     /gene="rarD"
                     /locus_tag="HMPREF0733_10402"
                     /note="Predicted permeases [General function prediction
                     only]; Region: RarD; COG2962"
                     /db_xref="CDD:225510"
     misc_feature    429324..429635
                     /gene="rarD"
                     /locus_tag="HMPREF0733_10402"
                     /note="Multidrug resistance efflux transporter; Region:
                     EmrE; pfam13536"
                     /db_xref="CDD:257855"
     misc_feature    429675..430061
                     /gene="rarD"
                     /locus_tag="HMPREF0733_10402"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(430404..430541)
                     /locus_tag="HMPREF0733_10403"
                     /db_xref="GeneID:9901660"
     CDS             complement(430404..430541)
                     /locus_tag="HMPREF0733_10403"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983295.1"
                     /db_xref="GI:311112073"
                     /db_xref="GeneID:9901660"
                     /translation="MSGAAIAMMIVAILIIWGGLVFALVNLSRHPEEPEDDTVEQAAT
                     E"
     gene            complement(430541..432151)
                     /locus_tag="HMPREF0733_10404"
                     /db_xref="GeneID:9901661"
     CDS             complement(430541..432151)
                     /locus_tag="HMPREF0733_10404"
                     /note="COG: COG0733; Pfam: PF00209; InterPro: IPR000175"
                     /codon_start=1
                     /transl_table=11
                     /product="NSS family sodium:neurotransmitter symporter"
                     /protein_id="YP_003983296.1"
                     /db_xref="GI:311112074"
                     /db_xref="GeneID:9901661"
                     /translation="MGTKPAKTPAKREGFSSRRVFLFAAIGSAVGLGNIWRFPAVAYE
                     NGGGAFMIPYIVALLTAGLTFLFFDYAIGHRGRASSPLAFRRLNRKTEFIGWWHMGIS
                     AVIAIYYAAIIAWAVRYMIFSFNQEWGNDAKSFFMKDFLKVGDPKLSFDFNPGILIPL
                     VLVWISLIVIMALGVQKGVGAANVVFMPLLIFMFVGLVAYSLTLPGAMNGLNTLFTPN
                     WGALTNGEVWVAAYGQIFFSLSLGFGIMVTYASYLKPKTDLTGSGAVVGFANSGFELL
                     AGIGVFAALGFMAQAQGIAVGEVVEKGTGLAFIAFPTIISQAPAGALIGFLFFGSLLF
                     AGFTSLISVLEVIIAGVQDKAGTSRLTSTMIVIIPLAIISTLLMPTASGLYVLDILDN
                     FVNNFGILAAGLTSIVVVVYCLRALPTLRDHLNSVSSLKVGWLWMILLAGVTPLILGY
                     SLISTLVKTINKPYEGYPADLLGIFGWGMVVLLIVGSIVISFLPWSHKSRAAEEPPAP
                     PVIGGKLAHTHVDDAALKAHAKAQGEEA"
     misc_feature    complement(430679..432118)
                     /locus_tag="HMPREF0733_10404"
                     /note="uncharacterized bacterial and archaeal solute
                     carrier 6 subfamily; solute-binding domain; Region:
                     SLC6sbd_u1; cd10334"
                     /db_xref="CDD:212042"
     misc_feature    complement(order(431135..431140,431147..431149,
                     432062..432064,432071..432073))
                     /locus_tag="HMPREF0733_10404"
                     /note="Na2 binding site [ion binding]; other site"
                     /db_xref="CDD:212042"
     misc_feature    complement(order(431123..431128,431135..431137,
                     431417..431419,431423..431425,431438..431443,
                     431825..431827,432050..432061,432065..432070))
                     /locus_tag="HMPREF0733_10404"
                     /note="putative substrate binding site 1 [chemical
                     binding]; other site"
                     /db_xref="CDD:212042"
     misc_feature    complement(order(431342..431344,431438..431440,
                     432050..432052,432065..432067))
                     /locus_tag="HMPREF0733_10404"
                     /note="Na binding site 1 [ion binding]; other site"
                     /db_xref="CDD:212042"
     misc_feature    complement(order(431228..431230,431240..431242,
                     431807..431809,431816..431818,431828..431830,
                     432041..432046))
                     /locus_tag="HMPREF0733_10404"
                     /note="putative substrate binding site 2 [chemical
                     binding]; other site"
                     /db_xref="CDD:212042"
     gene            complement(432439..433749)
                     /locus_tag="HMPREF0733_10405"
                     /db_xref="GeneID:9901662"
     CDS             complement(432439..433749)
                     /locus_tag="HMPREF0733_10405"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983297.1"
                     /db_xref="GI:311112075"
                     /db_xref="GeneID:9901662"
                     /translation="MAHKTVTAYQSAAIFFSSVIAAAATFAISVIAAYFLSHSEFRQF
                     QSAFWPLVFGIYGITGAIQQETTRAVGAALLQKPESRTHTNRLSYSAVAALLGLGIAA
                     IVVMTSPLWSSAFPIYPQMSVVLIAFGVVMYAVYAAVSGASAGRDSWYFYAALGSGEA
                     LIRLAATLAAVALSWHLLGFETAVVVASLIWLPCVVFSRTGRRVWYASIDVSSRRYAR
                     NIVMLMLSSAGASILMTAFPFFLQFTTQDQSAQFNALVAAIGVTRSPIMMPLQAFQGV
                     AISAFLKHQDYPLRALARPCLWVLGIGGFGALLAYLIGPFLFDIFYSKYAGLAPGMML
                     AVLTFESAIIAVLVLAGNLAIALNMHRLYVSGWVCAAALALLMLHVPLDVVSRTELAL
                     GAAPLCGFTVILVGILRASKGESGKSTDKSGLFQDAPATRHERS"
     gene            complement(433869..434981)
                     /locus_tag="HMPREF0733_10406"
                     /db_xref="GeneID:9901663"
     CDS             complement(433869..434981)
                     /locus_tag="HMPREF0733_10406"
                     /EC_number="2.5.1.30"
                     /note="COG: COG0142; Pfam: PF00348; InterPro: IPR000092"
                     /codon_start=1
                     /transl_table=11
                     /product="trans-hexaprenyltranstransferase"
                     /protein_id="YP_003983298.1"
                     /db_xref="GI:311112076"
                     /db_xref="GeneID:9901663"
                     /translation="MSNTQHTATHQHTEEGIVSTSEQSIAATDLMAGLDFNLPAGFEL
                     IASDPQLGPQILTSLARIEERLAEAISYTDKLADVAARHLLLAGGKRVRPLLTLLAAA
                     VDGQINDDVIEAAVVVELTHLATLYHDDVMDDAPKRRGVDTAQTIWGNSVAILTGDLI
                     FSRASLLVSDLGTRPMKIQAQTFERLVLGQLYETTGVRENQDILDHYIAVIEGKTGSL
                     IAAAGEYGSLLAGASEEVIQMLATYGELVGVAFQLADDVIDIVSDGASSGKTQGTDLR
                     EGVPTLPTILLNRAAEAGDESARQVRTLIEADLSSDDALAAAVSALAAHPVTQEAWQI
                     AYDWADRAIAAIAPLPDSTAKAALESFAHAVVHREG"
     misc_feature    complement(433878..434744)
                     /locus_tag="HMPREF0733_10406"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-tail; Region: Trans_IPPS_HT; cd00685"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(434145..434147,434160..434162,
                     434175..434177,434205..434207,434214..434219,
                     434328..434330,434337..434342,434403..434405,
                     434412..434414,434565..434570,434583..434588,
                     434592..434600,434604..434612,434619..434621))
                     /locus_tag="HMPREF0733_10406"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173833"
     misc_feature    complement(434583..434612)
                     /locus_tag="HMPREF0733_10406"
                     /note="chain length determination region; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(434145..434147,434160..434162,
                     434175..434177,434205..434207,434214..434219,
                     434340..434342,434403..434405,434565..434570,
                     434583..434585,434592..434597))
                     /locus_tag="HMPREF0733_10406"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(434214..434219,434340..434342,
                     434565..434570,434583..434585,434592..434597))
                     /locus_tag="HMPREF0733_10406"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(434340..434342,434403..434405,
                     434565..434570,434583..434585,434592..434597))
                     /locus_tag="HMPREF0733_10406"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(434139..434153,434160..434177,
                     434193..434198,434535..434579))
                     /locus_tag="HMPREF0733_10406"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(434145..434147,434160..434162,
                     434175..434177,434205..434207,434214..434219))
                     /locus_tag="HMPREF0733_10406"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173833"
     gene            complement(434999..435724)
                     /gene="ubiE"
                     /locus_tag="HMPREF0733_10407"
                     /db_xref="GeneID:9901664"
     CDS             complement(434999..435724)
                     /gene="ubiE"
                     /locus_tag="HMPREF0733_10407"
                     /EC_number="2.1.1.-"
                     /note="COG: COG2226; Pfam: PF01209; InterPro: IPR004033"
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone/menaquinone biosynthesis
                     methyltransferase UbiE"
                     /protein_id="YP_003983299.1"
                     /db_xref="GI:311112077"
                     /db_xref="GeneID:9901664"
                     /translation="MSNVEKNVQGTRATLDKKTGDIAAMFDTVAKRYDLMNGILSLGR
                     HIYWRKQTVAAVDARPGQKVLDVAAGTGTSSEPFADAGIDVIAADLSEGMLEVGRKRR
                     PDMTFVRADVTDLPFEDDSFDAVTMSYGLRNVADYPRALSELYRVTKPGGRIVVLEFS
                     TPTFAPFGKVYKEYIMKAIPPVARAISSNPESYVYLAESIIDWPDQRTLAHKFAQAGW
                     QDVKYRNLSGGIVAIHRGFKPQN"
     misc_feature    complement(435008..435694)
                     /gene="ubiE"
                     /locus_tag="HMPREF0733_10407"
                     /note="Methylase involved in ubiquinone/menaquinone
                     biosynthesis [Coenzyme metabolism]; Region: UbiE; COG2226"
                     /db_xref="CDD:225136"
     misc_feature    complement(435257..435538)
                     /gene="ubiE"
                     /locus_tag="HMPREF0733_10407"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(435341..435343,435389..435397,
                     435455..435460,435506..435526))
                     /gene="ubiE"
                     /locus_tag="HMPREF0733_10407"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            436028..436861
                     /locus_tag="HMPREF0733_10408"
                     /db_xref="GeneID:9901665"
     CDS             436028..436861
                     /locus_tag="HMPREF0733_10408"
                     /note="COG: COG0834; Pfam: PF00497; InterPro: IPR001638"
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter"
                     /protein_id="YP_003983300.1"
                     /db_xref="GI:311112078"
                     /db_xref="GeneID:9901665"
                     /translation="MSIFTAKPSLKKSLALLALAPLVLTGCVSTASDGENGEVNLINN
                     GVLTVCTNTPYMPFEYEENGKIVGIDADIANAIAKDLGAEAQLTSISFEGLDSGTGLT
                     SGQCDIALAGISVTDERKSKMEFTDVYFEDNQAILVPKNSKISSVEDLKNAKVGAQQA
                     TSGESYAKEKGADVVQYEDNELMFSALKTGQVQAVSANLSVISEALTKDPDSFKIAYQ
                     TSENADQIAGAVAPEKKALLDKANKTIQQLKSSGELDKIKEKWTKAKSSSSSASSSSA
                     N"
     misc_feature    436166..436810
                     /locus_tag="HMPREF0733_10408"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    436166..436810
                     /locus_tag="HMPREF0733_10408"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    order(436190..436192,436301..436303,436382..436384,
                     436511..436513,436619..436621)
                     /locus_tag="HMPREF0733_10408"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(436568..436570,436580..436582,436598..436600)
                     /locus_tag="HMPREF0733_10408"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    436691..436708
                     /locus_tag="HMPREF0733_10408"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            436949..437752
                     /locus_tag="HMPREF0733_10409"
                     /db_xref="GeneID:9901666"
     CDS             436949..437752
                     /locus_tag="HMPREF0733_10409"
                     /note="COG: COG0765; Pfam: PF00528; InterPro: IPR000515"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="YP_003983301.1"
                     /db_xref="GI:311112079"
                     /db_xref="GeneID:9901666"
                     /translation="MAQNKLSPRKKQAMFRYSQYALLAVIAVLIIALADWKTLSSQVF
                     NLEVAQKQFPNVITVALKNTLIYTALGFAVGLSLGLILALMRISSIAPYRWLATIYVE
                     IFRGIPALLVFFAFGYGIPLAFKIRFVDNLIPVTLSLGLVSSAYISEVLRAGLQAVPK
                     GQYEAARSLGMSHTRAMLSVIIPQAFRIVLPPLTNEVILLTKDSSLVYLLGVQIAQYE
                     LAKFGREGITASGAGLTPLVVAGLCYLIITVPLGQLSAYFEKRTGASRK"
     misc_feature    437078..437746
                     /locus_tag="HMPREF0733_10409"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    437129..437599
                     /locus_tag="HMPREF0733_10409"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(437177..437182,437189..437194,437207..437209,
                     437237..437248,437252..437281,437288..437293,
                     437297..437299,437372..437377,437384..437386,
                     437393..437398,437402..437404,437414..437419,
                     437426..437428,437477..437479,437519..437524,
                     437531..437533,437552..437563,437570..437575)
                     /locus_tag="HMPREF0733_10409"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(437255..437299,437552..437569)
                     /locus_tag="HMPREF0733_10409"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(437297..437299,437357..437359,437570..437572)
                     /locus_tag="HMPREF0733_10409"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(437429..437467,437483..437488,437498..437500)
                     /locus_tag="HMPREF0733_10409"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            437780..438583
                     /locus_tag="HMPREF0733_10410"
                     /db_xref="GeneID:9901667"
     CDS             437780..438583
                     /locus_tag="HMPREF0733_10410"
                     /EC_number="3.6.3.-"
                     /note="COG: COG1126; Pfam: PF00005; InterPro: IPR003593"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_003983302.1"
                     /db_xref="GI:311112080"
                     /db_xref="GeneID:9901667"
                     /translation="MTDTVTSAASVSITGLHKSYGKNEVLRGIDIQVEPGEVVCLIGP
                     SGSGKSTLLRCVNLLEEPNAGTITVGGVEVTDPDADINALRTRMGMVFQQFNLFGHLS
                     VLDNCTIAQIKVLDRDRATAEKIAREQLAKVGLADKENAYPSKLSGGQQQRVAIARAL
                     SMNPELMLFDEPTSALDPEMVGDVLTIMRDLADEGMTMIVVTHEMSFARDVADKVVFM
                     ADGVVVEEGPAERVIGSPQHERTKTFLARVLDPTHVDETPADQDAAANA"
     misc_feature    437810..438526
                     /locus_tag="HMPREF0733_10410"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    437810..438448
                     /locus_tag="HMPREF0733_10410"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    437906..437929
                     /locus_tag="HMPREF0733_10410"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    order(437915..437920,437924..437932,438056..438058,
                     438287..438292,438386..438388)
                     /locus_tag="HMPREF0733_10410"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    438047..438058
                     /locus_tag="HMPREF0733_10410"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    438215..438244
                     /locus_tag="HMPREF0733_10410"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    438275..438292
                     /locus_tag="HMPREF0733_10410"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    438299..438310
                     /locus_tag="HMPREF0733_10410"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    438374..438394
                     /locus_tag="HMPREF0733_10410"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            complement(438800..439240)
                     /locus_tag="HMPREF0733_10411"
                     /db_xref="GeneID:9901668"
     CDS             complement(438800..439240)
                     /locus_tag="HMPREF0733_10411"
                     /note="Pfam: PF07883"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983303.1"
                     /db_xref="GI:311112081"
                     /db_xref="GeneID:9901668"
                     /translation="MQILGCAYPKRTTIIGERLELMAGTHEGRVLVFPQLTEVLTPFE
                     TKPQAKKILDADGGSITLMELAAGQSWHEHHSVHPVVVQVLKGKVEYSTKGQSIILEP
                     GKLIHTTAKLLHSVTALEDSTLMVIMLTGESHPEPNITIEVEQV"
     misc_feature    complement(438860..>439090)
                     /locus_tag="HMPREF0733_10411"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            complement(439318..440808)
                     /locus_tag="HMPREF0733_10412"
                     /db_xref="GeneID:9901669"
     CDS             complement(439318..440808)
                     /locus_tag="HMPREF0733_10412"
                     /note="Pfam: PF01569"
                     /codon_start=1
                     /transl_table=11
                     /product="PAP2 superfamily protein"
                     /protein_id="YP_003983304.1"
                     /db_xref="GI:311112082"
                     /db_xref="GeneID:9901669"
                     /translation="MSQGPHTSRGHVPRHTSTSNDTDDATRILSPQTLADNDSADADA
                     TVPLSSIQSSYETDDDATEFLDLQDLPSSSPDTDATRAIPNPHEALKPHEGSDTVALD
                     ALDDSPTEAISASQDPRAHYVQHTRAAQPQTRVQPDITPSADYPATVAIPTGAPGMQT
                     APQDTQYSAAAHPHAANPAMSTANYAGYGARPNPAAPGAGVPAEAPIPNDPPSTKVVA
                     QHLGVMVLFGALLYATFQFFIYSRTGQQLDENAFTEYASQFAEYQRPTLAALDNLPTI
                     TGVIAVIGIIIGLIWKHRILPAIVGILAGTGACLSVHVLKNYVITKPNFGIQEALLNS
                     APSGHTAFAASAGAALFIAAPRALRPTIAVLAAMATCATGASTIINGWHRPADVISAI
                     LVVALWTVLGLGVLRYLRRAEFNVPTPRVVGAIAVPLLTIASLFLSFCAVAMYAVTMF
                     STMPGGVFVASTCMILAVSTGTTAILVRLLRPRNQVSSPYTRVWEY"
     misc_feature    complement(439606..439917)
                     /locus_tag="HMPREF0733_10412"
                     /note="PAP2_like proteins, a super-family of histidine
                     phosphatases and vanadium haloperoxidases, includes type 2
                     phosphatidic acid phosphatase or lipid phosphate
                     phosphatase (LPP), Glucose-6-phosphatase,
                     Phosphatidylglycerophosphatase B and bacterial acid...;
                     Region: PAP2_like; cd01610"
                     /db_xref="CDD:238813"
     misc_feature    complement(order(439648..439650,439660..439662,
                     439678..439680,439792..439800,439861..439863))
                     /locus_tag="HMPREF0733_10412"
                     /note="active site"
                     /db_xref="CDD:238813"
     misc_feature    complement(439453..>439746)
                     /locus_tag="HMPREF0733_10412"
                     /note="The Tellurite-resistance/Dicarboxylate Transporter
                     (TDT) family; Region: TDT; cl04176"
                     /db_xref="CDD:262045"
     gene            440950..442002
                     /gene="menC"
                     /locus_tag="HMPREF0733_10413"
                     /db_xref="GeneID:9901670"
     CDS             440950..442002
                     /gene="menC"
                     /locus_tag="HMPREF0733_10413"
                     /EC_number="4.2.1.-"
                     /note="COG: COG4948; Pfam: PF01188; InterPro: IPR001354"
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylbenzoic acid synthetase"
                     /protein_id="YP_003983305.1"
                     /db_xref="GI:311112083"
                     /db_xref="GeneID:9901670"
                     /translation="MSSVPPLGYGFITEGLALPPLEQVLRAVRVVDIPMRVTFRSVNR
                     RQSALIQGPAGWGEFAPFLEYDDHEAAAWLACALESAWLGAPPARRATIPVNATLPAV
                     SAERIPEVLNNYRGTIHELKIKVAEKGQTLDDDIARVAAARRALPNARLKVDANAGWS
                     VPEALEALAALNEYDLLYAEQPVATVDELAQVRALVGERSLSMLIAADESVRKASDPL
                     KVAQAHAADVLIVKAAPLGGVRRALKIVEQAGLPTVVSSALESSVGIATGVSLAAALP
                     DLPYACGLSTVSLMSADVTDDSLLARDGELQMRRVVPTESALRRVEAEGEVRDAWVER
                     IRRCYLVLQEALPTSL"
     misc_feature    440998..441984
                     /gene="menC"
                     /locus_tag="HMPREF0733_10413"
                     /note="O-succinylbenzoate synthase; Provisional; Region:
                     PRK02901"
                     /db_xref="CDD:235084"
     misc_feature    441034..441807
                     /gene="menC"
                     /locus_tag="HMPREF0733_10413"
                     /note="o-Succinylbenzoate synthase (OSBS) catalyzes the
                     conversion of
                     2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate
                     (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate
                     (o-succinylbenzoate or OSB), a reaction in the menaquinone
                     biosynthetic pathway; Region: OSBS; cd03320"
                     /db_xref="CDD:239436"
     misc_feature    order(441313..441315,441409..441411,441415..441417,
                     441487..441489,441571..441573,441643..441645,
                     441715..441720,441796..441798)
                     /gene="menC"
                     /locus_tag="HMPREF0733_10413"
                     /note="active site"
                     /db_xref="CDD:239436"
     gene            442105..444045
                     /gene="menD"
                     /locus_tag="HMPREF0733_10414"
                     /db_xref="GeneID:9901671"
     CDS             442105..444045
                     /gene="menD"
                     /locus_tag="HMPREF0733_10414"
                     /EC_number="2.2.1.9"
                     /note="COG: COG1165"
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-
                     cyclohexene-1-carboxylate synthase"
                     /protein_id="YP_003983306.1"
                     /db_xref="GI:311112084"
                     /db_xref="GeneID:9901671"
                     /translation="MTENPDCADTVQTPPAPAAPDSMLSAVAVLDSLIRAGMRHVVVS
                     PGSRSAPLAYAVAAAEEAGALVAHVRIDERVAAFTALGIAKASRLPVGLVCTSGTALG
                     EYLPAVMEAYHAGVPLAIMSADRPVRLRGTGANQTTIQTDFFSPFVRASADLTSYPEH
                     NPGQQTADFMACLAALTGSDAQDWSRTSDEPVGPAHVNVCFDTPLTPSARTAEILPTW
                     ATSLAEHIAPGAASYPAELEPAQLSPVEKLWLIQHEQVAQASPLKPEGAPDCPKTVVI
                     AGDGAEPFAAEFARALNLPLLAEPSSQARHGATAIPQYTTVLGEHAASELGQSIERTI
                     LCGHPTLSRPISALLARTDVQHAYYAPRRASWYEPGTRAVREIDSPAELEAFALMGSG
                     VRADDSWLDAWVTAGQRAQEASLTSIEAYRYAKSETVHPQASIPSEECHQDGAYTSQP
                     ARIPAQALALQTWNTCAQQHRTLVVGSSSIVRDLDIIAPALGADAPARVLANRGLSGI
                     DGLIATAVGVSLAGYYPTGNARTAADDSAHVAGAPIPVTLICGDLTFQYDISALNLPM
                     TELLPDLDVVVYDDAGGSIFTALEHGTLAQNPQFARAIERFFTVQAAPNTDLERMAAG
                     FGEESGIRVRIHRPNDIFDTQA"
     misc_feature    442186..443661
                     /gene="menD"
                     /locus_tag="HMPREF0733_10414"
                     /note="2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
                     carboxylic-acid synthase; Region: menD; TIGR00173"
                     /db_xref="CDD:232855"
     misc_feature    442186..442707
                     /gene="menD"
                     /locus_tag="HMPREF0733_10414"
                     /note="Pyrimidine (PYR) binding domain of thiamine
                     pyrophosphate (TPP)-dependent enzymes; Region:
                     TPP_enzyme_PYR; cl11410"
                     /db_xref="CDD:264357"
     misc_feature    order(442222..442224,442237..442239,442264..442266,
                     442306..442311,442318..442320,442327..442329,
                     442336..442341,442345..442353,442360..442362,
                     442420..442425,442432..442434)
                     /gene="menD"
                     /locus_tag="HMPREF0733_10414"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    order(442237..442239,442264..442266,442306..442311,
                     442318..442320,442408..442413,442417..442419,
                     442531..442533,442537..442539)
                     /gene="menD"
                     /locus_tag="HMPREF0733_10414"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    order(442237..442239,442321..442323,442411..442413)
                     /gene="menD"
                     /locus_tag="HMPREF0733_10414"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    443518..444027
                     /gene="menD"
                     /locus_tag="HMPREF0733_10414"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     misc_feature    order(443626..443628,443755..443766,443842..443844,
                     443848..443850)
                     /gene="menD"
                     /locus_tag="HMPREF0733_10414"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            complement(444203..445096)
                     /locus_tag="HMPREF0733_10415"
                     /db_xref="GeneID:9901672"
     CDS             complement(444203..445096)
                     /locus_tag="HMPREF0733_10415"
                     /EC_number="3.5.2.6"
                     /note="Pfam: PF00753; InterPro: IPR001279"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain-containing protein"
                     /protein_id="YP_003983307.1"
                     /db_xref="GI:311112085"
                     /db_xref="GeneID:9901672"
                     /translation="MATTIELADGVYRIATDNYCLNTGLILGLEKALVIDTGAGPRQA
                     TEIYDEVRRITRMPLVVVNTHAHPERYFGNDVFAAMGTEEFWSHPRAARAIKKYGDRQ
                     RLYVETLEPEMAHHQGAATDIVVPNHLVAQSGEGITFTPVDLGERSATLIYLGPGHTE
                     GDILVGIDDVLFTGGLLEQGTDPSFEDSFPDRWVETLGALLELDRYRVYVPGCGDPVE
                     RDFVERFQETMKKAIYAIRHSTIDPNDASTTAAMYHLPYAPGPTRFLLDRMAQLDGTE
                     VPTDSSETTGYTGPITIGSLH"
     misc_feature    complement(444470..445033)
                     /locus_tag="HMPREF0733_10415"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            445312..446262
                     /gene="gltX"
                     /locus_tag="HMPREF0733_10416"
                     /db_xref="GeneID:9901673"
     CDS             445312..446262
                     /gene="gltX"
                     /locus_tag="HMPREF0733_10416"
                     /EC_number="6.1.1.17"
                     /note="COG: COG0008; Pfam: PF00749; InterPro: IPR000924"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--tRNA ligase"
                     /protein_id="YP_003983308.1"
                     /db_xref="GI:311112086"
                     /db_xref="GeneID:9901673"
                     /translation="MHTPSSPGAGRYAPSPSGDLHLGNLRTAILAWLLARQEGLRFVM
                     RIEDLDRVRPGAAEQQLADLKSLGLDWDATPGEDPQRRDHVLRQSTRLAAYDAAVQKL
                     QDAGLLYECYCTRREILEATSAPHGIPGSYPGTCRSLSDAERESRREIRPPALRLRAE
                     ISEFTVQDMFAGEYTGAVDDVVVRRNDGTYAYNLAVVVDDHYQGVTQVVRGDDLLSSA
                     PRQAYLAALLGYELPLYAHVPLALNTEGKRLAKRDGAVTLRQLRDAGFAESDILEWVR
                     ASIPIPDAPQFPKSAQDFLEYFDPKAMSPKPWIITNPLDL"
     misc_feature    445318..446241
                     /gene="gltX"
                     /locus_tag="HMPREF0733_10416"
                     /note="glutamyl-Q tRNA(Asp) synthetase; Reviewed; Region:
                     PRK05710"
                     /db_xref="CDD:235573"
     misc_feature    445342..446238
                     /gene="gltX"
                     /locus_tag="HMPREF0733_10416"
                     /note="tRNA synthetases class I (E and Q), catalytic
                     domain; Region: tRNA-synt_1c; pfam00749"
                     /db_xref="CDD:250104"
     misc_feature    order(445372..445383,446059..446070)
                     /gene="gltX"
                     /locus_tag="HMPREF0733_10416"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    order(445372..445374,445381..445383,446062..446064)
                     /gene="gltX"
                     /locus_tag="HMPREF0733_10416"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     misc_feature    445372..445383
                     /gene="gltX"
                     /locus_tag="HMPREF0733_10416"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    446059..446070
                     /gene="gltX"
                     /locus_tag="HMPREF0733_10416"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173912"
     gene            446564..448060
                     /gene="putP"
                     /locus_tag="HMPREF0733_10417"
                     /db_xref="GeneID:9901674"
     CDS             446564..448060
                     /gene="putP"
                     /locus_tag="HMPREF0733_10417"
                     /note="COG: COG0591; Pfam: PF00474; InterPro: IPR011851"
                     /codon_start=1
                     /transl_table=11
                     /product="SSS family proline:sodium (Na+) symporter"
                     /protein_id="YP_003983309.1"
                     /db_xref="GI:311112087"
                     /db_xref="GeneID:9901674"
                     /translation="MTDGTFQVIALAIYFIAMIVIGLWANSKNNDLDDYVLGGRQLSP
                     TVAALSAGAADMSGWLLMGLPGAVYLAGLSKSWIAIGLTIGAWVNWKFIAPRLRSYTE
                     VAGDAVTVPVFLSNRLHDKYNILRIFAGIIILVFFTFYVSSGMVAGGKFFESSFHQDY
                     LTGMLLVAGITMFYTFFGGFMGASYTDMVQGLLMLAALIAVPIVAITNMGGLDHVTDA
                     VANVRPDALGLFAGTTFIGIASALAWGLGYFGQPHIIVRFMALRTPKDAKAGRRIGMS
                     WMLLTVVGSISTAFVGVAYFATHPEVSLTDKESAETVFLDLAQILFHPFIAGMILAAV
                     LAAIMSTLSSQLVVCSSALVEDLYGVFVKKKLSSNQSLWLGRAGVAIVAVIATLMALD
                     KNNSILSLVEFAWAGFGSAFGPIVILSLYWRKLTLPGAVSGMVVGAVVTFFWRQIFNL
                     TETIDVYEMIPGFFLAFLVTVVVSLATYQKNEEIEQEFDKAAELAKAG"
     misc_feature    446585..447991
                     /gene="putP"
                     /locus_tag="HMPREF0733_10417"
                     /note="Na(+)/proline cotransporter PutP and related
                     proteins; solute binding domain; Region: SLC5sbd_PutP;
                     cd11475"
                     /db_xref="CDD:212045"
     misc_feature    order(446720..446722,446729..446731,447572..447574,
                     447581..447586)
                     /gene="putP"
                     /locus_tag="HMPREF0733_10417"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212045"
     gene            complement(448171..449490)
                     /locus_tag="HMPREF0733_10418"
                     /db_xref="GeneID:9901675"
     CDS             complement(448171..449490)
                     /locus_tag="HMPREF0733_10418"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983310.1"
                     /db_xref="GI:311112088"
                     /db_xref="GeneID:9901675"
                     /translation="MRHERYAAATALLGESGFATRVGGFNALVRLADEWLADERTPEE
                     QRLAEAQVIIDTFCACIYAPFLPASRHKDYMRLNREPKKRWDSQKKARFRAEQAEFRA
                     EARFRQTVLDTIHLRVMPRYEGPGPWSRLSFDFSGSVFFYPVSFGRSQWEGRLNLRGC
                     TYYAEADFSGSTYTWYLDCSNSAYYTEADFSASTYNGGVNASFCNYRGNVDFSESVYR
                     ANASLSYNVYWGEAALNDSIYEGHADLACCTYVGHASLGNCDYRRGADLFLSTYATFA
                     DLDRCTYGGRANLSKSVYYGRAWFWHSTYLQEATFGDSIYNDSVDFSDSHFAGPVNLE
                     DSAYLDTTNFQNTIFEEDSPSFARSVYVPENNEHTGYNYGVVRVLTLDELQHLDQLRE
                     PRYEIEQELFNVDDATDAKTYRILRRALLEASHPIQKWCQELMAGTL"
     misc_feature    complement(448414..448560)
                     /locus_tag="HMPREF0733_10418"
                     /note="Pentapeptide repeats (9 copies); Region:
                     Pentapeptide_3; pfam13576"
                     /db_xref="CDD:257892"
     gene            449640..449816
                     /locus_tag="HMPREF0733_10419"
                     /db_xref="GeneID:9901676"
     CDS             449640..449816
                     /locus_tag="HMPREF0733_10419"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983311.1"
                     /db_xref="GI:311112089"
                     /db_xref="GeneID:9901676"
                     /translation="MCKPRTHRIDLNSDVIYIERKNVLKPSFFEKNHKFLEFSAEYMI
                     FFWYADSQLSSQKP"
     gene            449782..451146
                     /locus_tag="HMPREF0733_10420"
                     /db_xref="GeneID:9901677"
     CDS             449782..451146
                     /locus_tag="HMPREF0733_10420"
                     /note="COG: COG1106"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983312.1"
                     /db_xref="GI:311112090"
                     /db_xref="GeneID:9901677"
                     /translation="MQILNFRVKNHKSLRDETALELLDSSLTTLKPSANKTWGQYVHT
                     VAGIFGANASGKSNVLDALRYFTAAIENSSTIWQDSSSFPHVPFKLSDTSRTADSAYE
                     LDFLLDDIRYRYGFSVNSEGVNIEYLMHLPKSRWRTIFTREYVEGIDSVDFIARDVKK
                     LEVSHRELVLSRAATLGRKDILGSVAHAITHKIDFVLLSERDQQMRIEAIINALVELS
                     ITRDDIAQLLQVADIGIQKVDIWQSEDNLDVDNLPQDMPRTVQQIILQILATEQKSAA
                     DSNAKLIQRRLEFFHNSADSNSPPLYLSDESDGTLAWLAISFAVLEALRTGKVVCGDE
                     LDSSLHPHLVRLIISLFTDPSVNTQGAQLIFTTHDATILHHYEELGLSPENFWFTEKN
                     RDGATGLFSLADFPKITGANIEKRYLSGRYGAVPFVSHSIFWKILENKKQKLSQVEAV
                     SHGS"
     misc_feature    449788..451062
                     /locus_tag="HMPREF0733_10420"
                     /note="Predicted ATPases [General function prediction
                     only]; Region: COG1106"
                     /db_xref="CDD:224031"
     misc_feature    449797..>449973
                     /locus_tag="HMPREF0733_10420"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    449914..>450165
                     /locus_tag="HMPREF0733_10420"
                     /note="AAA domain; Region: AAA_21; pfam13304"
                     /db_xref="CDD:257641"
     misc_feature    449929..449952
                     /locus_tag="HMPREF0733_10420"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(449938..449943,449947..449955)
                     /locus_tag="HMPREF0733_10420"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    <450694..450900
                     /locus_tag="HMPREF0733_10420"
                     /note="AAA domain; Region: AAA_21; pfam13304"
                     /db_xref="CDD:257641"
     gene            451136..451783
                     /locus_tag="HMPREF0733_10421"
                     /db_xref="GeneID:9901678"
     CDS             451136..451783
                     /locus_tag="HMPREF0733_10421"
                     /codon_start=1
                     /transl_table=11
                     /product="Csm2 family CRISPR-associated protein"
                     /protein_id="YP_003983313.1"
                     /db_xref="GI:311112091"
                     /db_xref="GeneID:9901678"
                     /translation="MGRRSRKNSKDLFPNNPRSKDRVPKRNFLICVEGEKTEPKYFKM
                     LTEHIKNLGINTDIKVVKPKGSDPASILKGCLSYLREAENDGNAYDDCFCVVDVDAHA
                     TLDQALRDARSHHISMVVTNLKFEVWLLWHVGDQPGGYANNHQLDTLVKKLSNSGKAP
                     LLTGSNYKGLHPNFPIENYRDAVKIARQKDPQMAFNRKGQNPSSAMPLLIEKLMG"
     misc_feature    451217..451774
                     /locus_tag="HMPREF0733_10421"
                     /note="RloB-like protein; Region: RloB; pfam13707"
                     /db_xref="CDD:258005"
     gene            451875..452828
                     /gene="menB"
                     /locus_tag="HMPREF0733_10422"
                     /db_xref="GeneID:9901679"
     CDS             451875..452828
                     /gene="menB"
                     /locus_tag="HMPREF0733_10422"
                     /EC_number="4.1.3.36"
                     /note="COG: COG0447; Pfam: PF00378; InterPro: IPR010198"
                     /codon_start=1
                     /transl_table=11
                     /product="naphthoate synthase"
                     /protein_id="YP_003983314.1"
                     /db_xref="GI:311112092"
                     /db_xref="GeneID:9901679"
                     /translation="MTVTFPPQVSDIFNPQHWRIVEGFEDFTDITYHRQVQRDETGEI
                     LRDLPTVRIAFNRPEVRNAFRPHTVDELYRALDHARMTSDVGTVLLTGNGPSPKDGGW
                     AFCSGGDQRIRGRDGYHYASGDTAESIDPARAGRLHILEVQRLIRTMPKVVIALVSGW
                     AAGGGHSLHVVADLTIASEEYGKFKQTDATVGSFDAGYGSALLARQVGQKFAREIFFL
                     AKEYDARRMYEMGAVNDVVPHAELENKGLEYAAHIARQSPQAIRMLKYAFNLPDDGML
                     GQQVFAGEATRMAYMTDEAVEGRDAFLQKRDPDWSNYPYYF"
     misc_feature    451905..452825
                     /gene="menB"
                     /locus_tag="HMPREF0733_10422"
                     /note="Dihydroxynaphthoic acid synthase [Coenzyme
                     metabolism]; Region: MenB; COG0447"
                     /db_xref="CDD:223524"
     misc_feature    452010..452633
                     /gene="menB"
                     /locus_tag="HMPREF0733_10422"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(452055..452057,452061..452063,452157..452159,
                     452190..452204,452352..452354,452358..452366,
                     452433..452438,452445..452447)
                     /gene="menB"
                     /locus_tag="HMPREF0733_10422"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(452196..452198,452364..452366)
                     /gene="menB"
                     /locus_tag="HMPREF0733_10422"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(452304..452306,452328..452330,452391..452402,
                     452439..452450,452466..452468,452472..452480,
                     452484..452489,452502..452507,452511..452516,
                     452520..452525,452532..452534,452565..452567,
                     452574..452576,452619..452621,452628..452633)
                     /gene="menB"
                     /locus_tag="HMPREF0733_10422"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            452840..454342
                     /gene="menE"
                     /locus_tag="HMPREF0733_10423"
                     /db_xref="GeneID:9901680"
     CDS             452840..454342
                     /gene="menE"
                     /locus_tag="HMPREF0733_10423"
                     /EC_number="6.2.1.26"
                     /note="COG: COG0318; Pfam: PF00501; InterPro: IPR000873"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="YP_003983315.1"
                     /db_xref="GI:311112093"
                     /db_xref="GeneID:9901680"
                     /translation="MQNNRSVVPEGPRNPRESRADSGEAGATIGAFSGSLAPLPAPRQ
                     DALHPHAVMLSADAPANPQEILRAFERSLTGGLPNGARDNQDPLGQTENPESLALVVG
                     TSGSTGAPKQTALSVQALRVSARATERFFADYPSSGSAKPQRAVSEAPAQWLLALPAH
                     YVAGAQVLARSVLAGTTPVVAASVTDGVSFTPEVFLNAAERLSCARRFISLVPTQVHK
                     LLEAAEASPALGSEIYDALGQFTGILLGGAPASASLLAAARELGLNVVTTYGSAETAG
                     GCVYSGTALPGVRLRVVPEDGSLLDSSVAGDAAAGGPPNIGRIWLGGEHLASGYMGDS
                     ARTASHFFVDADGCRWYRTDDYGSLAPAAPKNAPEDEGAPMLNIVGRSDDVIITGGVK
                     VSARAVAAVLESHPAVREAAVMGIPDARWGSAVAAAITLRGASEAQSVLDTSRATCDM
                     LREFCTDKLGAAGTPKYLRILADFPTASTGKPDRRAIYSMLYREYTNTRG"
     misc_feature    453122..454300
                     /gene="menE"
                     /locus_tag="HMPREF0733_10423"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    order(453137..453139,453146..453163,453167..453172)
                     /gene="menE"
                     /locus_tag="HMPREF0733_10423"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    order(453146..453148,453575..453580,453638..453655,
                     453902..453904,453971..453973,453980..453982,
                     454013..454015,454280..454282)
                     /gene="menE"
                     /locus_tag="HMPREF0733_10423"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    order(453146..453148,453308..453313,453473..453475,
                     453479..453484,453491..453493,453575..453580,
                     453638..453655,453902..453904,453971..453973,
                     453980..453982,454004..454015,454223..454225)
                     /gene="menE"
                     /locus_tag="HMPREF0733_10423"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    order(453308..453310,453479..453484,453491..453493,
                     453575..453577,454004..454012,454205..454207,
                     454223..454225)
                     /gene="menE"
                     /locus_tag="HMPREF0733_10423"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            454393..455307
                     /gene="menA"
                     /locus_tag="HMPREF0733_10424"
                     /db_xref="GeneID:9901681"
     CDS             454393..455307
                     /gene="menA"
                     /locus_tag="HMPREF0733_10424"
                     /EC_number="2.5.-.-"
                     /note="COG: COG1575; Pfam: PF01040; InterPro: IPR004657"
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /protein_id="YP_003983316.1"
                     /db_xref="GI:311112094"
                     /db_xref="GeneID:9901681"
                     /translation="MATPAEWIEGARLRTLPLALAPIIAGSAAAYEIDAFKPWYAFLA
                     FLVAFFLQVGVNYANDYSDGIKGTDEGRVGPMRLVGSGAASAKSVKYAAFLCFALAMC
                     SGLILVALANQWWFLAIGASAVFAAWGYTGGKRPYGYMGLGDIFVFVYFGLVATLGTL
                     YTQSHELTVTGWVSAIAIGLISCALLMANNVRDIPTDRKSGKLTLAVRLGDWRARIAY
                     CAEMLIALLLGAFVVPHNPWFLVTFILLGPTVHSCVTVLFKQGPALIPVLKQAGIVAL
                     IYSILVAISVWLHGLNLLSNTVEVFTGY"
     misc_feature    454414..455247
                     /gene="menA"
                     /locus_tag="HMPREF0733_10424"
                     /note="1,4-Dihydroxy-2-naphthoate octaprenyltransferase;
                     Region: PT_UbiA_UBIAD1; cd13962"
                     /db_xref="CDD:260125"
     misc_feature    order(454567..454572,454579..454581,454957..454962,
                     454969..454971,454981..454983)
                     /gene="menA"
                     /locus_tag="HMPREF0733_10424"
                     /note="putative active site [active]"
                     /db_xref="CDD:260125"
     gene            455678..456922
                     /locus_tag="HMPREF0733_10425"
                     /db_xref="GeneID:9901682"
     CDS             455678..456922
                     /locus_tag="HMPREF0733_10425"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983317.1"
                     /db_xref="GI:311112095"
                     /db_xref="GeneID:9901682"
                     /translation="MRHSLQGAVQRAPFFLAASLLVSTSFIPANAVSTPNDSASYTHT
                     VSERSDDSASAVAPLSDDVLNADPQASVVAGQEGENPGAIPEGDPRVITYWTTERMEN
                     AIPADNVEDPQQEINNAVSQMETEEQNPEVVSQEETNESGEEYTPQTLTQEADEPETT
                     AESVDPVLPEQKDARNGVQLQGASKVTNFSHTNGKIFYTDASDGKNYVCSGAAINTPT
                     KRTVVTAGHCVHGGKNKTWHRNIVFVPGYNRGVRPHGTFSAQYLRVANDWVQYGQPTG
                     GTGDSYKHDVAFIKTNTNEKGQLLVNMVGGHGLNVDRSPIFESTVFAYPGNKESGRVM
                     HACWGNTHTIRITPYYFPTLSGCEFAGGSSGGPWLADYNNATGLGKVQSVTSFATNNN
                     TSVSGAIFDRPVWDIYQKAAQD"
     misc_feature    456212..456811
                     /locus_tag="HMPREF0733_10425"
                     /note="V8-like Glu-specific endopeptidase [Amino acid
                     transport and metabolism]; Region: COG3591"
                     /db_xref="CDD:226119"
     gene            complement(457118..457405)
                     /locus_tag="HMPREF0733_10426"
                     /db_xref="GeneID:9901683"
     CDS             complement(457118..457405)
                     /locus_tag="HMPREF0733_10426"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983318.1"
                     /db_xref="GI:311112096"
                     /db_xref="GeneID:9901683"
                     /translation="MNLFKYTLLRLGLVVVLFYLFMLIDAGIFIAGPAAILCAFALAY
                     IFFPKLHAAASADMRKIFKRAPTIKNKDEAENRTLEDQLVDEHKKVSGEDF"
     misc_feature    complement(457214..>457336)
                     /locus_tag="HMPREF0733_10426"
                     /note="Protein of unknown function (DUF4229); Region:
                     DUF4229; pfam14012"
                     /db_xref="CDD:258247"
     gene            457532..457966
                     /locus_tag="HMPREF0733_10427"
                     /db_xref="GeneID:9901684"
     CDS             457532..457966
                     /locus_tag="HMPREF0733_10427"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983319.1"
                     /db_xref="GI:311112097"
                     /db_xref="GeneID:9901684"
                     /translation="MIRAMMIIGAFALVVGLTLYTLLDALRTHQDQMRTFPKWLWIIA
                     VIFFPVVGPLLWLLLGRPRAVRAPKTQQGGGFTSSRRGTPPPATSSPDDDEEYLRWLK
                     TKADRQRRSREKDTGTGPADGGTGGRSEGESNDSDGKDDSKH"
     misc_feature    457571..457717
                     /locus_tag="HMPREF0733_10427"
                     /note="Phospholipase_D-nuclease N-terminal; Region:
                     PLDc_N; pfam13396"
                     /db_xref="CDD:257721"
     gene            complement(458297..459409)
                     /gene="resC"
                     /locus_tag="HMPREF0733_10428"
                     /db_xref="GeneID:9901685"
     CDS             complement(458297..459409)
                     /gene="resC"
                     /locus_tag="HMPREF0733_10428"
                     /EC_number="4.4.1.-"
                     /note="COG: COG0755; Pfam: PF01578; InterPro: IPR002541"
                     /codon_start=1
                     /transl_table=11
                     /product="apocytochrome heme-lyase"
                     /protein_id="YP_003983320.1"
                     /db_xref="GI:311112098"
                     /db_xref="GeneID:9901685"
                     /translation="MLNDSLARSSELFMYIAALIYTVVFIAFTSDVVANSRVTRRLEG
                     RSEGTAQKSTVKAKIKVGAGAVSGASATTNTAADTVRTGGTEQGTGERGMGYKGAAAR
                     ALEGEVADSAMLYTGVRRPAARIAVVVMVLAALVHTAAVIMRGIAAQRVPWGNMYEFC
                     TTGALMVSAVFLITLIFRDVRFVGTLVSGLVLIMLCAATIGFPTPVGHLKPALQSYWL
                     VIHVSIAVLASGVFTITFAMAVLQLVQTRREQRILNGKSGGWAFMRLVPSAQALENFA
                     FRMNALAFVMWTFTLAAGAIWANHAWGRYWGWDTKEVWTFVIWVVYAAYLHARATRGW
                     AGPRSAWLSIIGYACIIFNFTVVNIFFSGLHSYSGL"
     misc_feature    complement(458309..459001)
                     /gene="resC"
                     /locus_tag="HMPREF0733_10428"
                     /note="Cytochrome C assembly protein; Region:
                     Cytochrom_C_asm; cl00504"
                     /db_xref="CDD:260465"
     gene            complement(459413..461167)
                     /gene="resB"
                     /locus_tag="HMPREF0733_10429"
                     /db_xref="GeneID:9901686"
     CDS             complement(459413..461167)
                     /gene="resB"
                     /locus_tag="HMPREF0733_10429"
                     /note="COG: COG1333; Pfam: PF05140; InterPro: IPR007816"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis protein ResB"
                     /protein_id="YP_003983321.1"
                     /db_xref="GI:311112099"
                     /db_xref="GeneID:9901686"
                     /translation="MVSEHSDDENTSTEAKDTNTANRKAGKTADAGRAVNASEKTKKT
                     GKSARKDAPALGFVGMLRWCWTQLTKMNTALMLLLLLAVAAVPGSIFPQRVQDPTKVT
                     DYIKNHPGWGEFADKIQLFDVFSSAWFSAIYLLLFISLIGCVTPRAIKHAKDWRKPPA
                     RTPRNLSRMPVHRQLEIPVADAGLNLSAKGAIEDAARILKKSHYRVEIRDEENEHYSV
                     GAERGYLREIGNILFHVAMIGILVGVAFGSLYGYRGQKILVQDETFVNSLIGYDSFTP
                     GTNYNPDWLTPYAVTLNNFQVRYDRQQDSHTYGQDLDYKAELTVHDPQGSTEQKTLKV
                     NEPVDIGGTSIFLSGNGYAPVVRVTDGEGKVAYEGTVVGITTDGKYTSSVVLKVPDAK
                     PSQLGFVGMFLPTGDYARGTTVPHSVDSAPANPMLIFQSYSGDLGLNSGQPQNVYVLD
                     TSKLQELNSMAQGNGIVLSAQNPEAVLPDNKGKIEFLGYKRYVGLDVRHDPGQNIVLY
                     SFVVAFVGLIVSLFVARRRVWVRAHTADGVLVVEYGLLARGEDPRLANEAERLTDAFA
                     AAWGLEFDDDNHDENEGK"
     misc_feature    complement(459488..460909)
                     /gene="resB"
                     /locus_tag="HMPREF0733_10429"
                     /note="ResB-like family; Region: ResB; pfam05140"
                     /db_xref="CDD:253038"
     gene            complement(461183..462199)
                     /gene="ccdA"
                     /locus_tag="HMPREF0733_10430"
                     /db_xref="GeneID:9901687"
     CDS             complement(461183..462199)
                     /gene="ccdA"
                     /locus_tag="HMPREF0733_10430"
                     /EC_number="4.4.1.17"
                     /note="COG: COG0785; Pfam: PF02683; InterPro: IPR003834"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis membrane protein"
                     /protein_id="YP_003983322.1"
                     /db_xref="GI:311112100"
                     /db_xref="GeneID:9901687"
                     /translation="MPSVPHTPVQPLIAIAGVGVLPVASISSTVLDGSLWLSVPLAAL
                     AGFISFASPCVLPLVPGYLGYVAGLTGANIPATGASQADGHAEEPVDAKTFALVNSAA
                     ARRLASTVPQTQDVVDNHSASAPITTESKAQTPNEYAVTRRKTTWRLLAGVALFIAGF
                     SAIFVLLSVVLAQLGTAPWLKGQSWVTMILGALVVLMGVVFLGGFSIFQTDKRLHRRP
                     VAGLWGAPILGITFGLGWAPCIGPTFAAVQTLVYTGGSGTGKAVVLTLAYCLGLGVPF
                     LLVAWGMGRGVSTLAWARKHRLGIQRVGGAVLILIGVLLMTGLWTELMSWIQAALPAY
                     ELPI"
     misc_feature    complement(461255..462091)
                     /gene="ccdA"
                     /locus_tag="HMPREF0733_10430"
                     /note="Cytochrome c biogenesis protein [Posttranslational
                     modification, protein turnover, chaperones]; Region: CcdA;
                     COG0785"
                     /db_xref="CDD:223856"
     gene            complement(462192..462833)
                     /gene="resA"
                     /locus_tag="HMPREF0733_10431"
                     /db_xref="GeneID:9901688"
     CDS             complement(462192..462833)
                     /gene="resA"
                     /locus_tag="HMPREF0733_10431"
                     /note="COG: COG0526; Pfam: PF08534; InterPro: IPR012335"
                     /codon_start=1
                     /transl_table=11
                     /product="Tat domain-containing protein"
                     /protein_id="YP_003983323.1"
                     /db_xref="GI:311112101"
                     /db_xref="GeneID:9901688"
                     /translation="MNPMPKPTTPNTPLTRRALLHTGAGICATAAGAVLLSACSSSDD
                     SLAKQANSGDNKGYIAGDGSVTEYQEAERGDPVAFTGELFDGKTVTAESLRGKPVLLN
                     FWYAGCAPCRAEAPDLQKLSEEFKDKIAFYGVNVRDEKNTAEAFERSFNVTYPSFKDV
                     TGKVLLSLSKYVPAQAVPTTVILDEKGRVASRVLGQANPSILKTLVETVTKGA"
     misc_feature    complement(462249..462602)
                     /gene="resA"
                     /locus_tag="HMPREF0733_10431"
                     /note="TlpA-like family; composed of  TlpA, ResA, DsbE and
                     similar proteins. TlpA, ResA and DsbE are bacterial
                     protein disulfide reductases with important roles in
                     cytochrome maturation. They are membrane-anchored proteins
                     with a soluble TRX domain containing a...; Region:
                     TlpA_like_family; cd02966"
                     /db_xref="CDD:239264"
     misc_feature    complement(order(462501..462503,462510..462512))
                     /gene="resA"
                     /locus_tag="HMPREF0733_10431"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239264"
     gene            complement(462904..463593)
                     /locus_tag="HMPREF0733_10432"
                     /db_xref="GeneID:9901689"
     CDS             complement(462904..463593)
                     /locus_tag="HMPREF0733_10432"
                     /EC_number="5.4.2.1"
                     /note="COG: COG0406; Pfam: PF00300; InterPro: IPR013078"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="YP_003983324.1"
                     /db_xref="GI:311112102"
                     /db_xref="GeneID:9901689"
                     /translation="MTTQLTVTVHLMRHGEVHNPERIVYGRLPHYALSEKGQQMVRMS
                     AQEFAQRAQDGAKIVHLVCSPLLRTRESAAPITELLGLEAHADQRVIEADNYFEGEHV
                     TRQGLLRNRKHWGKLYNPLRPSWGEPYLDQVKRMASAIQDAARTAYDKGGEGAQAIIV
                     SHQLPIWVTRLGLEGRLLQHDPRTRQCNLASITSLDFKSTDFDHEMPQVSGYSEPASP
                     LYGGVIQLPGS"
     misc_feature    complement(<463315..463572)
                     /locus_tag="HMPREF0733_10432"
                     /note="Histidine phosphatase domain found in
                     phosphoglycerate mutases and related proteins, mostly
                     phosphatases; contains a His residue which is
                     phosphorylated during the reaction; Region: HP_PGM_like;
                     cd07067"
                     /db_xref="CDD:132718"
     misc_feature    complement(order(463390..463392,463552..463557))
                     /locus_tag="HMPREF0733_10432"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     gene            complement(463650..463904)
                     /locus_tag="HMPREF0733_10433"
                     /db_xref="GeneID:9901690"
     CDS             complement(463650..463904)
                     /locus_tag="HMPREF0733_10433"
                     /note="Pfam: PF05768; InterPro: IPR012335"
                     /codon_start=1
                     /transl_table=11
                     /product="redoxin"
                     /protein_id="YP_003983325.1"
                     /db_xref="GI:311112103"
                     /db_xref="GeneID:9901690"
                     /translation="MPEPVIELLTRPGCHLCEDARLTVSEICAEYGLDYTELDITDNP
                     DLLKRHKTEIPVLCIDGEAKDFWRINPKRMRKILDKKLAR"
     misc_feature    complement(463695..463892)
                     /locus_tag="HMPREF0733_10433"
                     /note="Glutaredoxin-like domain (DUF836); Region: DUF836;
                     pfam05768"
                     /db_xref="CDD:253377"
     gene            complement(464564..467482)
                     /locus_tag="HMPREF0733_10434"
                     /db_xref="GeneID:9901691"
     CDS             complement(464564..467482)
                     /locus_tag="HMPREF0733_10434"
                     /note="Pfam: PF00392,PF07729"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_003983326.1"
                     /db_xref="GI:311112104"
                     /db_xref="GeneID:9901691"
                     /translation="MAIHRKILRWLETELFEGNIQLGQSLPDDQRIAHAIGVGRSRTR
                     DALKTLEDMELMRLYSGRGKEIIPYLYEEPAAAAAGPIRLHMSTSRYPTRDMLQTRIL
                     LESWAVSNIDPDKVSFDEVDEALETLQDDTLSIGEFLDQLLTFHHRLVRLAGNELVVG
                     LLVAIRQSSFDSLLSLMGRLPLWSSTMTRIRVENRAIVDAVKDGDARTARELIAHQLQ
                     ELYSEAGIELDQAANTPNGMPGDPSEDDEEFQEEEYSEESTDSSEEPEADADVEEHEE
                     AEAEQDTDENIPESEYKAEQEKSPAAQLPKIIREGSTVSRRRQGRMRVPTPVAVGFEE
                     DEAEETASAESTGDTPTADIPEQQETVESTHESPIDPLEETAAHEPQLESVQPEFEDD
                     VLPVDESSESASDDAQDKEPAEEITAEKAPDKSADGSEKSKSSEEAQGTSQDDSASHE
                     DSIESTEDKDAEETPDEQEHVREVYVEKAPVGKISAEELVATGLIPWRTMGQQAENGT
                     STQTEAEGEDDVIRAPLRRNVPPVRPAQFSPRKSEKPEKAEKPASERISLIRRVRHYF
                     GLDLPHTQAVKLVEAQEAAEQKAADNAKFATEPPKVEPKSASASSPEDAPAAASAETS
                     KSSAAEQEREASTEPKKPAAQPSPAKAAEAPKPAEAPKSSKPSSDATSKSAEPAPEAA
                     PSDKTDSKPAKPAEKSASAPAQSVDSAKREKPAVETPQTDSSDAVKADPSDAPVQRAA
                     ANVELEETPEEIRSELQSAITLDEPSPDSVPTPTAEPVAVKRPNRKDSDSQAPAKNVS
                     VAAAAIPQPVPAVARPETANLSGVDSTPVASAVNETENKPADSQPKQKAQADTEKTPV
                     KPAPSPSEIAQASAKPASKKPETKKPAPVAGSASKSASANKKALTAVDANGAPNPFEG
                     FDVLGAVERAHAAEAAAAQKKQAKTQGSASEAKKPAQNGTSKGASALSKGKKNRKRRH
                     "
     misc_feature    complement(466826..467482)
                     /locus_tag="HMPREF0733_10434"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(467294..467464)
                     /locus_tag="HMPREF0733_10434"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    complement(466826..467200)
                     /locus_tag="HMPREF0733_10434"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            complement(467592..470072)
                     /locus_tag="HMPREF0733_10435"
                     /db_xref="GeneID:9901692"
     CDS             complement(467592..470072)
                     /locus_tag="HMPREF0733_10435"
                     /note="Pfam: PF01022; InterPro: IPR011991"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983327.1"
                     /db_xref="GI:311112105"
                     /db_xref="GeneID:9901692"
                     /translation="MQSDVFSVIADPTRRNIVHLLAEQTRTVGAVVEHLNMSQPTISK
                     HLKVLREARAVTVLVEGQRRLYSLNPEVFDEITAWVADIQAIAHSTKEQRESQIKQAS
                     VIEVVDVVESSDDDTAKTEKTEKPSAEAKTEKEVKTEKTAHAGESDTDEHQQRDAEQR
                     PKAIGKTTDETAGEAATAHAQDVQDQDKTSDSDAPAQPVESSSVVEQPEPTPQERVSK
                     ALSQRKRFEAFPGSTGSANAGVKPGASLSGERDAEKASGQKDRDGQGASHEAGAHDSH
                     AEGESSAKKKTTTAAIAKPAIFDDEARSAESSVTSGLGPKTSTKSAARIVSKPAQQAA
                     PAASEEGTETAGTVEENEFIPMRPFTPSGSSYQEKPQQSYGYDDGIDDGQQGFSPEAR
                     GFVPRSKSQDRTTAQAKPEAVKSEKTDKGVSAQKDAEPSVKGAEQTKAPARSHDTKQP
                     HVEAQTQEHTHVSGAQQPAQQSESAKPAKPSSAESKQASHVAKAEAQKPVKDAHKSAQ
                     TKPQKPESPSPQAQTAAKTESAQAQSIREEVSAPKPGSERAAQAHTGKPGAKTEAHTG
                     SQETPAQAAKPAESPIQAAASEKKPEDKPAETTATNAQTATQPGTSSTVSYGIDTAEK
                     STENGERAVQGTAQKKQTEKGQGNAGSPDTKEPAKPATVRSAKGTASTGAAAKTQEPE
                     KKPAAQVEESLSTAQEPQKSGAETPVEAAPAAAQNMTQAQSEEAKAVEAKLAENAPVK
                     SDSVTFTAVLPVVTPEMSSVQGARPQEDEEAADASDKMKSAASEKSGKNEELPYQTQT
                     EYTSAFGTADTPKEPPRGLLSRVFGRRR"
     misc_feature    complement(469845..470057)
                     /locus_tag="HMPREF0733_10435"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(469845..469853,469857..469862,
                     469914..469916,470004..470006,470013..470018,
                     470025..470030,470037..470039,470046..470048,
                     470052..470057))
                     /locus_tag="HMPREF0733_10435"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(469875..469883,469896..469904,
                     469920..469925,469929..469934,469941..469946,
                     469950..469961,469986..469994,470031..470039,
                     470049..470054))
                     /locus_tag="HMPREF0733_10435"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(469860..469862,469983..469985,
                     469992..469994))
                     /locus_tag="HMPREF0733_10435"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            470390..471907
                     /gene="trkB"
                     /locus_tag="HMPREF0733_10436"
                     /db_xref="GeneID:9901693"
     CDS             470390..471907
                     /gene="trkB"
                     /locus_tag="HMPREF0733_10436"
                     /EC_number="3.6.3.14"
                     /note="COG: COG0168; Pfam: PF02386; InterPro: IPR003445"
                     /codon_start=1
                     /transl_table=11
                     /product="Trk family potassium uptake protein TrkB"
                     /protein_id="YP_003983328.1"
                     /db_xref="GI:311112106"
                     /db_xref="GeneID:9901693"
                     /translation="MGRYLRRLRAHQRKRVRDFSEGRISTAIGKVPPTSPMMYEQEEV
                     TRRFNPFDIRSYEKLRNLIDTTVFSSPSRTAIASFFLVIVFFTVTLSLPISSVTGEPA
                     PFHHAFFTATSAVTVTGLTTVSTAAQWSVFGQVMILLACQIGGLGALTMTSLLALAIG
                     RKMGLRSKLIAQEELSIGRLGEVGSVLRTVAYTSIGIESTIALVLTPRFLLLGENLPT
                     SLWHGIFYAISSFNNAGFTPHSDGLVPYGHDFFVLAPVSIAVFLGALGFPVLMTIQQK
                     PFRPRDWTLTTKLTVTTTSILFVLGALLWGIAEWANPRTIGNYGAGEKILSSIFASIM
                     TRSGGFNLVDMNDIRPVTGLITDVLMFIGGGSASTAGGVKVTTIAVIMLAIIAEARGD
                     QFVMTFGRTIPVSALRIAISVTMMSTGIVLVGTGVLLAITDQPLVRVLFEVISAYATC
                     GLSNGLSTELPPSGIYVLSLLMFIGRIGTITAATGLALRSRRRLYKYPEERPVIG"
     misc_feature    470525..>470824
                     /gene="trkB"
                     /locus_tag="HMPREF0733_10436"
                     /note="Cation transport protein; Region: TrkH; cl17365"
                     /db_xref="CDD:266653"
     misc_feature    470657..471817
                     /gene="trkB"
                     /locus_tag="HMPREF0733_10436"
                     /note="potassium uptake protein, TrkH family; Region:
                     2a38; TIGR00933"
                     /db_xref="CDD:233196"
     misc_feature    470909..471850
                     /gene="trkB"
                     /locus_tag="HMPREF0733_10436"
                     /note="Cation transport protein; Region: TrkH; cl17365"
                     /db_xref="CDD:266653"
     gene            471900..472562
                     /gene="trkA"
                     /locus_tag="HMPREF0733_10437"
                     /db_xref="GeneID:9901694"
     CDS             471900..472562
                     /gene="trkA"
                     /locus_tag="HMPREF0733_10437"
                     /note="COG: COG0569; Pfam: PF02254,PF02080; InterPro:
                     IPR016040"
                     /codon_start=1
                     /transl_table=11
                     /product="Trk family potassium (K+) transporter, NAD+
                     binding protein"
                     /protein_id="YP_003983329.1"
                     /db_xref="GI:311112107"
                     /db_xref="GeneID:9901694"
                     /translation="MASNHNAPVLIIGLGRFGSATAAQLHAQNKEVLAIEKDPEIAQK
                     WTGVLTHVVSADARDIDALRQLGASDFGSAVVGVGTSIEASVLITANLVDLGVERIWA
                     KAITPSHGKILERIGAHHVVYPEADAGRRAAHLVSGRMLDYIEFDDDFAIAKMRPPKE
                     THGFTLAESDIRAKYGVSVVGIKSPGEEFTYADAATRIHSRDILIVSGQVDLIERFAA
                     RP"
     misc_feature    471924..472547
                     /gene="trkA"
                     /locus_tag="HMPREF0733_10437"
                     /note="K+ transport systems, NAD-binding component
                     [Inorganic ion transport and metabolism]; Region: TrkA;
                     COG0569"
                     /db_xref="CDD:223643"
     misc_feature    471924..472271
                     /gene="trkA"
                     /locus_tag="HMPREF0733_10437"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    <472392..472547
                     /gene="trkA"
                     /locus_tag="HMPREF0733_10437"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     gene            complement(472652..473500)
                     /gene="proC"
                     /locus_tag="HMPREF0733_10438"
                     /db_xref="GeneID:9901695"
     CDS             complement(472652..473500)
                     /gene="proC"
                     /locus_tag="HMPREF0733_10438"
                     /EC_number="1.5.1.2"
                     /note="COG: COG0345; Pfam: PF03807; InterPro: IPR000304"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="YP_003983330.1"
                     /db_xref="GI:311112108"
                     /db_xref="GeneID:9901695"
                     /translation="MTEHIAFLGTGSMNGSIAAGLIAGGYPAEAIRATVRSKNSIDRL
                     RHQLGPKGRDAVVIGCELKPEANREAVSGASVVLLGVKPYGIVELAREISPALAPDAL
                     VISVAAGVTLDTLQKALPAGQPVIRCMPNTPSSVGKGVLAISVSENVTEKQLALAEKI
                     LETVGLVVQVREDQMDAVTAVSGSGPAYGFLLAETMASAGVKLGLDEETAQRLASATI
                     AGAGYLLDSNPDAAALRKAVTSPNGTTERAINTFIDKGLFDLTEDAMRACAARSAELS
                     EQYTAD"
     misc_feature    complement(472667..473500)
                     /gene="proC"
                     /locus_tag="HMPREF0733_10438"
                     /note="pyrroline-5-carboxylate reductase; Reviewed;
                     Region: PRK11880"
                     /db_xref="CDD:237008"
     misc_feature    complement(473174..473488)
                     /gene="proC"
                     /locus_tag="HMPREF0733_10438"
                     /note="NADP oxidoreductase coenzyme F420-dependent;
                     Region: F420_oxidored; pfam03807"
                     /db_xref="CDD:252177"
     misc_feature    complement(472676..472993)
                     /gene="proC"
                     /locus_tag="HMPREF0733_10438"
                     /note="Pyrroline-5-carboxylate reductase dimerization;
                     Region: P5CR_dimer; pfam14748"
                     /db_xref="CDD:258885"
     gene            473660..475030
                     /locus_tag="HMPREF0733_10439"
                     /db_xref="GeneID:9901696"
     CDS             473660..475030
                     /locus_tag="HMPREF0733_10439"
                     /note="Pfam: PF00654; InterPro: IPR014743"
                     /codon_start=1
                     /transl_table=11
                     /product="voltage-gated chloride channel family protein"
                     /protein_id="YP_003983331.1"
                     /db_xref="GI:311112109"
                     /db_xref="GeneID:9901696"
                     /translation="MKTRLIRCAHLLLCTVLIGAATGGGAIILHYLLDIMQEVTFGHT
                     EAEHPIVTDHSDIVRRVLVLIAVGVVVSIIWFLLQRRTKLVSIKAQIRGETPQERHPG
                     FLRQTLHSLTQIVAVGAGAPVGKEVAPRELGALFAGRLADLMRIPQTVRPVLVASAAA
                     AGLAAVYQVPVGGFVFLFEALGLALSLRNIFTGAVLVLVATCTANLVISDAPTYPVPQ
                     LQTTGESLLLAVVLGLAITPLALWFRAASQRAESRKTTNRNVLWRLPLVLALVAVTSI
                     FLPEILGNGRPLTQHIFDAASGLSSSSGRLDATALGQALLYALALLAAKVILVVASLR
                     NGAYGGTLTPGLALGSACGFVLTGALILVFPTLLQLPPGAGAFHASELLGIAGLLGAV
                     TFLSLSMNAPLSACALILGFAGQDWQAYAPFTVAVGTAWGVKYLWMRLGNKTQHAPQT
                     VAPSQR"
     misc_feature    473714..474970
                     /locus_tag="HMPREF0733_10439"
                     /note="CLC voltage-gated chloride channel. The ClC
                     chloride channels catalyse the selective flow of Cl- ions
                     across cell membranes, thereby regulating electrical
                     excitation in skeletal muscle and the flow of salt and
                     water across epithelial barriers. This...; Region:
                     Voltage_gated_ClC; cl02915"
                     /db_xref="CDD:261508"
     misc_feature    order(473909..473923,474029..474043,474677..474691)
                     /locus_tag="HMPREF0733_10439"
                     /note="Cl- selectivity filter; other site"
                     /db_xref="CDD:238233"
     misc_feature    order(473912..473914,473918..473920,474035..474040,
                     474677..474685)
                     /locus_tag="HMPREF0733_10439"
                     /note="Cl- binding residues [ion binding]; other site"
                     /db_xref="CDD:238233"
     misc_feature    474035..474037
                     /locus_tag="HMPREF0733_10439"
                     /note="pore gating glutamate residue; other site"
                     /db_xref="CDD:238233"
     misc_feature    order(474170..474172,474197..474199,474248..474250,
                     474269..474271,474857..474859,474866..474868,
                     474890..474892,474917..474919,474938..474943)
                     /locus_tag="HMPREF0733_10439"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238233"
     gene            complement(475200..475319)
                     /locus_tag="HMPREF0733_10440"
                     /db_xref="GeneID:9901697"
     CDS             complement(475200..475319)
                     /locus_tag="HMPREF0733_10440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983332.1"
                     /db_xref="GI:311112110"
                     /db_xref="GeneID:9901697"
                     /translation="MHNTICIVELEPAVGCAAGTLFRVCASPGKPGESSPAVP"
     gene            475404..475526
                     /locus_tag="HMPREF0733_10441"
                     /db_xref="GeneID:9901698"
     CDS             475404..475526
                     /locus_tag="HMPREF0733_10441"
                     /EC_number="2.1.1.37"
                     /codon_start=1
                     /transl_table=11
                     /product="C-5 cytosine-specific DNA methylase"
                     /protein_id="YP_003983333.1"
                     /db_xref="GI:311112111"
                     /db_xref="GeneID:9901698"
                     /translation="MPVLGTIAEVIPRNSSSQPSHTANRALAELLPVPSTRWIF"
     gene            475709..476962
                     /locus_tag="HMPREF0733_10442"
                     /db_xref="GeneID:9901699"
     CDS             475709..476962
                     /locus_tag="HMPREF0733_10442"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983334.1"
                     /db_xref="GI:311112112"
                     /db_xref="GeneID:9901699"
                     /translation="MQHAQEESPAQNSLPPQDAGPDATAQTPQAAQDPQDAKTQESAQ
                     KSAEDSSAESAHATQSTPWGSQTSKPQPAEAESAQPAAVEIDTNTPAEALPQSISRPD
                     ADEAVHHENTQTRQLPVQSRPEQGPLSSYLSEKPQDSEAPDPAAAHAEAPEAEPVDNI
                     PQSISRPDADEAGDAEDVRTRQLPAQAQEQGAFQSIADTMSAARAERGSSAPADSAAS
                     EAQASAEKTGAKKVYEDTMPASAIPIITANTPAVSVGAPASGQIAATTGSVPAGAEKT
                     PEQKRSRELKTIVTVTAIRTVLLAACLVMYGFGFGGGGTFNMMLGYGGAVYMLVQIVA
                     CIFAVRSKSTKGMRILNGISAGLGIILLIVTAIVYAGWSGEDSSAGAYIFIMADIILS
                     VIIASARSIIEQPKEDVEPERLARE"
     misc_feature    <475724..476125
                     /locus_tag="HMPREF0733_10442"
                     /note="Domain of unknown function (DUF4628); Region:
                     DUF4628; pfam15429"
                     /db_xref="CDD:259560"
     gene            477399..477887
                     /locus_tag="HMPREF0733_10443"
                     /db_xref="GeneID:9901700"
     CDS             477399..477887
                     /locus_tag="HMPREF0733_10443"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983335.1"
                     /db_xref="GI:311112113"
                     /db_xref="GeneID:9901700"
                     /translation="MSTRAASAGAYTALGGVERAHGIPQRGSGEVTFRHTLASVGYTV
                     RVLFMVLPYVMTFFALLVSGDLTSDWSHILFHPMGQFILVYALGHIVANVCFNFRMGT
                     GLVRSVNALGAVLCVAVSPLWFRLLTSGNLALDALWTLTIVPLEFVACLTFYMHAVRR
                     DG"
     gene            478275..480092
                     /locus_tag="HMPREF0733_10444"
                     /db_xref="GeneID:9901701"
     CDS             478275..480092
                     /locus_tag="HMPREF0733_10444"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983336.1"
                     /db_xref="GI:311112114"
                     /db_xref="GeneID:9901701"
                     /translation="MDDHRLNAESRIQSITEPPLLEPSKQRTARPIAWSILICAILCV
                     IAAIIIPFLTKQTTLSLVLYAIGGVLTVLALIVFTRRNRSSVATVAHKSVDIFGVTRA
                     ERESIYQQATAQLEDQQAKTRQKSLYTLLALVDKCLEDETLSYEDRNKEGQRIVNKIS
                     GYIQSPPIFDPHALELTHGAFHAKSALLREEAELRFGLMQQIRDRLRAPSDAGGYQDG
                     PWTNFEYDFSGSTFFYPIEFSRVFFNKTADFSGCTYRYEADFSGTIYRNWADFRGSTY
                     LAHANFSGSSYHGAASLNDSVYRSTADFSGNLYLDQANFSGSTYHEAVTFVNSTYRNW
                     AVFRNSTYLGAVDFSGSVYHNQANFHNSVYTGTVTFNSSVYHNQANFHNCVYTRVASF
                     GDCTYHRADFSGSVYTDDVHFNHCRYGGDVYFRRSVYNGWADFQGSVYSKWANYTSSL
                     YYGLAGFQNSTYADKALFRGSVYGNAVTFQGSVFTGAAPAFMNVEAWAQYISFFAPTE
                     NVFSLGQGYSIDTGASGLPSECPPLAVEHRQYLAHKNGELHEITQHLHGDDARSTDRL
                     GLTKELSGRLKSTVEELHAWREKITTIPLQEQDRQQVGV"
     misc_feature    478368..>478739
                     /locus_tag="HMPREF0733_10444"
                     /note="IncA protein; Region: IncA; pfam04156"
                     /db_xref="CDD:252417"
     misc_feature    478953..479099
                     /locus_tag="HMPREF0733_10444"
                     /note="Pentapeptide repeats (9 copies); Region:
                     Pentapeptide_3; pfam13576"
                     /db_xref="CDD:257892"
     misc_feature    479277..479513
                     /locus_tag="HMPREF0733_10444"
                     /note="Pentapeptide repeats (9 copies); Region:
                     Pentapeptide_4; pfam13599"
                     /db_xref="CDD:257914"
     misc_feature    479382..479525
                     /locus_tag="HMPREF0733_10444"
                     /note="Pentapeptide repeats (9 copies); Region:
                     Pentapeptide_3; pfam13576"
                     /db_xref="CDD:257892"
     gene            480273..481844
                     /locus_tag="HMPREF0733_10445"
                     /db_xref="GeneID:9901702"
     CDS             480273..481844
                     /locus_tag="HMPREF0733_10445"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983337.1"
                     /db_xref="GI:311112115"
                     /db_xref="GeneID:9901702"
                     /translation="MKSKKQLYMEYQPEENPRLHKAWSWTKRWWLPIAIVLITSVGLV
                     CALSIPQKVFQTPANPDDKSASVLLAQSNLRLAFLYITGGAIAVLGLIETFRRNNNEK
                     LKNDQEKEKHDKEHRRQVRAERRERYTKAVEQLTHKEAPARIGGIYTLVGLVTEWLED
                     ENLSEYEKTREGQFIINNLCAYIRSPFALSSHYDELMQDKPTGSYQEKPDKFYSDKAT
                     LNAEKDVRLIIIKEIRDRLQKSTQEESGTWSNFEYNFSGSTFFYIVDFKGSYWNNLCN
                     MKNCTYLEDADFSGSKYTGLLYRKNCKYKKKVSFESSIYNQPKLENSQKYYFLSFEGS
                     VYEDTVTFKWSHYYVNVKFSSPESPSKYKNVADFTDSTYKEEVYLEYASYMSSALFYI
                     STYYSLASFANSIYHDQVDFSQSTYMNIVKYDHNIYIKSVDFSYSNYYYTPSFSTHYN
                     EGSLFSYLHLSSFMVSKNSNSLIVHPNESLPPNCRKISTKENTAYNYMRENSSLEELE
                     KWLRELQSAQNSNES"
     misc_feature    <480591..>480779
                     /locus_tag="HMPREF0733_10445"
                     /note="Nucleolar protein 12 (25kDa); Region: Nop25;
                     pfam09805"
                     /db_xref="CDD:255569"
     misc_feature    481035..481157
                     /locus_tag="HMPREF0733_10445"
                     /note="Pentapeptide repeats (9 copies); Region:
                     Pentapeptide_3; pfam13576"
                     /db_xref="CDD:257892"
     gene            482157..483284
                     /locus_tag="HMPREF0733_10446"
                     /db_xref="GeneID:9901703"
     CDS             482157..483284
                     /locus_tag="HMPREF0733_10446"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983338.1"
                     /db_xref="GI:311112116"
                     /db_xref="GeneID:9901703"
                     /translation="MPEEYEDVEATLEQGTTSDAPQQKEKRQEQFVCWLKSRPINKIV
                     GSTLIIEALWVALFWFMPQVLHWWSWNPAVSAEHFAQFYFAWGLGFLSLGYIVLILWP
                     IFRKDDDPRWFHARILSSGIVGGSYAFLLPVVMSLPEGSVNSGGAAALRQAILLATGG
                     LIALIALGETRRKNDNDREAAENLRIHQQDTLDQQKEQFEKQLEKQQKQFEANAFKER
                     KAERRERYTKAVEQLGDEKAPVRMGGVYTLVGLVDEWLEEENLSESERVKEGQVIINN
                     LCAYIRSPFTLASHYDELSQNTPLSEGIYKDKEQEFYADKATLDSEADVRLGIIKEIH
                     DRLQGSGKNAPGAWSDFEYDFSGSTFFYPVDLTKSYYKKNC"
     misc_feature    <482271..482549
                     /locus_tag="HMPREF0733_10446"
                     /note="Zinc dependent phospholipase C/S1-P1 nuclease;
                     Region: ZnPC_S1P1; cl16915"
                     /db_xref="CDD:266488"
     gene            complement(483970..484104)
                     /locus_tag="HMPREF0733_10447"
                     /db_xref="GeneID:9901704"
     CDS             complement(483970..484104)
                     /locus_tag="HMPREF0733_10447"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983339.1"
                     /db_xref="GI:311112117"
                     /db_xref="GeneID:9901704"
                     /translation="MEFFVKSLQLFREFCLLFGIFYLKKFIIRFFYFLELICKVFLLF
                     "
     gene            complement(484396..484956)
                     /locus_tag="HMPREF0733_10448"
                     /db_xref="GeneID:9901705"
     CDS             complement(484396..484956)
                     /locus_tag="HMPREF0733_10448"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983340.1"
                     /db_xref="GI:311112118"
                     /db_xref="GeneID:9901705"
                     /translation="MPIYTSEEYPAVIERIKAKIAQKNIDLGPTVSEADIIAFERACN
                     TRLPQAYRLFLLEVGDGWNDPATEGISTSSIHRLAEIERKDLSLPMTLTDGWLWEVEE
                     DEEQLSDDSFEHKLGNQGVELMDEGCGMTYELITAGSCAGEVWSFSDVGVSPCCERQD
                     FLGWFELWLDSDGDPDYFKDYVYQEK"
     misc_feature    complement(<484693..484866)
                     /locus_tag="HMPREF0733_10448"
                     /note="SMI1 / KNR4 family (SUKH-1); Region: SMI1_KNR4;
                     pfam09346"
                     /db_xref="CDD:255303"
     gene            complement(485182..486153)
                     /locus_tag="HMPREF0733_10449"
                     /db_xref="GeneID:9901706"
     CDS             complement(485182..486153)
                     /locus_tag="HMPREF0733_10449"
                     /note="COG: COG0248; Pfam: PF02541; InterPro: IPR003695"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolyphosphatase (ppx)"
                     /protein_id="YP_003983341.1"
                     /db_xref="GI:311112119"
                     /db_xref="GeneID:9901706"
                     /translation="MRLGVLDVGSNTVHLLLLDGHPGARPEPYASHKIPLQLVQYLTP
                     SGDISDEGRAALTEFVKSARDFAIENNAEDLLAFATSAIREAGNGAEVLQHVRLKTGV
                     SLSEISGDQEAAITYFAVRRWQGWGAGRILNFDIGGGSFEFSTGTDALPDAAMSVPLG
                     AGRLTREFFDEQPPSPKQTKRLRRYVREQIEPVAQRLLAFGEPNMVVGTSKTFRSLAR
                     ICGAAPYSAGPHVKREMHVTDLRLWTRRMEAMAPAERADLPGVSRMRADQVLAGAMAA
                     EAAMETFGIETMRVSPWALREGLILRRLEHLAEGTSTPLDPKTLVGE"
     misc_feature    complement(485242..486150)
                     /locus_tag="HMPREF0733_10449"
                     /note="Ppx/GppA phosphatase family; Region: Ppx-GppA;
                     cl19483"
                     /db_xref="CDD:267836"
     gene            complement(486730..489543)
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /db_xref="GeneID:9901707"
     CDS             complement(486730..489543)
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /EC_number="5.99.1.2"
                     /note="COG: COG0550; Pfam: PF01751,PF01131; InterPro:
                     IPR000380"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase TopA"
                     /protein_id="YP_003983342.1"
                     /db_xref="GI:311112120"
                     /db_xref="GeneID:9901707"
                     /translation="MRRAVPTKAKNGKALLIVESPSKVKTISGYLGNEFLVDSSMGHI
                     RDLPQPSELPENLKKGPVGKFAVNIDDDFDPYYVVNPDKKKKVAELKRKLKDVDALYL
                     ATDGDREGEAIAWHLKEVLKPKVPVYRMTFPEITREAIERAFGELRDIDLHLVDAQET
                     RRILDRIYGYEISPVLWRKVGRGLSAGRVQSVATRLVVERERERMAFVAANYWDLTGH
                     FITTSNEGFDAKLVAVDGTRVATGKDFADDGTLTSTKVTHLSEADARTLAEALTAAPF
                     AVRSVETKPYKRRPAAPFTTSTLQQEAARKLRFSSRVTMQVAQRLYESGYITYMRTDS
                     VALSDQAVKAARRQASELYGTEYVPSAPRTYASKSKNAQEAHEAIRPAGDKFRTPDAV
                     RGTLSNDEYRLYELIWKRTIASQMADATGSTASVRLGATASNGRDAEFAASGTVITFR
                     GFLAAYEEGVDATRLAERDAKNAEKRLPALAQGDSLTAEKLEATGHETLPPPRYTEAS
                     LVKTLDELGIGRPSTYAAVISTIMDRGYVQVRSGSLVPSWTAFSVVRLLETSFGPYVN
                     YEFTAQMEEDLDRIARGEESRVEWLGDFYFGGGVQKKRGLKPIVDNLGDIDARDINSI
                     RIADGIVLRVGKFGPYLEAEGTVNTETGEVSDPVRANVPTDLAPDELTAEKAKELLEQ
                     GKSDGRVLGTDPASGNQIIARDGRYGPYVTEVIEEMTEEQIQAYLDAQPTEYYKNGKP
                     KPKKKPKPAKPRTASLFKSMDLATLTLEDALKLLSLPRVLGTDAEGNEITVQNGRFGP
                     YLKKGTDSRSIGSEEEIFTITLEQALDIYAQPKQRGRAAAKPPLAELGVDPNSEKNIV
                     VKDGRFGPYITDGVTNITVPRSETIESLTHERAVELLAEKRAKGPAKRKTAAKKTTAK
                     KSTAKKTTAKKSTTAKKTAAKKE"
     misc_feature    complement(486847..489510)
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="DNA topoisomerase I subunit omega; Validated;
                     Region: PRK07561"
                     /db_xref="CDD:236048"
     misc_feature    complement(489112..489507)
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="TOPRIM_TopoIA_TopoI: The topoisomerase-primase
                     (TORPIM) domain found in members of the type IA family of
                     DNA topoisomerases (Topo IA) similar to Escherichia coli
                     DNA topoisomerase I.   Type IA DNA topoisomerases remove
                     (relax) negative supercoils in the...; Region:
                     TOPRIM_TopoIA_TopoI; cd03363"
                     /db_xref="CDD:173783"
     misc_feature    complement(order(489217..489219,489223..489225,
                     489229..489231,489475..489477,489484..489489))
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="active site"
                     /db_xref="CDD:173783"
     misc_feature    complement(order(489187..489192,489196..489201,
                     489220..489222,489226..489228,489466..489468))
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="interdomain interaction site; other site"
                     /db_xref="CDD:173783"
     misc_feature    complement(order(489223..489225,489229..489231))
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173783"
     misc_feature    complement(489220..489222)
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173783"
     misc_feature    complement(487759..489084)
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="DNA Topoisomerase, subtype IA; DNA-binding,
                     ATP-binding and catalytic domain of bacterial DNA
                     topoisomerases I and III, and eukaryotic DNA topoisomerase
                     III and eubacterial and archael reverse gyrases.
                     Topoisomerases clevage single or double stranded DNA...;
                     Region: TOP1Ac; cd00186"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(488932..488994,489007..489084))
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="domain I; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(487942..487947,487957..487959,
                     487963..487968,487975..487980,488551..488553,
                     488575..488577,488587..488589,489025..489027,
                     489037..489039,489049..489051,489058..489063))
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="DNA binding groove [nucleotide binding]"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(487870..487872,488947..488949,
                     488959..488961))
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(488047..488079,488176..488232,
                     488236..488238,488254..488295,488677..488724,
                     488899..488919))
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="domain II; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(488296..488358,488395..488421,
                     488485..488652,488656..488676))
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="domain III; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(487912..487914,487978..487980,
                     487984..487986,488317..488319,488329..488331,
                     488338..488340,488416..488418,488623..488631,
                     488641..488643))
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(488416..488418,488551..488553,
                     488557..488559))
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(487759..487854,487870..487914,
                     487924..488046))
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="domain IV; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(487198..487467)
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="Topoisomerase C-terminal repeat; Region:
                     Toprim_C_rpt; pfam13368"
                     /db_xref="CDD:257695"
     misc_feature    complement(487027..487197)
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="Topoisomerase C-terminal repeat; Region:
                     Toprim_C_rpt; pfam13368"
                     /db_xref="CDD:257695"
     misc_feature    complement(486841..487002)
                     /gene="topA"
                     /locus_tag="HMPREF0733_10450"
                     /note="Topoisomerase C-terminal repeat; Region:
                     Toprim_C_rpt; pfam13368"
                     /db_xref="CDD:257695"
     gene            complement(489748..490191)
                     /locus_tag="HMPREF0733_10451"
                     /db_xref="GeneID:9901708"
     CDS             complement(489748..490191)
                     /locus_tag="HMPREF0733_10451"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983343.1"
                     /db_xref="GI:311112121"
                     /db_xref="GeneID:9901708"
                     /translation="MTMQDTPDTTKKMSAEDCWAHLQANNLGRLVLTDGNFVDVLPVL
                     YGVADHEIYLRTTRGDRFSAVVMSRRVSFEIDEELENGIRSVIVQGVAHWLPPEMTPP
                     LVHTFGLRHYESGHLMQWVRIVPRKVYGREYPLLPAQGEGYFPYN"
     misc_feature    complement(489898..490152)
                     /locus_tag="HMPREF0733_10451"
                     /note="Pyridoxamine 5'-phosphate oxidase; Region:
                     Pyridox_ox_2; pfam12900"
                     /db_xref="CDD:257388"
     gene            complement(490282..492018)
                     /locus_tag="HMPREF0733_10452"
                     /db_xref="GeneID:9901709"
     CDS             complement(490282..492018)
                     /locus_tag="HMPREF0733_10452"
                     /note="Pfam: PF08241"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="YP_003983344.1"
                     /db_xref="GI:311112122"
                     /db_xref="GeneID:9901709"
                     /translation="MGSMADELYSRIPDTPISDDTARLERIRGALERLNYSYDGVREL
                     LGERAFEAMARDQVVPGTWRVQNILDDAHTTDPDRRLGRMIGFFLFARTLTRTELADA
                     LGGEPALNDLIAAHLVEPAESDNARTPENPGEEPQYRAVFDLRPHSADDGTELWVASD
                     LGAHQRPGVLRKDHVLGIGQASLTLAQITERTPVARALDVGTGCGIQTFHLLAHADHV
                     TATDISPRALAFARFNLLLNAPALKLDPQNLEARVSLRQGSLLDPVAGEQFDLVVSNP
                     PFVITPRRADESSDDQFTYRDGGLPGDDIVSTLIRRIPEVLVPGGRAQMLGNWEIHRD
                     NTGEAQPWDARLRTWFAESATGTPSEAWVIQREVLTPESYAETWLKDASENRDRDHYE
                     NTYRAYLDDFKNRNVHSIGFGMLWLRRRAHTTETAPLNRFEDITYPIAQPIAQSITEA
                     VARFDRLTALTDQALAEAHLVLAEDVTEERHGRPGAEHPNVILLRAGSGLCRTILLST
                     ETAGFVSACDGELSIGQILGALAVLLGWEDYTPDARAAFGTENEHPRDTLLVAIRELI
                     EKSFLHFADENS"
     misc_feature    complement(491056..>491520)
                     /locus_tag="HMPREF0733_10452"
                     /note="Methylase of polypeptide chain release factors
                     [Translation, ribosomal structure and biogenesis]; Region:
                     HemK; COG2890"
                     /db_xref="CDD:225443"
     misc_feature    complement(491053..491433)
                     /locus_tag="HMPREF0733_10452"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(491194..491196,491239..491247,
                     491350..491355,491401..491421))
                     /locus_tag="HMPREF0733_10452"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(492128..493207)
                     /locus_tag="HMPREF0733_10453"
                     /db_xref="GeneID:9901710"
     CDS             complement(492128..493207)
                     /locus_tag="HMPREF0733_10453"
                     /note="COG: COG2141; Pfam: PF00296; InterPro: IPR011251"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterial luciferase"
                     /protein_id="YP_003983345.1"
                     /db_xref="GI:311112123"
                     /db_xref="GeneID:9901710"
                     /translation="MNASDTQKTELAVQNLEPQPGTEKKLGFLSFGHWAEIPGSRVNS
                     ASESLHQAIDLAVGAEDIGLDGAFFRVHHFDQQQATPYPLLSAIAAKTSRIELGTGVI
                     DMRYENPLYMAELAAMADLISAGRLQLGVSRGSPESVIRGFESFGYFPAEGEDESAMA
                     RRHLDIFMKAIQGEGMAPSARVQGKYAPVQPQSPGLSKRIWWGAGTDSTAVWTAQQGL
                     NLMSSTLMLEDKGVPFDQQQAEQIRLYREEWVKAGYTRVPRVSVSRSVIPIIDADSAR
                     YFGRRAQEDSQDYTGIIDNTFSRFGRSYIGEPDLIAEELARDAAVQAADTVLLTVPNQ
                     LGVDFNLRMLESIVKDIKPALTVKA"
     misc_feature    complement(492173..493075)
                     /locus_tag="HMPREF0733_10453"
                     /note="Coenzyme F420-dependent N5,N10-methylene
                     tetrahydromethanopterin reductase and related
                     flavin-dependent oxidoreductases [Energy production and
                     conversion]; Region: COG2141"
                     /db_xref="CDD:225052"
     gene            complement(493635..494126)
                     /locus_tag="HMPREF0733_10454"
                     /db_xref="GeneID:9901711"
     CDS             complement(493635..494126)
                     /locus_tag="HMPREF0733_10454"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983346.1"
                     /db_xref="GI:311112124"
                     /db_xref="GeneID:9901711"
                     /translation="MLVATVVAEAMFWACLVLGCVFRYTLKMPRTGIVLLAATPVIDL
                     LLLVFSYITLSQSGAAEFMHGFAAFYIAFSIVFGRSIIHAFDRKFSGSASEGVAVSSA
                     QQLRKCVAACLIAAALLIAGIFVTGLKGSFWLVYWLIAVAFTPLMWWGVGKWYARKAS
                     KES"
     gene            494450..494950
                     /locus_tag="HMPREF0733_10455"
                     /db_xref="GeneID:9901712"
     CDS             494450..494950
                     /locus_tag="HMPREF0733_10455"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine dimer DNA glycosylase"
                     /protein_id="YP_003983347.1"
                     /db_xref="GI:311112125"
                     /db_xref="GeneID:9901712"
                     /translation="MNAGLRRYSGWMRIWSAHPSLLDRRALIACWRESLLAQKVLRGL
                     TRGYTNHPQLIRFRAHSQPVEAIGAYLHGLADEAHLRGYSFNRSLIATERGKNLRSSI
                     PVTEGQLAYELSFLAHKVAGRDVDWEPILTERLAKFTQAGKPAVHPVFEVVPGEIEAW
                     EKTKEF"
     gene            complement(494961..495467)
                     /locus_tag="HMPREF0733_10456"
                     /db_xref="GeneID:9901713"
     CDS             complement(494961..495467)
                     /locus_tag="HMPREF0733_10456"
                     /note="Pfam: PF06445; InterPro: IPR010499"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional activator"
                     /protein_id="YP_003983348.1"
                     /db_xref="GI:311112126"
                     /db_xref="GeneID:9901713"
                     /translation="MSESVQAPVTVSPARIEKHGSLLVAGVSQVYKLGDDFTPLWDEL
                     NQKASPAMLDILAVTQYIGVCTQPSTDGFVRYTAGILVDDRASAHKLGLGLLDLPEST
                     YAVVEITGPISRSIPAGFESFEREFFPSHPQYRPLGGLEVYGRGDMQAADYTMELWVP
                     LLEVPASA"
     misc_feature    complement(494985..495425)
                     /locus_tag="HMPREF0733_10456"
                     /note="Bacterial transcription activator, effector binding
                     domain; Region: AraC_E_bind; smart00871"
                     /db_xref="CDD:214874"
     gene            complement(495464..496378)
                     /locus_tag="HMPREF0733_10457"
                     /db_xref="GeneID:9901714"
     CDS             complement(495464..496378)
                     /locus_tag="HMPREF0733_10457"
                     /note="COG: COG1054; Pfam: PF00581; InterPro: IPR001763"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="YP_003983349.1"
                     /db_xref="GI:311112127"
                     /db_xref="GeneID:9901714"
                     /translation="MAQNRIILYYQFAPITDPVAVMLWQRALCEKLGLRGRILISKHG
                     INGTLGGEISAVKAYTKETRQYPGFKNMEFKWSEGGAEDFPRLSVKARDEIVAFGAPD
                     ELKVDENGVVGGGVHLKPEEVNKLVEERGDEVVFFDGRNAFEAKIGKFKNAVVPDVRT
                     THDFIREIESGKYDDLKDKPVVTYCTGGIRCEILSALMKNRGFKEIYQIDGGIVRYGE
                     KYGDKSLWEGSLYVFDKRMHMEFTPDTVTIGQCERCSAPSNKFENCSNESCRELVLLC
                     PECATDDAKRRCVPECAVDRQSAHAGIS"
     misc_feature    complement(495485..496378)
                     /locus_tag="HMPREF0733_10457"
                     /note="putative rhodanese-related sulfurtransferase;
                     Provisional; Region: PRK00142"
                     /db_xref="CDD:234663"
     misc_feature    complement(495725..496036)
                     /locus_tag="HMPREF0733_10457"
                     /note="Member of the Rhodanese Homology Domain
                     superfamily. This CD includes Escherichia coli YceA,
                     Bacillus subtilis YbfQ, and similar uncharacterized
                     proteins; Region: RHOD_YceA; cd01518"
                     /db_xref="CDD:238776"
     misc_feature    complement(495824..495826)
                     /locus_tag="HMPREF0733_10457"
                     /note="active site residue [active]"
                     /db_xref="CDD:238776"
     gene            complement(496383..496604)
                     /locus_tag="HMPREF0733_10458"
                     /db_xref="GeneID:9901715"
     CDS             complement(496383..496604)
                     /locus_tag="HMPREF0733_10458"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003983350.1"
                     /db_xref="GI:311112128"
                     /db_xref="GeneID:9901715"
                     /translation="MFRSPRQIGIRYQKTAKPAGAMGQKNDETYLMVKKPHAIHHRGR
                     IPRENRDYRPRYGTSSAATAHTMYPESVK"
     gene            496603..499293
                     /locus_tag="HMPREF0733_10459"
                     /db_xref="GeneID:9901716"
     CDS             496603..499293
                     /locus_tag="HMPREF0733_10459"
                     /EC_number="3.6.1.-"
                     /note="COG: COG1205; Pfam: PF00270,PF00271; InterPro:
                     IPR014001"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase family protein"
                     /protein_id="YP_003983351.1"
                     /db_xref="GI:311112129"
                     /db_xref="GeneID:9901716"
                     /translation="MPGVPSNAHAGLPYPRFYNGVMRPEPSCDSPADEHPGFSPSLRP
                     DENLREQLSRLMPKLPGDGSLPPQITHVHRIPAREGQYSPWPHWLHPRVIEAFESLGV
                     HKPYTHQVQAAQAAHCAFDAALAEDAHRLSFGRASGQGHDESGTTARHVIVATGTASG
                     KSLSYLMPAFDALYRGAHREPLSTTAADTSSTGFHQRANVLYISPARALSADQLNAIT
                     AYHLPGLNAATYDGDTPAQERRWVREHANFVLTTPDMLNYGILGNHRQWANFLRGLRY
                     VVLDEVHSYRGVFGAHIANLLRRLRRVCALYRVSPVFYGASATSANPAESFAKLIGVP
                     EGNVDAITTSTAPRGESTVILWEPEFLPDTQVTDKLAVGASAFDTRSEAEKQAPQRIS
                     AIEQGAQMLTDLVLSRTRTLAFTRSRRGAELISQRAQRYLDETEAGLAHRVAAYRSGY
                     MPEERRELEHRLRTGELLGLASTSALELGIDISGLDAVLVAGWPGTRASFIQRIGRAG
                     RGGQDALAVLIAGDDPLDTYLVHHPQAIFGQSVEATVFDPTNPYVLSPHLCAAAAESP
                     LRAEELSLFGEHTEALLNRLVQQNYLRRRADGWYWTHAESATNLVDLRATGGGPYQLI
                     DAEDGSLIGTMDSAQAMTQGHPGAIYIHQNAQYLVESLDEAARVILLSRVYPDYYTRA
                     IEATEVKILQEKAGVRYGFDGTQPDTAGLTLHRGRVQVTDQVMGFQRFSVYGSEYLGD
                     EPMEMPPSILMTEAIWFTFEPSYLFAAGVAEPDAPGTLHAAEHAAIGLLPLIATCDRW
                     DLGGLSTLYHADTERPTIFVYDAAPGGAGFTQRGFEAVRTWLGATLDAIDSCGCESGC
                     PSCVQSPKCGNRNEPLSKAGAQNLLRAILHSLDEAERDML"
     misc_feature    496807..499266
                     /locus_tag="HMPREF0733_10459"
                     /note="helicase/secretion neighborhood putative DEAH-box
                     helicase; Region: DECH_helic; TIGR03817"
                     /db_xref="CDD:234365"
     misc_feature    497047..497559
                     /locus_tag="HMPREF0733_10459"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent