GenomeNet

Database: RefSeq
Entry: NC_014643
LinkDB: NC_014643
Original site: NC_014643 
LOCUS       NC_014643            2506025 bp    DNA     circular CON 30-JUL-2015
DEFINITION  Rothia dentocariosa ATCC 17931, complete genome.
ACCESSION   NC_014643 NZ_ADVO01000000-NZ_ADVO01000021 NZ_GG771275-NZ_GG771284
VERSION     NC_014643.1  GI:311111670
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN00120582
            Assembly: GCF_000164695.2
KEYWORDS    RefSeq.
SOURCE      Rothia dentocariosa ATCC 17931
  ORGANISM  Rothia dentocariosa ATCC 17931
            Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Rothia.
REFERENCE   1  (bases 1 to 2506025)
  AUTHORS   Muzny,D., Qin,X., Buhay,C., Dugan-Rocha,S., Ding,Y., Chen,G.,
            Hawes,A., Holder,M., Jhangiani,S., Johnson,A., Khan,Z., Li,Z.,
            Liu,W., Liu,X., Perez,L., Shen,H., Wang,Q., Watt,J., Xi,L., Xin,Y.,
            Zhou,J., Deng,J., Jiang,H., Liu,Y., Qu,J., Song,X.-Z., Zhang,L.,
            Villasana,D., Johnson,A., Liu,J., Liyanage,D., Lorensuhewa,L.,
            Robinson,T., Song,A., Song,B.-B., Dinh,H., Thornton,R., Coyle,M.,
            Francisco,L., Jackson,L., Javaid,M., Korchina,V., Kovar,C.,
            Mata,R., Mathew,T., Ngo,R., Nguyen,L., Nguyen,N., Okwuonu,G.,
            Ongeri,F., Pham,C., Simmons,D., Wilczek-Boney,K., Hale,W.,
            Jakkamsetti,A., Pham,P., Ruth,R., San Lucas,F., Warren,J.,
            Zhang,J., Zhao,Z., Zhou,C., Zhu,D., Lee,S., Bess,C.,
            Blankenburg,K., Forbes,L., Fu,Q., Gubbala,S., Hirani,K.,
            Jayaseelan,J.C., Lara,F., Munidasa,M., Palculict,T., Patil,S.,
            Pu,L.-L., Saada,N., Tang,L., Weissenberger,G., Zhu,Y., Hemphill,L.,
            Shang,Y., Youmans,B., Ayvaz,T., Ross,M., Santibanez,J., Aqrawi,P.,
            Gross,S., Joshi,V., Fowler,G., Nazareth,L., Reid,J., Worley,K.,
            Petrosino,J., Highlander,S. and Gibbs,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) Human Genome Sequencing Center, Baylor
            College of Medicine, One Baylor Plaza, Houston, TX 77030, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP002280.
            Rothia dentocariosa ATCC 17931
            
             Strain source, body site: oral, teeth
            
             Inquiries should be directed to microbe@hgsc.bcm.tmc.edu
            
             This is a reference genome for the Human Microbiome Project. This
            project is co-owned with the Human Microbiome Project DACC.  Source
            DNA provided by American Type Culture Collection (ATCC 17931).
            Funded by by ###Genomes and Genetics at BCM-HGSC### (U54 HG003273).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler Assembler v. 2.3.10192009
            Genome Coverage          :: 35x
            Sequencing Technology    :: 454
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 07/30/2015 18:28:02
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 2,126
            CDS                                       2,040
            Pseudo Genes                           :: 24
            CRISPR Arrays                          :: 2
            rRNAs                                  :: 4, 3, 3 (5S, 16S, 23S)
            complete rRNAs                         :: 4, 3, 3 (5S, 16S, 23S)
            tRNAs                                  :: 49
            ncRNA                                  :: 3
            Frameshifted Genes                     :: 20
            Frameshifted Genes On Monomer Runs     :: 4
            Frameshifted Genes Not On Monomer Runs :: 0
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2506025
                     /organism="Rothia dentocariosa ATCC 17931"
                     /mol_type="genomic DNA"
                     /strain="ATCC 17931"
                     /isolation_source="biological product [ENVO:02000043]"
                     /host="Homo sapiens"
                     /db_xref="taxon:762948"
     gene            complement(join(2505928..2506025,1..1309))
                     /locus_tag="HMPREF0733_RS00005"
     CDS             complement(join(2505928..2506025,1..1309))
                     /locus_tag="HMPREF0733_RS00005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_013397366.1"
                     /db_xref="GI:503162705"
                     /translation="MAPATSKKTATGETSEETVAETPKKTTRTKKTAATSKPAKKTPA
                     KKRAAAKTQEDAKSDAEDSVETTAEAVPEEKPKRARKTTTKRKTGGRKKKTDEDEFDL
                     DLDDELDPENVDGEEHEDADEDEEAVAKKEEKKAAEEVAAKGSGFVLTASDDDDAPAQ
                     RVVTPGATADPVKDYLKQIGKVSLLNAQQEVDLAMRIEAGLYAEHKLADNPDMDPKLK
                     KELRWVIHDGKRAKNHLLEANLRLVVSLAKRYTGRGMLFLDLIQEGNLGLIRAVEKFD
                     YSKGFKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLARVQRQMLQDLGREP
                     TPEELGKELDMAPEKVIEVQKYGREPISLHTPLGEDGDSEFGDLIEDSEAVVPADAVS
                     FTLLQEQLHSVLDTLSEREAGVVAMRFGMTDGQPKTLDEIGKVYGVTRERIRQIESKT
                     MSKLRHPSRSQVLRDYLD"
     gene            complement(1584..3221)
                     /locus_tag="HMPREF0733_RS00010"
                     /old_locus_tag="HMPREF0733_10002"
     CDS             complement(1584..3221)
                     /locus_tag="HMPREF0733_RS00010"
                     /old_locus_tag="HMPREF0733_10002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397367.1"
                     /db_xref="GI:503162706"
                     /translation="MTTTSNLTTTYSLHTEEDLIALVLHQFGYWPQESLVLLSVTKHA
                     VGPCIRVNLPDEQQDLEQYFDKLANLVPATVDGFEPITGVFALIFSGNAATRERQLSP
                     ATRTVLHNTDLYIDNRAGISFNQWLPTFYAACNNVHLDLYDVLYCGSVSRWSLDRNQL
                     ALTYRGPIEDIMHSSYYLDRVYEGRRVSAEPLSAYTQCLWDTATSASTNEVTEWEQAS
                     LLWMHTFEEELNQATGRHTVLEHPGYYRQKSIELCYWESALEAVRWVMRTYPPENAEE
                     HDNAISFGDRLRSLISPEIAGYLLCSMNTQATPEFILYQAAKDLPEALGVLDGYDCMH
                     AACGEGSYEPVEPLCYGKPTTRRRTTLPETFYQTFRGESPRIGGIGHGRVSWHDWIRR
                     THRILQQQILDDTCDSSETRPEEHITKIDRMVEFLSGLTKDYKPAWSRLNALEVLCNL
                     LVHAVQSGEQYGRLRLLQAWINWLRGGNTYAGILADIARLHCDEDMPLFQALSESVFP
                     LWITDPVRCWRGDLYFSTLLPHEATAAKVETIEPKAG"
     gene            complement(3490..4401)
                     /locus_tag="HMPREF0733_RS00015"
                     /old_locus_tag="HMPREF0733_10003"
     CDS             complement(3490..4401)
                     /locus_tag="HMPREF0733_RS00015"
                     /old_locus_tag="HMPREF0733_10003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="WP_013397368.1"
                     /db_xref="GI:503162707"
                     /translation="MLNPEDLYLANNKILHDARLKNLTLVIALSSPQDAGSTAGQLGH
                     FLLKELKNIEVVEFDTDQLHDYRSRRPHIFFNKDHFEQPIMPALKLYAVEDTLDKPFL
                     LLTGSEPDYQWQRFQQALLSIVRTLDPSLVVLVSAFPMPVPHTRPMPVTAHGSRKDLI
                     EGISPWRPKADLHANMTNLLEVLFTENGFDTVGFGINIPQYVSDADLPQGTLTALEHV
                     SMATRLAFPSDELREAARAVHGQINEQVKENPEIGRMISTMEANYDENFRTSNVAIPL
                     SQRDAHKIPGRDEIGAMFERFLEEHEE"
     gene            4627..6120
                     /locus_tag="HMPREF0733_RS00020"
                     /old_locus_tag="HMPREF0733_10004"
     CDS             4627..6120
                     /locus_tag="HMPREF0733_RS00020"
                     /old_locus_tag="HMPREF0733_10004"
                     /EC_number="3.4.11.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M17"
                     /protein_id="WP_013397369.1"
                     /db_xref="GI:503162708"
                     /translation="MSTALSLHTNDLQSLNAEVLVLGVFSGEDGPYLASNSLPDDSAQ
                     SINKLLESLGATGALDQILRLPGVEGASSDIIALIGLGSDTTIDQERLNALRFAAGSA
                     TRQLLGTAHIALDFGITSRDEIEAVAHGAVLGSFSEEGVRSKTADSVRDEAESITIVA
                     KADASEAEPALVRAVILGEATKDARRLVNMPPSHLYPESFANLAAELVKDYSDVSIEV
                     YPYDRLLKEGFGGIAGVGQGSPRKPALAVVKYTPETPSAHVALVGKGITFDTGGNSLK
                     PAASMMTMKCDMAGAASVLHAVLAASELEIPVEVTGYLCLAENMPGGASLRPEDIITI
                     RDGRTVEVLNTDAEGRLVMADGIALASESNPTVILDIATLTGAAMAALGLRTAALMGD
                     EDIRDRVQQAGAKSGEAYWQIPLESYLRASMNSPVADIKNMGSRYGSMMIAGLFLQEF
                     VGEGIPWAHLDIAGPAFNEEGAYGFTPKEGTGFGTATLVNFIESYAQ"
     gene            6447..7829
                     /locus_tag="HMPREF0733_RS00025"
                     /old_locus_tag="HMPREF0733_10005"
     CDS             6447..7829
                     /locus_tag="HMPREF0733_RS00025"
                     /old_locus_tag="HMPREF0733_10005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="WP_004004973.1"
                     /db_xref="GI:490103118"
                     /translation="MQGSNIVAQEFDILILGGGSAGYSAALRARQLGFTVGLVEKEKV
                     GGTCLHTGCIPTKAYLHAAELAEDAREASKVGVNATLESIEMGKVRDYKDGIVAGKFK
                     GLSGLLKMKGVEVIAGEGKLTAQDTVTVNGTDYKGKNIILASGSISKTFGLPIEGRVL
                     TSTEALEMDYLPKSAIVLGGGVIGCEFASMWKAMGVDVTIIEGLPNLVPNEDPAIIKV
                     LERAFKKRGIKFNTGTFFEKVEQDANGAKVTLADGKVFEADIVLVAVGRGPNTANMGY
                     EEQGIPMDRGFVLANERLHTGVGNIYAVGDIVPGVQLAHRGYQQGIFVAEEIAGLNPT
                     VVPDVNIPKVTFCDPEIASVGYSEPKAKEKFGEDNVEVAEYNLAGNGKSSILGASGIV
                     KVVREKDGPIVGVHAIGKRMGEQIGEAQMWVDWEAFPEDVAKFIHAHPTQNESLGEAA
                     MALNGTPLHG"
     gene            7997..9670
                     /locus_tag="HMPREF0733_RS00030"
                     /old_locus_tag="HMPREF0733_10006"
     CDS             7997..9670
                     /locus_tag="HMPREF0733_RS00030"
                     /old_locus_tag="HMPREF0733_10006"
                     /EC_number="2.3.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide acetyltransferase"
                     /protein_id="WP_013397370.1"
                     /db_xref="GI:503162709"
                     /translation="MSHTVELPALGESVTEGTVTRWLVAVGDTVAVDDPIVEVSTDKV
                     DTEIPSPVAGVVEQILVEEDEDVEVGAALVVIGDGSSAPTAAPAAPAAEAPAASAPAA
                     PEAPAAAAASAAGSVSGQEVTLPALGESVTEGTVTRWLKEVGEQVEVDEPLVEVSTDK
                     VDTEIPSPVAGTLLEIRIPEDEEAEVGQVLAIIGDSSAAAAPAAPAAPAPAAAAPAPA
                     TPAAPAAPASAPDTPATPAAPAADGEAYVTPLVRKLAKDNGIDLSTVKGTGVGGRIRK
                     QDVQAAIAAKGSTAPAAAPAASAAPAADGAPKAAHTFEVSPKRGTVEKTARIRQVIAK
                     RMRESLDISTQLTQVTEVDMTRVAQLRAKAKDGFLAREGAKLTFLPFFAQAVTEALQQ
                     HPALNASMTEDLKQITYPDSENVAIAVDTPKGLLVPVIKNASDLGIAGLAKAIGDLGG
                     RARTGDIAPEELTGSTFTITNIGSFGALFDTPIINQPNVAILGTGSIVKRPMVVKDVD
                     GNDSIAIRSMCYLSLTYDHRVVDGADAGRFLYTLKTRLEEANFEAELGL"
     gene            9817..10164
                     /locus_tag="HMPREF0733_RS00035"
                     /old_locus_tag="HMPREF0733_10007"
     CDS             9817..10164
                     /locus_tag="HMPREF0733_RS00035"
                     /old_locus_tag="HMPREF0733_10007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397371.1"
                     /db_xref="GI:503162710"
                     /translation="MFLLNNILVFLHIIGAAIIIGLWIAHFRTPKVLPGQFHASLLML
                     ITGLLLVGIAEVTGSPNHIKIAVKILIALGISIAAFIGQRKYKAGEPISTGLAHAVGG
                     LAVINVAVATIWH"
     gene            complement(10309..11718)
                     /locus_tag="HMPREF0733_RS00040"
                     /old_locus_tag="HMPREF0733_10008"
     CDS             complement(10309..11718)
                     /locus_tag="HMPREF0733_RS00040"
                     /old_locus_tag="HMPREF0733_10008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397372.1"
                     /db_xref="GI:503162711"
                     /translation="MNTDSITYLENLHEEPNLSIWTVKIHTNRDSSVKNRILPKQLAP
                     GLYTLAISHDSQQIPSHQIKTLCGLPPLPGVATVLAVTRDERQLSGTETGTYYWYEPV
                     EAGSLESLVHARGSLPLAEVATLAHHIGWGFKSLHAAHIYPEHLEPQYVMITIAGLPE
                     FLCLPSSIKASKHQPDEHEHVGVHDFVALLWYALTGESPRQTHQRIPLPLLADVPQTL
                     GTELERLLDDPKATVQEVLDAFSAFQTQPLNAYTSAPESVRSKLPVALREPNTVKSTK
                     TLPKVRHQNAQKLIGKSTFKVGHSRGRSKARNFTTRKLVILGVGSLIILGAGAIVGAT
                     WVPEAMHHHESHATQPAVVSTPQDEQAILAQVIEERNQSLSSQGAATLKLRSLTRILH
                     RDSDSLGITAEVESPGYTPTDAEQKESGVHLVDGVPVQTVIFELHRDEGVWRIVTATP
                     VTDETPNEPDAQPTVVREP"
     gene            11955..12659
                     /locus_tag="HMPREF0733_RS00045"
                     /old_locus_tag="HMPREF0733_10009"
     CDS             11955..12659
                     /locus_tag="HMPREF0733_RS00045"
                     /old_locus_tag="HMPREF0733_10009"
                     /EC_number="2.3.1.181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octanoyltransferase"
                     /protein_id="WP_013397373.1"
                     /db_xref="GI:503162712"
                     /translation="MSVILERVGFAPDYVNYVESLDMQSRLHAEVAARARQNTILLLE
                     HEPVITAGKRTEDHEYPTDRSTPVVKIDRGGKLTWHGPGQLTGYPILKLPEPLDVVAY
                     VRILEEIIMNVLAHFGIKGERVEGRSGVWILGDGITPDKKIAAIGIRVSKQTTMHGFA
                     INCCNETAPFMQFIPCGITDAGVTTISEQLGRTVTPADILETLERELIKYQDRLAMPF
                     EPLVPQEHKVAHETAA"
     gene            12868..13875
                     /locus_tag="HMPREF0733_RS00050"
                     /old_locus_tag="HMPREF0733_10010"
     CDS             12868..13875
                     /locus_tag="HMPREF0733_RS00050"
                     /old_locus_tag="HMPREF0733_10010"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2GJ88.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoyl synthase"
                     /protein_id="WP_004004979.1"
                     /db_xref="GI:490103124"
                     /translation="MSIKPEGRKLLRVEARNAEVPIEKKPHWIKTKAVVGPEYNEMKE
                     LARGQGLHTVCEEAGCPNIYECWEDREATYLIGGSECTRRCDFCNIATGKPAAVDYAE
                     PFKVAKNVKVMGLRYATVTGVARDDLEDGGAWLYAETTRQIHKMCPNTGVEMLIPDFK
                     GKPEHVQKVIDARPEVFAHNLETVPRIFKQIRPAFRYERSLDVITQGKEAGMVTKSNL
                     ILGMGETNDEIYEALCDLYDAGCDIITLTQYLRPGPLFHPIERWVKPAEFLEFSAMAE
                     SIGFAGVMAGPMVRSSYRAGRLWARAMKKNGYEIPENLAHIEDGGAALQEASSLVAAG
                     F"
     gene            14132..14851
                     /locus_tag="HMPREF0733_RS00055"
                     /old_locus_tag="HMPREF0733_10011"
     CDS             14132..14851
                     /locus_tag="HMPREF0733_RS00055"
                     /old_locus_tag="HMPREF0733_10011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397374.1"
                     /db_xref="GI:503162713"
                     /translation="MAEKREEKKKQKKDKSPGTFAQMKQVYQMTKKSDPNIGWILLLA
                     VVVTLLVFVLIGALLNNIITFIILGLAVGVLAAMIILGRRAQKAAFTQIEGQPGRAGA
                     AMNSVRRGWIVEEQPVAANRNQDLVFRGLGRPGIVLVTEGPSSRVQNLVKNEKKHLNR
                     VVPGVPVHVIETGHDENQVELKDVVKTMNKLPKALTQQEVQGVSNRLSTLNHVRNPMN
                     SIPKGIDPNRVRPDRRAMRGR"
     gene            complement(14961..15410)
                     /locus_tag="HMPREF0733_RS00060"
                     /old_locus_tag="HMPREF0733_10012"
     CDS             complement(14961..15410)
                     /locus_tag="HMPREF0733_RS00060"
                     /old_locus_tag="HMPREF0733_10012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_013397375.1"
                     /db_xref="GI:503162714"
                     /translation="MIERDDLGSWLNGAPSDQKYPGEIMGRPETGPGAIARPMRRLLG
                     FIIDWYLCLGLAFLLVGGQNVQIHGLMTLGIFLLYLIVLVGFMGHTLGHFLVGVQVQT
                     LDGRPAGWKRALIRAVLTMLVLPTVILDANSRGLHDRAAGTILVRIR"
     gene            15601..17025
                     /locus_tag="HMPREF0733_RS00065"
                     /old_locus_tag="HMPREF0733_10013"
     CDS             15601..17025
                     /locus_tag="HMPREF0733_RS00065"
                     /old_locus_tag="HMPREF0733_10013"
                     /EC_number="6.3.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_013397376.1"
                     /db_xref="GI:503162715"
                     /translation="MFTSPQEVLDFIKSDEIVFVDIRFTDMPGVQQHFNLPAKAIDED
                     FFVNGQLFDGSSIRGFQGIAESDMQLIPDVKSAYVDPFRLEKTLVIICSIVNPRTGEP
                     YHRDPRGVAERAEAYLQSTGVADTAFFASEAEFFVFEDVRYQVEPNSVFYKIDSDEAY
                     WNTGRKEEGGNLGNKTPIKGGYFPVSPVDKQADLRDAMCVAMDQVGLEVERSHHEVGS
                     PGQAEINYKFSTLTNAADDLLKFKYVIKNTADEWGKSVTFMPKPVFGDNGSGMHCHQS
                     LWLGGDPLFYDERGYANLSDIARWYIGGLIEHSSAVLAFTNPTVNSYKRLVPGYEAPV
                     NMVYSQGNRSAGIRIPITGANPKAKRLEFRAPDPSCNPYFAFSAQLMAGLDGIRNRIE
                     PPAPIDKDLYELPAEEAKDIKKAPANLEEALAALEADHDFLLEGGVFTEDLIHAWIDY
                     KRTNELEPLSLIPHPLEYQLYYGV"
     gene            complement(17232..17414)
                     /locus_tag="HMPREF0733_RS00070"
     CDS             complement(17232..17414)
                     /locus_tag="HMPREF0733_RS00070"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321509.1"
                     /db_xref="GI:752672800"
                     /translation="MPQCIVNMKAQPEYTNSGKVSMCMLAMSIIYDEAKVDKKTIRLS
                     QNYYKANKYACQRSES"
     gene            17639..18154
                     /locus_tag="HMPREF0733_RS00075"
                     /old_locus_tag="HMPREF0733_10014"
     CDS             17639..18154
                     /locus_tag="HMPREF0733_RS00075"
                     /old_locus_tag="HMPREF0733_10014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397377.1"
                     /db_xref="GI:503162716"
                     /translation="MSHVLSRRTVCLSAGLTAVATFVGCASSSLSSDEALYKNDQLLP
                     SAPGEPYTGSDEQPIRTQERMFMAMMDADAESLRSTLTEDATLTHITGQIQTRDEWVQ
                     SVADKTMSYSNIEVVSAHVERSDNGAQLVARTRTTANINGSNGTWNLQLVSQIHPDGA
                     HFTKTVASLWS"
     gene            18376..19242
                     /locus_tag="HMPREF0733_RS00080"
                     /old_locus_tag="HMPREF0733_10015"
     CDS             18376..19242
                     /locus_tag="HMPREF0733_RS00080"
                     /old_locus_tag="HMPREF0733_10015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose transporter GlcU"
                     /protein_id="WP_013397378.1"
                     /db_xref="GI:503162717"
                     /translation="MNILIGLIPALFWGILPLCVSKIGGKPTQQIMGTTMGVLLMGIA
                     TSLLFFPIRLDAWAFFLCFLSGASWAFGQMNQYRAFTQIGVSQTMPLSTGMQLVGTSL
                     MGVVAFGDWGTVQAKVIGAVALALIIIGIWMTTKQENPDPQSGGNMRTGIITLLFSTI
                     GYVGYSFFPNYVSVDGWYKFLPQSVGMVVAAITMSMLTRDGTRPWDKKSLQNIICGVI
                     FSGAALAYLVSIEPHRNGVASGFTLSQMNVIISTLGSILLLGEKKTRLELLYVLGGLA
                     LVVIGGVLIGTL"
     gene            19337..19840
                     /locus_tag="HMPREF0733_RS00085"
                     /old_locus_tag="HMPREF0733_10016"
     CDS             19337..19840
                     /locus_tag="HMPREF0733_RS00085"
                     /old_locus_tag="HMPREF0733_10016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_004004986.1"
                     /db_xref="GI:490103131"
                     /translation="MTNAGEPVSKFIAKHFDELTAHELQQIHIIRSLVFTVGQQSTDQ
                     EPDDADFECIHMVNEDDSGKVLAYLRLFDLEKVQDARHRYIPGAWTFGRVAVHPDARG
                     TGLGRKLLHAALEWIRNNTDAKEIVIAAQAYLKDTYYSPEGFVERGEHYMESGIEHVE
                     MVLDLQR"
     gene            19995..20480
                     /locus_tag="HMPREF0733_RS00090"
                     /old_locus_tag="HMPREF0733_10017"
     CDS             19995..20480
                     /locus_tag="HMPREF0733_RS00090"
                     /old_locus_tag="HMPREF0733_10017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_013397379.1"
                     /db_xref="GI:503162718"
                     /translation="MTSSPGFTAKLFDELTLHELQQIHITRTLVFAAGQKITEPEADE
                     TDFECVHFFSADDSGRVLAYLRMFDLEHVNDGNHRTIADAWTLGRVAVRQEVRRNGLG
                     RKLLHAAIDWIRTNTSARQIVISAQAYLRDTYYGAAGFVARGEPYQEAGIKHIEMVLD
                     L"
     gene            20571..21320
                     /locus_tag="HMPREF0733_RS00095"
                     /old_locus_tag="HMPREF0733_10018"
     CDS             20571..21320
                     /locus_tag="HMPREF0733_RS00095"
                     /old_locus_tag="HMPREF0733_10018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="decarboxylase"
                     /protein_id="WP_004004988.1"
                     /db_xref="GI:490103133"
                     /translation="MAYQPTQLNGETVFRNEVFQTGLMSQLLDGVYDGEMTIGELLSH
                     GNFGVGTFNGLDGEMVVLDGDCYQVRHDGSVSIPQLTDRTPYAVVTNFVPMIRRELPQ
                     NMLRTSTSQVLDNFTVSKNYMYAIKIYGEFEWVRTRTVVKQEKPYPKMVDATENEDIV
                     QFDNLTGTIVGFRTPIYEQGISVPGCHAHFIDDDRTHGGHVVDFKLKSANVEICPGTG
                     LQLHLPLTPEFSSANLSPEDLADQISKAEKH"
     gene            complement(21552..21980)
                     /locus_tag="HMPREF0733_RS00100"
                     /old_locus_tag="HMPREF0733_10019"
     CDS             complement(21552..21980)
                     /locus_tag="HMPREF0733_RS00100"
                     /old_locus_tag="HMPREF0733_10019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diadenosine tetraphosphate hydrolase"
                     /protein_id="WP_041321510.1"
                     /db_xref="GI:752672801"
                     /translation="MSSIFTKIIDGEIPGRFVWKDEKCVAFMDIQPASHGHLLVVPHE
                     EIDRWPELPVELAAHLFAVAHKISGALDRAFDKDRVALMIAGFDVPHTHIHLFPADSM
                     AEYDPANALANVTAEELDADAEAVRTALRDLGHGEFVPEA"
     gene            complement(21996..22655)
                     /locus_tag="HMPREF0733_RS00105"
                     /old_locus_tag="HMPREF0733_10020"
     CDS             complement(21996..22655)
                     /locus_tag="HMPREF0733_RS00105"
                     /old_locus_tag="HMPREF0733_10020"
                     /EC_number="3.5.2.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallo-beta-lactamase"
                     /protein_id="WP_013397382.1"
                     /db_xref="GI:503162721"
                     /translation="MELTKYTHSSVRIEHDGHVLVFDPGNFAPEGEHAQLLDGADYLL
                     ITHEHPDHFDADRVLPLIAEKQQLRIWAPQAVAEKILDTAPNAHVTVVSADSEFSVPG
                     FDVQTFGGQHALIHPLIPTIANIGYLINGVVYHPGDSLVVPHGVKAPHVLVPVHAPWS
                     KVQEVIDFVIAVGAQHAYPIHNGMINENGTGIIEGLITTFSNKYGTEYSHLNPGDTVK
                     F"
     gene            22850..23314
                     /locus_tag="HMPREF0733_RS00110"
                     /old_locus_tag="HMPREF0733_10021"
     CDS             22850..23314
                     /locus_tag="HMPREF0733_RS00110"
                     /old_locus_tag="HMPREF0733_10021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_037231042.1"
                     /db_xref="GI:739370025"
                     /translation="MDTHIPVRKIVKQAEARNTKQRRIIKATMAELGDFISAQDLHLT
                     LANRKEQVSLATTYRVLQSLANSGELDVVKGVEGESLYRHCQGDTHHHHLLCRRCGKA
                     VELEAPAIEDWALDMGKKYGFSELEHVVEVTGYCPECTLELRDEENRLTGRQ"
     gene            complement(23441..24391)
                     /locus_tag="HMPREF0733_RS00115"
                     /old_locus_tag="HMPREF0733_10022"
     CDS             complement(23441..24391)
                     /locus_tag="HMPREF0733_RS00115"
                     /old_locus_tag="HMPREF0733_10022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013397384.1"
                     /db_xref="GI:503162723"
                     /translation="MILSTVISPVLAASQQQNDLLSRIFVFDRYSELVQLLQNSILAG
                     AVLGIIGGFVGMFVMMRDHAFAVHGVSEMSFAGAALALLLGYDVITGSMIGSIISALL
                     IGMMGVKKSESNSVIGALMPFGLGLGILFLSLYQGRSANKFSLLTGQIVSVDGDQLNA
                     MIAGAIVIIAILTLVWRPLSFASLDPEVAQAKGVPMRTLSLVFMVVLGIAVALSVQVV
                     GSLLVLALLITPSAAALQVTASPLKALILSVIFAELAIVGGILLALAGSLPISPYVTS
                     VSFVIYLICRIIGGIRRRHSASGRIARQTQGDAHHHPASV"
     gene            complement(24388..25374)
                     /locus_tag="HMPREF0733_RS00120"
                     /old_locus_tag="HMPREF0733_10023"
     CDS             complement(24388..25374)
                     /locus_tag="HMPREF0733_RS00120"
                     /old_locus_tag="HMPREF0733_10023"
                     /EC_number="3.6.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013397385.1"
                     /db_xref="GI:503162724"
                     /translation="MKNTTPSGTPAIEIRGGNLAFGTRTLWNDLNLSIAQGEYFAVLG
                     PNGSGKSTFLKVALGLTAMNTGTISVLGKPARAGNPGVGYIPQQKAIDPSTPMRARDL
                     VGLGIDGHRWGIRLGGRKYRAKVNELLEAVGALEYANVPVGLLSGGEQQRLRIAQALA
                     NNPQMLLADEALLSLDLNHQYAVADLIHRFNRDQGGSVIFVTHEINPIIEHVDRVLYL
                     ANGRFTVGTVPEVMNSETLSDLYGTPINVLKSNGRYVVVGETHASDHCHVVGGEQNLH
                     GAHQDLREIAVETDHDASSGKPVKTASAAGALEDSSNTTKYHAEHKGGGTPQ"
     gene            complement(25375..26355)
                     /locus_tag="HMPREF0733_RS00125"
                     /old_locus_tag="HMPREF0733_10024"
     CDS             complement(25375..26355)
                     /locus_tag="HMPREF0733_RS00125"
                     /old_locus_tag="HMPREF0733_10024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013397386.1"
                     /db_xref="GI:503162725"
                     /translation="MKKLMSTITVLAGVSLMVSGCSTANSGSNGSSGNDGGKVKVVAT
                     TDVYADIVKQVGGDNVDVTPIIASTSTDPHSYEATAADRVKTKDAGLVVVNGGGYDQF
                     LEDMAGKDNSSQKVVNAVKLSGKLTDSEYDHLAEDHKDGHHDHEDGEEHKHAHEFNEH
                     LWYDFDTMKKVATEVAEDLAQLDSAHADSYRENAKKLGTELDTLDSSAKKIDGKGKKY
                     ISTEPVPDYLIASTGAENATPEEFAESIEAEKDVPALVLKETQDLVTEKQVSLVAYNE
                     QTETSQTKEVLQTAKDAGVAHVSFTETLPENTDYLSWMKTNVSNLEKALS"
     gene            complement(26502..27596)
                     /locus_tag="HMPREF0733_RS00130"
                     /old_locus_tag="HMPREF0733_10025"
     CDS             complement(26502..27596)
                     /locus_tag="HMPREF0733_RS00130"
                     /old_locus_tag="HMPREF0733_10025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397387.1"
                     /db_xref="GI:503162726"
                     /translation="MNDWIAIALLVILLIGNAFFVAGEFAIMSTRRAQIEPLADGGNK
                     RAKVVLYALERVSLMLATCQLGITICSLLILNVSEPALHHLLGTPLELLGLPHATVDI
                     LAFVVTLIVVTYLHVIFGEMVPKNAAVTLAARGIALWIVPTLVRVSHVFAPIVAFLNG
                     MSNMLLRWMRVDIKDEVASTFTLGELQSIVAQSTAEGTVEDDAGVIGGALEFSGKHVS
                     EIMVSRDNVHTLPFGCTPAEVEHAVARTGYSRFPVHDEAGIYMGYLHLKDALDVAPER
                     TDQPFPWYKLRSLTVLTPTTEIDDALATMQQNRSHLAQVVDTSGTLLGVVFMEDVIEE
                     LVGEIRDTTQDSKRRKASTSHSEGISQDEQ"
     gene            complement(27593..28945)
                     /locus_tag="HMPREF0733_RS00135"
                     /old_locus_tag="HMPREF0733_10026"
     CDS             complement(27593..28945)
                     /locus_tag="HMPREF0733_RS00135"
                     /old_locus_tag="HMPREF0733_10026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041321824.1"
                     /db_xref="GI:752673115"
                     /translation="MNFILLALGIALILGTGFFVAVEFSLVALETATVYQEREKGDTR
                     ANAVLQCLRTLSTQLSSCQIGITITTLLTGYTLDASINALTAGFISSWGLPRAVTSTL
                     TLVLAMGIATLLSMLLGELVPKGLAIAEPYRVARQVAPAQLIFTRIMKPVVVVMNGSA
                     NRILRLFGMEAQEELSAARSPEELSAMVRRSAEQGTLDSDTARFVDRTLSFAELTASE
                     VMTPRGRVTMLEDTAPVTEVIEQARATGHSRFPLYRGDHDNIVGVIHVKKAVGVPTDV
                     RETLEAGALADDVLQVPETLHVDALLTQLREGALQLAVVLDEYGGTSGIVTLEDLVEE
                     IVGEVSDEHDQGRTERPLRFGNGDWVFSGLRRPNEVNEFIPGVIAEHPSYETVGGFMM
                     EQLGRIPEQGDQVPISGGILRVDHVEGRRVDRIRFIPDSIGKGLVSQPAVLQNRRVRS
                     "
     gene            29311..33141
                     /gene="kgd"
                     /locus_tag="HMPREF0733_RS00140"
                     /old_locus_tag="HMPREF0733_10027"
     CDS             29311..33141
                     /gene="kgd"
                     /locus_tag="HMPREF0733_RS00140"
                     /old_locus_tag="HMPREF0733_10027"
                     /EC_number="1.2.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397389.1"
                     /note="kgd; produces succinic semialdehyde; part of
                     alternative pathway from alpha-ketoglutarate to succinate;
                     essential for normal growth; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoglutarate decarboxylase"
                     /protein_id="WP_013397389.1"
                     /db_xref="GI:503162728"
                     /translation="MCARLEEAHTKPTYTQRDDSPLEDAGRLCRISPDATDKFTVKEE
                     AFTVPNLPDHLVPEEFAGNEWFVEEQYERYQQDKNLVDPSWWPIFQSIDKALQGTPAV
                     SAPVTATQKAEATPSAPAAAASITTPAPQPAAPTKSTASPAPKTSSKAENVEPLEDKI
                     VPLRGPAKAVAANMEDSLTVPTATTVRAVPAKLLIENRSAINAYLARTRGGKISFTHI
                     IGYAVIRALAAMPSMNVTYGHDEKGKPIAIHNANVNFGLAIDLPRPDGSRNLVVPNIK
                     GAQTLSFLEFWQAYDDIVKRGRAGQLGLEDFQGTTVTLTNPGGIGTVHSVPRLSKGQA
                     AIIGVGALEYPAEFRGVAETMVAQHAISKVITLTSTYDHRVIQGAGSGEFLKIVESYL
                     LGAEGFYDEIFQAIQIPFEPVRWSQDNQVNPDTEVSKVARIQQLIHAYRVHGHLIART
                     NPVGYQLHSNPDLNVESYGLTLWDLDRVWPTGGFGDKEQLPLRTILARLREAYAGTLA
                     VEYMYMEDRKAREWFQEKLEHGYSKPSRERLMHVLEKLVEAEAFETFLQTKYLGQKRF
                     SLEGGESLIPLLDAIINKAADNNMHGVAIGMAHRGRLNVLTNIAGKSYAQIFREFSGT
                     AAPYEGGSGDVKYHLGTEGTFTSTSGKQTQVYLAANPSHLEAVNTVLEGIVRAKQDVL
                     NDQGIEGHPILPILIHGDAAFAAQGIVMETLQMANLRGYTTGGTVHIVVNNQIGFTTS
                     PKDGRTATNATDIARMTKAPVFHVNADDPEAVVRAGRLAFEYRERFGRDAVIDLLCYR
                     RRGHNEADDPSMTQPKMYQVIDNMPSTRTKYAEALVGRGDITQEEADEALSAYHSKLD
                     AIFSETQAAVPAPETPNVAGLELPASQQSTEIVHGGNTAISRDTFEHIAKAFGEVPEG
                     FTVHKKLKKLCEQRVEMGTNGKVNWGMGELLAFGSLLMEGTDVRMSGQDVQRGTFVQR
                     HAVLHDHLTDDEWSPLQHLSDHQGKLRIYNSLLSEYGVIGFEYGYSVERPDSMVVWEA
                     QFGDFANGAQTIIDEFVSSSEQKWGQRSSLVLLLPHGYEGQGPDHSSARIERYLQLCA
                     ENNMTVAVPSTPASYFHLLRRHAQHRPYKPLVVISPKQLLRLKAASSSIEDFTEGSFQ
                     PVIGDRSGVTPAQVERVVFVSGRLYYDLEAERAKRGDTKTAIVSVEQLYPLPEAEIKA
                     QLDLYSNATDIVWAQDEPANQGQWPFMALNLLPIIDYRMRLVSRPASASPAAGTGKRH
                     AAEAEALMKQVFEG"
     gene            33381..33977
                     /locus_tag="HMPREF0733_RS00145"
                     /old_locus_tag="HMPREF0733_10028"
     CDS             33381..33977
                     /locus_tag="HMPREF0733_RS00145"
                     /old_locus_tag="HMPREF0733_10028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipase"
                     /protein_id="WP_013397390.1"
                     /db_xref="GI:503162729"
                     /translation="MEQRNIRLVAVGDDLLAGVGDPRTLGWFGRVMARTPQTSASISA
                     YNLAAPNEGSEQLSTRWFDEARRRFLPGADNRLVIAPSTFDIDLGLTSARSRLNLANM
                     VDMASQNSIRVLVVGPPPTLDPERNRRIADLSAAYADVVTRRNHVYVDTFNPLLHHEQ
                     WRNDLAANDGRPGQSGYGLMAWLVLHRGWYSWLNLPEQ"
     gene            34453..35094
                     /locus_tag="HMPREF0733_RS00150"
                     /old_locus_tag="HMPREF0733_10029"
     CDS             34453..35094
                     /locus_tag="HMPREF0733_RS00150"
                     /old_locus_tag="HMPREF0733_10029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase"
                     /protein_id="WP_041321511.1"
                     /db_xref="GI:752672802"
                     /translation="MSESNAAEATATLTPRELRERFTADAMQYVDQLYAAALRMSRNP
                     ADAEDLVQETYTKAFASFHQYRQGTNLKAWLYRILTNTYINLYRKRQREPQQAHTESV
                     EDWQLAQAGAHDASGLRSAEMEALDALPDTEVRQALASLTEDFRMVVYYSDVEGFSYK
                     EIAEIMDIPLGTVMSRLHRGRRILREKLLDYARENGLRPSTIAKVEAKAAKKK"
     gene            35131..35421
                     /locus_tag="HMPREF0733_RS00155"
                     /old_locus_tag="HMPREF0733_10030"
     CDS             35131..35421
                     /locus_tag="HMPREF0733_RS00155"
                     /old_locus_tag="HMPREF0733_10030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma factor"
                     /protein_id="WP_004005003.1"
                     /db_xref="GI:490103148"
                     /translation="MEEQTPENSTALTEDCGGNPCSTTLKNLYEYLDGALTAEEIQEI
                     QRHLDACSHCTEAKDLEVLLRAKIKSSCDEQAPESLKARLLEHIDEFCSASA"
     gene            35596..37119
                     /locus_tag="HMPREF0733_RS00160"
                     /old_locus_tag="HMPREF0733_10031"
     CDS             35596..37119
                     /locus_tag="HMPREF0733_RS00160"
                     /old_locus_tag="HMPREF0733_10031"
                     /EC_number="2.5.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="WP_013397392.1"
                     /db_xref="GI:503162731"
                     /translation="MVEVYGREEERPQVQITGEFQRKHQTDYGRQRVIPMSELSTAQN
                     TTAHAWEAPTYRGAPGMSARMRIPGSKSLTNRYLLLAALADSPSRLRAPLHSRDSALM
                     ISALEALGAQFERIETGSEFGPDLLITPLNLASAPPMVKIDCGLAGTVMRFVPALAAL
                     LPGDYNFDGDPQARKRPMAALCDGLRQLGARIERSGNDSVDTLPFTLHSPGLAAASGT
                     PAEIFIDASASSQFVSALLLIAPRLPQGLTIHHRGNAVPSIPHIEMTLQTLRDLGVRA
                     EAVADEYAWRIFPGTISGFDITVEPDLSNAGPFLAAAMVTGNSVTIPGWPAPTADGSP
                     GTTQGGDEWRTILPRLGGAVEFSNGSLTVTGPEDITRLSGVEFNLQTAGELAPTVAAL
                     VALLDSPSTLTGIGHLRGHETDRLAALVTEINRLGGLAEETADGIHVLRPVRRLPQDS
                     PVTVQTYEDHRVATFAAVIGLHEPGVRIENVQTTAKTLPQFTALWQKMLSQWEGARS"
     gene            37098..38240
                     /locus_tag="HMPREF0733_RS00165"
                     /old_locus_tag="HMPREF0733_10032"
     CDS             37098..38240
                     /locus_tag="HMPREF0733_RS00165"
                     /old_locus_tag="HMPREF0733_10032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase EngC"
                     /protein_id="WP_013397393.1"
                     /db_xref="GI:503162732"
                     /translation="MGRSALVNPSRNRSFDEWDESDVRVRPNKKGSRPRTKERPRYKH
                     AIRGRVVTVDRGRWSVVVDEGTPQERTLIAARARELRRTPIVTGDFVDVVGDISGAKD
                     TLARIVRLGERSSVLRRSADDTDTTERVVVANANQLVIVVAAANPQPRTGFIDRAVVA
                     AYDAGIEPILCITKTDVSHPQQLLDYYSASGLKIVLSGSADGRAPSESGAEGLLHAPV
                     HKLLEELVGKVSVLLGHSGVGKSTLVNALTGADRATGHVNAVTGRGRHTSSSALALQP
                     VSTPELHVPPGTWIIDTPGIRSFGLAHVPPEQVVQAFPDLAPGEQDCPKGCHHAAQAV
                     DCGINTYVQAGKAGASGAARLDSLRKLLQVVPDEEADSDKELGTLV"
     gene            38309..39121
                     /locus_tag="HMPREF0733_RS00170"
                     /old_locus_tag="HMPREF0733_10033"
     CDS             38309..39121
                     /locus_tag="HMPREF0733_RS00170"
                     /old_locus_tag="HMPREF0733_10033"
                     /EC_number="3.1.3.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphatase"
                     /protein_id="WP_013397394.1"
                     /db_xref="GI:503162733"
                     /translation="MNFTTSYTDDLRLAHILADNVDRVSMSRFKDRSFTVEHKSDGTP
                     VTEVDREVEELLRAQLSRVRTRDGIIGEELGSTGTAARQWVIDPIDGTQNFVRGVPVW
                     ATLIALLDQGEPVMGLISAPALQRRWWAAQGTGAYAGKSLTQATRLQVSSVPTVSGAS
                     LSYAEFKGWEGLELEQNFLSLVHAVNRSRAYGDFWSYCLVAEGAVDIACEAQVALHDI
                     AALVPLVHEAGGTFTTAAGDDAVATAQAEGTASTLATNGTLHRSVISQLAPE"
     gene            complement(39261..39932)
                     /locus_tag="HMPREF0733_RS00175"
                     /old_locus_tag="HMPREF0733_10034"
     CDS             complement(39261..39932)
                     /locus_tag="HMPREF0733_RS00175"
                     /old_locus_tag="HMPREF0733_10034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397395.1"
                     /db_xref="GI:503162734"
                     /translation="MEKKMTENPRQDPMPDSNTPQASYPQAEAPTLQEGHDMQNSAAS
                     DAPLAAYASATDGASHPQAQQAVPPVGNVAAAYDFGYRRAPRQYEVPPEDRRPYGEPT
                     GEIRGPGYFYSIGSFAASLCGLVLTGFSGFQVLGIAILHDDYDSMGYGAYEFTTISNT
                     MLLALVPIVISIWLGIFSFTVNKGCITPMTGRMRAFASLGIVMGALGALGIVGNFFLY
                     LLAIS"
     gene            complement(40133..40505)
                     /locus_tag="HMPREF0733_RS10670"
     tmRNA           complement(40133..40505)
                     /locus_tag="HMPREF0733_RS10670"
     gene            complement(40743..41978)
                     /locus_tag="HMPREF0733_RS00180"
                     /old_locus_tag="HMPREF0733_10035"
     CDS             complement(40743..41978)
                     /locus_tag="HMPREF0733_RS00180"
                     /old_locus_tag="HMPREF0733_10035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397396.1"
                     /db_xref="GI:503162735"
                     /translation="MSENLYGQNKPQGQSQQPGQDQNSQNQDSQAQQQYQGQVPQSNS
                     SQQGNYQGNGAQNSYQQQYPQQPQQGSGNQHLFYGGQAQNQQPTPSAGQPSYNTQYSS
                     SSNMVSGQQQHSAPQHSSQTGQNASGQGYASQQSYNSAQGYNQYQPTQESRNYSQQGN
                     SGQQNSNSAQNYQNSAGYQNAQQQGSPQQNSYGQSSAQTQQSGSSVYNGNSSYAQPQQ
                     QAPYGTSGSQPAQQNAQQGYGQQNSYSQTSGYQNQAVNSGYTSQNQNYYGAQNQQGQY
                     GQPAYGSSQFDANAQNAGGPSQAAPVMAIISLVLGVLAIVSGWFIVGGLLGIGAIVLG
                     ALGLRQSRQLGKGKGMSIAGIITGGVGIIVAIIATILFVLGQQTLQECQKVGTPDGNG
                     NKVCQVGDNPDSRMTVPAQ"
     gene            complement(42207..42683)
                     /locus_tag="HMPREF0733_RS00185"
                     /old_locus_tag="HMPREF0733_10036"
     CDS             complement(42207..42683)
                     /locus_tag="HMPREF0733_RS00185"
                     /old_locus_tag="HMPREF0733_10036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397397.1"
                     /db_xref="GI:503162736"
                     /translation="MSENTPGRSEGQPEQPKFVPAAPPVAPAGNAYAGYVPTKLPAGL
                     AIASLVLGIVSIVGAIPLSFVTIVVALVGLILGIIALRKVSKGTGGGKGMAIGGVVTS
                     AIGFILSAVVLIFVIITLMMVQDCKNTGVQNSDGSVTCSINGQQMTVRTDGTTSIR"
     gene            complement(42892..43386)
                     /locus_tag="HMPREF0733_RS00190"
                     /old_locus_tag="HMPREF0733_10037"
     CDS             complement(42892..43386)
                     /locus_tag="HMPREF0733_RS00190"
                     /old_locus_tag="HMPREF0733_10037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_013397398.1"
                     /db_xref="GI:503162737"
                     /translation="MAQKKKKGSKTDPNNSIIAQNKKARHNYNIVDTYEAGMVLLGTE
                     VKSLRDGGASITDGFCHVKDHELWLEGIHIAEYGYGTWTNHSARRSRKLLLHRSEINR
                     LEQKLKETGYTVVPLKLYFSGGRVKVEIALATGKREYDKRQALRERQDNLEAARAMRY
                     RNLG"
     gene            complement(43401..44528)
                     /gene="prfB"
                     /locus_tag="HMPREF0733_RS00195"
                     /old_locus_tag="HMPREF0733_10038"
     CDS             complement(43401..44528)
                     /gene="prfB"
                     /locus_tag="HMPREF0733_RS00195"
                     /old_locus_tag="HMPREF0733_10038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397399.1"
                     /note="recognizes the termination signals UGA and UAA
                     during protein translation a specificity which is
                     dependent on amino acid residues residing in loops of the
                     L-shaped tRNA-like molecule of RF2; in some organisms
                     control of PrfB protein levels is maintained through a +1
                     ribosomal frameshifting mechanism; this protein is similar
                     to release factor 1; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 2"
                     /protein_id="WP_013397399.1"
                     /db_xref="GI:503162738"
                     /translation="MASFDFSAEIKDLRSIYASIVAVSDLEGIKCALEDLSQQASAPE
                     LWDDPEHAQRVTSALSHKQAELNRLTNLASRIDDVEVMVELAQTEDESSAEDLLAEAE
                     AECKELRKKLDELEVLVLLSGEYDQREAVVTIRSGAGGVDAADFAEMLLRMYLRWAEK
                     NGYPTKVLDTSYAEEAGLKSVTFEVNAPYAFGRLSVEAGTHRLVRISPFDNQGRRQTS
                     FAAVEVIPLIEQTDALEIPESEIKVDVFRSSGPGGQSVNTTDSAVRMTHIPTGIVVSM
                     QNEKSQIQNRAAALRVLQSRLLMLRQEQEDAKKKELAGDIKASWGDQMRSYVLHPYQM
                     VKDLRTGYEEGNTSSVLDGGLNRFIEEGIRWRASGRRVNEG"
     gene            complement(44597..45067)
                     /locus_tag="HMPREF0733_RS00200"
                     /old_locus_tag="HMPREF0733_10039"
     CDS             complement(44597..45067)
                     /locus_tag="HMPREF0733_RS00200"
                     /old_locus_tag="HMPREF0733_10039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397400.1"
                     /db_xref="GI:503162739"
                     /translation="MVVSYIHAVRSRDGDNDEGSISPLIVGMCALILLIASVTLAVTG
                     AHVQTHRLEDLADAQAISIARTIEHGFSEYSDKSADNARARQLAAKYLEESGASHEFV
                     NLQVDSVQISDDRTVHVTLRARIHPPIVSAVVPDGFEVKAQARARIHQKQKDEK"
     gene            complement(45078..45596)
                     /locus_tag="HMPREF0733_RS00205"
                     /old_locus_tag="HMPREF0733_10040"
     CDS             complement(45078..45596)
                     /locus_tag="HMPREF0733_RS00205"
                     /old_locus_tag="HMPREF0733_10040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein TadE"
                     /protein_id="WP_013397401.1"
                     /db_xref="GI:503162740"
                     /translation="MLRIFSLRNLALRLRARTEDSENTDHEHERGSAIVEFLGLGVTL
                     LLPIMYGVLTIFSVQASILGAHAASAQVAQYIQELPPETSMSQEQAQRLSALVARDFG
                     VAESDISVSLSCSGSCSARESIRVQVQVNAHLPLIPQGLGASVIPVSSQSVTWGQTEI
                     GSAASSASRETP"
     gene            complement(45574..45984)
                     /locus_tag="HMPREF0733_RS00210"
                     /old_locus_tag="HMPREF0733_10041"
     CDS             complement(45574..45984)
                     /locus_tag="HMPREF0733_RS00210"
                     /old_locus_tag="HMPREF0733_10041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein TadE"
                     /protein_id="WP_041321512.1"
                     /db_xref="GI:752672803"
                     /translation="MSRHQKQELAAPPSERGDASTEFVMVSALLVLLTVAILQVSYAF
                     YTRNILLDAASAGARYGTLYDRTPEEGRERAEQIIRGNLPESYAQDVHTSVYVDPSGI
                     RILEVHITAPLPVLGPWGFPGSISVSGHAAYIQS"
     gene            complement(45989..46207)
                     /locus_tag="HMPREF0733_RS00215"
                     /old_locus_tag="HMPREF0733_10042"
     CDS             complement(45989..46207)
                     /locus_tag="HMPREF0733_RS00215"
                     /old_locus_tag="HMPREF0733_10042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397403.1"
                     /db_xref="GI:503162742"
                     /translation="MFTQLRMLFLSVPGIAFLLASYRGMHDDPERGDVPGWVMITMMS
                     AILVAAILAIAQPALIKMFNDAIALIRP"
     gene            complement(46269..47201)
                     /locus_tag="HMPREF0733_RS00220"
                     /old_locus_tag="HMPREF0733_10043"
     CDS             complement(46269..47201)
                     /locus_tag="HMPREF0733_RS00220"
                     /old_locus_tag="HMPREF0733_10043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion system protein"
                     /protein_id="WP_013397404.1"
                     /db_xref="GI:503162743"
                     /translation="MNFAIIFGLFFAFGVMLIASSLRKRRGPNFGERIAPQMRSVSIR
                     ESLHRENQVSGTSVLDALYSFLEPMMQSFLGRVRSTESRDEALAARLRRAGSDQTVSA
                     FRAEQILWAVSSVALLGVLSVIGLLENQLSLWSGLMLIILGGVTGFLARDWWLGQIIV
                     RREKQLIAEFPALAEMMALSVAAGESALASLERICRTSRGELAREFNDILAQTRAGSS
                     LLAALNEFAQSTQIPALSRFVDGVAVAIERGTPLADVLRAQAQDVRDNAKRELLEVAG
                     KKEIAMLAPVVFLILPLTVVFAIFPGLSLMKLAF"
     gene            complement(47198..48052)
                     /locus_tag="HMPREF0733_RS00225"
                     /old_locus_tag="HMPREF0733_10044"
     CDS             complement(47198..48052)
                     /locus_tag="HMPREF0733_RS00225"
                     /old_locus_tag="HMPREF0733_10044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein F"
                     /protein_id="WP_013397405.1"
                     /db_xref="GI:503162744"
                     /translation="MGVIYGLAMGIGVFLVWWSCWSMPQGAVKTEREPKIAVTLRKAG
                     MHTITPSAFTGVSILSGVLAGVLLFALTGLWSFAFLGTGSGFIMPRVVVNHRAKVREG
                     KLWQLWPDAVDHLRSAIRAGLSLPEALIQLSYRGPYELREAFARFGSDYRATGDFVAS
                     LNRLKEYVADPVADNIVEALKIAREVGGSDLGRLLGTLSNFLRENARTRAELQARQSW
                     TVNAARLACVAPWVVLMLMATQPAVRNIYNSFAGFVLMFAGAGLSVIAYRIMLRIGAL
                     PQERRVFA"
     gene            complement(48052..49314)
                     /locus_tag="HMPREF0733_RS00230"
                     /old_locus_tag="HMPREF0733_10045"
     CDS             complement(48052..49314)
                     /locus_tag="HMPREF0733_RS00230"
                     /old_locus_tag="HMPREF0733_10045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein CpaF"
                     /protein_id="WP_013397406.1"
                     /db_xref="GI:503162745"
                     /translation="METPRSAVVPDYYSLLDAEIRDAIRDGDLDPYTSQDAVEGLIRS
                     TVSAYERRMVRASLPPLENVEEIIHRLRNDLCGYGPLQPYLDDEEVEEIWINSPDEIF
                     VARAGESELTGLHLSDEAIQQLLERMLKPSGRRVDLSSPFVDASLPDGSRLHAVIPDI
                     TRAHTSLNIRKFVVRAKRLPDLVKLGSLSAGAASFLHAAVESGVNILVSGATQAGKTT
                     MLNCLAASIPPRERVVTCEEIFELSIPLRDVVGMQCRQPNLEGKGAIALRRLVKEALR
                     MRPDRLLIGEVREAESLDMLIALNAGLPGMCTIHANSARDAVTKICTLPLLAGDNISS
                     AFVVPTVASCFDLVIHCGRDTHGHRQVEEIYMLGGRVEDGVIEMSPLFTRQQGEMVCV
                     ALEIPTPEKWVRAGHRPEQVLAAAKAGR"
     gene            complement(49580..50347)
                     /locus_tag="HMPREF0733_RS00235"
                     /old_locus_tag="HMPREF0733_10046"
     CDS             complement(49580..50347)
                     /locus_tag="HMPREF0733_RS00235"
                     /old_locus_tag="HMPREF0733_10046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_004005021.1"
                     /db_xref="GI:490103166"
                     /translation="MKIEKIDLPEIDPNAPVVIQVDELVKSFVLRHTRSMKEAFVWLM
                     KGRKGDLSEKFNALNGITLNVKQGERVALLGLNGSGKSTLLKLISGVMQPEGGQVLNR
                     GKIAGLIEVGAGFHPDLTGRDNVFLNGAILGMTKKEIEDAFDDIVAFSEIEEFIDTEV
                     KFYSSGMYLRLAFSVAVHTNPDIFLVDEILAVGDEPFQKKCIARIQELIQAGKTLVVV
                     SHDLDLVSQICDRGVVLDHGNLSFDGDIKDAVKMIRG"
     gene            complement(50353..51231)
                     /locus_tag="HMPREF0733_RS00240"
                     /old_locus_tag="HMPREF0733_10047"
     CDS             complement(50353..51231)
                     /locus_tag="HMPREF0733_RS00240"
                     /old_locus_tag="HMPREF0733_10047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_013397407.1"
                     /db_xref="GI:503162746"
                     /translation="MSTLHDEPLKAPGRGRGILDAIRNRYLLRLLVDKEIQVRYRGSV
                     LGILWSYIKPGVQFGVFYVAMGLFLGLERGMHNYAIYLFSGMIVINFFSEGFGNGART
                     MVVNSALIRKIYLPRELFSLSTVWVAVVHFIPQIVVMLIACFFAGWRPGLRNIAAILA
                     GMAIVMLLSYGLGLIFGVANVFFRDSENIVDMLLMVATWFSPVLYSWTMVRDTLYPWV
                     FNVFMLNPLTVAVELFHYGFWRPTADLEKSGHFAEIVPHLFSFWTPVGIGISLLTVLI
                     GDLLFRKFEGNFAQEL"
     gene            complement(51228..53237)
                     /locus_tag="HMPREF0733_RS00245"
                     /old_locus_tag="HMPREF0733_10048"
     CDS             complement(51228..53237)
                     /locus_tag="HMPREF0733_RS00245"
                     /old_locus_tag="HMPREF0733_10048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_013397408.1"
                     /db_xref="GI:503162747"
                     /translation="MAETQTLKTLQRVIFPSAVETDVVPLYVDAGVAAGVQLPTRIDG
                     DATTSITEAAQVQEQSAANIAANRTAAEGLIGRRSINVNPGQSLSFGTYFNAFPASYW
                     RRWTDLKEVVLSVQTRGEGMVIVYKSNGRGVIQRVDAKLLSGDETSIFTLPLAPFGDG
                     GWYWFDLSGTEDLELVEANWLGDIEPRADVQAGQATVQITTMNKVDYCIDNIRTLGNS
                     PEIFDAVHEFLIVDQGSSKVQDHEEFEEVVKPLAGKFRIINQGNLGGSGGFSRGMFEA
                     VKNGSDYVLLLDDDVIVEPEAILRMVTFANYCKDPTIVGAHMFDMFDRSVLHAFGEVV
                     DPWRNFYAKPHEDMAMGHDLGRSNLRSTHWLHRRVDVDYNGWWMCLIPTSVIRKIGLS
                     LPLFLKWDDAEYGLRAKAAGIPTVSFPGAGVWHVSWTDKDDSVGWQAYYHERNRLITA
                     LLHSPFDKGGRVLVDSMFLDVKHTLSMQYYTQAGRLMALEDLLAGPEHLHESLSARLP
                     VIRQLAGEYPESQMKPNVDDFPTVKSKKPPFRGRRNFKSPGYKKLVPWTARTVARQLF
                     KPVDDEAKEHPQIQLNYGETNWWTLSKFDSALATNAEGTGLFWYRRDPQQLRSKLIHA
                     TRLHAKIIKDWEQLRKRYQDAAADVASYDAWAETFAKHTESELKR"
     gene            complement(53240..54427)
                     /locus_tag="HMPREF0733_RS00250"
                     /old_locus_tag="HMPREF0733_10049"
     CDS             complement(53240..54427)
                     /locus_tag="HMPREF0733_RS00250"
                     /old_locus_tag="HMPREF0733_10049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-galactopyranose mutase"
                     /protein_id="WP_004005025.1"
                     /db_xref="GI:490103170"
                     /translation="MTADLVVVGSGLFGLTIAEQAATELGLKVVLLDRRSHIGGNAYS
                     ENEEQTGIEVHRYGAHLFHTSNERVWEYVNRFTGFTNYVHRVYTRHNGIVYPMPINLG
                     TINQFFNAAYSPAEAKALIAEQAGELAGTDPQNLNDKGISLIGRPLYEAFIKHYTAKQ
                     WQTPPEELPASIISRLPVRYTYDNRYFNDKYEGLPVDGYAAWLERMAAHPNIEVRLNT
                     DFFSDDHEYSREKVLGQIPVVYTGPVDRYFDYAEGDLSWRTIDLEEEVLPIEDFQGCS
                     VMNYPDADVPFTRIHEFRHFHPERDYTKDATVIMREYSRFANKGDEPYYPVNTSVDRE
                     KLLKYRDLAKGEQNVLFGGRLGTYKYLDMHMAIGAALSMFDNKIRPHFAQGAKIESGG
                     VDA"
     gene            54931..58200
                     /locus_tag="HMPREF0733_RS00255"
     CDS             54931..58200
                     /locus_tag="HMPREF0733_RS00255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012903222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321513.1"
                     /db_xref="GI:752672804"
                     /translation="MKLRLFHTPDIADVSAQERLTDHDFYPSLLSLECSEQTSGAQVQ
                     HIISPSKNVYSVFSPSGDSTRLEDCVAAAAPLIHGAWIKPEQPSDERPASVSTLCVLR
                     GPDAGRSFSLPRGLTVLGRSETRSGISLNDPYIKPRHAEFDASGSGVTLRVLEPEGTA
                     QRTGSHARPKPQILQWNKPFMVGTSLCVICPPGKAPELLTPSHDSSPFTPVIVNPPAP
                     RKLGMMLMTILLPLVAGVAFALFTGMWIFLLMSVASSLFMLMHFFGGRAENRGAAALV
                     KSSAKQELERAQALPTAGTLLHAAAPDAARSPAVVLGYGPRLPYISGRNVRFEKISPH
                     PQAPHYIPIPVPGLPHDVLLRAEHLHAYLVQLVAHARDTITVITDAEHAETPLYGALR
                     SLGVCPRVFLHEGASQAHHILEKICDAAERPGTALSTSQEAGDDRLFIISASLVRSIP
                     AALIKRAAQGARLCIVHMPIARGTIDSPRSASVFTHIPHLQVHTHGDYLESVQYLLRG
                     NITDDTAHKITGSSQHAGLTPHEGIVQNHPLDLHDICATADGLSTDTYIRTLGALSAV
                     QASSPPGSGHGTGSVHARTLAFSELTQQSTNLLYEQCLQRWEHNRYAEDIRCLLGATT
                     EGFCDIGFTTHGPHWLLGGTTGAGKSQLLRSLILSAALRYSPERLGLILVDFKGSAGL
                     GPLAELPHTLSLLSDFDVAAVRRALEFLRADVNRRELDLRNLGVNSYHDYLRLCASTG
                     KTPQYPEVVIVVDEFRMLVESMPDAMTELMRIATIGRSLGIHLLLATQRPQGSISQDI
                     RANIATNICLRVASAQDSYNLLGHEKAAHISASSPGAGYVSLPDGRILAFRAPLVDAL
                     PQQHADFQQIYRWESPGWVPLNEIPSVQQVPAEGEDKLLTRAVHSIRDLYLSSHKSPA
                     FVDHSEQNSSSVAYTRARYTPIPQALPENFPLTRTLLDTDLHQILGSDGARRRGYLLG
                     TVEIPQYGKRQPIRLDLEAHPGALAVLGTVSERTAITNALIAQAIERQNPVYVFTSDA
                     GYHRRLHSYADSLAVLVGPHEPQHLRFCLEKYVRVIMLTRALSSLCSSVTELMDGLKC
                     S"
     gene            58197..59216
                     /locus_tag="HMPREF0733_RS00260"
                     /old_locus_tag="HMPREF0733_10052"
     CDS             58197..59216
                     /locus_tag="HMPREF0733_RS00260"
                     /old_locus_tag="HMPREF0733_10052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012903222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321514.1"
                     /db_xref="GI:752672805"
                     /translation="MRDPQTESYLYDVLAQSYREGYQVVFTSALPLRGRFNSVAYSTL
                     LSRRFVESDLLRKSSKSYPLPNATHFAIEGGLNTALVGDVPLEASTLCPVVTSCENII
                     ELQSGNSNFSCDKSLSLRQFPQTFPMPQLETIVMWHRGYNAQGTHILCGYSRTGDPSF
                     LQAKEGVFIPVVGSRASGKTHFLSALRMLNPHLGALYINGNTPPDAQKIRQMCKSVQD
                     PEKTLILIDDLAYIPTAAQQVLLELGPRFRAVWVAYTPWARWHSSPILTALSGCSRAV
                     LLAPASISDGDICSLHEIPRDMYTEGMLPAGRGALVDAGRVQAFQVPDEVYQSAHNAV
                     QAYQE"
     gene            complement(59219..59695)
                     /locus_tag="HMPREF0733_RS00265"
                     /old_locus_tag="HMPREF0733_10053"
     CDS             complement(59219..59695)
                     /locus_tag="HMPREF0733_RS00265"
                     /old_locus_tag="HMPREF0733_10053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397412.1"
                     /db_xref="GI:503162751"
                     /translation="MGKTTNTMKARITVPITVKITSGILGFFAVVLVYRGIIAPFIMN
                     DSERNADRIVNSLIQVALGVGIMFCAVRFYQGHARVWVMLISLCAAFVGASNLSIYFS
                     LTPEVQAAAVTFLVINCVEILLAGTAFALLFTRATREYTLKVTEEEERELSRYAGR"
     gene            60107..60355
                     /locus_tag="HMPREF0733_RS00270"
                     /old_locus_tag="HMPREF0733_10054"
     CDS             60107..60355
                     /locus_tag="HMPREF0733_RS00270"
                     /old_locus_tag="HMPREF0733_10054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002854852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WhiB family transcriptional regulator"
                     /protein_id="WP_004005030.1"
                     /db_xref="GI:490103175"
                     /translation="MDWRSRAACLDKDPELFFPVGNTGPALLQIEEAKTVCRSCEVID
                     VCLKWAIETGQDSGVWGGTSEDERRAMKRRAARARRAS"
     gene            complement(60461..62026)
                     /locus_tag="HMPREF0733_RS00275"
                     /old_locus_tag="HMPREF0733_10055"
     CDS             complement(60461..62026)
                     /locus_tag="HMPREF0733_RS00275"
                     /old_locus_tag="HMPREF0733_10055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013397413.1"
                     /db_xref="GI:503162752"
                     /translation="MSFTESNLSPGGFGPGDTEWIHLIIGEWQIIADIAQSDLVVWFP
                     TDYVVADGSGPDSVSGPSASSGFSAIAHVRPSNVHTLFHHDIVDHTMDDNICDEARKS
                     WHTQKIVHHVMEAGPSMRPGVKVTFVPIVRNSRTIALLSMHTIPTVVRASSQAEEIYN
                     WVTENMLEMIHLGIWPDPLAQENNTRGNPRAIDGIIVINPQGQVVLASPNANSMYARL
                     GLGDHLENLNLADVTRDMLPSGEEADETLQLVLAGRADIRTELTIGRTRVTMRSIPLV
                     HSTTFRLERRGALILCRDVTELRRRELELMTKDATIREIHHRVKNNLQTVSALLRLQS
                     RRMTTPEAKQGLEQAMRRVATIATVHEALSQGLTQSVDFDELIERQFHIAAELASPGQ
                     TVDTELLGHFGLLPSQFATPLALVINEVVANAVEHGLNGETGRVTLEGRRNINEQGDN
                     TLTVIITDNGRGMGDDPIEESGADAYRPTAEHEGLGMQIVRTLVASELNGSIRWEANE
                     PSGTRVIINAVLS"
     gene            complement(62180..63736)
                     /locus_tag="HMPREF0733_RS00280"
                     /old_locus_tag="HMPREF0733_10056"
     CDS             complement(62180..63736)
                     /locus_tag="HMPREF0733_RS00280"
                     /old_locus_tag="HMPREF0733_10056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator"
                     /protein_id="WP_013397414.1"
                     /db_xref="GI:503162753"
                     /translation="MIHNIPLVLLGDDGTILNAIESQRGRVSVARSAHTFADALGYAH
                     AGIACAILSVGLPQEATVSILHELDEADVKFIALVPEDTPLPDLVMPLATDTEPHQLP
                     AVVEKLLDEASAEPEQELGITPQKAENGYGYDSGYSGHYGYDTQNLYNGSGEYLHPDT
                     SGYGYALVNPNRSQTEQSSMDFPLSCPSQEQLKASQLQEGYEASAHFESNMQQPTLNE
                     RRDSPRQYYPQFSAPQIDDTVEAGNRGTIVAVWGTGGAPGRSTLALNLANCAAAEGMR
                     VCLVDADTYNPSLSPLLGLLDDYSGIAQLCHFIERGQLDTQISDEAISTLRVGKYYLD
                     FLSGITRPDRWPELRTRALRDSIKWLAHRYDVIILDTAACLESDAELGFAQAGPRRNG
                     AAITALEMADHIVLLGNADIIGIPRTIRAYDQMHEGACTLRDTAKVHIWLNKVRAEAT
                     GRDAERELANTWQRFGPRNPISGFLPYDRKTVDRAWFRGQTLLEYAPRSPLIVGIRKL
                     YTSLGLRKLR"
     gene            complement(63737..64393)
                     /locus_tag="HMPREF0733_RS00285"
                     /old_locus_tag="HMPREF0733_10057"
     CDS             complement(63737..64393)
                     /locus_tag="HMPREF0733_RS00285"
                     /old_locus_tag="HMPREF0733_10057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlgA"
                     /protein_id="WP_013397415.1"
                     /db_xref="GI:503162754"
                     /translation="MRMHKPGFKDPKLIVGLILILISIAGVIGIIRINNQTYTYYTAK
                     NDISIGQKITPDMLIEKQVNLGDSKDRYLSREQLESGKYIAVRQIPAGELISSASANE
                     NIQERRRLVTVTLDRGIASTFKAGERVDIWVISSGKEKQKVPEGEGKNEDIESEQKPL
                     VQNAEISTIAVDEGVLGANGHANVQLWIESEKLPDILHAMSSETKVTLVPIEYKSEGN
                     "
     gene            64785..65015
                     /locus_tag="HMPREF0733_RS00290"
                     /old_locus_tag="HMPREF0733_10058"
     CDS             64785..65015
                     /locus_tag="HMPREF0733_RS00290"
                     /old_locus_tag="HMPREF0733_10058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_004005036.1"
                     /db_xref="GI:490103181"
                     /translation="MSAPRFLTLSDVAEELQVSLSQVRALVRSGELPAIQIGGRNQWR
                     IERTRFEEYINERHEQTLEAIASGKMTKIKAN"
     gene            complement(65012..65587)
                     /locus_tag="HMPREF0733_RS00295"
                     /old_locus_tag="HMPREF0733_10059"
     CDS             complement(65012..65587)
                     /locus_tag="HMPREF0733_RS00295"
                     /old_locus_tag="HMPREF0733_10059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397416.1"
                     /db_xref="GI:503162755"
                     /translation="MRMQRLFRDLDIQFEAEQLRALENQAQRRARMEYMAVTMRERCA
                     AQHGSRVKVNGTDGMVREGYLEAIGQGWIQISTGRENILIPESSILWWESESQAAEVK
                     VDVQARAYRFSMSDACYALMMAQEPVRLSCASPVNTMFEGVIARVGADFIEMALAPCE
                     PYSAYSNALAYKERGVRIIPTSRICAIVTVN"
     gene            65780..66814
                     /locus_tag="HMPREF0733_RS00300"
                     /old_locus_tag="HMPREF0733_10060"
     CDS             65780..66814
                     /locus_tag="HMPREF0733_RS00300"
                     /old_locus_tag="HMPREF0733_10060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397417.1"
                     /db_xref="GI:503162756"
                     /translation="MKSQAQMSVLDGVLSIGVPTLSVLSGALAHSVRVISVSLTGLEN
                     AMMMSVEVLSAAVMLWWALGVILGVGYLLKVRAGSIHLHHREDRGTFLLPRYIRNTIL
                     TLGGAALGLSAAFAPAQAADAHPNISSPAISAPSQLSASPAAHSASSSEASVENSTPS
                     TEANASPQESAAGTPQGVPSQNSPFYQAAASSPQVTGAASASPHEYSESPAVPVKKHQ
                     QQRPSLSPYAQPYGTPPPYISAEPAVPSTTQPQAEHQSLSPFFGGQREGAPSREVAPA
                     SRNHTTRSSHQVVVGDSLWSIACHELSDDASPPEILEYSLRIHAANLDVMGDNPNILY
                     PGQTLTLPDR"
     gene            66872..67501
                     /locus_tag="HMPREF0733_RS00305"
                     /old_locus_tag="HMPREF0733_10061"
     CDS             66872..67501
                     /locus_tag="HMPREF0733_RS00305"
                     /old_locus_tag="HMPREF0733_10061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397418.1"
                     /db_xref="GI:503162757"
                     /translation="MTAINISLHDLSKKIESHLLEEAAARAQQGDIPDVPPSTAPGNL
                     VQSQYGVVLSPINMYAQDQQNRESHHMLPQNTAVRARIRSRKSASHGRPLKRSDSGTL
                     RIESLCAGIGLAVLEVLMKKRSAQQFKHWLSPECFTALEQRRSSQEQHASYLAFTKTP
                     HVARSRAQRLNDETYEACIILTDGVVTRAMAMRVQARYGGWYITALHFI"
     gene            complement(67576..70185)
                     /locus_tag="HMPREF0733_RS00310"
                     /old_locus_tag="HMPREF0733_10062"
     CDS             complement(67576..70185)
                     /locus_tag="HMPREF0733_RS00310"
                     /old_locus_tag="HMPREF0733_10062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="WP_013397419.1"
                     /db_xref="GI:503162758"
                     /translation="MASFLEKILRTGDKKILRQLEAYSAAVDSLEDSFASMTDAELRG
                     ETDKFRARIEDGESLDIMLPEAFAVVREASKRTLGKRHYKVQVMGGAALHLGNIAEMK
                     TGEGKTLVATLPAYLNALSGKGVHVVTVNDYLAEYQANLMGRVYRFLGMESGVILSSM
                     DPDQRRKQYEADITYGTNNEFGFDYLRDNMAWTVDEQVQRGHNFAIIDEVDSILIDEA
                     RTPLIISGPAAGEANRWYGEFARIAKNVLKEDEDYEVDEKKRTVGILESGIDKVEDHL
                     GIKNLYESRNTPLIGFLNNSIKAKELFTNNKDYVVIDGEVLIVDEHTGRILPGRRYND
                     GIHQAIEAKEGVEIKPENQTMATVTLQNYFRMYDKLSGMTGTAETEASEFMSTYELGV
                     VAIPTNKDVQRIDNPDKVYRNEVAKFKAVVKDIKKRHEKGQPILVGTTSVEKSEYLSR
                     QLAKEGVRHEVLNAKNNEREAHIVAQAGRKGAVTVATNMAGRGTDIMLGGNPEFEAVA
                     KMAELGLDPNRDSEAYEKRWPDILEQCEEEAAAEHDEVTELGGLYVLGTERHESRRID
                     NQLRGRSGRQGDPGESRFYLSLTDELMRLFNTGAATRLMAMAPEDSSLDSKLVTRAIA
                     TAQSNVESRNAEQRKNVLKYDDVLNRQREAIYKDRSLILHGDDLKEQISGFVDEVLTT
                     AIDERVSEGHAEDWDLDDLWEALESIYPVSITADDLAEDAGDRTQITRDQIVKEILAD
                     AHLVYDEREESVGEDSMREIERRVMLSTIGERWPEHLYEMDYLKEGIGLRAMAQRDPL
                     VEYQREGYSMYQAMLDAIREETVSYLFNLDLSKQRTKASAVQLQSPSRPKFLQYSAPN
                     EEGGTDVRVENAD"
     gene            complement(70438..71073)
                     /locus_tag="HMPREF0733_RS00315"
                     /old_locus_tag="HMPREF0733_10063"
     CDS             complement(70438..71073)
                     /locus_tag="HMPREF0733_RS00315"
                     /old_locus_tag="HMPREF0733_10063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S30"
                     /protein_id="WP_037231053.1"
                     /db_xref="GI:739370037"
                     /translation="MEVNIYGRNIKISDRLREYVEEKVEKFEQLGDNVSDIDVKVTKD
                     GHLGGESIRVEITVVGRGPVLRAEAQGHDKFAVFDETYGKLLERLRRARDRRKLRKHG
                     GKHPVSVADATGSLPTVTETITEILLPDVPVEEAAFDNSEVTLVDEAASPIEIRHKSF
                     VGEKLTPAEAVDRMELVGHDFYLYIDKETGAPAAAYRRKGWSYGIITLTEE"
     gene            complement(71247..72071)
                     /locus_tag="HMPREF0733_RS00320"
                     /old_locus_tag="HMPREF0733_10064"
     CDS             complement(71247..72071)
                     /locus_tag="HMPREF0733_RS00320"
                     /old_locus_tag="HMPREF0733_10064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComF"
                     /protein_id="WP_013397421.1"
                     /db_xref="GI:503162760"
                     /translation="MDKTPRKRGKKALYAVWELFFPATCVGCGVGGTALLDAAGTRRA
                     LCTRCETSLRKQTSAVHTPVLQHPVPGAVAAGIYEKTLAHVILSMKNAGRTDAVPELA
                     RALGRAVATIIDRAQVPAGTRILLIPAPSSQRSVQRRGYVPAELLARQVEHELNRSVA
                     LYRRKVRVKTHHILSLEKENIYQRLIRPNTAGQKTLGVSARAQRMEGAMRVSPRASVA
                     GALCIVCDDVMTTGATVFEASRVLHQGGARVLGAACVAAVSMQKKVDEEALMVHPD"
     gene            complement(72079..73821)
                     /locus_tag="HMPREF0733_RS00325"
                     /old_locus_tag="HMPREF0733_10065"
     CDS             complement(72079..73821)
                     /locus_tag="HMPREF0733_RS00325"
                     /old_locus_tag="HMPREF0733_10065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775408.1"
                     /db_xref="GI:908631375"
                     /translation="MRRIFQNSSHKQTLSETLPTLSRRTMLLGGVGSIALLVQACSGL
                     PDPKGIQKYSESLDNADDRKSAIHAMSPQVGGTPEGIIEGFLRAGVDSSDNYGVARQY
                     LTTEFAQQWVPEVQTRIYSETARITRGEDNIYKVSIKQTARVDERGLVTSFINAPAPT
                     PETFEMIQEGGEWRIRNCPNGLWIDGSEFDRSFKSYRLYYYDPSYTYAVPDLRWFARS
                     DEIFKTLAQTLIMGPANYLKESVFSATYESMKVNGANFDAEKHTIKVDFGGESTDELQ
                     LARLRQQIVHLASNFTGIETVVFCYNGHEISSSDKPEGFHEIPLVTQSNTRIVALNED
                     RLVTQRDFDAGDSQRTLVEKIKDPSAPTIGYDGTTYAYLSEGRKKLYTVRDTNSSKVW
                     ETRDLSRPSIDHYGWVWATDHSGTVRAFNPASDSVEEREKGINISVPWQNGLVFNSLK
                     ISRDGTRGAFITTRDNASMLVISGIIRDESGKPRSFTELVRVNASVSPHCVDWAGEQT
                     LAVVNTTTGEAELTSLNSEETKLDRLEGLRSMSAAGDSGHIIGHVDTGECYLLEDRGW
                     KLISGSLSEITYAG"
     gene            complement(73821..75569)
                     /locus_tag="HMPREF0733_RS00330"
                     /old_locus_tag="HMPREF0733_10066"
     CDS             complement(73821..75569)
                     /locus_tag="HMPREF0733_RS00330"
                     /old_locus_tag="HMPREF0733_10066"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013397423.1"
                     /db_xref="GI:503162762"
                     /translation="MPTPDATSGASDSRDLDAKSKPRKKRTLNPFRAIHRLWVHSLQF
                     RSVTSAGIMMLIAFIAVGTSLSNQIATSLFENKKNQALEETSKGFETVQRVLDPISAR
                     EDSEVRRTVKHNLTVLDAGGDTQRRWVLVSLDQQSKKGFIPEQSSDNAPLDASVIPTD
                     FKDTVRDSPGVFWEKTTLSEPGKSNGEPYPALIIGTSVSIPQNPNYGLFMVYDLSESE
                     STITYINVVLSTGFTVLLILVLSIVWFVTRLVVRPITSTAITAEKLAAGDLNRRVNIR
                     GKHQAARLGISFNKMADSLQDQITQLERLSTLQQRFVSDVSHELRTPLSTVRLSSELL
                     YDSRDTLNPVQSRSVELMHNQVDRFQALLSDLLEISRFDAGSAVLNIDAEDFMSVLND
                     VLVEVIPHLERTGTRLIVHSEQAHIDIDIDRVRIERVLRNLLFNAIEHGESKPVDIYI
                     ATNATNLGVAVRDHGIGLSEEEAAQVFNRFWCADTSRKRTLGGTELGLSITAEDVRLH
                     GGRIEAWGIKGKGACFTMNLPLVQGGELGPSPVLITGEPEPEAYAHSALAGDTLSTSL
                     RKTRHETQDDASEGQI"
     gene            complement(75624..76319)
                     /locus_tag="HMPREF0733_RS00335"
                     /old_locus_tag="HMPREF0733_10067"
     CDS             complement(75624..76319)
                     /locus_tag="HMPREF0733_RS00335"
                     /old_locus_tag="HMPREF0733_10067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_013397424.1"
                     /db_xref="GI:503162763"
                     /translation="MTTTTSTVLVVDDDDALAEMIGIVLAQEGYNAVFCENGSRAFET
                     FMRHSPDLVLLDLMLPGKSGIEVCEQIRSSSNVPIIMLTAKSDTEDVVKGLEAGADDY
                     IAKPFKHLELMARIRARLRPRESRQLVVRVGDTIMDMDGRTLKYKGVEVPMTPLEFDL
                     LAALVRRPGQAMSRQELLETVWGYSDVSDSLVNVHVQRLRAKFTDIGAEQVIQTVRGV
                     GYKVPLENVGGAA"
     gene            complement(76357..77616)
                     /locus_tag="HMPREF0733_RS00340"
                     /old_locus_tag="HMPREF0733_10068"
     CDS             complement(76357..77616)
                     /locus_tag="HMPREF0733_RS00340"
                     /old_locus_tag="HMPREF0733_10068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="WP_013397425.1"
                     /db_xref="GI:503162764"
                     /translation="MTSFSTRFADENTRKQYVPERLLLPGDYRAPEREFATELAERDT
                     VAVRASGLGEFPGTQIIDALHRVRGELGHPHLPFLPELPERGWQSTTLARTIATLSGM
                     ELEGASYGWRLVHARGGGTRESARARSCYVSDINALADVVGGESSGASVPEDAAPSFK
                     IQLCGPYTLAARVYAPNGERAISDAGAARDIRDAFLEGLGESISLIRQALNQPEARLT
                     VQLDEPELGRIISGTIPTVSGFRTIPAVPVSEIYESYRICANTFTELTITPMLNLTKV
                     PLTYPDDRTSNLSSVADACAIARTFSTADNPAELLFDPDEASQNLIQAQPLSDPHRWE
                     IAAAVLESGARLWLPIVDSDAIPQQAQRLWRLWNDVGLQKTEIRSVGLTHRANTTHIN
                     PHEATLQMARTTEYARIVAEMAAEGLG"
     gene            complement(77634..78023)
                     /locus_tag="HMPREF0733_RS00345"
                     /old_locus_tag="HMPREF0733_10069"
     CDS             complement(77634..78023)
                     /locus_tag="HMPREF0733_RS00345"
                     /old_locus_tag="HMPREF0733_10069"
                     /EC_number="5.4.99.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate mutase"
                     /protein_id="WP_013397426.1"
                     /db_xref="GI:503162765"
                     /translation="MTQQEFDPRATSMGDEVSAEVYEELFAMRRSIDNFDAALVHILA
                     ERFRATQRVGVLKAQHNLPAGDPGREEAQIARLRAMAKESSLDPEFAEKFLNFIISEV
                     IRHHEKIAHAHKDELAQNDDSLDRQTD"
     gene            complement(78052..79263)
                     /locus_tag="HMPREF0733_RS00350"
                     /old_locus_tag="HMPREF0733_10070"
     CDS             complement(78052..79263)
                     /locus_tag="HMPREF0733_RS00350"
                     /old_locus_tag="HMPREF0733_10070"
                     /EC_number="2.1.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /protein_id="WP_013397427.1"
                     /db_xref="GI:503162766"
                     /translation="MKILAAMSGGVDSAVAAARAVEAGHEVVGVHLALSRMPGTLRTG
                     SRGCCTLEDSMDARRVCAQLGIPFFVWDFSERFKEDVVDDFIAEYEAGRTPNPCMRCN
                     EKIKFAALLERAVSLGFDAVVTGHYARVITNDDGNRELHRAADWAKDQSYVLGVLTHE
                     QLKHAWFPLATTPSKAEVRAEAERRGFSVAKKPDSYDICFIPEGDTRAWLGEHIQMRP
                     GMIKDTSGNVVGEHPGAQGFTVGQRKGLALGTPAPDGKPRFVLEIRPKTNEVIVGSRE
                     LLSIDEIRGIRATWAGIPVPEAEHFLAQEPKLGVRSETFDVTAQVRAHADPVRGTAHL
                     EWAEDTDAETPGKLRVETVVRLHDGLFGVAPGQTMVLYQGTRVLGQSTIARAYSLARE
                     DLDDLRENAAV"
     gene            complement(79361..80590)
                     /locus_tag="HMPREF0733_RS00355"
                     /old_locus_tag="HMPREF0733_10071"
     CDS             complement(79361..80590)
                     /locus_tag="HMPREF0733_RS00355"
                     /old_locus_tag="HMPREF0733_10071"
                     /EC_number="2.8.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_013397428.1"
                     /db_xref="GI:503162767"
                     /translation="MNRVYLDHAATTDVLPIAIDAMVQQMRAGGNPSSLHATGRDARA
                     TVEYARERIARAVGCDAAEVIFTSGGTEADNLAVKGMYWKRREADPVRRRILVSSIEH
                     HAVEETCEWLQKTEGAIIDWIPVDSQGLVDPENVRELIAQNPADVALVTVMWANNEVG
                     TVQPIQDIAAIASEYGIPMHTDAVQAFGAVPVNFRDSGVDTMAISGHKIGGPMGIGAL
                     IATRTAQLTPVLHGGGQERSVRSGTIDAPAIAGFAEAAAHVIEHLEEESIRIAALRNE
                     LIAAVQAVIPQAHLSGIDPTTEAFPGEKRLPANAHFTFEGAEGDTILFLLDMQGIQTS
                     TGSACNAGVTRPSHVLLAMGLDEDTARSAQRFTLGHSSTGEDIARLLAALPEAYAQAA
                     KAGLSSHLPDAQRWYGG"
     gene            80728..81195
                     /locus_tag="HMPREF0733_RS00360"
                     /old_locus_tag="HMPREF0733_10072"
     CDS             80728..81195
                     /locus_tag="HMPREF0733_RS00360"
                     /old_locus_tag="HMPREF0733_10072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA methyltransferase"
                     /protein_id="WP_004005052.1"
                     /db_xref="GI:490103197"
                     /translation="MFKILFYTPEIPGNTGNAIRLAAVTGAELHLVEPLGFNFEDAHL
                     RRAGLDYHDLAVVTVHKTLQDAWKAMMPARVFAFTTTAATSYADLEYRDGDVLMFGPE
                     SVGLPADVQQDEHITERVKIPMIPGRRSLNLANSASIAIFEAWRQHGFTGGKI"
     gene            81200..81805
                     /locus_tag="HMPREF0733_RS00365"
                     /old_locus_tag="HMPREF0733_10073"
     CDS             81200..81805
                     /locus_tag="HMPREF0733_RS00365"
                     /old_locus_tag="HMPREF0733_10073"
                     /EC_number="3.2.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil DNA glycosylase"
                     /protein_id="WP_013397430.1"
                     /db_xref="GI:503162769"
                     /translation="MCANRQVPLLFEDIAADPMNAEYTSRGWEPVYSASARSRIILVG
                     QAPGRIAQETRIPWNDVSGRLLRTWLSVSDDEFYNPELFALMPMDFYYPGKGKHGDLP
                     PRKDFAPRWHPRLRAMMPHAQLTILVGAYAQKYYLDGVSAPRLRSNLTETVAHAEDYL
                     PGFVPLVHPSPLNIGWRKRNPWFEAENIPDLRERVRKILGA"
     gene            complement(81861..82868)
                     /locus_tag="HMPREF0733_RS00370"
                     /old_locus_tag="HMPREF0733_10074"
     CDS             complement(81861..82868)
                     /locus_tag="HMPREF0733_RS00370"
                     /old_locus_tag="HMPREF0733_10074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006889205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit alpha"
                     /protein_id="WP_013397431.1"
                     /db_xref="GI:503162770"
                     /translation="MMTTAYRVLVIGGTTNFATEPSSVDRELLALARLRAGVGQGGTQ
                     LGVMTFAQGSADIAQFYAKQGAARVFAPAQSMTDTLPAARVELAVQAITEFGPDVVLA
                     PHDIDSIELLGRVAVRLGNSEAGSRPVGVVTGAHDVDDALNIRKNVLAGEYDSTVRVE
                     GLPLVTLRLNSVDTAAAPTAVGEGVLTTYTLPGYDMVRITEITEKPTSARPNLEEAAT
                     VVAAGRGIGGKLAPIEDLADALGAAIGSTRAVTDAGWLDHSTQIGQTGKSVSPELYVS
                     VGISGALQQKVGMDTSKTIVAINRDADAPIFEIADFGVIGDLFTVIPQAVEEIKRRRN
                     A"
     gene            complement(82884..83705)
                     /locus_tag="HMPREF0733_RS00375"
                     /old_locus_tag="HMPREF0733_10075"
     CDS             complement(82884..83705)
                     /locus_tag="HMPREF0733_RS00375"
                     /old_locus_tag="HMPREF0733_10075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit beta"
                     /protein_id="WP_013397432.1"
                     /db_xref="GI:503162771"
                     /translation="MSVSENAYRIAVLTKYVPDTQFEQKIDDTLRVDRSESVMSELDE
                     YAVEAAMQIVEAEDTDAANSAVIAFTLGAADASKGLRRALQLGAHAGVHILDDAFAGA
                     DALATSRIIAAALSTYEQEHGTFDLILTGMASTEGETSLVPVQVSELLGRTGISQVAS
                     LTVAGRTVRARRDLDTRSQHCETELPALISVTDQVNTPRYPNFKALMAAKKKPITTVN
                     AADIADELAKFGGSASTVTVTEAQTREERTAGETIVDEGDGGIQLVEFLASRNLI"
     gene            complement(83895..85229)
                     /locus_tag="HMPREF0733_RS00380"
                     /old_locus_tag="HMPREF0733_10076"
     CDS             complement(83895..85229)
                     /locus_tag="HMPREF0733_RS00380"
                     /old_locus_tag="HMPREF0733_10076"
                     /EC_number="3.4.21.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trypsin"
                     /protein_id="WP_013397433.1"
                     /db_xref="GI:503162772"
                     /translation="MTQYPGGWNQDSGANGYNDATRPMQHSAPGSYAQQDYQSTGYQQ
                     QGYQQNYQTSGYQQSSQNPQNGYQNQYSGQGQNPQQEPKKKYGTGVVLTAALLAALVG
                     GGVGAGVGGGIAASTSSNSSSVTGRNAGGSATNPTVVTDTAKKVLPSTVTVGSKLTDG
                     NGVGTGEVLDNQGHILTNNHVVSTNGTQQSSRVEVRLHDGSIRVAKIVGTDVTSDLAV
                     IKIDPSGLDLKPITFGDSSKVVPGETVVALGSPHNLQDTVTAGVISNTDRAAEAEKDG
                     VYIPMIQTDAPVNHGNSGGPLVNSSGALVGINSQIESEGGGNEGIAYAIPSNYAKRIS
                     DEIISKGKATHGYLGANIESAPGQTNEGESRFFPDGVRVTNISSGSPAEKAGLQKGDV
                     IVEADGHRIEQSKTLNGVVRAQAAGATVDMKIKRGSETKNIKVTLGDADNQH"
     gene            85888..86835
                     /locus_tag="HMPREF0733_RS00385"
                     /old_locus_tag="HMPREF0733_10078"
     CDS             85888..86835
                     /locus_tag="HMPREF0733_RS00385"
                     /old_locus_tag="HMPREF0733_10078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005060.1"
                     /db_xref="GI:490103205"
                     /translation="MFIGMTIHRRNTVSQNFYGATSRPHSSQRSLTRIMVTLMLSFIC
                     ALTGIGASFIAYPTAAHAQAPFEVTLNPQTPIIDRDGTLNALSDGLEDELTEGLSTSN
                     ALHSVEAYMVLVSGTNGKPLKEWGQEFLSLNHARPRTVILLIDTSKNQGTIISNDQSF
                     MSDAWAHALYVKDNSSSQNSSIKRVIADHGLYGTAGRMFTDIFIGDHDYSASNDGNIP
                     QGLSDISEADGWFENFLVAAGVLVFILFILLGIPVLIIRVVRKNRRKTAELQKWQNDL
                     PLRDPSQVQVPQQYQMPNRPGHHMVTDTEYMKNRGYDLN"
     gene            87048..89111
                     /locus_tag="HMPREF0733_RS00390"
                     /old_locus_tag="HMPREF0733_10079"
     CDS             87048..89111
                     /locus_tag="HMPREF0733_RS00390"
                     /old_locus_tag="HMPREF0733_10079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397435.1"
                     /db_xref="GI:503162774"
                     /translation="MRKNGSLPLSNITNADRPFGSRRIRRALSVGALAFGTTMLSVAL
                     PAAGSSFLTPGISTAQAQTPMTITGRVQDTTNVLGDTSELNSKISELSKNHNIDLHVL
                     TIDKFESPEEAKAWTEETAKKNSYGNADAILVIATESRRAYFAAGSNKPLSSDQQSEV
                     YQKYIKPKLQSGDYKGAALEAVNGINAQKGGISPAVAIGGGAIGVAGVAGAGYYIMKR
                     RRSKNEPGSTPAYSASKVPEVSLEELRTRAGAALVQADNSMVQSKQELEFARAQYGNE
                     HVKPFEEELTRAQELMQASFHRQKLLNDDVPDTVAEQRAWLSEIIDNSQEISDISRDQ
                     AQKLSEMRNLEHEAPQAIARLQGRIPELQQIVETAQHTYARLKDQYLPSALEPINKSA
                     ALLDSHQSLVAQELQEASRLVDVSRSEAVVHLRNAEESAAQITSLAEAVSNHASALES
                     AQSSLSTDILSIQRDVAEAKSLAESQNRAELAATAAGMEAILGQVSQQAQERPNDPIA
                     LTEQLHQLTSELNRSMSSLRADREREQAAKESLSRTLRSAEAQVRSASDFINNRRRGV
                     GSQARTYLSEAQTALSDAHRLRESDPVNSLNRAYEAISLASDAQNSANQDVNNYWDDN
                     RYGQSYGGDSLAQGMLLGAIFSAMGSHSASASTGHHWGGGDSGGGWDFGGGGGDFGGG
                     DGGSF"
     gene            89301..90017
                     /locus_tag="HMPREF0733_RS00395"
                     /old_locus_tag="HMPREF0733_10081"
     CDS             89301..90017
                     /locus_tag="HMPREF0733_RS00395"
                     /old_locus_tag="HMPREF0733_10081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397437.1"
                     /db_xref="GI:503162776"
                     /translation="MVKQSIFGRIAQLAKANINALIDAAEDPQKMLDQMVRDYTNNIV
                     EAEAAVAQTIGNLRLLEQDHAEDLRDADEWGSKALAASNKADEFRAAGDTANADKFDN
                     LAKIALGKQMQAEREAKAAEPQIASQTQVVEQLKDGLTKMRAKLDELKSKRDELNARQ
                     KTAAAQSQVNDALKAFDVMDPTSEVSRFEEKVRREEARVQGQQELAASSLDAQFNDLE
                     ELGRQSELDARLAALKNKNA"
     gene            complement(90111..91466)
                     /locus_tag="HMPREF0733_RS00400"
                     /old_locus_tag="HMPREF0733_10082"
     CDS             complement(90111..91466)
                     /locus_tag="HMPREF0733_RS00400"
                     /old_locus_tag="HMPREF0733_10082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_013397438.1"
                     /db_xref="GI:503162777"
                     /translation="MTRIRKMRAGTLAALTVPAIVGATLTAPAHATIASGTYRSYTAP
                     NGLNSQYHVYANGIDWSKPVGVVFYIDGDYWRNDQSKIHSPEQGMLPAMGRIANARNM
                     VFVPVVSPDKNASGNGITWWENLDANGDYFRSFAQQFISSNGIDPSQVWTMGYSGGAE
                     FITYELNADRQGTWRSGGGSILVAGGGYERMQTEAPQNIKNQPMYWWVGAADTSGTTN
                     PPTWSARGAVEQGYAAYRNSGFTNTQMKLIPGFSHQDYDLPLIMAQSLDTGGHRFGAG
                     YSDLPTTNPFYTEISWNSDRRIMTGFADRTFRPYSAVNRAQVATYLYRLAGSPAVELP
                     ATSPFPDVTPNHPAYKEIVWLKQQGITTGWSDGTFRPHDTISREALAAFFYRFNGSPA
                     YAPGAQQFADVNPSTMFYKEISWMADQGITTGWPDGTFRPGEATSREAMAAFLYRASK
                     L"
     repeat_region   92004..92367
     gene            complement(92005..92790)
                     /locus_tag="HMPREF0733_RS00405"
     CDS             complement(92005..92790)
                     /locus_tag="HMPREF0733_RS00405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013399001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775409.1"
                     /db_xref="GI:908631376"
                     /translation="MGQYKEFTDDGQAKPVGETITNHLFGDTCTLNDPEAAQQAQGEY
                     ERIITEMRTHLLELIPAHPHLTLDSAHPPHTSKGEETNFYTTLEGSSNIFEGDLPIGR
                     TRIRAVPVAYRYEYGDGHDLKTHSAGNPVSSQYSGQPLHETSTSYAYPQVGNFHAYVT
                     VTYAGQYSIDGGPWQFFGTEVSRISDPVLVRVWESEVHSVGKTCAEDPGAKGCPGHEE
                     EPDVGNPNPQLRKVDVYTGQRWHLDDVGVGDSEGRLHPTWPNM"
     repeat_region   92435..92910
     gene            complement(93171..93899)
                     /locus_tag="HMPREF0733_RS00410"
                     /old_locus_tag="HMPREF0733_10084"
     CDS             complement(93171..93899)
                     /locus_tag="HMPREF0733_RS00410"
                     /old_locus_tag="HMPREF0733_10084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397440.1"
                     /db_xref="GI:503162779"
                     /translation="MNTRTPVLSRRALMSVLGVSGFAVLLSACGEGAKPAGMATESPS
                     SSSSATAVASASSSDSPSPSLSTSPHYSGKSKAPEGEYRPADFYGPAQNVPKPKTEEG
                     YTNASLEGMRKTVQAWTEWRNYGLQTGDFKDAMKFVDKQYTDELELYQNTSRFYKDGG
                     WIVGGDLHQYEFHGEPINQGNGKYEWKYLLLWPYRIYIAADGRVNKVYNDDYENNWYM
                     MTLHHDGNRWFIDGTRFLNVQGNK"
     repeat_region   93808..93908
     gene            94565..95413
                     /locus_tag="HMPREF0733_RS00415"
                     /old_locus_tag="HMPREF0733_10085"
     CDS             94565..95413
                     /locus_tag="HMPREF0733_RS00415"
                     /old_locus_tag="HMPREF0733_10085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-diketo-D-gluconic acid reductase"
                     /protein_id="WP_004005070.1"
                     /db_xref="GI:490103216"
                     /translation="MQYVTLNNGVKMPQLGLGVLYIDDLTECERVVSEALEVGYRLID
                     TAAGYQNEQAVGAAIEASGLDREDIFVTSKLWVPDYSYEGAKRGFEESRRRLGVDYLD
                     LYLIHLPLNNYFGAWRALEELYQAGHARAIGVSNFDSVRIADISHFSEVTPAVNQIEI
                     NPFHQRVDEISYMKGKGIQPEAWAPFAEGANDIFSNPILLEIGEKYGKSPAQIILRWQ
                     MQEGVVAIPKSVRRERMEQNFDIFDFALTVEDMASVKTLNTDQSLIFDPRKVEHVEGL
                     LTRFNL"
     gene            complement(95619..95692)
                     /locus_tag="HMPREF0733_RS00420"
                     /old_locus_tag="HMPREF0733_t10001"
     tRNA            complement(95619..95692)
                     /locus_tag="HMPREF0733_RS00420"
                     /old_locus_tag="HMPREF0733_t10001"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(95656..95658),aa:Met,seq:cat)
     gene            complement(95908..99090)
                     /locus_tag="HMPREF0733_RS00425"
                     /old_locus_tag="HMPREF0733_10086"
     CDS             complement(95908..99090)
                     /locus_tag="HMPREF0733_RS00425"
                     /old_locus_tag="HMPREF0733_10086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397441.1"
                     /db_xref="GI:503162780"
                     /translation="MTASDNEHQPPQPPRRAGADQKKKKRRYPGPLGITIAVVIVLIM
                     AFVYATQVYTDWLWFNQLGFGSVFTTEILLQSSIFVVTALVVAVPFWASMSYAIKHAD
                     HDDSQAKKDAKNADKSEEQAHHETSKSGPHERHTTEHEHTEAEDLLRDMFGGRDFTDS
                     MARYRRGMERIRKILLVILPIALGFFIGSAGISQWQTVALFLNRQDFGVQDPEFGLDV
                     GFFVFTLPFLNLVVNLLTAVIVLCAIGGAIMHYFYGGIKVRPGGVGTSAAFRRHAAVL
                     ACAFLLVRGAAFWLERYTAVQQQSGRWAGAMYTDTNAIIPVRSILAISAVLVAVLFLA
                     TASAHRWRLPLVGTAMLVVVALVAGGLYPWIVQRFQVVPNEQAAQSQFIQRNIDATRY
                     AYGLDKVETTPYDATIDTRQGALGNSSETIANIRLLDPNVVSSAFAQMQQFRPYYRFD
                     SNLSVDRYSVDNKTQDTVIAARELNPSQTSDDSWYNRHVVYTHGYGVIAAYGNQVDGA
                     GNPKFMQSGIKANGVISENYEPRIYFGMSSPQYSIVGGSGDQLELDRPQSADETNSSD
                     AKYTFNGNGGPRLDSTLNRLSYAIKFQSSDILLSDAVRDGSQILYERNPVDRVQKAAP
                     YLKVDSKAYPAIINNRVQWIVDAYTTTNQFPYAQGVSQENNQNPRTNSMNYIRNSVKA
                     TVDAYDGSVTLYAWDENDPILKAWQGVFPGTVKSYKEMSAELLNHVRYPSDMFTIQRS
                     MLNKYHVTNSNSLYAGDDVWSIPNDPTNDSGRQIPPYYLSLQMPGDRKAHFSLTSTFI
                     PQQSDSNSRNVMYGFLAANGDAGTGKDGERSADYGKLRLLELPRSSVVPGPGQAQNIF
                     NSDAEVSNQLNLLRRGSSEVINGNMLTLPVAGGILYVQPVYVQSSGDARYPRLQRVLV
                     SFGDKVGFAPTLEEALNQVFNGSSGAKIDAQSGPSGAGTEGNGEKTSGSSSSSSGASG
                     SDQSASLKQHLADASKAMQDSDAALKKGDWAAYGEAQKRLNDSLQKAIEAENKQQQDQ
                     KQGGDQQGSEQQPSGSSSASQSPSGEATSK"
     gene            complement(99244..100437)
                     /locus_tag="HMPREF0733_RS00430"
                     /old_locus_tag="HMPREF0733_10087"
     CDS             complement(99244..100437)
                     /locus_tag="HMPREF0733_RS00430"
                     /old_locus_tag="HMPREF0733_10087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal protein PDZ"
                     /protein_id="WP_013397442.1"
                     /db_xref="GI:503162781"
                     /translation="MAKRAFFLRKSHQQSDESLPLSERRSLNLRFLTASATCLLMLGA
                     FVLPSSYSKEGPGPLFDILGQYQDQDIIQINGTQTYPTTGKLNMTTVSVSGGPYTVLP
                     GADAFYSWLATDGNRYLVVPSEITYPHVTHQQANQVSSAQMADSQTQAKVAAARYLKL
                     PVTEKISVLQTASGSPAEGQVQGGDRILKVGDKQINTLKDVTGTVQASEGRPVTFEIS
                     RNGENQNITLTPRRDDKSGRWLVGIVLKQDFDLPFEATYNLDGVGGPSAGLMLTLGTI
                     DKLTEQSLLAPEDAGNEESARSYVAGTGTIDASGKVGAIGGIKYKIIASGRHGAHYFL
                     APRENCDDLQEIRRTDPNVFKYYRGETPAGDMQVIPVDNVDEAVDALTKIKNGAAPDQ
                     FPTCG"
     gene            100652..102094
                     /locus_tag="HMPREF0733_RS00435"
                     /old_locus_tag="HMPREF0733_10088"
     CDS             100652..102094
                     /locus_tag="HMPREF0733_RS00435"
                     /old_locus_tag="HMPREF0733_10088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013397443.1"
                     /db_xref="GI:503162782"
                     /translation="MAENPTNDNSNDRDPLEEFLKKMQEQGFDPNAEQNGNGTADNPF
                     AFLNGNINPEDMNAMGMSFDPSMLQGIFAQVQSMFTAGASENGINWQGVKDQARQLLA
                     TTGEDPAITESLRAATRDASNLADLWLDSVTIFERHNIPVEAWSKAEWLDSSFESWRD
                     MVQPVAAEVTQAMVLPSTEDVPEELAQLLGGTGFLNNIGSMIFGAQMAQALTELAGEV
                     YSSTDIGFPLAPGRSALLPAGYTQLAEDIEVPAQEILLYLAVREAALIRLHRTNPWLR
                     EDILELVSRYARGIRVDMNRIQDAASQVDLSNPEAVQDAFDGGLFNPQRTEDQELAVE
                     RLEALLALVEGWVSLVAEQATQNLPTAPQLAETLVRRRIEGGPTERVFETLVGLEIRP
                     RLVREAQNFWRTYEEKHGYEARDELWAAPETLPTAAELEDPDAYEARQDEFKVEDIDF
                     DTELQKLLDGGFDEGESDGGESSTGDEPNT"
     gene            complement(102247..102837)
                     /locus_tag="HMPREF0733_RS00440"
                     /old_locus_tag="HMPREF0733_10089"
     CDS             complement(102247..102837)
                     /locus_tag="HMPREF0733_RS00440"
                     /old_locus_tag="HMPREF0733_10089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="WP_013397444.1"
                     /db_xref="GI:503162783"
                     /translation="MMARQKVRQHHEVIPATASTPEILVVRSSRRRRTVSAQPQKDGS
                     IRLLVPGASTDAQIREYLENLIPRVQRKQRESARRRRTFTSDDYLTERARALTADHLP
                     ELAPEKFPDSIRWVSNQRKRWGSTTPTQGTIRISDDLQGAPEYVVDSVIYHELCHFVE
                     LHHNARFRTLEARFPNLDKARAFLAGMEFIRAQATN"
     gene            complement(102908..104854)
                     /locus_tag="HMPREF0733_RS00445"
                     /old_locus_tag="HMPREF0733_10090"
     CDS             complement(102908..104854)
                     /locus_tag="HMPREF0733_RS00445"
                     /old_locus_tag="HMPREF0733_10090"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="WP_013397445.1"
                     /db_xref="GI:503162784"
                     /translation="MPAQGAGASKQQALFGIPAQKSSPTHTQTPQVPARPAPPPAAPQ
                     QNHAAPQLSPEDILAGLDEDQRRVASELNGAMRVLAGAGTGKTRAITHRIAYGIACGK
                     YVPQRVMALTFTTRAAEEMRLRLRSLGAVGVQTRTFHSAALRQLRYFWPSAIGGSFPD
                     IVKHKAGLITEAAQRLRMSVDRALVRDIAAEIEWAKVSLFTPDTLTPHLHQRNLPSGI
                     TPQNMVRLFRAYEDLKDERNLIDFEDVLLLTVGIIEDDDALAATIREQYRHFVVDEYQ
                     DVSPLQQRLLDAWLGERDDLCVVGDASQTIYSFTGATSRHLLEFPRRYRGAHTVRLTR
                     DYRSHSQVVELANRLLAARRPRPDSTEFSWAPPLKLVSQRGPGVESQWFGYTDDEREA
                     EGIAEQIQDLLEKDGVPASEIAVLFRTNGQSGLLEAALADRGIPYQLRGAEQFFDRPE
                     VKQAMLALRASAKSTDGSENVPRYVREVLEPLGYTEKAPQSAGAVRQKWESLAAIVSM
                     VDHLEATRIEDIAQAEAAGAPVPHRLTVHDVVATLAHRLATQDAPVMEGVTLASLHSA
                     KGLEWDAVFLCGLNEGLMPITFAQTSDEIDEERRLLYVGITRARKYLWFTWSDSRTTG
                     GRGKRRRSRFLDDIDPSRQSARHS"
     gene            105083..106078
                     /locus_tag="HMPREF0733_RS00450"
                     /old_locus_tag="HMPREF0733_10091"
     CDS             105083..106078
                     /locus_tag="HMPREF0733_RS00450"
                     /old_locus_tag="HMPREF0733_10091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_013397446.1"
                     /db_xref="GI:503162785"
                     /translation="MTLTPLQLAAIVSAGVPGIYPVGASAVLDDTADFDSAIIVDSTN
                     RRWRVRAPRRPDASMRLEAEHLILQSFTPGLRARLPFQVPTVVGTVPYQDGSVFIYTH
                     IPGTSYEVDDLAAQNGHTAEGQDSLAVSLGKILATLHTMPHDLVFEAGLPSYNSEEIR
                     RRRSVELERVAQTGKIPADLLAHWRSVLSPGPTWQFQAHVIHGDMNSDNLVLDGAKIV
                     EVTGWSDVQVGDPAQDFAWLFSCSDQGFTDSVLDAYQRQMRPEPDEHLIQRAHFYAEF
                     AIAQWLAHGAEIGDDDIVQHAVAMLLDVQDGLRATGGLLGQEEEEDIPQVIDDED"
     gene            complement(106206..110555)
                     /locus_tag="HMPREF0733_RS00455"
                     /old_locus_tag="HMPREF0733_10092"
     CDS             complement(106206..110555)
                     /locus_tag="HMPREF0733_RS00455"
                     /old_locus_tag="HMPREF0733_10092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase UvrD"
                     /protein_id="WP_013397447.1"
                     /db_xref="GI:503162786"
                     /translation="MDTYRMTTSEPDQPHKHDGDRGASGVSGGTAHQPARLSAREIAH
                     ALGLNPPTDEQVRIIESPLEPRLVIAGAGSGKTATMVDRVVWLVANKIVRADEVLGVT
                     FTRKAAGELRDRMRTRLNILRERNLIELSEEELLAGSSEPTVSTYHSYANNLVKEYGL
                     RLGVEQDAQMLGDAQAWQLAAQIVQYWDGDLPAASSALGVASKSTIVQSLLQLSGECA
                     EHLVSPQQVIEFCSAHLAAYESLSSPGPSANAKKVIERLKAKIILAQLVQRYARVKAR
                     MQVLDYGDLIALAARIAREVPAAAQLERERYKVVLLDEFQDTSHAQLRLFADLYGAGD
                     GHDGRPGQPEHPVMAVGDPKQSIYGFRGASDGQLFSFYQYFPTRDETPLYLTVAWRND
                     VAILDAANLIAAKLKNIPDWVRAPAPPHVPDLRPRSVVLNPDESGYRAMLGSVQLARY
                     GSETEEAQGIAERIVQERARYANTPEQMPTMAVLTRTRAQMEPIRQACESLGVPVQVV
                     GLGGLLERPEIIDMVSMLRVLADPNRSDALMRLLAGARWRLGTADLLALGDWSNYLTT
                     TREKNMGRTFGEQSSGETSGDVPSSPQTDTDANLRAAHEEFERVRKNAVEDLAEYGSL
                     IEAIEHLPAADEAGNPIYPADYPESRRRLSVEGLRRLHAFTAEVEYLRQFTTEDIGTL
                     LYEIERVMLLDIELAARPGGDAYGSRAHLDAFHEVAASYAASSPRINAMLYAGADGTE
                     VDEDAPTARRFVLSANGISYLLGFLSWLEQAQNHERGLTPAEEEPRRDAVQILTMHAS
                     KGLEWDHVYLPRMCDKYPTRPHTWHRLEHGSLPWPLRGDRDYLPSALERAEEVSALEN
                     YKELNARLEDGEDMANDYVGFEGRRLVYVAMTRARSLLHISNCRWVGPNVNPYQPEPY
                     WNELVQFAQGYAEEPYEGIQVAPWLYPGYLGTGFYTSGWAIEHRDASIEVLFGRCLWL
                     ENYSIPRGIRLENGTSVPVIPAPDDPEDTAASQRYTSAVYEQIAHALVHDGGNPITNA
                     EVLNLPEVHRVKQALMGGVQEPGLPDPQESKGAYDENLEGLKKRYGLDVVENFRYARE
                     PLAQLAQGKQGPEQPGVRPQIVHRFLEPAAWVKDNPQQGSVLTADWPFDPFDGAQVIR
                     WASEKDLAERTENRDIIAVPGQRRARVERTALNVARGSLSLDELDKLTSPTEAEAQQI
                     QDWEHEVDLLLALAQRAVTPAVPTKPEHMSASTLIALSEDKETVLSRLVRPVPMQPSA
                     AARQGTLFHAWVEEYFGDEPMLDIQDELYSDDDLDGSFDLDKLRATFLESEWASRTIW
                     RAEYPVETHVAGVNIRGRIDAVFRRTEQVTNADGTLQEQEHWDLVDWKTGRKPSAHAM
                     RHKRIQLALYRLAFAKIQGIDPECVHAAFYYVGSDQTVWDTDIAGGLQNEQQLERIIS
                     RAGWGEELPGRPR"
     gene            complement(110744..114262)
                     /locus_tag="HMPREF0733_RS00460"
                     /old_locus_tag="HMPREF0733_10093"
     CDS             complement(110744..114262)
                     /locus_tag="HMPREF0733_RS00460"
                     /old_locus_tag="HMPREF0733_10093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="WP_013397448.1"
                     /db_xref="GI:503162787"
                     /translation="MTATLILGAPGTGKTERVITAAVDFLNAGGDPARLLVLTPTRAG
                     ATRVRDELARRIDRSMSTAPTRAWAAYAFDLLRRAHVSGLLPGVEFAPKLLSGPEQDV
                     MIGEILAGHREGKGAAVRWPADLHEALGTRGFRQEIRDFFDRIAEYALTAEDLENLAQ
                     TLDRPAWHSVAQLYTEYQQIRRLRAPNAYDPAALIHEACAFLLANPEYLREERARFDL
                     ILIDDAQELSPSVYRLMRILVGREPGQVLATYTGDQREAVEAAFAPSARVLMTCCTET
                     VVQGFRGARPDLAATLPQIFPELQREELKTSYCMNAPITQAWRNIARRLPVIANVPTP
                     REPQAAPSKYEESALLRLSDDGDLLDPRHSDELPEGVFGYLLGSPQDEANQVAQLLLE
                     DYLYRGAAYARSAIIVRSGTEVARFRRVLAASGIPTVTGAALVPVRDEPAVRPFLDAL
                     SLLVYARQQSADYLKLPDHNEFDGSLTENISPEAVTEAGTRSADDEAEKLARQSLADV
                     LAEENRTNPGSGAHNAITLLTSRLGGASSMEVRRLRQQLRAAELRAGGHRCSDDLLLG
                     ALLNPQALPAQGIGAAVRRVARVLAAGHKALSERGANAETVLWALWQASGLEKNWVTE
                     SAQTGPEAERAHRNLDAMIGLFEAATRFVDQMPGSSAELFLDYIDAQDLPMDTLAARG
                     KRYDAVEILTPALAAGRHWQTVYVCGLQDGTWPNTTVRGSLLKAGELTDICDMGVAAA
                     QQVRMSDRVRAVRHDELRMFSTAISRANERLVVTAVSSTEDAPSEFFDILVPDARTAG
                     ITHVRRPMTLRALVAELRRYAQAQDTDPTLANAAAAQLNRLAQAGVPGAAPEQWWGLL
                     PLSTEQNAFTPHPHRDGLSTDSGDPEKLTVPVSPSRIETIHKSPLDWFVSAARAEAQT
                     DTSRSLGTLIHAIAEEYPDADYMTLRGQLEERLSTLALPDTWEGQQIRERAEKMVDKL
                     AVYINEIMPGDHRELVGVEGSFRVLVPGDAVNAQISGRVDRLEKTEDGRYVIVDLKTG
                     KTKPNKNQIAEHAQLAAYQVAVEAGAGDAMSRDFGVEPDGLDIPAGLEHREAAPQRFE
                     VFTRKSGGAALVQLGDGTAASSRNRPQEQDALDPETGIWAVQLVQRAAELIAGAVMQT
                     RHRPGETCRLPEICPLCPQGRQITQD"
     gene            114369..115061
                     /locus_tag="HMPREF0733_RS00465"
                     /old_locus_tag="HMPREF0733_10094"
     CDS             114369..115061
                     /locus_tag="HMPREF0733_RS00465"
                     /old_locus_tag="HMPREF0733_10094"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="WP_013397449.1"
                     /db_xref="GI:503162788"
                     /translation="MSWIDAPRATFDLETTGVDVTTARIVTASLLLLNPDGSVQRAGE
                     WLANPGIEIPEGAASVHGITTEYARSHGQPAQQVIWEVAGAIGSLFLDGIPVIAFNAA
                     YDFSVLHHEMLRYNIAHGELPAGHILDPYVIHKHVIPRKRGNRKLETLTAEHDVVLEN
                     AHTSKADALAAERLLVKLAERFPEIATDAAALHTHQVQWSLDQARDFQDWLRTKPGKE
                     NEVIDGRWPIRR"
     gene            115283..116626
                     /locus_tag="HMPREF0733_RS00470"
                     /old_locus_tag="HMPREF0733_10095"
     CDS             115283..116626
                     /locus_tag="HMPREF0733_RS00470"
                     /old_locus_tag="HMPREF0733_10095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397450.1"
                     /db_xref="GI:503162789"
                     /translation="MEYQDTNTYSIYLGSSREQHKYIVSQSQVVLKLGRILMKSGASA
                     YRIKASMARLAKAVGLQEHHAQVTFTEIATSSYADGNFRTEVAEQRTMGINSYKIDLL
                     GKFISELPDRISPSEADAEITRIDSMPHLYKRWMLSLASAIACTGFAFLNRGGLVECL
                     VVFIAAGAGQFLRSTLMKRGTSHMAIWMACGFLGAGTYIGIIRLLVALNLVGSDHMVG
                     FISSILFLVPGFPMVTGMLDISRMDFLAGVSRLTYVAVLLVSGSFAVWVLASLFEIPL
                     LQNIRPDIPVGLYILLQVISSGVAAAGFAMLFAASPVACVWGGVIAAIANPARIWLVE
                     AGWAPHMAATVAVFGVGIMAEIVAPLHGRKYSRISLSVPAVVTMVPGVPFYLSMSYFS
                     GGNMYAATNGFVQSLLTFLALGLGLAFVRLLFDKNWLFDQDTQVMKKLDSASHMR"
     gene            116705..117514
                     /locus_tag="HMPREF0733_RS00475"
                     /old_locus_tag="HMPREF0733_10096"
     CDS             116705..117514
                     /locus_tag="HMPREF0733_RS00475"
                     /old_locus_tag="HMPREF0733_10096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321516.1"
                     /db_xref="GI:752672807"
                     /translation="MPYLVCYVCIVSGVLCRSHSPTKRLLFRCRSFARHIFLSTNYRT
                     RKITVMLHRIIQRPLNTAFDKLYARRAAKFPINPDGVLRVRHPALILISVFISALVGT
                     LLTALIVYMVLHPNTTQTPQQSLSILGSFILCVVIFYGLAVWAYLNYRNIYVETARDY
                     VEQRNAFGRITRIYYSEVSAYSYWYEYNNKMLTLFSSDGRQVSFRPKIYRGERVLAVL
                     AFRMYNSRWPDPRNSSDQHIVETQAANGIAERALWNEHPVGKNLLMPQDIQ"
     gene            complement(117622..118473)
                     /locus_tag="HMPREF0733_RS00480"
                     /old_locus_tag="HMPREF0733_10097"
     CDS             complement(117622..118473)
                     /locus_tag="HMPREF0733_RS00480"
                     /old_locus_tag="HMPREF0733_10097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397452.1"
                     /db_xref="GI:503162791"
                     /translation="MVFAWIAVAALCSIHLIFSLAQSWVESKKHPYRVRRFHGANYIL
                     YILVIGYLYFAPLIFSGEYDGSHTIKITIFAYGGPILILGLFFLVAQHDMSYIDITSE
                     GFLTQTVFGKEKFTPFAAIDGYIYSPKRKRQTLDGQHWKITQDLSDDLYLIDPWGNTV
                     FSCIPAKPQERIFGALLYARARSGRWPDLENPEDELVIMKLADSKYEVTDFLMEYPQV
                     NGFITPEQTAVPQQPMPPQYPQNAYPQEGYLNSGQQPSNQQMNPYGYLQQPHNYQQNQ
                     NPPQGSA"
     gene            complement(118555..119271)
                     /locus_tag="HMPREF0733_RS00485"
                     /old_locus_tag="HMPREF0733_10098"
     CDS             complement(118555..119271)
                     /locus_tag="HMPREF0733_RS00485"
                     /old_locus_tag="HMPREF0733_10098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041321517.1"
                     /db_xref="GI:752672808"
                     /translation="MNTSVFVSAGIVGGVLLTCAALHITYLGMRAKRESEAMLRRARY
                     PWWILVIVDIFLVGFGSFFAFVLSVILTPSAGTPIVIVLFAVPMCLIFAFFIFIILLI
                     RGLTIRYIELVPSGFVFRSGFGRVHNIPFSDIKGYDYRPARFDFEGTLRVSMGDRHAV
                     NTSRGDRLRVINHEGKKILQTQVRHSAMPDYVGQCLMFRGMQERWPQLGYSEDEKILA
                     EYTKDVVVRYLTVNRWRQDF"
     gene            complement(119471..119917)
                     /locus_tag="HMPREF0733_RS00490"
                     /old_locus_tag="HMPREF0733_10099"
     CDS             complement(119471..119917)
                     /locus_tag="HMPREF0733_RS00490"
                     /old_locus_tag="HMPREF0733_10099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013397454.1"
                     /db_xref="GI:503162793"
                     /translation="MRQEEFNQLIGYRLKEVQSLLRSRMEEVLRPLGITVAQYVCLEI
                     LKSTPGASNAELARQAFVTRQTMNTLLRGLQERSLIERAEQAPRGRALPTILTAEGER
                     VLDQATGRIRDVEQHMVGGLSDAKRQELWDLLTICIEGLHAGGSKT"
     gene            119992..120360
                     /locus_tag="HMPREF0733_RS00495"
                     /old_locus_tag="HMPREF0733_10100"
     CDS             119992..120360
                     /locus_tag="HMPREF0733_RS00495"
                     /old_locus_tag="HMPREF0733_10100"
                     /EC_number="4.4.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006889188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_013397455.1"
                     /db_xref="GI:503162794"
                     /translation="MTVTGPSFIALQVRDLERSAQFYETYLGLRRTPQAPPNAVVFAT
                     EPIPFAVREPLPGVNLDEISRPGLGVALWMHGNDVRSLHAKLKEAGVRILQEPTSGPF
                     GENIIFADPDGYAVTVHDRV"
     gene            120455..120889
                     /locus_tag="HMPREF0733_RS00500"
                     /old_locus_tag="HMPREF0733_10101"
     CDS             120455..120889
                     /locus_tag="HMPREF0733_RS00500"
                     /old_locus_tag="HMPREF0733_10101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397456.1"
                     /db_xref="GI:503162795"
                     /translation="MRYWVGVASRDHVLLGVAGGFCQVCHGKQVPLARMKQGDWILYY
                     SPKTGMNSGEKVQAFTAVGQIVDDRVYQFRMAENFEPFRRDVVFQDAPHPCPIEVARE
                     HPEWRSYAKQLRYGHFEVSHDFFEHIYRYMMASKHEITPDRC"
     gene            121101..122450
                     /locus_tag="HMPREF0733_RS00505"
                     /old_locus_tag="HMPREF0733_10102"
     CDS             121101..122450
                     /locus_tag="HMPREF0733_RS00505"
                     /old_locus_tag="HMPREF0733_10102"
                     /EC_number="5.4.3.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde aminotransferase"
                     /protein_id="WP_013397457.1"
                     /db_xref="GI:503162796"
                     /translation="MSLSAEHHLAHQHSEELFERSRSVIPGGVNSPVRAFNSVGGTPA
                     FVDRASGPYIYDADGNEYVDLVCSWGPAILGHAHPQVVAAVQEAASRGLSFGAASAPE
                     AELAELVVDRINTAIPGAIEQVRMVSTGTEATMTAIRLARGITGRDKIIKFSGCYHGH
                     VDALLSEAGSGVATLALPGSAGVTAATASETIVLPYNDLDAVREAFAAHPGEIAAVIT
                     EAAPCNMGVVTPEPGFNRGLREITQSNNALLIFDEVLTGFRVSSAGYWGKFAPEDNGW
                     VPDIFTFGKVIGGGMPIAALAGKREVMEYLAPTGPVYQAGTLSGNPLSVASGITTLKL
                     ADDALYRTLDTRSEQLQAALTQALTDAGVDHSIQTAGNLFSVAFGTGEHGVHNYADIK
                     GSATAKYTAFFHAMLDAGVYLPPSAFEAWFLSGAHDDAAMERIIEALPGAARAAAKA"
     gene            122611..123615
                     /locus_tag="HMPREF0733_RS00510"
                     /old_locus_tag="HMPREF0733_10103"
     CDS             122611..123615
                     /locus_tag="HMPREF0733_RS00510"
                     /old_locus_tag="HMPREF0733_10103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397458.1"
                     /db_xref="GI:503162797"
                     /translation="MDFRDIWLIAFIVYLGLCLLIEAVYPVRVRKKYALKDEHAQWFW
                     AYKHFFLYIWSWFVAASLFMLFWDISDFIRPVALFFPFLMVYAGARIGRRNYRISHGT
                     FPDNRAVGMPKIYAATLGALSKPLRFKPDTPDSQLVRETSWSVIVGAIVFALCTLIFL
                     LSLTDFDISPTVTFGTIVLAIGLLEGLWAIFVHTGMYTVFTPHHMRVSKTLGSARNIP
                     YRDIIGYRVIPKNPDDLNPDAKQVSQWKIELQIPWGTRSVIARNWELQNPHIEYLTRQ
                     IAFRVEQERWADENSPADRERLDEYRQDARLVCTTKGYIPAGKYAQEAANRASFKQTH
                     "
     gene            124151..124942
                     /locus_tag="HMPREF0733_RS00515"
                     /old_locus_tag="HMPREF0733_10105"
     CDS             124151..124942
                     /locus_tag="HMPREF0733_RS00515"
                     /old_locus_tag="HMPREF0733_10105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775411.1"
                     /db_xref="GI:908631378"
                     /translation="MGVHITSDYSPTTTTQKANSPMSISNNFITCTRRAAFGFLGASS
                     LVALLTACDDEDKPGARPSTTTSSTAAPETEPPEPADSPSAAPSSSGPKYSGKSKAPA
                     GEFRAADIYGPAQNVPKPTNPPGYTEPTLDGMMKSMKAWTQWRNYGMQTGDYTEAYKF
                     VSKNLVEEINAYNADAKLYHDGGWIIGGEQRSYDFRNDPVHQGNGVYSWDFFVGWSYI
                     ITVGADGRHKRSRNTNYADNLYTLTVHYEETGWIIDSITRKQAQK"
     gene            complement(125416..126054)
                     /locus_tag="HMPREF0733_RS00520"
                     /old_locus_tag="HMPREF0733_10106"
     CDS             complement(125416..126054)
                     /locus_tag="HMPREF0733_RS00520"
                     /old_locus_tag="HMPREF0733_10106"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397461.1"
                     /db_xref="GI:503162800"
                     /translation="MVANVYIYSHSISGSTYAKAEEELTSYYEGLGYKVIRGQYPTGL
                     GSVTLPASVSLLLKVVSVAVKLGRPIATIVSQGLRQWSINQIIGGRDRTHGFIHIQSI
                     PMVSDESHGVSRGISTDNLLLSLVRATEIIRENTEPFRVVLKGVGDGHRGDKTYINGL
                     RCDKNTVRPLARIAKVYRQFSDENNRQDLHFAFEERKVLGPKLTWHLAQEDK"
     gene            complement(126445..129297)
                     /locus_tag="HMPREF0733_RS00525"
                     /old_locus_tag="HMPREF0733_10107"
     CDS             complement(126445..129297)
                     /locus_tag="HMPREF0733_RS00525"
                     /old_locus_tag="HMPREF0733_10107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GcrY protein"
                     /protein_id="WP_013397462.1"
                     /db_xref="GI:503162801"
                     /translation="MQTYYDRTYIQGELSRFTQQWRQKIDSHRRSSRKNFEISETQTF
                     WNSLLACFGIKPGTVAEFERPARRASTGNHGRIDMFWPSVLLVEQKTEGKNLEEALDQ
                     ARDYIAGGSIPEENLPRYLAVSDFERFIFVNRRTGDREEFTLEQLPDRYDTLKFLAGE
                     EAISAEEQQELTIAASKIMANLYQAMMGDTDTPVGEEAAQNAEDEDLRVQETSMFLTR
                     ILFLLFGDDAGIWEMHLFTRFLRKHTREDGSDLGTQINALFEYLDTPESKRTRMRHVP
                     ELMARFPYVNGSLFAERTPTEYFTRELREQLLIACGFDWSQISTAIFGSMFQLVKSRE
                     ARRAAGEHYTSEENILKTINPLFLDDLRARAESLIASTKGSKTKRAELAAFLDELGSM
                     HFMDPACGSGNFLQVAYMRLRELETRVLTEIHRLEDSGGFTLDASLNTRLSISQFHGI
                     EINWWPSKIAEVAMFLSEFQADRTLARALGQVPTRLPITSVAHIVHADALTTNWREMI
                     PAEATKVFVFGNPPFLGQWTMSKAQTSAMKTVWGKDYDGYLDFVTAWFWKAVQFFDQD
                     FEGEFAFVSTNSIAQGQPVPALFGPIFREGWRIKFAYHTFPWDSQAPGQAAVHCVITG
                     FTRSEDYKPRLFEYDWNARQTREAADVKNINAYLLDAPNILVKKRSKPLATQLPPVRF
                     GSKPVDGGNLIVEEKDYAEISSDSIAAKYLRPFRMGKELVRGLDRWCLWLEDANPADI
                     TKSPVLKKRTEAVRTVREKSPKKATQELASVPRLFAEIHQPDTSYVGIPRVVSETRLF
                     YTVAHLSSDVIAGDKVYTAIDPDGFLFAIISSSMFITWQKAVGGRLKSDLSFSNTIVW
                     NNLPLPEVAEDLRSKIITAGQKILKVRKALAEKHNGRVSLADMYNPLAMNAELLKAHK
                     ELDRHVDKAFGAAKLCASNNKRLEILFARYAELTAE"
     gene            complement(129603..130598)
                     /locus_tag="HMPREF0733_RS00530"
                     /old_locus_tag="HMPREF0733_10108"
     CDS             complement(129603..130598)
                     /locus_tag="HMPREF0733_RS00530"
                     /old_locus_tag="HMPREF0733_10108"
                     /EC_number="4.2.1.24"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="WP_013397463.1"
                     /db_xref="GI:503162802"
                     /translation="MNLTRRPRRLRITAAMRALTAETALRPEQLIQVFFVRDGISEPQ
                     PISSMPGQYQHTLDSLIPAVRQAVEAGIKCIDLFGVPLDDDKDEIGSAAWDDNGILNR
                     AIAACRADFGDEIVIMADTCLDEFTSHGHCGVLVDDGYGTMIVDNDATVELYCKMAVS
                     QARAGAHTVSPSGMMDGQIAAMRAALDEAGFQNVSIMAYSAKYASAFFGPFRDAVESS
                     FTGNRKTYQQDPANRRESLLEVQTDIDEGADMVMVKPAGSYLDIVREVAEFSPVPVAA
                     YQVSGEYAMIEAAAANGWIDRRAVALEALRSIHRAGADMILTYYAAEAARWLRED"
     gene            complement(130644..131543)
                     /locus_tag="HMPREF0733_RS00535"
                     /old_locus_tag="HMPREF0733_10109"
     CDS             complement(130644..131543)
                     /locus_tag="HMPREF0733_RS00535"
                     /old_locus_tag="HMPREF0733_10109"
                     /EC_number="4.2.1.75"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen III methyltransferase"
                     /protein_id="WP_013397464.1"
                     /db_xref="GI:503162803"
                     /translation="MARVLLTRTAAQGAPFERALNDLAAERGIPKIQVDFAPMQLPRT
                     VAPEYSLFSLVSLAAEGAFLWATFTSANAVRSCAELFGTSFAWALRDGGTRIACVGSA
                     TARALREIGLEPHFMPEKQDALGMLAEFPTEGANPELGIPESLRKPQNTPESAALGWD
                     DMLSAQANVLVFEGANARPTLREGLVGLGFRAVRAVVYEMVPATASVLEAGEISCVNA
                     RELTAGTGSNSAAVDVIIATAPSRLKELVGENPNPERIPPAVAIGSTTARTCEELGLR
                     HRTADSPTPEALALAAIELLHSA"
     gene            complement(131547..132662)
                     /locus_tag="HMPREF0733_RS00540"
                     /old_locus_tag="HMPREF0733_10110"
     CDS             complement(131547..132662)
                     /locus_tag="HMPREF0733_RS00540"
                     /old_locus_tag="HMPREF0733_10110"
                     /EC_number="2.5.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylbilane synthase"
                     /protein_id="WP_013397465.1"
                     /db_xref="GI:503162804"
                     /translation="MSDPYILGTRGSALALTQSTLAAEHIVQMFNAHSREHGAERTLS
                     FDITTVKTDGDVLTGPLATLGGTGVFAAALRQRLLDGDTPDGVDVAVHSLKDLPAEPC
                     PGLVIAAILEREDPRDALVARDNLTLDTLPTGARVGTGSPRRAAQVHALRPDLEIVDI
                     RGNVGTRIARVKGLEEHGNRQVIVRDSAETDEAAHRGIGTENTGDCDAVILAVSGLKR
                     LGKESVITEYLDPSRMLPAPGQGALAIEVRETEFANPDTATLFNSEISQPVRTLGEAL
                     IAADHFETHLEVTAERRLLRRLEAGCAAPIGAYATVKDGDLVLTAVVASPDGTESLRH
                     TSATGELDVPGAERLGIRVAEDLLQMGAAALAGLEVK"
     gene            complement(132738..134102)
                     /locus_tag="HMPREF0733_RS00545"
                     /old_locus_tag="HMPREF0733_10111"
     CDS             complement(132738..134102)
                     /locus_tag="HMPREF0733_RS00545"
                     /old_locus_tag="HMPREF0733_10111"
                     /EC_number="4.99.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="WP_013397466.1"
                     /db_xref="GI:503162805"
                     /translation="MSETVRAGCCGNIPDDVCPNATDPANTASNGPAALTPETLKSYR
                     GECGITRSRTAVPAPYDLVILSSFGGPEGQEDVIPFLRNVTAGRGIPDERLEEVATHY
                     RANGGISPINEQNRALLVALREAMQERGPHIPIVWANRNWKPYVTDVVQQAYEEGHRN
                     ILVLATSAYPGYSSCRQYREDYGVALEKLGLQDRMRIDKIRQFFDAPGFVEAFTEGLE
                     NGLKQVRNTVAERIADGTAAAGNGRIRIMFCTHSVPTSAANEAGPRGIDYEGGSAYVE
                     KHLQVARAILAKIREQDESLLDNIDWELVYQSRSGSPSTPWLEPDVNDAIDKIAGDVD
                     GIIMVPLGFVSDHMEVLWDLDTEAMETCRNHGIVAVRTPTPGVHPAYVESLRRLIAER
                     MAEPAESGHDRRESVFGESISGELGWFDECDPDCCKPLRGQEKPVIAEYTPKKTCACC
                     HEHV"
     gene            complement(134099..134812)
                     /locus_tag="HMPREF0733_RS00550"
                     /old_locus_tag="HMPREF0733_10112"
     CDS             complement(134099..134812)
                     /locus_tag="HMPREF0733_RS00550"
                     /old_locus_tag="HMPREF0733_10112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chlorite dismutase"
                     /protein_id="WP_041321828.1"
                     /db_xref="GI:752673119"
                     /translation="MQHSPADENKRGREEGETLHYTLYTVFARAGQRAESASSAEAIA
                     EFEQLIEELKADGVTLRGLYDVSAMRDNADVMVWTHGPTPEKLQAAVRKIRRTALFSA
                     TTIVWSTMGVHREAEFTRNHAPAYARQKAPEAWVCVYPFVRSYDWYYMNPERRAEMLK
                     NHGMKAIDFPQVLANTVATFGLNDYEWVLALEAPELVDLVDMMRHFRNTEARLHVREE
                     IPFYTGRRVNAADVAEVLA"
     gene            complement(135070..136533)
                     /locus_tag="HMPREF0733_RS00555"
                     /old_locus_tag="HMPREF0733_10114"
     CDS             complement(135070..136533)
                     /locus_tag="HMPREF0733_RS00555"
                     /old_locus_tag="HMPREF0733_10114"
                     /EC_number="1.3.3.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoporphyrinogen oxidase"
                     /protein_id="WP_013397469.1"
                     /db_xref="GI:503162808"
                     /translation="MNMVHQHKNHHAPSAIVVGGGISGLLAARRLTDAGVNVTVLDQN
                     DYLGGALGAHKVAGLVLDSGAESYATRTPTVTNLVKELGLDDQIVHPNSHGSWLYLPQ
                     GARKTPSTGIMGIPGDLSDKSLAGVLGKSGLRRARMDKVLPASVGANAKTLGELVRAR
                     MGKKVLDNLVAPVVSGVYSTHPDMLDIDAVIPGLREGLKKHKSLAAASAAIRAQAPAG
                     SQVAGLSGGMHLLIEQLIEKMPAPVRYIPECGVIAVDRDPITNEWVVIRRRSDGEKAA
                     SVGADYLVIATDGSTAARLLGPHIKGSSLPNIDPGPEVALVTLVVDQPALNSNPRGTG
                     LLVSEAVTNVRAKALTHATAKWAWVAEEAGKNRHVVRLSYGRGGEQSTFSDVSLDEDQ
                     LITLALRDASKLLDVPITAQNLVDADVVRWNGVLPLSTPGYRERVQLFRERAAELDTV
                     CTVGSWAAGSGLAAVVRDTQEQLDQFIAHITQKRASK"
     gene            complement(136581..137768)
                     /locus_tag="HMPREF0733_RS00560"
                     /old_locus_tag="HMPREF0733_10115"
     CDS             complement(136581..137768)
                     /locus_tag="HMPREF0733_RS00560"
                     /old_locus_tag="HMPREF0733_10115"
                     /EC_number="4.1.1.37"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="WP_013397470.1"
                     /db_xref="GI:503162809"
                     /translation="MTETQQPQRAANGADSQQSRSTVGAHPRDRQRDLLTEAQLSRLD
                     ASHPLRAAQTADSPMLQALTGRASEHRPVWFMRQAGRSLPEYRKAREGIPMLDACLTP
                     ELAAEITVQPVRRHKVDAGIFFSDIVIPMKLAGVNVDIVPGRGPVLEHPVRTLDEVRA
                     LPELTDAALDPIRESVAATVEMLGSTPLIGFAGAPFTVAAYMVEGGPSRDHLRPRTMM
                     HADPVAWRELAQWAARTAGQFLRAQIEAGASAVQLFDSWAGSLGEADYRRYVQEHSAA
                     ALGMVEEFGVPRIHFGTGTAELLPAMHEAGADVIGVDYRLPLDEANRRLNGAVPLQGN
                     IDPALLAAGRETLYAHADEVLAAGASAPAHIVNLGHGVPPTTDPQVLTDLVTYLHERT
                     RRP"
     gene            138045..139292
                     /locus_tag="HMPREF0733_RS00565"
                     /old_locus_tag="HMPREF0733_10116"
     CDS             138045..139292
                     /locus_tag="HMPREF0733_RS00565"
                     /old_locus_tag="HMPREF0733_10116"
                     /EC_number="1.2.1.70"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA reductase"
                     /protein_id="WP_013397471.1"
                     /db_xref="GI:503162810"
                     /translation="MATYSFVASHRIIDLTTVALLSNGAAGIPELFRTETAQNLGVTG
                     TIVLATCNRLEIYVQLSVAEHLGPVSDMLYAEIAQKSELDAELIADSFEIYENLEAAK
                     HLFTVASGLESAVVGEREIAGQVRRALAYAQEEGTVPGELVQLFEHAAHTARQVGQHT
                     TIGSQGRSIVSVALDLADAVAEKDWKTRRALVFGTGAYAGATIAALRERGCEDIWVNS
                     RSGRAPEFAAKRDVRAVPKGETYKAMEQADVIVGCSGGSDPLSPAEIPPGHHTILDLA
                     LSRDFDPAIADLPQVELITLESVRLAAPEETEEAVATAERIVESETQAFAARQKTRNI
                     DSAIVALRSHTMEVLDEELDKVRSQFGCTAATEQLELAMRRMVKSLLHTPTIRAKQLA
                     TQGRTSDYIAALETLYGITIDDR"
     gene            139441..139668
                     /locus_tag="HMPREF0733_RS00570"
                     /old_locus_tag="HMPREF0733_10117"
     CDS             139441..139668
                     /locus_tag="HMPREF0733_RS00570"
                     /old_locus_tag="HMPREF0733_10117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_004005102.1"
                     /db_xref="GI:490103248"
                     /translation="MEIKIGIRHISREVTLETKESVETIRTKVADAITNGSLLEITDD
                     KGATTLVPGEQIGYVELGSEEKRRVGFGVGA"
     gene            140094..141836
                     /locus_tag="HMPREF0733_RS00575"
                     /old_locus_tag="HMPREF0733_10119"
     CDS             140094..141836
                     /locus_tag="HMPREF0733_RS00575"
                     /old_locus_tag="HMPREF0733_10119"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase"
                     /protein_id="WP_013397473.1"
                     /db_xref="GI:503162812"
                     /translation="MTDAQNATTDEAQPSSVPQSSPKSFADFGVRQDISDALAAVGIV
                     SPFPIQEMTLPVALAGHDIIGQAKTGTGKTLGFGLPTIQRVVGRDDDQWGSLQKPGAP
                     QALILVPTRELAIQVGNDLAVASKLRNARVATLYGGVPYEPQVEQLTKGLEVVVGTPG
                     RLIDLYQHGALTLTQVKTVVLDEADEMLDLGFLPSVEKIMGYLPTDRQTMLFSATMPG
                     PVITMARKYMTKPMHISAADPEDHAKTKASIRQVVYRVHHMDKDEMLGRILRAHGRGR
                     TVIFTKTKRDAARVADELIARGFAAAPLHGDLNQGAREQALRAFRNGKVDILVATDVA
                     ARGIDVEDVTHVINHRVPEDEKTYLHRTGRTGRAGHEGTAVTFVDWEDIARWRLINDA
                     LDLGVSDPVETYSSSEHLFYDLDIPPGTKGRLPRSEQTLEGLDAEHLDDYGDSRSSRG
                     SSRSSRGSRSRGSKSRGSRGGSRKAKSEKRGEDSFSKDAAPKRERRPRRRTRRVEGET
                     VETRAEKTAGKAPEKKSAKKSGSAKDSSVEKTDSQGSSRRRSRRRSGNKGKADWTTAK
                     KAGRKKSDAASGEE"
     gene            141877..143085
                     /locus_tag="HMPREF0733_RS00580"
                     /old_locus_tag="HMPREF0733_10120"
     CDS             141877..143085
                     /locus_tag="HMPREF0733_RS00580"
                     /old_locus_tag="HMPREF0733_10120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methyltransferase"
                     /protein_id="WP_041321829.1"
                     /db_xref="GI:752673120"
                     /translation="MPKRSDTDDIPAFDPNGSSLVVQADNLAYLSELPSASFTVIYID
                     PPFNTGKTQTRRTLKTAPAADGEEQGKGNGNRTGFQGKSYTSALQTLASYHDAFEDYW
                     AFLEPRIRQAHRLLTEDGTLYLHLDWREVHYAKVMCDMIFGRDCFINEIIWAYDYGAK
                     STKRWPTKHDNILMYVKNPQEYYFNADAVDREPYMAPGLVTEEKAARGKLPTDVWWHT
                     IVSPTGKEKTGYPTQKPLGLLKRMIAASSRPGDWVLDFFAGSGTTGAAAAALGRRFVC
                     VDQNPPAIEVMAKRLNVDAESFADYRGVPRGAAVLFTPHRHVGVRGGTSRDALTAASR
                     RALAEQSKKIQERVKPIDGAHSQFVRHPSTDVLERELRAQAREKLRKDRKRQELTKKR
                     KQVKETAASS"
     gene            complement(143198..144061)
                     /locus_tag="HMPREF0733_RS00585"
                     /old_locus_tag="HMPREF0733_10121"
     CDS             complement(143198..144061)
                     /locus_tag="HMPREF0733_RS00585"
                     /old_locus_tag="HMPREF0733_10121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol phosphatase"
                     /protein_id="WP_013397475.1"
                     /db_xref="GI:503162814"
                     /translation="MTERYDLHIHSAISDGTQPLTELIPLIHEAGLTGFALTDHDTAC
                     GWSQAAELAGEYGLDFLPGAEFSCRYTYCDEQGRKRTKSVHLLAYGYDPQSSELARRV
                     EEIRRSRAGRARRIVELLSADYPLTWEHVQEQTGEENASVGRPHIADALIAAGIVASR
                     EEAFGRILYAGSPYYVPQESMDPLEATRLVRAAGGVPVVAHPMSENRGPALPLEYLGQ
                     MVDAGLAGVEVYHRENSEPNRARLLEFARDRELLVTGSSDYHGAGKPNRLGENTTARE
                     TVEAIRAQIRG"
     gene            144188..145717
                     /locus_tag="HMPREF0733_RS00590"
                     /old_locus_tag="HMPREF0733_10122"
     CDS             144188..145717
                     /locus_tag="HMPREF0733_RS00590"
                     /old_locus_tag="HMPREF0733_10122"
                     /EC_number="3.4.11.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro aminopeptidase"
                     /protein_id="WP_013397476.1"
                     /db_xref="GI:503162815"
                     /translation="MTENTKKSTGAPTTDHRDTPKASAFQEFIASNWEPAADDGYTRE
                     RVADFAAQRRKKISQKFPGERLVLPAGPLKVRSNDCDYRFRPHSAFAHQTGLGVDHEA
                     DAVLVFEPVDEGTGDNGSNHEVTLYFRPLAGRDTTQFYADARYGEFWVGPRPTLKEFS
                     ERYGVRTKDLSELEVAITKNAGAQALGGVRIRLVREVDPSIDALVDTSRYNTGVALEE
                     SDKLDSELTVALSEARLIKDEIEVENLQRSVDMTVKGFEEVVRELPKAVAHHRGERVV
                     ETAFFSVARTDGNDLGYDTIAACGNNATILHWIRNNGTVDEGKLLLLDAGVEDDTLYT
                     ADVTRTFPVNGKFTEVQAKVYNAVLDAADAAFKVAVPGRKFHEIHDAAMEVLAHRLEE
                     WGLLPVSAEVSLTVEGGQHRRWMPHGTSHHLGLDVHDCAQAKAELYTGATLEPGMVFT
                     IEPALYFKDEDLSVPEEYRGIGIRLEDDVLCTEDGNVNLSAALPRTVEEIEEWMAKLA
                     Q"
     gene            complement(145811..146818)
                     /locus_tag="HMPREF0733_RS00595"
                     /old_locus_tag="HMPREF0733_10123"
     CDS             complement(145811..146818)
                     /locus_tag="HMPREF0733_RS00595"
                     /old_locus_tag="HMPREF0733_10123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397477.1"
                     /db_xref="GI:503162816"
                     /translation="MTQMPPNMPPSSYLASRLAQANGQLMPQGEPVAAFSRREEAFAA
                     FDVLAAANYPITALYLVNEGLKQVEYPTQQGYGRPLLVALIQGILAGLFYSALVSTAG
                     TNFLSAASSAVPIAVAVFVVWKIFELRRGGSGRYPMRGEAVPERTIVYALSDYSSEAR
                     RILSANPLFQKAVAAVSSGTPSAGTGLPHAASPYVSYTPTPAGESSQTPSTPSTVTDQ
                     QGGYPENHESAAKNPNPEQADADGQQSSAAQEIPWQSPAGGDSQAPQTAASQTAMQQT
                     QPDDSSEQSSPAADARERKPQAPAAQRFGLRIDDPEEYAKTIRQAPTRETPKPKGVKE
                     D"
     gene            147003..148331
                     /locus_tag="HMPREF0733_RS00600"
                     /old_locus_tag="HMPREF0733_10124"
     CDS             147003..148331
                     /locus_tag="HMPREF0733_RS00600"
                     /old_locus_tag="HMPREF0733_10124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="WP_004005110.1"
                     /db_xref="GI:490103256"
                     /translation="MSNTKFSAPSKIYIARLLGLDVFDPFGDRLGRLRDVVVLKRGFG
                     AALAAGAHLRKGSEPVVVGIIIEVLGKKRVFMPMTRVRSIDASQIISTGLVNLRRFEQ
                     RNSETLVVGELFDRRVRLLDGSGDAVIEDVAIEQRRNGDWGVTELFVSRVSSSSGWRR
                     RSKETLVVDWDQAMLSTELEPQAATAFVANHENSKPADLADAIHEMNDKRMVEIAAEL
                     QDERLADVLQELPEEDQVQILSYLADERAAQVLEEMEPDDAADLLIELDDVQREKLLE
                     LMEPDEADDVRRLLEYDEGTAGSLMNPVPIILSPEATVAEALAHIRAEEISPAMAAAV
                     LVARPPLETPTGKYLGLVHMQQLLRVPPSESIGHILDTDTEPVSDQASLAELARVLAA
                     YDLTIIPIVNESHRLVGAVTIDDVLDALLPEDWRTFDDGTPVRKVGRRFV"
     gene            148324..149115
                     /locus_tag="HMPREF0733_RS00605"
                     /old_locus_tag="HMPREF0733_10125"
     CDS             148324..149115
                     /locus_tag="HMPREF0733_RS00605"
                     /old_locus_tag="HMPREF0733_10125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397478.1"
                     /db_xref="GI:503162817"
                     /translation="MSDQNRRNENLKHEENPRIDKARILKDRLEKKYAERSRDTRETS
                     RSGNRAESQLSTPAERKNKLFAYNPNPDAFGRMTEAFARYMGTPQFLLWMTVFCGVWL
                     GWNTLAPEELQFDPRSLNFTLLTLMLSLQASYAAPLLLLAQNRQDDRDRVVASEDRKR
                     DQQNLEETQYLTREIASLRIALREVATRDFVRSELRDILEELKSIQEEQERQAEQLQD
                     IGDDIEELEDADGEENTEAESHTANTENSPDAKAPTAHKGERPTS"
     STS             148670..150249
                     /standard_name="Tjp1"
                     /db_xref="UniSTS:144635"
     gene            149299..150555
                     /locus_tag="HMPREF0733_RS00610"
                     /old_locus_tag="HMPREF0733_10126"
     CDS             149299..150555
                     /locus_tag="HMPREF0733_RS00610"
                     /old_locus_tag="HMPREF0733_10126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_013397479.1"
                     /db_xref="GI:503162818"
                     /translation="MSSPNATPHDRSRENEPAPDNPLEDALWAALARVEDPELRRPIT
                     ELGMVEYARVLAEEDDPQRRYAQVKVLLTIEGCPLKNTIDTQVREAAAAVTGIDRVQL
                     ELGAMNSEQRGALKSRLKPERTNPFTAPGSLTRIFGVVSGKGGVGKSSMTANLAAAFA
                     SRGLAVGIIDADVHGFSIPGLMGITEAPTRLDDLIIPPTVDVPASVRGKDDTGGQESA
                     TGASGGFVKVISIGMFLKDNQPVAWRGPMLHRALEQFILDVHFGALDVLLLDLPPGTG
                     DIAISMAQLLPNAELILVSTPQHAAVDVAERAGTLSLQTQQKVVGVIENMAAMTLPDG
                     TVLEMFGSGGGEHLAKRLTEALDYSVPLLGSVPLDVALRTGGDEGMPVVWGHPESATS
                     VEIRNIAAQLLRRKDSLAGKPLSLIV"
     gene            complement(150721..152199)
                     /locus_tag="HMPREF0733_RS00615"
                     /old_locus_tag="HMPREF0733_10127"
     CDS             complement(150721..152199)
                     /locus_tag="HMPREF0733_RS00615"
                     /old_locus_tag="HMPREF0733_10127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397480.1"
                     /db_xref="GI:503162819"
                     /translation="MSESLDSPTYGEAEKPRGPISPLNPRRAERFNPTRFTLHTGGFF
                     FFDSLGTSATAALHRVAHRFAALPAWAQVLSIWAPSRLWGFIVFWVVGMQQVAGQQKM
                     GDGHVPTLLEYLGWWDAEWYERIYKNGYPVQLPVYDNGVVGHNTWAFLPAQPTIAGFI
                     ADTTGIPFALSTVMLSVVVSFALAWVIYLLFVGCLNWREHGVFEIRASQESPHRSLAL
                     WSVAAYGFCGPAVIFGTGYAESLTIFAIALFILLLAYDRYLWAIPVAFLATQSRPVGV
                     PLGALAGIWWLYCVASEYHVRRAADGPSALSTGQALMGAFAARSLHLISALIVCFFAL
                     GHALHAAIATGRIDAYLATEIGWSGRTVDDGQHYVVQWVTNLNIYLPQWNMWAVALLV
                     AVGFFAYFCWIFSRSTRSLLHPVMLIWCAAYMVYLGVFWLPQTSTFRILLPLFPLALV
                     LINYGKDSRAYRWLLVFFGLVLQLIWVGWLWHSHGPGDLNIP"
     gene            complement(152364..152735)
                     /locus_tag="HMPREF0733_RS00620"
                     /old_locus_tag="HMPREF0733_10128"
     CDS             complement(152364..152735)
                     /locus_tag="HMPREF0733_RS00620"
                     /old_locus_tag="HMPREF0733_10128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase TatA"
                     /protein_id="WP_013397481.1"
                     /db_xref="GI:503162820"
                     /translation="MFGISGTEFVVLAVLTFFVIGPERMPEYVRQIKELIKTVRRMAF
                     EARDEFKDTLGDATLNEINWRQYDPRQYDPRVIVREAFAEDDAERAREAKERSEANKP
                     AASNLNRLPRGAYAPYDTEAT"
     gene            complement(152890..154392)
                     /locus_tag="HMPREF0733_RS00625"
                     /old_locus_tag="HMPREF0733_10130"
     CDS             complement(152890..154392)
                     /locus_tag="HMPREF0733_RS00625"
                     /old_locus_tag="HMPREF0733_10130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397483.1"
                     /db_xref="GI:503162822"
                     /translation="MNNPSDKTPQQHTTVPSIPWSSANKPVSQTKPASTSSRDEDKNP
                     SKTSTLNADITWLYIASGERLRRMGDAFLRLPAWLQVMLVYAFSRVWGFIIFSVVGNQ
                     QLLGPWGQHLGYLPFISTWDSSWYGQIAQSGYPSKLPYDSTGAVAQNPWAFYPLFPLI
                     AGGINRITGIGYYPVAATVALLAGFAAAWVIYLLFTTSLNIVGYRDQSHGEKVSEAAS
                     STEDSKDVKTSRHNLALWAVAAVAFLPVAPVLQVPYAESLNLVFLVWVLLLMMRKQYL
                     LMMPVALLACLSRPVGVPLGATAGLWWFACLITEAKAQQQRRQRGEDQERFESVFLRS
                     LPQLGSALFICFCALIWPIYAWQITGRIDAYTATETAWRQGDLAPVAPWISQGIAYFG
                     YFTILLFPLLIVGYAAFLASPLVKRVLASPIILWCACYGAYLLIFLNPQSSTFRLLLP
                     LFPLMLPIVAISSSRAYRWLLIGSGALLQLVWVGWLWHWKQLPGGGDYPP"
     gene            complement(154389..154610)
                     /locus_tag="HMPREF0733_RS00630"
                     /old_locus_tag="HMPREF0733_10131"
     CDS             complement(154389..154610)
                     /locus_tag="HMPREF0733_RS00630"
                     /old_locus_tag="HMPREF0733_10131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397484.1"
                     /db_xref="GI:503162823"
                     /translation="MNILITLLAVVVLILTLLGTFGLTSQRLYPGKKLAAYIARDGLD
                     VFADKTAPRESVSDESTLTSSPVLPQHSR"
     gene            complement(154865..155998)
                     /locus_tag="HMPREF0733_RS00635"
                     /old_locus_tag="HMPREF0733_10132"
     CDS             complement(154865..155998)
                     /locus_tag="HMPREF0733_RS00635"
                     /old_locus_tag="HMPREF0733_10132"
                     /EC_number="3.5.1.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397485.1"
                     /note="catalyzes the formation of succinate and
                     diaminoheptanedioate from succinyldiaminoheptanedioate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-diaminopimelate desuccinylase"
                     /protein_id="WP_013397485.1"
                     /db_xref="GI:503162824"
                     /translation="MTISLDLNVSMPELTRTLLDIYSVSGEEKTIADAVYESLSAYPH
                     LHLTRDGDAMIARTEFGPRNGEERTRILLAGHLDTVPLPKVAGSLGTVPASIVEDNGD
                     WILYGRGATDMKGGVAVQLKLAAELGEHDTDYNLTYVFYDHEEVASELSGMARLIRNH
                     GELLTDADFGVLLEPTDGTIEGGCNGTMRFYLRTAGLAAHSGRAWKGENAIHKLAGAL
                     RVLEEYEPQTYKVEGLAYREGLNAVQVSGGVAGNVIPDAAALHINYRFAPNKTLDEAK
                     AHVTEIFDGYELDFVDLSPAARPGLDTPLAASLIAAVGQEPKPKYGWTDVARLSEIGI
                     PAVNFGPGDALLAHTDNEHVSFSALTRCYTDLLFWLHTEVDED"
     gene            156106..157080
                     /locus_tag="HMPREF0733_RS00640"
                     /old_locus_tag="HMPREF0733_10133"
     CDS             156106..157080
                     /locus_tag="HMPREF0733_RS00640"
                     /old_locus_tag="HMPREF0733_10133"
                     /EC_number="2.3.1.117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-carboxylate
                     N-succinyltransferase"
                     /protein_id="WP_013397486.1"
                     /db_xref="GI:503162825"
                     /translation="MVGMSENLSSESRYASGVALVNVVAAGNEAGTVLDAWFPAPALT
                     QTPDLSLADELDALVADHPERNARTEVRTASINLDEAPEDAVDAYLRLHLLSHTLVRP
                     NSINLDGLFGKLANVAWTNHGPVLASEFQKLALGLRKLGHLSVSHIDKFPRLVDYVVP
                     AGVRVGDGDRLRLGAHLSPGTTVMHEGFVNFNAGTLGTSMVEGRISQGVVVGDGSDVG
                     GGASTMGTLSGGGTQRVSIGERSLLGAESGIGIALGDDCVVEAGLYVTAGSRVSVLIP
                     GEEPRVVKAAELSGVSNLLFRRNSVSGAIEVLPRAKNTVELNDALHLN"
     gene            157412..158425
                     /locus_tag="HMPREF0733_RS00645"
                     /old_locus_tag="HMPREF0733_10134"
     CDS             157412..158425
                     /locus_tag="HMPREF0733_RS00645"
                     /old_locus_tag="HMPREF0733_10134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="WP_037231082.1"
                     /db_xref="GI:739370066"
                     /translation="MKVLVTGGAGYIGSHTVLELLNAGHEVVVMDNLSNSSETSLQRV
                     AELAGRAPEFHKVDLLDFEGMKKLFLEIRPDAVIHFAGLKAVGESAEKPLWYYQTNVA
                     GTLNLLYAMDAADCRSIVFSSSATVYGEPESMPLIEKLNMDAQSCYGRTKEHIEDMLV
                     DLAASDDRWNIALLRYFNPVGAHESGRIGEDPSGIPNNLVPFIAQVAVGRREHLNVFG
                     NDYPTVDGTGVRDYIHVVDLADGHLKALDYISEHGGLHTWNLGTGNGYSVLEVLHAFE
                     KACGKELPYKIVARRPGDVAVSYADPSSALADLGWSASRDIDTMVRDHWNWQKNNPNG
                     YDA"
     gene            158774..159535
                     /locus_tag="HMPREF0733_RS00650"
                     /old_locus_tag="HMPREF0733_10135"
     CDS             158774..159535
                     /locus_tag="HMPREF0733_RS00650"
                     /old_locus_tag="HMPREF0733_10135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter ATP-binding protein"
                     /protein_id="WP_004005123.1"
                     /db_xref="GI:490103269"
                     /translation="MTQASAPAEKPLVELNEVNKYYGTNHVLKNINLAVNKGEVIILL
                     GPSGSGKSTLCRTINRLETTSSGSIHIDGKELPKEGRELAKLRAEVGMVFQSFNLFAH
                     KTILDNVTLGPRRIRKLSKEQAEAEAMELLAKVGVDSQAEKMPAQLSGGQQQRVAIAR
                     ALAMKPKVMLFDEPTSALDPEMVNEVLDTMVSLARDGMTMIVVTHEMGFARKAADRIV
                     FLADGEIVEEATPDEFFTKPKSERARDFLSKIIDH"
     gene            159546..160394
                     /locus_tag="HMPREF0733_RS00655"
                     /old_locus_tag="HMPREF0733_10136"
     CDS             159546..160394
                     /locus_tag="HMPREF0733_RS00655"
                     /old_locus_tag="HMPREF0733_10136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_004005124.1"
                     /db_xref="GI:490103270"
                     /translation="MKKSFFNRAATKFFAASTAAALALGFTLTGCSSASDSKPKIRIG
                     IKYDQPGLGYQDGQDYTGFDVDVARYIAGKLGYSEDQIEFVESPSANRENMLSNGQVD
                     MILATYSISDSRKKSVDFAGPYYVAGQDLLVRADETSITGPDSLNGKNLCSVTGSTSA
                     KKIQDTYAKNVNLVKQNSYSDCVVALNGGVVDAVTTDDIILAGLAATKANKGKLKLVG
                     KTFTTEKYGVGLPKGTDKCEAINKAINEMVEDGTWENLVKKHTDGTGYSYNTEKNPPK
                     PSASCA"
     gene            160415..161098
                     /locus_tag="HMPREF0733_RS00660"
                     /old_locus_tag="HMPREF0733_10137"
     CDS             160415..161098
                     /locus_tag="HMPREF0733_RS00660"
                     /old_locus_tag="HMPREF0733_10137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012903145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004005126.1"
                     /db_xref="GI:490103272"
                     /translation="MSFFDQLGALFAKYDVLGAFWVNIQLTFWAAIGSFVLGAILALM
                     RISPVPSLRWAGTIYVHLFRNTPLTILMTLALLGVWTQFQLSFSTDFETNFFVYAVIV
                     LSIYHASFVCEAIRSGVNTVPTGQAEAARAIGLGFMDTARMIIFPQALRGSITPLGNT
                     LIALAKNTTVASVASVAEASGMMKSMIEFDANMVLAIFLIFALGFVAIVVPLGILTTW
                     SSRKLAVKR"
     gene            161095..162030
                     /locus_tag="HMPREF0733_RS00665"
                     /old_locus_tag="HMPREF0733_10138"
     CDS             161095..162030
                     /locus_tag="HMPREF0733_RS00665"
                     /old_locus_tag="HMPREF0733_10138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate ABC transporter permease"
                     /protein_id="WP_013397487.1"
                     /db_xref="GI:503162826"
                     /translation="MKFFNSDVTTSTTVLFDAPGPRAKARTRVFNIAAILVFIAFAVY
                     VLSVMGAKGQLEAEKWTDLFTAKAWGSYYLPGLVSTLQAAGISVITSIAFGVIFGMAR
                     LAQNRVLRWFGTIVVEFFRAVPVLMMMIFFWLFLSRFSWINPSQLPFLAVVIGLTFYN
                     GSVIAELLRSGVKQLPRGQGEAGLAIGLTPGQTLRTILMPQAFNAMMPSMLSQFVVIL
                     KDTALGYIISYPELLASARRIGSGDGNVLQTLLLAAALFVIVNFALTALATWLSSFLA
                     SRTSSKVRKVDLVPGEVDNPNPPTLQMFLLPGKRK"
     gene            complement(162113..163291)
                     /locus_tag="HMPREF0733_RS00670"
                     /old_locus_tag="HMPREF0733_10139"
     CDS             complement(162113..163291)
                     /locus_tag="HMPREF0733_RS00670"
                     /old_locus_tag="HMPREF0733_10139"
                     /EC_number="2.6.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397488.1"
                     /note="catalyzes the formation of
                     N-succinyl-LL-2,6-diaminopimelate from
                     N-succinyl-L-2-amino-6-oxopimelate in lysine biosynthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyldiaminopimelate aminotransferase"
                     /protein_id="WP_013397488.1"
                     /db_xref="GI:503162827"
                     /translation="MRAYGLDLPEYPWETLIPYRKLAAEHPGGTIDLSIGTPVDDTPQ
                     LIQDALTAASDAPGYPTTHGTVELRQAIVDWFARCRGVTGLSTDQVMPTVGSKELVAW
                     LPFLLGLGTDPGTQERDVVVYPRVAYPTYDIGARFAGAQSVPADSLDELPEDVRRRVR
                     LVWVNSPANPNGVVRDVAELREIVRQARDIGAVVASDECYAELGWGAWDEARGGQRVP
                     SILDPRVCDGDFTGLFAAYSLSKQSNLAGYRAAFIAGDAQLMPNLINSRKHAGMIVPA
                     PVQRALIAALGDEAHVAAQKNKYRARREELLAAITAAGGRVENSEAGLYLWTTFGEDT
                     WASIERLAKLGIVAGPGVFYGEDGAGYVRIALTASDEDIAKASERLTASAGIGNAVRE
                     "
     gene            complement(163468..163788)
                     /locus_tag="HMPREF0733_RS00675"
     CDS             complement(163468..163788)
                     /locus_tag="HMPREF0733_RS00675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_004005129.1"
                     /db_xref="GI:490103275"
                     /translation="MTYVIALPCVDVKDRACVEECPVDCIYEGDRTLYIHPDECVDCG
                     ACEPVCPVEAIYYEDDVPEEWSEYITANAEFFDDLGSPGGAAKMGPTGKDVPFIAALP
                     PQGE"
     gene            complement(164112..165491)
                     /locus_tag="HMPREF0733_RS00680"
                     /old_locus_tag="HMPREF0733_10141"
     CDS             complement(164112..165491)
                     /locus_tag="HMPREF0733_RS00680"
                     /old_locus_tag="HMPREF0733_10141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1D-myo-inositol
                     2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase"
                     /protein_id="WP_013397490.1"
                     /db_xref="GI:503162829"
                     /translation="MPETSAPQYPAQGEHLMKNAKRDLLPSGYTPSEAVMLFVHAHPD
                     DETTATGATMAYYAKKGAKVHLLTLTRGEMGEVIPPKLQHLEVGKPGNSDNGEALGEY
                     RTVELNNATAKLGVRKRFFLGEEPATAPGALNIYRDSGMAWGKDGKPVANPKASEDSL
                     TAQPIAPQAEAIANAIRDIKPDVLITYDLDGGYGHPDHVRTHQAVLEALKILGDSNDR
                     PILTWGIEGEFSEQDARQQCAITGSVEAKREAMKAHGTQIVVTGDTTFEFSNKVEQKI
                     SAVETYRLLDGNAQRKIPETPTQAGIVSLLITCILLGTLAGIAGSIYHAWVMYTGETP
                     LPVGLVFGFATVFFASLWASLALCRGGATVITGAFAFLVIYALAFMRPDSPFVLVNPD
                     YPPIGLYGTLWLLGTPVISLLAFFVFTRTKEGNAFYNTPRQVHLRHRRAEEKARRAQT
                     LNNSSRTAP"
     gene            complement(165626..167536)
                     /locus_tag="HMPREF0733_RS00685"
                     /old_locus_tag="HMPREF0733_10142"
     CDS             complement(165626..167536)
                     /locus_tag="HMPREF0733_RS00685"
                     /old_locus_tag="HMPREF0733_10142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_013397491.1"
                     /db_xref="GI:503162830"
                     /translation="MSENTASRPDLRNVAIVAHVDHGKTTIVDAMLKQTHAFSAHADV
                     EDRVMDSGDLEKEKGITILAKNTTVFYDGPSANGETITINVIDTPGHADFGGEVERGL
                     SMVDGVVLLVDASEGPLPQTRFVLRKALAAKLPVILVVNKVDRSDARIDEVVSETMDL
                     LLGLASDLSEEVPDLDLDSVLDVPVVYASGKAGAASLNQPADGALPDNDDLEPLFKTI
                     IEHVPAPTYNPDEVLQAHVTNLDSSPFLGRLALVRIFNGTLKKGQTVAWARQDGDIKN
                     VRISELLATKALERVPAEEAGPGEIVAVAGIEDITIGETLTDAENPKPLPLIKVDDPA
                     ISMTIGINTSPMAGRVKGAKVTARQVKDRLDRELIGNVSIKVLPTQRPDAWEVQGRGE
                     LALAILVEQMRREGFELTVGKPQVVTKTIDGKLYEPMEHMIIDVPEEHLGAVTQLMAA
                     RKGRMENMSNHGTGWVRMEFAVPARGLIGFRTQFLTETRGAGISSSYSIDPEPWAGDI
                     EYRTNGSMIADRAGVVTPYAMINLQERGTFFVEPTSEVYEGMVVGMNSRADDMEVNIT
                     KEKKLTNMRSSTADSFENLTPPKKLTLEECLEFAREDECVEVTPEAIRIRKVILDANE
                     RVREFRRRARAN"
     gene            complement(167743..168681)
                     /locus_tag="HMPREF0733_RS00690"
                     /old_locus_tag="HMPREF0733_10143"
     CDS             complement(167743..168681)
                     /locus_tag="HMPREF0733_RS00690"
                     /old_locus_tag="HMPREF0733_10143"
                     /EC_number="3.6.1.22"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylhexosamine kinase"
                     /protein_id="WP_013397492.1"
                     /db_xref="GI:503162831"
                     /translation="MGTGAKTACGRVETMSVQQNLYLVISRRGETLINRDGTVHYLPE
                     APQNTIIETSLEPKFRKPSDREGTDYCAAYLEDEELLALAEDLSRANADAPITASQNG
                     FRFYPVHKDSAGRARYAAALAKRDYLLEMEYSAYSGDPALIDRERQVRRTASGELVFP
                     RIEPAVMALVLSRDGERVLLANNRLWHENRFALIAGFVDPGENLEQAVAREVYEETGL
                     QALNLDYRMSDVWPFPRSLMICYRVTVDDTQPVEHLDGEIRAARWFTAPELAQAIAES
                     EAIRQKQGVPKLELPGTNAVARRMLDDWLHEKNAGR"
     gene            complement(168803..170973)
                     /locus_tag="HMPREF0733_RS00695"
                     /pseudo
     CDS             complement(168803..170973)
                     /locus_tag="HMPREF0733_RS00695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005135.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
     gene            171379..173049
                     /locus_tag="HMPREF0733_RS00700"
                     /old_locus_tag="HMPREF0733_10146"
     CDS             171379..173049
                     /locus_tag="HMPREF0733_RS00700"
                     /old_locus_tag="HMPREF0733_10146"
                     /EC_number="5.3.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="WP_013397495.1"
                     /db_xref="GI:503162834"
                     /translation="MTITNPTTTSAWSALTQHKASLTPNLRAWFEQDPSRAQKLSFDA
                     ADLHVDLSKNLVTEETVQLLLKLAEEVNLAERRDAMFTGEHINVTEDRAVLHTALRRP
                     KGYSPALVVDGQDVDSDVHAVLNKIYAFADRVRSGEWTGVSGKRIETVVNIGIGGSDL
                     GPVMVYEALKPYADAGISARFISNIDPTDVAEKVSDLNPETTLFIVASKTFGTLETLT
                     NARVARDWLLTALGEANALQGKTAEEAVAKHFIAVSTALDKVAAFGIDPENAFGFWDW
                     VGGRYSVDSAIGTSLAIVFGPKVFEEFLAGFHAMDEHFRTAPFEKNVPVLMGLLNVWY
                     VNFLGAETHAVLPYDQYLHRFPAYLQQLTMESNGKSVRADGSFVDYSTGEVFWGEPGT
                     NGQHAFYQLLHQGTRLIPADFLAFANPAHPTKDGEQDVHELFLANFFAQTQALAFGKT
                     EDEVRAEGTAEHVVNARIFSGNRPSTSIMASRLTPRVLGELIALYEHITFVQGIVWGI
                     DSFDQWGVELGKKLALDLVPAIKGDREVLARQDSSTASLIDYYLKHRK"
     gene            complement(173159..173833)
                     /locus_tag="HMPREF0733_RS00705"
                     /old_locus_tag="HMPREF0733_10147"
     CDS             complement(173159..173833)
                     /locus_tag="HMPREF0733_RS00705"
                     /old_locus_tag="HMPREF0733_10147"
                     /EC_number="3.4.19.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C15"
                     /protein_id="WP_013397496.1"
                     /db_xref="GI:503162835"
                     /translation="MTKTLLITYFGPFPGVSVNPSGVTARQVADVLANESAVRVITRE
                     VPVSYTGSSEALGEMLTDIRPDAVLSLGVAVGRDKVSFEKVAINLDSADIEDNDGVVR
                     VDEAIAPDGREAYFSTLPVRASYERLRGVGLPVEISYTAGTYVCNHVFYEAHRILELQ
                     GRRIPAGFVHIPATRVDHEPADAQTTLTAHADAGGVESESVPTLPEAVVARIVAELVR
                     DTLKVM"
     gene            173870..174289
                     /locus_tag="HMPREF0733_RS00710"
                     /old_locus_tag="HMPREF0733_10148"
     CDS             173870..174289
                     /locus_tag="HMPREF0733_RS00710"
                     /old_locus_tag="HMPREF0733_10148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397497.1"
                     /db_xref="GI:503162836"
                     /translation="MARTHRHKEEPVFLLQDTPDALREIGVDDEQEALAAVREPAQAL
                     EGASFLQAVGRFYRFYTLGRGHASRSEVLWALLYLILTTGVVLGLTVYLGMLSEDPHM
                     ESLIRVLYMLMMTLTPVWIIVHILPLSSLLSRARGKN"
     gene            complement(174386..174931)
                     /locus_tag="HMPREF0733_RS00715"
                     /old_locus_tag="HMPREF0733_10149"
     CDS             complement(174386..174931)
                     /locus_tag="HMPREF0733_RS00715"
                     /old_locus_tag="HMPREF0733_10149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005139.1"
                     /db_xref="GI:490103285"
                     /translation="MRDSFNLAVYCGATMGNDPDFAACARELGTLCAKRGVGVVYGGG
                     RTGLMGTVAGATLDAGGKVYGVVTHQLVEWEGVYPGQTTLDIVDTMHQRKIAMINKAD
                     AFVAMPGGPGTLEEFFEVFSWQFLKIHTKPVALLNVNGYWDKLVEAMQYMASTELLRP
                     SYLERLIVVDTPEELMKVLGK"
     gene            complement(175092..175568)
                     /locus_tag="HMPREF0733_RS00720"
                     /old_locus_tag="HMPREF0733_10150"
     CDS             complement(175092..175568)
                     /locus_tag="HMPREF0733_RS00720"
                     /old_locus_tag="HMPREF0733_10150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="WP_013397498.1"
                     /db_xref="GI:503162837"
                     /translation="MVDEHSAIDTAQRIVHVSAVVIRNHAGHVLTVRKAASHGFMMPG
                     GKPDAGESPLYTAVREVTEELGFAPDPAQMVYLGKFDAPALNESGFVVRAETFEYMPH
                     PQEEKILEQLSPHAEIAELRWVDPAADYTDQAPLNTECIFPLICRISPGETPSVPL"
     gene            complement(175611..175988)
                     /locus_tag="HMPREF0733_RS00725"
                     /old_locus_tag="HMPREF0733_10151"
     CDS             complement(175611..175988)
                     /locus_tag="HMPREF0733_RS00725"
                     /old_locus_tag="HMPREF0733_10151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005141.1"
                     /db_xref="GI:490103287"
                     /translation="MDIVIKRIYEEPSPDDGYRVLVDRLWPRGVSKDKAHLDEWAKDL
                     APSTEARRDFGHKPENFESFKQRYLNELDSNSEVYPELERMVAGAQKLQSSRVTLLYG
                     AKSPTCNHAVILRDYLIDRLKSL"
     gene            complement(176741..178240)
                     /locus_tag="HMPREF0733_RS00730"
                     /old_locus_tag="HMPREF0733_10152"
     CDS             complement(176741..178240)
                     /locus_tag="HMPREF0733_RS00730"
                     /old_locus_tag="HMPREF0733_10152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-aminobutyrate permease"
                     /protein_id="WP_013397499.1"
                     /db_xref="GI:503162838"
                     /translation="MAQTSQQSSPASDASDVAADTDLKRGLSARHMQMIAIGGAIGTG
                     LFVASGKTISTAGPGGAIVAYGLIGIMVLFLMQSLGEMAAHLPVPGSFQTYATRYVSS
                     SFGFAMGWNYWFNWAITVAAELVAVGEVMKYWLPETPSWVWAGIFLVLLTGLNALSAK
                     AYGEGEFWLATIKVVTVIVFLIAGIAMIFGVLGGASPGTSNWTTGEAPFVGGPVAIFA
                     IFMVAGFSFQGTEMIGIAAGESKNPRRDVPRALTSVFWRIMLFYIGAMVVIGFLIPYT
                     DPNLLTAAEGDINISPFTLIFERAGIAFAAAAMNAVILTAVLSAGNSGLYVSARMLFS
                     LAQEGKAPKIFTKVNKGGVPMPALMATSAVGAIGFIASVISPDAAYLWLVNVSGLAGF
                     ITWVGIAVAHYRFRRAYMRQGHNLNDLPYTAPFFPVGPIIAFIMCLLVIGGQNYEAIL
                     AGDWVGVMSSYIGLPVFVAVWAIHAIVTRDRLIPLEQVDVSGLEVKTSK"
     gene            complement(178580..181282)
                     /locus_tag="HMPREF0733_RS10680"
                     /old_locus_tag="HMPREF0733_10154"
     CDS             complement(178580..181282)
                     /locus_tag="HMPREF0733_RS10680"
                     /old_locus_tag="HMPREF0733_10154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014585069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397501.1"
                     /db_xref="GI:503162840"
                     /translation="MTSHQRKSPGIKKALVTTGTAASLLGASFVAMPATFANVPDQVP
                     TSPACDCQPGQPGQPGQGGQGQTGQPGTPGDNGQTSTPGGGNGQTGDNGQPGQGGQGQ
                     TGQPGDHDSDHPDTPDTPDTPDTPGDHDSDQPGTPGQGGQGQTGQPGTPGQGGQGQTG
                     DNGQPGTPAQPGTPGQGGQGQTGQPGTPGQGGQGQTGQPGTPGQGGQGQTGQPGTPGQ
                     GGQGQTGQPGTPGQGGQGQTGQPGTPGQGGQGQTGQPGTPGQGGQGQTGQPGTPGQGG
                     QGQTGQPGTPGQGGQGQTGQPGTPGQGGQGQTGDNGQPGTPAQPGTPGNNGGNGGDGI
                     GGNGGNVTPGTPGQPGTPGNNGGNGGNGIGGNGGNVNPGTPGQPGTPGGNNGGNGGNG
                     IGGNGGNVNPGTPGQPGTPGGNNGGNGGNGIGGNGGNVNPGTPGQPGTPGGNNGGNGG
                     DGIGGNGGNVTPGTPGQPGTPGEPGQPGQPGQPGQPGQPGQPGQPGTPGEPGQPGQPG
                     QPGQPGQPGQPGTPGEPGQPGQPGQPGTPGEPGQPGQPGTPDPSLPDNNKGGGDWNIG
                     GGGYYEGDFNLNGHYQGGWDFGATVPGWGQWDNGGDDCFQGGGNFFQVTPGENNAVTP
                     APNGHGGLGWVGDNATPNTPGNAGNTPAPNGHGGLGQTGDTPQSVAPDTTGQGGLGQV
                     GGNTTTETGQATGSESQGAQFGQLSESYTRTSEGEILQEQQRHQDHGGLGLTADNDSD
                     NGRGGLGQTGDNRAPQRQGTVTISNDVDIDLNAGAVSRGSEAVNTNASEDVNGGGAGL
                     VGNGSENNNGGGAGLVGNAPNVNGGGAGLVGDNGNGGSAQVNGGGNAAVNQATQADNG
                     SSASSQKSGSLAHTGVSGVLFAAGLGLLSLMTGLVVLLTRRNKA"
     repeat_region   180318..180440
     repeat_region   180765..180887
     repeat_region   182160..182259
     repeat_region   182641..182740
     gene            182890..183546
                     /locus_tag="HMPREF0733_RS00750"
                     /old_locus_tag="HMPREF0733_10157"
     CDS             182890..183546
                     /locus_tag="HMPREF0733_RS00750"
                     /old_locus_tag="HMPREF0733_10157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005147.1"
                     /db_xref="GI:490103294"
                     /translation="MIIIITVAIAIFYLTYDAVRRSREKKLPYVFKRKYHQLEGWLNV
                     TALGLTIDALIIPWDMAWTGTWNTILFGGTALLSANFLYAYEMEYFSIHSDGTIKYHT
                     RTGKIITTHFNCINKYSYSPWGKNFRGGEDISFPDIFHLRTRDDKTAAKFSIKATKEY
                     SIAAHVIFRQEKGRWAHIHSSEDQAQIEEILHDKKAIIQYLTENPQGTDLADDSAHYM
                     "
     gene            complement(183662..184126)
                     /locus_tag="HMPREF0733_RS00755"
                     /old_locus_tag="HMPREF0733_10158"
     CDS             complement(183662..184126)
                     /locus_tag="HMPREF0733_RS00755"
                     /old_locus_tag="HMPREF0733_10158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="osmotically inducible protein OsmC"
                     /protein_id="WP_004005148.1"
                     /db_xref="GI:490103295"
                     /translation="MNKAPAEKTIVRRESEDYREVRVERVDRLRYRAHGANGATLDFG
                     VGDGLLTPVELLLAAIAGCSSVDVDAVTTRREIPQVFEVLASALKKHEDGAVRLDDVE
                     VDFDVQFPETEAGTQAAKMVDRLIRLSAEKDCTVSRTVEHPTKVEFHNVNAE"
     gene            184298..185173
                     /locus_tag="HMPREF0733_RS00760"
                     /old_locus_tag="HMPREF0733_10159"
     CDS             184298..185173
                     /locus_tag="HMPREF0733_RS00760"
                     /old_locus_tag="HMPREF0733_10159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter"
                     /protein_id="WP_013397504.1"
                     /db_xref="GI:503162843"
                     /translation="MKDTAKETSDAEHYAAIGHNPTESGFKQALRASSVVLASFVVLG
                     LGLGVIISAHHLPWWLAPAISLIVYAGSVEFLVVEMIATGASVGAIGFTTLLVNSRHL
                     VYGISFPLQNVKGFWAKLYAIYTLCDESYALNTGPNRNTLSHARILWVSTFLHISWVA
                     GTTAGFFIGASFLSHLEGMDFAMTALFTILAIDAYRAQRDNVTALLTLISGAVGIILA
                     PGSMLLVSMGTYTALLIVRFFIAKSRGTLPEHQIPAPENNASLTVAEDSTTDQVKTPS
                     PTFTHYTDPQENPHD"
     gene            185166..185504
                     /locus_tag="HMPREF0733_RS00765"
                     /old_locus_tag="HMPREF0733_10160"
     CDS             185166..185504
                     /locus_tag="HMPREF0733_RS00765"
                     /old_locus_tag="HMPREF0733_10160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter"
                     /protein_id="WP_004005150.1"
                     /db_xref="GI:490103297"
                     /translation="MINGHIDSGYIISAVLVAAAVTFVLRVLPFGLKKALAGSEVLDA
                     LSHWIPLGAVALLAIYAVSRIDFSSTHTAVPYLAGFVVTALVHLWKKNMVYSMIAGTA
                     TCVILINWVF"
     gene            185514..186467
                     /locus_tag="HMPREF0733_RS00770"
                     /old_locus_tag="HMPREF0733_10161"
     CDS             185514..186467
                     /locus_tag="HMPREF0733_RS00770"
                     /old_locus_tag="HMPREF0733_10161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter"
                     /protein_id="WP_013397505.1"
                     /db_xref="GI:503162844"
                     /translation="MFERSSHPNRHLGEAPQQTSDEQVLDIIASAGLATSSIPVVQER
                     EQALRAGDDALSLELRRTGESGFREAMRVASLVMLGLFFVGIGLGVVIHSLGFPWWLA
                     PLLPGVLFAGSVEFVLLTMMAAGASLVSVAVMTLLINSRHLMYGLSYPIERVHGSLAK
                     FYTVYTLIDEAFALNSGPERHTLRGSRILWIHAGMHVSVILSSTLGFFLGSSFLAHLE
                     GFDFVMTALFTVLALDAYRANPDRLTVLFSVIAAAVALIIAPGSMLLVAMAVYMALLV
                     GRYAAAKKRGSLPQHMLVADELTHHRTEHDRAEETPHEPAQ"
     gene            complement(186546..187046)
                     /locus_tag="HMPREF0733_RS00775"
                     /old_locus_tag="HMPREF0733_10162"
     CDS             complement(186546..187046)
                     /locus_tag="HMPREF0733_RS00775"
                     /old_locus_tag="HMPREF0733_10162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol peroxidase"
                     /protein_id="WP_041321518.1"
                     /db_xref="GI:752672809"
                     /translation="MAEITFQNNLAVHTSGNLPAIGSKVPAFSVLDADLAEVTGAQFS
                     GKNLVLNIFPSVDTGVCAASVRNFNKEAAGLDNTVVVNVSHDLPFALGRFCAAEGIEN
                     VVTTSAFRSSFGQDFGVTMTDGPLEGLLARAVVVVNPAGEVVYTELVPEITNEPNYEA
                     ALAALK"
     gene            187296..187937
                     /locus_tag="HMPREF0733_RS00780"
                     /old_locus_tag="HMPREF0733_10163"
     CDS             187296..187937
                     /locus_tag="HMPREF0733_RS00780"
                     /old_locus_tag="HMPREF0733_10163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397507.1"
                     /db_xref="GI:503162846"
                     /translation="MSRFPVKPLVFCAGAALLLSSCGNPFGASTDSGSSSQAARSSSS
                     SSSSSASTSASHSPTASATSSSASPSPSVSVVTVTANPQPEASTVTVTASSNSNSGSS
                     SSSGRLALDSNASKLRGHHSWSLSSADTSTFDSSAELSWITVGSSDGASHIMLFHHGD
                     YLGTGTLNPVQGSPSVSRNSANQISASVGSSQATFTWDSAQEKIVMNGDLPTG"
     gene            188399..188815
                     /locus_tag="HMPREF0733_RS00785"
                     /old_locus_tag="HMPREF0733_10164"
     CDS             188399..188815
                     /locus_tag="HMPREF0733_RS00785"
                     /old_locus_tag="HMPREF0733_10164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397508.1"
                     /db_xref="GI:503162847"
                     /translation="MSLKKNVSEDSRSGGKKHIAPVVTAGFLGTTGVLHFAKPEHYDA
                     IVPRALPGSARFYTYASGAAELGIAGLLTVPTTRRAGALAAIALYTAVFPANVQMAWD
                     WRHESAFKRVVAFGRLPLQLPMIRRAWRIYKTSSRR"
     gene            188895..189590
                     /locus_tag="HMPREF0733_RS00790"
                     /old_locus_tag="HMPREF0733_10165"
     CDS             188895..189590
                     /locus_tag="HMPREF0733_RS00790"
                     /old_locus_tag="HMPREF0733_10165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_013397509.1"
                     /db_xref="GI:503162848"
                     /translation="MSSTRQNPAEQAKALASQLKCPMGDTGQELAHSLNLGNLPMIVS
                     ALNALGIEEDDRILEAGPGNGGLLNYVLSLAENLHYDGVEISPLMYEQARAANNVFIA
                     EGLAEYALYDGVNLPYEDGIFTKVLSVNTVYFWEEPAWLLAEMCRVLTAGGRVCLSFC
                     EKDFMKTLPFTKYGFALYDAADIVALTQELPLHTVAVQHLHDMAVAGGSARLVRRDYV
                     NLVFKKETISSTT"
     gene            189612..190046
                     /locus_tag="HMPREF0733_RS00795"
                     /old_locus_tag="HMPREF0733_10166"
     CDS             189612..190046
                     /locus_tag="HMPREF0733_RS00795"
                     /old_locus_tag="HMPREF0733_10166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397510.1"
                     /db_xref="GI:503162849"
                     /translation="MVVPFVMAGVLMALAFGAHIFVGTRETLSLRPVAHPANTENMVR
                     VPANHTELSRHWTQAMCAFQLVSIDLLLITIVTFLLAFTDLLPAKREIGLFIAAYLGA
                     WGFVWLVQLAAVKVERRTYYMLGQWMLFFLCAALMVWGSLAL"
     gene            190184..190933
                     /locus_tag="HMPREF0733_RS00800"
                     /old_locus_tag="HMPREF0733_10167"
     CDS             190184..190933
                     /locus_tag="HMPREF0733_RS00800"
                     /old_locus_tag="HMPREF0733_10167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_041321835.1"
                     /db_xref="GI:752673126"
                     /translation="MMSTTLLDKLKPEFRTNPPAEENGILLCLDEAQIQGDNAKYMKF
                     YNRLASVYDLGERWFGRLAYGNEVAQMRQQFMKELEWFPGCSALYVSIGTGTDLRYLP
                     DDIEVSAIDWTGADISLGMLKKCQKIWGGRANLNLVNCAAEDLPFIDQSFDVVLHVGG
                     INFFSDKKRAIKEMIRVAKPGTKIMIADETSDYIDSQYKKNVLTRKAYKNATFDLSEI
                     EALIPEDMEDASTSLLWNDQFYCITFRVPQD"
     gene            complement(191088..191699)
                     /locus_tag="HMPREF0733_RS00805"
                     /old_locus_tag="HMPREF0733_10168"
     CDS             complement(191088..191699)
                     /locus_tag="HMPREF0733_RS00805"
                     /old_locus_tag="HMPREF0733_10168"
                     /EC_number="3.4.11.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S51"
                     /protein_id="WP_013397512.1"
                     /db_xref="GI:503162851"
                     /translation="MMRAFLCSYFAGVEPAFKNFLRGNPSQQQVVFIPTASTVENTTF
                     YVQDALNVFKNLGLTPDILDIAEVDSETAKLRIEQAEVLYISGGNTFYLLQQLKSKDL
                     INFIVEKVRHGMMYVGESAGAMVASPDIEYARVMDDSDAALGMFNFKALGIVDFYPAV
                     HEEEEPFVQAVRRMKSEYSDKLDLVPINNRRAIRVEGGVRFIV"
     gene            complement(191851..193089)
                     /locus_tag="HMPREF0733_RS00810"
                     /old_locus_tag="HMPREF0733_10169"
     CDS             complement(191851..193089)
                     /locus_tag="HMPREF0733_RS00810"
                     /old_locus_tag="HMPREF0733_10169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013397513.1"
                     /db_xref="GI:503162852"
                     /translation="MEYKMSNTRFILTGVGALALLGASVVPSVPSFAAEGNAGAQTQQ
                     AISTLPGGQNTGTNNTNGNNTNINTGAKVTSVEGGPLNPLTGQNNLTITGEGIDLNKS
                     FDGLGAEVYEVDADGDFTGENLVQDGGGLVVTEDGHFRGTAKVKGDFDPQKHYVLYIM
                     SYPGHGNRTIEAKQDLPVQQVDSKDLQSSVTLTTNSSKTNMLSSHLNTNVLTLTGTHF
                     DDVKQVKIKVEGLDENGQVNETLATKDVSAEMKNGNFTTQIQIPGSKIQEGKHYRVLI
                     ESSSDDWVRAVTKDLYGDTDDEVVGIINGAPLSRSAAENHLKVAGGGFNPAAAAQNGS
                     KVRLIFTEYNVELDDPSSDEIVNTTVTPKPNGDFEGDLTIPGNKLQAGKKYVVRAYLE
                     YADGGVASDITLKTLVPTTN"
     gene            complement(193362..194450)
                     /locus_tag="HMPREF0733_RS00815"
                     /old_locus_tag="HMPREF0733_10170"
     CDS             complement(193362..194450)
                     /locus_tag="HMPREF0733_RS00815"
                     /old_locus_tag="HMPREF0733_10170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein argonaute-2"
                     /protein_id="WP_013397514.1"
                     /db_xref="GI:503162853"
                     /translation="MEFMMAFRYSRSAMTGAAIFTLAGVTVLPLAQANAAPASPQDEA
                     RSGSTQGQPNSAAQNGQDQGQQQSANANGQDQQGANASGQNQDGATQGQQQSANGQGR
                     QQGANADAQGQQGANASDQSQNGATQGGAAQDPSQAASGGEQQQGQPSASQDQQGTNA
                     SGQGRQQGANADAQGQQAQPGATQDQQQSANANANGQGQQAQGQQQGAPASQSSSNSN
                     SASQNNQSRQSQPSAPANQNSGFIAITSVDGFIDPQNTDNVLSVETTGIDNTHRVQYE
                     PRVQELDEFGNIVNDDVSNGGGSSLGSDGSFGMYVSVDGTKINPNHQYRVYIDVFDQD
                     TLTASYAYYPIVVWNRTYIPVVPLSAAQ"
     repeat_region   193958..194069
     repeat_region   194215..194637
     gene            complement(195198..195854)
                     /locus_tag="HMPREF0733_RS00820"
                     /old_locus_tag="HMPREF0733_10171"
     CDS             complement(195198..195854)
                     /locus_tag="HMPREF0733_RS00820"
                     /old_locus_tag="HMPREF0733_10171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013397515.1"
                     /db_xref="GI:503162854"
                     /translation="MIDSSKPLRADARRTVNIVLHAAEQVLRRDPTASLEQVATVAGV
                     TRTTIHRRFASREALLAELSNIAVREFYEAFESASPETAPVMVALHRLTVNVMRVKAI
                     WLYAMAHLSDDDPAVITKQRTLLGRLGKVFERAQREGYIAADVDLIWAQRMFRAMTDE
                     AVAGITGTGMGAKAPPMPTGPDDLARLEAVVDDAELDRLTTLIMHTLFTGIGTHEPSI
                     "
     gene            195948..196307
                     /locus_tag="HMPREF0733_RS00825"
                     /old_locus_tag="HMPREF0733_10172"
     CDS             195948..196307
                     /locus_tag="HMPREF0733_RS00825"
                     /old_locus_tag="HMPREF0733_10172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397516.1"
                     /db_xref="GI:503162855"
                     /translation="MTTKQTVLNYYSAIHAENWQDYISDKLAYGFNSAEQNLGKQDYL
                     QGAGNFFNSTTNVELAHLVVEGDKAAVIARYTAKSPAGDTQIFEVPEFLTVRDGKIIA
                     SSIYLDGAAFMAFIKGE"
     gene            196439..197221
                     /locus_tag="HMPREF0733_RS00830"
                     /old_locus_tag="HMPREF0733_10173"
     CDS             196439..197221
                     /locus_tag="HMPREF0733_RS00830"
                     /old_locus_tag="HMPREF0733_10173"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013397517.1"
                     /db_xref="GI:503162856"
                     /translation="MNTNSALSGKNAVITGGSDGIGYGIAEEFARQGANLFLIARTPT
                     KLAEASARLSEYPVTVHTFAADLTDISEVHRAAEHALDILGSIDVLVNNAGIARFIPF
                     EQTDENAFDEHFNLNVKAPYFLAQKLLPELAKNSGNIVNISSYFSKRMLPGRPSTVYS
                     MTKGALNLFTQSLAFETGSAGVRVNAIAPGMVETPQLLRNVSAMPPEAQEQMKQNASA
                     LIPLGRIGNVDDIGRAAAFLASDAAAWVTGAVLSVDGGVTTH"
     gene            complement(197344..197976)
                     /locus_tag="HMPREF0733_RS00835"
                     /old_locus_tag="HMPREF0733_10174"
     CDS             complement(197344..197976)
                     /locus_tag="HMPREF0733_RS00835"
                     /old_locus_tag="HMPREF0733_10174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyladenosine transferase"
                     /protein_id="WP_041321836.1"
                     /db_xref="GI:752673127"
                     /translation="MTTTSVYCLFFDGYETLDAMGPIEFLHRVPDVRMRYISVAGASE
                     NGGSLVRSAQGFTLKTEIVESLPPGSILLIPGGIGTRSLVMNNLFLQNLAKLVQQSQT
                     CLTVCTGAALLAATGVLDGKPATTNKRAFEWVRGTRPQVGWRQKARWVSTEKFYTSSG
                     VSAGMDMTLGFIADRWGLETAQEIASRCEYLWQNDPDTDPFAHSAEFESA"
     gene            198276..199235
                     /locus_tag="HMPREF0733_RS00840"
                     /old_locus_tag="HMPREF0733_10176"
     CDS             198276..199235
                     /locus_tag="HMPREF0733_RS00840"
                     /old_locus_tag="HMPREF0733_10176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_041321519.1"
                     /db_xref="GI:752672810"
                     /translation="MSLPTTMRAVQYDKFGGSDLLTINEVPVPSPRPGQVLVRVQAFS
                     VNRIDVIVREGEMRLFTGKRFPKGTGVDALGEIVSVGTGVMDYKVGDIVWGFNGSISM
                     APTGTAAEYVLFRENRIHHAPRIQNQIDAAALPLVSLAALQVLRKNLKLQAGQRLLVV
                     GASGGVGHAALQIGQILGAQVATVSAEENIALCRELGSIEAYDHEALPDPEKVEKFDA
                     ILDCGGVVTAFYRNYLKPGGRMMTVSPDGLPAVLTSLFTNRRVGFLLATKASSEAMKW
                     ITNAVERGQLRPVIEKKYSLEELGAAQDRVAEKHTRGKLVVVM"
     gene            199373..199573
                     /locus_tag="HMPREF0733_RS00845"
                     /old_locus_tag="HMPREF0733_10177"
     CDS             199373..199573
                     /locus_tag="HMPREF0733_RS00845"
                     /old_locus_tag="HMPREF0733_10177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397521.1"
                     /db_xref="GI:503162860"
                     /translation="MRIGMRKPSVKRMIKARTTGRAKRAVKSAVIPGYGKRGMGFVKN
                     PKRAVKGAIYRRTTFSVWDLFR"
     gene            199903..200718
                     /locus_tag="HMPREF0733_RS00850"
                     /old_locus_tag="HMPREF0733_10178"
     CDS             199903..200718
                     /locus_tag="HMPREF0733_RS00850"
                     /old_locus_tag="HMPREF0733_10178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-methyltransferase"
                     /protein_id="WP_013397522.1"
                     /db_xref="GI:503162861"
                     /translation="MLKIEDAISETLLIPLYMKHLASQQPDPIIKDEAAGRIVSQLDY
                     NFSKFDNIIHTVVGTAIRSDYFDRLAADFIKRQPNPVIVNVGCGLDSRRERIGEIAQN
                     VPFYSLDLPDVMTLRIKLLPPQGSEVFLGTSAFDAGWMDELNDLQPNAQFLFVIEGMM
                     MYFDRYTVRALFRDLAQRFHGSEIAFDVINSWMVTHSDQHEALKHSRARFVFGCDDDH
                     EPERWAHNLRLVSAKRLMTDFPAWKKSGALSAMIARRLPFLKESFRMLHYRID"
     gene            201095..201352
                     /locus_tag="HMPREF0733_RS00855"
                     /old_locus_tag="HMPREF0733_10179"
     CDS             201095..201352
                     /locus_tag="HMPREF0733_RS00855"
                     /old_locus_tag="HMPREF0733_10179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="WP_037231102.1"
                     /db_xref="GI:739370086"
                     /translation="MGQLIGMIIAGAIIGALARLFMKGQQNISILWTIILGAVGAFVG
                     GWVAGLLGVAETAGIDWIRWILSIIAAMVAISIYLSVTHKK"
     gene            complement(201492..201863)
                     /locus_tag="HMPREF0733_RS00860"
                     /old_locus_tag="HMPREF0733_10180"
     CDS             complement(201492..201863)
                     /locus_tag="HMPREF0733_RS00860"
                     /old_locus_tag="HMPREF0733_10180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease"
                     /protein_id="WP_013397524.1"
                     /db_xref="GI:503162863"
                     /translation="MILVDTNVWIDHLHRTEPELSELLMSDEICCHDLVLTELALGSL
                     KKRNEFLSALSELKQLPTVDDHEVRWFIEKRKLWGRGLSAVDVHLLASVVVVPGTTLW
                     TRDKRLRDVAQDLGCRFENDG"
     gene            complement(201860..202057)
                     /locus_tag="HMPREF0733_RS00865"
                     /old_locus_tag="HMPREF0733_10181"
     CDS             complement(201860..202057)
                     /locus_tag="HMPREF0733_RS00865"
                     /old_locus_tag="HMPREF0733_10181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin"
                     /protein_id="WP_013397525.1"
                     /db_xref="GI:503162864"
                     /translation="MRITVTLDEKVVAKVAKLTGIEERSVLVREAMETLLRIENGRLL
                     AALGGSDPQAQAAPRHRNVQS"
     gene            complement(202124..202857)
                     /locus_tag="HMPREF0733_RS00870"
                     /pseudo
     CDS             complement(202124..202857)
                     /locus_tag="HMPREF0733_RS00870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887454.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase type 12"
     gene            complement(202854..203315)
                     /locus_tag="HMPREF0733_RS00875"
                     /old_locus_tag="HMPREF0733_10183"
     CDS             complement(202854..203315)
                     /locus_tag="HMPREF0733_RS00875"
                     /old_locus_tag="HMPREF0733_10183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397527.1"
                     /db_xref="GI:503162866"
                     /translation="MRFNDMNFSDGHYVQIPASWDAQEFTHRFLSATPPWVRVIMRVR
                     NRVVQKMGFTVQPATKSTQLEVAVGSSAGPFTFTEVTDEHVIGGHKDKHIEFSSKFVV
                     TAAEEGSTSARGGIETHAQPQSAVGKVYLTCIWPFHKILVPYMLRQVEIKP"
     gene            complement(203427..203654)
                     /locus_tag="HMPREF0733_RS00880"
                     /old_locus_tag="HMPREF0733_10184"
     CDS             complement(203427..203654)
                     /locus_tag="HMPREF0733_RS00880"
                     /old_locus_tag="HMPREF0733_10184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397528.1"
                     /db_xref="GI:503162867"
                     /translation="MREQHTMPKDIAAALKNAGLRTDYKARPAYQRNDYIGWINRAKT
                     PAMRIERLEQMLTELAQGGIYMGKEHKASRK"
     gene            complement(203881..204447)
                     /locus_tag="HMPREF0733_RS00885"
     CDS             complement(203881..204447)
                     /locus_tag="HMPREF0733_RS00885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-beta-cellobiosidase"
                     /protein_id="WP_013397529.1"
                     /db_xref="GI:503162868"
                     /translation="MNNGGGTSGNSGSGANGGAGAEQNSGNGAVQGDGGTGANGGGTQ
                     ADQGAGANGGVAGGGAQQQGAPGKTANQNPGSEGYVQVAEDGSWTATEPDGEIVRVYS
                     DGSWDRSNPATGNTDWVGADGSWITNENGLPNGSNKNSQVQPNGTYEVRMNGETSRET
                     PSGTPETPVMPNGSNAVTPKGAVQPAKR"
     gene            204464..204655
                     /locus_tag="HMPREF0733_RS10685"
                     /old_locus_tag="HMPREF0733_10186"
     CDS             204464..204655
                     /locus_tag="HMPREF0733_RS10685"
                     /old_locus_tag="HMPREF0733_10186"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775412.1"
                     /db_xref="GI:908631379"
                     /translation="MELEARDELDEEEAEDELEESFALFEPHALKAKMPATARDTHAV
                     AFLVVMIRILSPDKYQLVF"
     gene            complement(205056..205832)
                     /locus_tag="HMPREF0733_RS00890"
                     /old_locus_tag="HMPREF0733_10187"
     CDS             complement(205056..205832)
                     /locus_tag="HMPREF0733_RS00890"
                     /old_locus_tag="HMPREF0733_10187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein RtoA (Ratio-A)"
                     /protein_id="WP_013397531.1"
                     /db_xref="GI:503162870"
                     /translation="MRIMTTTKVPVYVSLAVAGIMALSACGSNSSNNASNSSPSSSSS
                     TTASKTASAGGSGTVSSGDGNSANSGSGANGGAANSGAEDGTGADQNSGTGAQSGSVT
                     GADTNGGAQANQGAEAQGGAQQQQADPGGANAANDEHNVTKNPNALTPGEYVIHREAS
                     WDYVDTTGSRYHVDGDGGWTSVGEDGTSTVAADGSWTKNYADGHTVARVEADGTYRVT
                     YDGQLSPEMPSNAVPVSPGKLPDPKAVPAVNPVQPTKPGM"
     gene            206214..206426
                     /locus_tag="HMPREF0733_RS00895"
                     /old_locus_tag="HMPREF0733_10188"
     CDS             206214..206426
                     /locus_tag="HMPREF0733_RS00895"
                     /old_locus_tag="HMPREF0733_10188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum-pterin-binding protein"
                     /protein_id="WP_013397532.1"
                     /db_xref="GI:503162871"
                     /translation="MKLSARNQLAGKVVEITEGATNGIVKIEIAPEVVISASITNESI
                     KELGLKVGETAYAVIKASNVMVGADH"
     gene            complement(206608..207678)
                     /locus_tag="HMPREF0733_RS00900"
                     /old_locus_tag="HMPREF0733_10189"
     CDS             complement(206608..207678)
                     /locus_tag="HMPREF0733_RS00900"
                     /old_locus_tag="HMPREF0733_10189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397533.1"
                     /db_xref="GI:503162872"
                     /translation="MLLLGVASFVATALIPIVLWRAGAKQAKRDSELQAKILARQTLV
                     SQLQRRDALLGIVTQSSDARYLEVLWKEILEYKEEDRDFLLAHLRANPALALPGTSTG
                     AKAQDNLTDAAVSNYVDGFERRYAESDGYPPYPGLLKFIAEAKRQGAKIEDSRIVALV
                     TGPTAEKQCPGHFFYYDLVLALPQAVSPLLHAVERIDSQAHGGLKLNVLTGALLAVKD
                     LEKGRRGATSNADEVEKLRGGIAQALAYLLHRGVLSSFNQWEIKGSTDSVTATAAWLI
                     RAVGWVADVDGHLAMRMIEKLALAIESVPKSEGNWGTDSHDVRQGFEWISEKCPELWE
                     IYGESLETAATEVGQRKEHLSS"
     gene            complement(207855..208985)
                     /locus_tag="HMPREF0733_RS10690"
                     /old_locus_tag="HMPREF0733_10190"
     CDS             complement(207855..208985)
                     /locus_tag="HMPREF0733_RS10690"
                     /old_locus_tag="HMPREF0733_10190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019175572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775413.1"
                     /db_xref="GI:908631380"
                     /translation="MIMNNEPVEENSKPAVSDKSKTDVMRSRSAKIHISSELLRTSNR
                     ISEIFYARKIPVLQEALKPFQGQYATHFEEALKPFREQNAARCRELIKVVQKQNWFID
                     SAAIQNLSLSKIDSINFEIPVFNNQFSASLDVIGEVIDNFLGSVNKTIPLEVFNLFKG
                     LPKKIPENLIEVGSSITIEQVLKVAKRDGIPLYAVPRMSTVLELVEADNGASRREILV
                     KYQESIFEDCENVLNKISSKYALEKKFFILAGLKALKNGHVEAAQALFTNTLDTVHQN
                     FWGLNKQTRTAISNHKEGDELPQLIKNMNFLDMFVFAPIWNSHMKFFGHAGEEPPAEY
                     SRHASVHGVSRRQYKLENCIQALMLVTSLLIYVDNIKKSSES"
     gene            complement(210021..210827)
                     /locus_tag="HMPREF0733_RS00910"
                     /old_locus_tag="HMPREF0733_10194"
     CDS             complement(210021..210827)
                     /locus_tag="HMPREF0733_RS00910"
                     /old_locus_tag="HMPREF0733_10194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397538.1"
                     /db_xref="GI:503162877"
                     /translation="MRVAKLLDYRLPVVACVLAVGVGLADLLWDQFRVFALGHAMITA
                     LFSMTIFAVLTTWFVNWFALRRERSKRAPVTGNAVRVTADMGWDVVTHVGMSWQNLYD
                     AQVREEVLRCLRAYNSQVAILALTPNTDTNFLELLACHDRLGAALESFFLTPPRTAQE
                     DSEKREEIRRLQAAVDAASWPYIKANMPYYWDDPGKFTPPFTEPPSWYARIPKRPERI
                     SPLGQYPEPSAEQDAPVVNLGSDEMAKMLDDECRAILFPDSEGSPIEEAE"
     gene            complement(210879..211964)
                     /locus_tag="HMPREF0733_RS00915"
                     /old_locus_tag="HMPREF0733_10195"
     CDS             complement(210879..211964)
                     /locus_tag="HMPREF0733_RS00915"
                     /old_locus_tag="HMPREF0733_10195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_013397539.1"
                     /db_xref="GI:503162878"
                     /translation="MALTIGIVGLPNVGKSTLFNALTRNTVLAANYPFATIEPNIGVV
                     NLPDARLNRLAEIFGSERILPATVSFVDIAGIVKGASEGEGLGNKFLANIREAHAIAQ
                     VVRAFDDPDVIHVDGKVDPASDMETINTELILADLQTLENAIPRLEKAVKIKKGDAAQ
                     LETYKQAQQILEDGNTIFSRAAAEKLEMAHLKELNLLTAKPFIYVFNADEGVLASEEK
                     QAELRELVAPAEAVFLDAKLEADMVELSEEEAREMLEMSGQDESGLDKLARVGFSTLG
                     LQTYLTAGPKESRAWTIYKGDTAPQAAGVIHSDFERGFIKAEVVSFDDLDAAGSMNEA
                     KARGKVRMEGKDYIMADGDVVEFRFNV"
     gene            212298..213233
                     /locus_tag="HMPREF0733_RS00920"
                     /old_locus_tag="HMPREF0733_10196"
     CDS             212298..213233
                     /locus_tag="HMPREF0733_RS00920"
                     /old_locus_tag="HMPREF0733_10196"
                     /EC_number="3.6.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013397540.1"
                     /db_xref="GI:503162879"
                     /translation="MNTTTVIQAENLTQVFRVPGGTLTAVDNLDLTISKGEIIALLGP
                     NGAGKTTLIDMILGLTEPARGTLTVQGISPKKAVQRGDIGAVLQTGGLLKDLTVRQTL
                     EMLATLYPTRIDIDKVLASADLTELAHRKVGKCSGGQQQRIRFAIATMHDPNILILDE
                     PTTGMDVTARRTFWERMDKLAETGKTIIFATHYLEEAQNFAQRIVLMRDGAIIADGTS
                     EEIRDLTGYRHVSFLADAPLAFDDLPHQQVEITQENGKYRHRLNISDAEDFVRLLLNT
                     QVVSDLEIVKPSMDESFMLLTSDTESAASSATKES"
     gene            213236..213997
                     /locus_tag="HMPREF0733_RS00925"
                     /old_locus_tag="HMPREF0733_10197"
     CDS             213236..213997
                     /locus_tag="HMPREF0733_RS00925"
                     /old_locus_tag="HMPREF0733_10197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013397541.1"
                     /db_xref="GI:503162880"
                     /translation="MLRYTLYEIRRSVLSPSSVFYTIILPVGLYMLFGALQDYAKVKV
                     ADGNASAYVMIGMALYGAISSTVSVSGLTVVENVAGWGRQLALTPMNTGKYLFSKCCV
                     AFVMAAVPVIAVNIAARLTGIDMPLNQQIACAALSILCAMVFGFFGLAIGLLVPSESA
                     VGIANGVLVVFSFFGTLFAPLTKDLMPYARFTPLYGAAEISRYPFTQGLTIINGSGPD
                     WNMIEPLWYGVVSFAAWGALFILATMLLMRRTTRR"
     gene            214109..215335
                     /locus_tag="HMPREF0733_RS00930"
                     /old_locus_tag="HMPREF0733_10198"
     CDS             214109..215335
                     /locus_tag="HMPREF0733_RS00930"
                     /old_locus_tag="HMPREF0733_10198"
                     /EC_number="2.7.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013397542.1"
                     /db_xref="GI:503162881"
                     /translation="MTPLKPRNKTPENRTIDWISLGFSAPWLIFLGYIYDGVLEPNAP
                     VWKHVYVIICLVIFSITDVAAYTVPWALPASSYFRRLLLWTALLFVPVCGVMLIAAIP
                     PADVLIGFTIYFVALWTFTEDIPYSTRIRGAFIIAAVFWIIYMFSDGIPINFADKSRL
                     TLSLGAPMIGIMAFSYLIQMSKNADKTQAKLDMVSERERIARDVHDVLGHSLTVITLK
                     ADLARRLLHADPDRADAELEAIAQLSRSSLAEVRSTVTRLRIPDFSGEIQASARALQT
                     ASITAKLPDAEHALSVVGVNSSLFSWVLREAVTNIVRHSQAGFCEVRLSNTGLEVLDN
                     GVGIPAEYAAGSGIKGMKSRVESAGGTLVIEDAPAHWLRAHPAGSGAADVRGTRVRVS
                     MDGNTAEIEPSGDTDD"
     gene            215328..215960
                     /locus_tag="HMPREF0733_RS00935"
                     /old_locus_tag="HMPREF0733_10199"
     CDS             215328..215960
                     /locus_tag="HMPREF0733_RS00935"
                     /old_locus_tag="HMPREF0733_10199"
                     /EC_number="3.1.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_013397543.1"
                     /db_xref="GI:503162882"
                     /translation="MIKIMLADDQQLVREALAALLGLENDIEVVAQVGGGDEVIPAIN
                     RYHPDVVLLDIEMPGSELSSGIDVAAAIRDAKLVTLTGDPVRSLIVTTFGRPGYLRRA
                     LAAGASGFMVKDTSASQLAEGIRRVHAGMHVVDPALAAESLAYGESPLTERETEILRV
                     AGHGATARAIGEQLFLSPGTVRNHLSSAMAKLNASNRQEAIRIAADNGWL"
     gene            complement(216075..217160)
                     /locus_tag="HMPREF0733_RS00940"
                     /old_locus_tag="HMPREF0733_10200"
     CDS             complement(216075..217160)
                     /locus_tag="HMPREF0733_RS00940"
                     /old_locus_tag="HMPREF0733_10200"
                     /EC_number="1.17.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="WP_013397544.1"
                     /db_xref="GI:503162883"
                     /translation="MSTETISLGLPPLPRTRRSRADIEAANPVTSAKKVLLATPRGYC
                     AGVDRAVIAVEKALEHYGAPVYVRKQIVHNRHVVETLEQQGAIFVDEVDEVPEGSVTV
                     FSAHGVSPAVVSAAGDRQLNTIDATCPLVNKVHREAVRFAKQDYDILLIGHTGHEEVE
                     GTAGEAPEHIQIVNSPDEVDSVTVRDPEKVVWISQTTLSVDETLETVARLRERFPSLQ
                     DPPSDDICYATSNRQGAIKEIAPQSDLVIVVGSANSSNSVRLKEVALEYGAKRAERVD
                     FAHQVDESWFEGVATVGLTSGASVPEVLVQEVLALLAEYGYENIEEVETAKEDILFSL
                     PKELRAALKNDENTGRQLGGRGAKPTR"
     gene            complement(217188..218432)
                     /locus_tag="HMPREF0733_RS00945"
                     /old_locus_tag="HMPREF0733_10201"
     CDS             complement(217188..218432)
                     /locus_tag="HMPREF0733_RS00945"
                     /old_locus_tag="HMPREF0733_10201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397545.1"
                     /db_xref="GI:503162884"
                     /translation="MGAHDDPQPHEPKRTIKLEVPEDSPDTTRVLPEPPRDDYRVISS
                     EPHDLEGADETTTLLSAPEINQQTRVLNESFDALRPHSETPEPTGAPVANLANQKPQR
                     HVLEPTSVSKLRYALAILAASLSILCALTGSVASWVNQNLISQSGFNQLSTQLVEDQD
                     FQKRIADAAVTDVMNSDAVKRVFPESGNNFLTQILSTSRGEVKKRLSENAQRLTGTSE
                     YRTMWRQVAADTHTYNLAHPDDPAALDISAFYRELDARVGSIGIYDPDISSWGKHLIS
                     IDRDGNPVQHAVQRAQWVGSMSGALIAASIIGLVIALILLPRGRFVLLTCAFLILAAG
                     LWILSAVMAQQTPQMLGLSTDSTVGTVFLDGLVNTARPMLTGHLNSLASYSAWAAVVS
                     LLGGILAKLIALTASGTTVRTH"
     gene            218561..219871
                     /locus_tag="HMPREF0733_RS00950"
                     /old_locus_tag="HMPREF0733_10202"
     CDS             218561..219871
                     /locus_tag="HMPREF0733_RS00950"
                     /old_locus_tag="HMPREF0733_10202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII large subunit"
                     /protein_id="WP_041321839.1"
                     /db_xref="GI:752673130"
                     /translation="MTDFSAAHHEYPHSAPPIVPPAAERQLPAKSQETTPQNPWPLAL
                     LAQNMKNYIDKVPQLWVEAQVASLNGRGGNVFIELKDLQEDFSFTLALFGQAGRGLGS
                     DVKVGARVVTLAKPSLWKNGRLSLIGRRIYAVGTGNLHEQLQILREKLAAEGLFADAR
                     KKPLPLLPHRVGLITGRDSDAEKDVIRNASLRWPGVQFEVRNVKVQGEGSASEVMAAL
                     SELDAHPEVDVIVIARGGGSFEDLLSFSDEALVRAVAAAQTPVVSAIGHEADSPILDA
                     VADVRASTPTDAGKRIVPDVAEELAVIREARARADRAVLGYLNYQEQYIRQLHERPVL
                     TQPETDLGWRSEDIFRLRERAARSVEYRVARERDAISHTIARVRALSPVETLKRGYTI
                     VQRADGDLVRDATALSAHDKLTMRAAVGGAEVSVVKTYDSNLDL"
     gene            219894..220175
                     /locus_tag="HMPREF0733_RS00955"
                     /old_locus_tag="HMPREF0733_10203"
     CDS             219894..220175
                     /locus_tag="HMPREF0733_RS00955"
                     /old_locus_tag="HMPREF0733_10203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII small subunit"
                     /protein_id="WP_004005186.1"
                     /db_xref="GI:490103333"
                     /translation="MSENISFHTEELGAPVETLSYEQARSELENVVRQLESGTSNLES
                     SIALWERGEALASRCEAWLEGARERLHAVRNTQDATGEEAESEGSESED"
     gene            complement(220289..221512)
                     /locus_tag="HMPREF0733_RS00960"
                     /old_locus_tag="HMPREF0733_10204"
     CDS             complement(220289..221512)
                     /locus_tag="HMPREF0733_RS00960"
                     /old_locus_tag="HMPREF0733_10204"
                     /EC_number="2.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005187.1"
                     /note="broad specificity; family IV; in Corynebacterium
                     glutamicum this protein can use glutamate,
                     2-aminobutyrate, and aspartate as amino donors and
                     pyruvate as the acceptor; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase AlaT"
                     /protein_id="WP_013397547.1"
                     /db_xref="GI:503162886"
                     /translation="MTKYRQSSKLNNVLYDIRGPILEEANRMEALGHRILKLNIGNPA
                     PFGFEAPDAIMMDIIRHLPVTQGYSDSHGLYSARTAIVQYYQNRGILDLDTNDIYLGN
                     GVSELIPMTLQALCEPGDEILVPMPDYPLWTASTTLAGGNPVHYLCDEENNWYPDIED
                     IKSKITERTRGIVVINPNNPTGAVYSREILQQIADVAREHELVVFADEIYEKITYEGA
                     EAINMATITGDDVLCMTFSGLSKAYRVCGYRAGWLAITGPKEDAKNYIEGITLLASMR
                     LCSNVPAQHAIQTALGGYQSIDELVAPGGRLYEQRTLAYRMLNEIDGITCEQADGALY
                     LFPKIDTEKFNIKSDEQFMLDLLKDQKILFSHGSAFNWHKPDHFRLVFLPDVQTLKSA
                     LERLGNFMADYKQKN"
     gene            complement(221520..222593)
                     /locus_tag="HMPREF0733_RS00965"
                     /old_locus_tag="HMPREF0733_10205"
     CDS             complement(221520..222593)
                     /locus_tag="HMPREF0733_RS00965"
                     /old_locus_tag="HMPREF0733_10205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013397548.1"
                     /db_xref="GI:503162887"
                     /translation="MISALALAPLLAACSSEDDKPKVDPSASSYGTLRVGIGALREMR
                     AVAYLYAQALRNVGYNVEVVTNEDSRSKFLDALKQTEANTPEPDTLDLVIDYSGDLLL
                     HLTNDGKLSPAQIQAERQAASASASAASAGVTLPPTPTNTPSHDASASEGATASPSGA
                     INARALNITDTVAAINRVLPEHLELLDVANAQNRDVLVTTRQNEVQHKLRSLANLADV
                     KATLSFALTSGYTSSNYGVASLKTVYKYTVENPILNENSAERVSMLSKDTAQVVLLHS
                     ADPAIEDNRFTTLEDPQTTQLNQQLLPIARRNLPDSAREAINRVSSTLDTGNLSFLLR
                     LTSGTNPIADDEAAKFLLEHPRK"
     gene            complement(222632..223123)
                     /locus_tag="HMPREF0733_RS00970"
                     /old_locus_tag="HMPREF0733_10206"
     CDS             complement(222632..223123)
                     /locus_tag="HMPREF0733_RS00970"
                     /old_locus_tag="HMPREF0733_10206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="WP_004005189.1"
                     /db_xref="GI:490103336"
                     /translation="METRPAAYAVIIEQGKLLMTRWVPEDRAQSPLWSLPGGGMEPGE
                     QADETALRETLEETGYSVAIEDILGVHAGHFPARNGLSDSTLPFCALRIVYRAHVVTG
                     ELRAEENGSSDSACWVPIAELDTLRYGTLIDEVASMMGFQNAAAWSREYQEFLADENA
                     RKI"
     gene            complement(223154..224143)
                     /locus_tag="HMPREF0733_RS00975"
                     /old_locus_tag="HMPREF0733_10207"
     CDS             complement(223154..224143)
                     /locus_tag="HMPREF0733_RS00975"
                     /old_locus_tag="HMPREF0733_10207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013397549.1"
                     /db_xref="GI:503162888"
                     /translation="MSENSTNARAEEKARADELPHHIANLLYTPQALPAQVLERSELR
                     IAYVPGIMPGKWFTRWHERYGDRAPLAEIPVGEGLGIQALTIELSTSQSAEPLAHMAI
                     VRPNHEPRSRDTDEYHSIRLYEEIPVLIMPSDHVLTVLDEVSFEDLAEEFLLHDPADY
                     PAWAEASNTWRAENPRFLPEFTGDREALELVAAGIGLYIAPMSVARFYHRKDLTYRPM
                     RGLEPYPVTLTWRRAPVAHPRPEREETLIQDFIGIVRGRTASSERGSETKQSRAKRIA
                     DEKAKTKAKNRAANARREARDRKKSNAKKSGNLREYARHNAQAVRARRAGKKR"
     gene            complement(224210..224680)
                     /locus_tag="HMPREF0733_RS00980"
                     /old_locus_tag="HMPREF0733_10208"
     CDS             complement(224210..224680)
                     /locus_tag="HMPREF0733_RS00980"
                     /old_locus_tag="HMPREF0733_10208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397550.1"
                     /db_xref="GI:503162889"
                     /translation="MKEWFAALPLELAVVIMWGIGILRTSIVYALGYLAATGSARLER
                     IRNAMQTPLYTRATAMINRWGAYAVPLCFLTVGLQTAVIITTGFTKMPMRRWLPGMLL
                     GTLIWAIIYVTIGFALLAAFGFEPWMVPLIFVALILISLTASKIRTYIADKRQS"
     gene            complement(225172..227475)
                     /locus_tag="HMPREF0733_RS00985"
                     /old_locus_tag="HMPREF0733_10209"
     CDS             complement(225172..227475)
                     /locus_tag="HMPREF0733_RS00985"
                     /old_locus_tag="HMPREF0733_10209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397551.1"
                     /db_xref="GI:503162890"
                     /translation="MTILSTSGVLVVLAVVMLLWFIPRNMRRASAADTPEQTVVNPHS
                     MTDDVLTSHSILFSEESAVPGSDPKKSNAASGNVPPLSEEETSAALSDLREASPVEPF
                     TSPVPVLEQKPWLPERLHRLGTLRLTLLGIGALVALILIFSLILSLMGWLPWSAPTVS
                     FVALAGIGGALYYLGQPKDGHEEPDAAYPETSGHNALPIEGEATEEEFAQDEAHELDV
                     EEPEETSPSRSSKASRWGSLRWNSGRASRKSTLEEESSEQGVPADHAPQIGADEFAAE
                     PHELSEEPVHEEYVEYAESYSAEDAQQHFSGTSHARRLPAQLHPKYPPQQAPEPVLYD
                     DDQGASHEASYEQAPSAHAFSASAAEEAPAQDVFVQPKNLHRAPAPQPEAQRHETRFV
                     GSASAQGQTPRRPARIPGTHLRPLERTSELFDQEVQTTPTGQIPVTPAPGNTVNAPQR
                     EGAAPRNGFLESAPANTNQTQGYSAPSGMSNTSAQDAAFGSGMQDRADDSAHSAPYRS
                     AAHNPYLAQPQNTAQNPYAAPAQGYGTHQGQGVGQHQQGMQQNQNAGQNRQAAQTGLG
                     QQSLGEQQGYGQRSFAPQNQKHQTSTAQHTNAQNSGPGFAPSRSVAEEKNLPPAGFTP
                     QGAIRPMNQEPPRSQRPMGTTTGSGAQNSRFQQGPATGSVPVGGGSGFTNTSQFDVPV
                     PLDLDDSEFEPLDIIPVVDEPGERSGSSSNASASYKRGNMPGTGASFTGVSQKTWTPT
                     QLPKPLSSLHQKKPNGSDGGPNNGEQK"
     gene            complement(227758..228663)
                     /locus_tag="HMPREF0733_RS00990"
                     /old_locus_tag="HMPREF0733_10210"
     CDS             complement(227758..228663)
                     /locus_tag="HMPREF0733_RS00990"
                     /old_locus_tag="HMPREF0733_10210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="WP_041321840.1"
                     /db_xref="GI:752673131"
                     /translation="MTKVSKSVTKAVIPAAGLGTRFLPATKATPKEMLPVVDRPAIQY
                     VVEEAIRAGLNDVLMITGRNKRALEDHFDRVPVLESQLAEQGKDALLKAVEATNELGE
                     LHYVRQGDPKGLGHAVLRGKVHVGDEPFAVLLGDDLIDEKEDLLSRMVEVQQATGGSV
                     IALMEVPHESISAYGAAAIEAVEGQDGYVKVTGLVEKPAPEEAPSNYAVIGRYVLSSK
                     VFEVLENTAPGRGNEIQLTDALQTLAVGTGEGEGVYGVVFKGRRFDTGDKLSYLKANV
                     ILASEREDLGPELREWLKEFADKNC"
     gene            228852..229535
                     /locus_tag="HMPREF0733_RS00995"
                     /old_locus_tag="HMPREF0733_10211"
     CDS             228852..229535
                     /locus_tag="HMPREF0733_RS00995"
                     /old_locus_tag="HMPREF0733_10211"
                     /EC_number="6.3.3.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="WP_013397553.1"
                     /db_xref="GI:503162892"
                     /translation="MKPEPSTVSAPHESNDAPHSKTPEDTALDKQILRSQIRPQRLIV
                     KNARTAAEHEQMKQQYRDHILSLIPKDAQAQTIAAYLPTASEPPITAALHDLHARGHR
                     ILVPVVRPARTLAWVVWDPHVEHPLNGLGIAEPEGEEYDTQAFVAADLRLVPALAYAR
                     NGRRLGQGGGYYDRIIPALSADKLRESTVGVVFSHEVLESIPYDEWDAVLPRVLTENG
                     IEPLGDSTL"
     gene            229687..229893
                     /locus_tag="HMPREF0733_RS01000"
                     /old_locus_tag="HMPREF0733_10212"
     CDS             229687..229893
                     /locus_tag="HMPREF0733_RS01000"
                     /old_locus_tag="HMPREF0733_10212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FmdB family transcriptional regulator"
                     /protein_id="WP_004005195.1"
                     /db_xref="GI:490103342"
                     /translation="MPVYVYQCKNCGHAFEKRQSFSEDALRTCPQCGEDTLRKRFNTV
                     GVVFKGSGFYSTDKGSSSSSSQAE"
     gene            complement(229930..230205)
                     /locus_tag="HMPREF0733_RS01005"
                     /old_locus_tag="HMPREF0733_10213"
     CDS             complement(229930..230205)
                     /locus_tag="HMPREF0733_RS01005"
                     /old_locus_tag="HMPREF0733_10213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_013397554.1"
                     /db_xref="GI:503162893"
                     /translation="MGEYSPTPKPRRGHRRASGGGALAGDEPRIAGVNAPLHAHTPTP
                     ARKEISGKSAANRGNLRHARGSAQEHLTPEERARLEWMREQKPPHWG"
     gene            complement(230252..234079)
                     /locus_tag="HMPREF0733_RS01010"
                     /old_locus_tag="HMPREF0733_10214"
     CDS             complement(230252..234079)
                     /locus_tag="HMPREF0733_RS01010"
                     /old_locus_tag="HMPREF0733_10214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase"
                     /protein_id="WP_013397555.1"
                     /db_xref="GI:503162894"
                     /translation="MNETPDTLENTAAKEPRSAEFQPEYLDPSSPAFDPSGGLERWAQ
                     QMDVYTGPDAMLDFNQVDYVHINLSDANPSGLAQLLAGRKTRLSTLIRDKSLLGHEMR
                     AARTLRTKIYELSTGHGLDAGYFVAGTASWLSHAMRDDAKASEKRFIAPILMAPLNLT
                     PHPTSDDFELQLAGSARLNPAMVRQIKQEYEIDLGTMDVAQLANSMSRLDPEPVIERM
                     RASAGRIPGMTIESKYFISTFADLKESMGELPHTAHTPLVRDLAALKVPGAQPREMNA
                     HNLQQPLNQRDPAQETLLFDADPVAQNIIDTAASGFSMTVTAAPGTEPLRTAVNIAST
                     LMGRGKSVLVVGEKRSTLASFSELLGRTGLNDLRYDLLAEHTAEDQRTEFIRAIVRNE
                     NTAEPNSTNLNRELIETRTALTDHTHALTARDPLWHISISEALQRVAELASEESAPQT
                     QVRFSRQLLDTLQDREAITADIVRFAELNGFTRATRTSPWHRARLLNEDEAADAYALV
                     ITLRSSLLSLREAMNAMNASLHLRRARTIADWDAQLAILIRIRETLKRFRAEVYDRPV
                     TDLIAATASGSWRRENRIDMSSMQRSRLRRAAKEYILPGVHIGDLHEHLKVVQTERAE
                     WIRLLDSPSTPKIPENLDALANALHSLGSELSGLEIILPDTAEGVDFVHTDLDQLEAR
                     LDALLNDREVLMSLPERDVLLGRLTNAGLSDFLDELGEREANASEVTSELELAWWQSA
                     LEELLEQHAEKILDGDELRDIEARFRRADYAHMSSAQARLLAHTARLWTERIEEFHEQ
                     ASYLKSQLRGREFDLESLLVNAPVMARTLLPLWTASPFSLARRVPMSMRFDAVILLDA
                     ESTPLAANLPAITRADQVIAVGDPHAGFPAPFIVSAPTSGAPASDSHRLESTFGALSR
                     LLPNRTLSLVHRPFDRVLFDYLNREFYGSHLREIPVSPASRKPVSTLSIEYIDTRGKV
                     SDNANLESPSVEVDRVTRLVLEHAYRRPERSLAVVTASPKHAQRIAGAVRQALNTYPQ
                     LAEFFKPGTESFRVVDVNRAGSLERDTIIFSLGVGRARLGQSSHNLGLLSGPHGREGF
                     VVGLTRARRATHIVSCVSPTDMNAQKLHEGALDLYRLMLAYEENQQQIAAQTPREDVL
                     ASNAWLETEDEPTDPVTQDWLLNDAVARLRERGVRVRPGEDEIAFIALAPQQLIHTES
                     EQESAQRMPLMVGSDVLFDYTTESVREHTRLVPERLSRTGWNYVTLNTLEVFADPEAV
                     VARILRYLGIYAD"
     gene            complement(234223..234678)
                     /locus_tag="HMPREF0733_RS01015"
                     /old_locus_tag="HMPREF0733_10215"
     CDS             complement(234223..234678)
                     /locus_tag="HMPREF0733_RS01015"
                     /old_locus_tag="HMPREF0733_10215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397556.1"
                     /db_xref="GI:503162895"
                     /translation="MIAILELINNPQKMRRYLFWYLIIMPLALFAWILLGAANSGLDF
                     KAAINIPFYAVAFLNGCLSILFAGLLKFAASENEHTERMIAFYTLVMLVFAGNLPGAL
                     LAFFLWWALREAPEEPFAPNYRWVFIASMIFFGLVTLLVLFANIRLWSA"
     gene            complement(234682..235581)
                     /locus_tag="HMPREF0733_RS01020"
                     /old_locus_tag="HMPREF0733_10216"
     CDS             complement(234682..235581)
                     /locus_tag="HMPREF0733_RS01020"
                     /old_locus_tag="HMPREF0733_10216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_004005201.1"
                     /db_xref="GI:490103348"
                     /translation="MDLQDVVNANQHRFSDTERDILAFMLENEEFVAEATINSLAHKT
                     YTSTSSIIRLTKKLNFSGFAELKYFIKSSLTKSEPYNPRFIESGREDILRTYDYLEHM
                     ELSGLLRKLHTARTIYCFGTGYAQRNAVQEFAKSMQVCGKFCHVIPARNEFESTMSAM
                     NQDDVVILVSFSGQTENMREHVKMLALRKIPMIAITAIGVNFMSSYAEYSLHYQTTPT
                     QLSTQRKPYHSFVALSVLLDYIVRRYIDHVETQQRGNSTKTAQVLESSEFSAETGALD
                     VADIRAQAGAVAIDRQHTDPSET"
     gene            complement(235677..237320)
                     /locus_tag="HMPREF0733_RS01025"
                     /old_locus_tag="HMPREF0733_10217"
     CDS             complement(235677..237320)
                     /locus_tag="HMPREF0733_RS01025"
                     /old_locus_tag="HMPREF0733_10217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS alpha-glucoside transporter subunit IIBC"
                     /protein_id="WP_004005202.1"
                     /db_xref="GI:490103349"
                     /translation="MMEKIQRFGSAMLAPVLLFAFAGLAVGIGTVATLPNIVGDLANE
                     DTFWYQAWTVWLDGAWTVFRQIELLFVLGLPIALAKTANARAVLEAGMVYLTFNYLVA
                     GMLNFWGQGGSGFFQLDYNTSISLDNSDSYGTGLKIIAGIKTIDTGIFGAIIISAIVV
                     WVHNRYFDKKLPDFLGIFQGTQFVYAICFFLMMPIAFIFAWLWPYAQHGIASMQGFFI
                     ASGALGVWIYTFLERILIPTGLHHFIYSPFMFGNAVTPNGIVKDWPTHISEFAKSDKP
                     LRELFPGGGFALHGNSKIFAPLGISAAFYTTARREKRKEVLALLIPVTLTAMLIGITE
                     PLEFTFLFVAPPLFAVHAVLAASMASIMYMLGLSGNMGGGLLDNFLFLNWVPLWQNHW
                     PTYLMQIGVGLSFTVIYFLLFRFLILKFDFKTPGREAEGGETKLYSKAEYKAAKAAEK
                     KGAASADDAGDADLYAPRAAGFLELLGGADNITTVNNCATRLRVSVADESLVDTSDAA
                     FKDAGALGIVRKGKAFQVIVGMDVPQVRERFETMVNTKE"
     gene            237677..238570
                     /locus_tag="HMPREF0733_RS01030"
                     /old_locus_tag="HMPREF0733_10218"
     CDS             237677..238570
                     /locus_tag="HMPREF0733_RS01030"
                     /old_locus_tag="HMPREF0733_10218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_013397557.1"
                     /db_xref="GI:503162896"
                     /translation="MRFLTLNTHSWCEPHQIVKIHELARFIAHHRVDVIALQEVNQYL
                     HSPIVDMPLGYQGGASIPIREDNYALLLVRFLADLGVQYEWALTETHIGWERYDECVA
                     VLSRMPIERIEPIVMSPQYDYDRVERRSSLAVRVGTDAGSVWCASTHMSWWDFQGEPL
                     FAQEFARLSQALTECGQDAPVLMGGDFNTAAQVRGEGYDLALSSGLVDTREIAERTDG
                     EFTVHREIAGWEGQEDAKRIDFVFADRAVKVLSHAVVFRDNSPKAISDHSGVLVELDE
                     SSFEPTARMHPVQLPSQVQPG"
     gene            238655..240460
                     /locus_tag="HMPREF0733_RS01035"
                     /old_locus_tag="HMPREF0733_10219"
     CDS             238655..240460
                     /locus_tag="HMPREF0733_RS01035"
                     /old_locus_tag="HMPREF0733_10219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligo-1,6-glucosidase"
                     /protein_id="WP_041321521.1"
                     /db_xref="GI:752672812"
                     /translation="MKTEIQWWQQPVVYQIYPRSFNDSNGDGIGDLPGITEKIPYLAK
                     LGIDVIWLSPIYASPNDDNGYDISDYRAIMTEFGTMADFDELLATAHEHGIKLMMDLV
                     VNHTSDEHEWFRQARSAKDNPYRDYYVWRDPAGFSEDGTPIPPNNWISCFSPSVWEWD
                     EGTQQFYLHYFSVKQPDLNWENPKVREEVYDIMRFWLDKGVDGFRMDVINLISKDLSF
                     PDDPAVTAGGLDNSLAVAANGPRVHEFLREMNREVLSKYPVMTVGETPCVSVEDAALY
                     TGFDRHELQMVFQFEHMDVDASAGGATGKWSDTRFNLVDLKKVLSHWQTGLHGRGWNS
                     LYWNNHDQPRTVSRFGNDSPEFREVSGKMLGTILHMMQGTPYIYQGEELGMTNVFFDS
                     VDDYNDLEIHDSWRKYVVESQRVSPEDMLRYISASGRDNARTPMQWDASENAGFTTGT
                     PWLKVNPRYTDINAAEELANDDSIFYHYSDLIHLRKEHPIVLTGEYRVLNPEDEQVYA
                     YLRVNSAEDAAASGERALLVVANFTQETLSLPYADGQLASLALKNPGVLKLEELAAMG
                     EAPELISSNYRNEHGEFTDEGTTLRPYEAKVYLYR"
     gene            240591..242423
                     /locus_tag="HMPREF0733_RS01040"
                     /old_locus_tag="HMPREF0733_10220"
     CDS             240591..242423
                     /locus_tag="HMPREF0733_RS01040"
                     /old_locus_tag="HMPREF0733_10220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligo-1,6-glucosidase"
                     /protein_id="WP_041321522.1"
                     /db_xref="GI:752672813"
                     /translation="MSSETTTEERAVPSYAGRQWWKEAVVYQVYPRSFNDSNGDGIGD
                     LPGITEKIPYLAKLGINVIWLSPVFDSPNVDNGYDISDYFDIMSDFGTMEDFDELLAT
                     AHEHGIKILMDLVANHTSDQHPWFVQSRSSKDNPYRDYYIWKDPNGFDETGSPIPPNN
                     WASEFGGSAWEWDEATQQFYLHIFFKEQPDLNWANPKVREDLYAMVRWWLDKGVDGFR
                     LDAINIISKPEGFPDDPSTDFEKHTSSIPFVIANGTMVHPWMKELNREAFSKYDVMTV
                     GETSATSPEDAKLWAGYDAGELQMLFHFDHMGVDNDPEGSLGGKWSYAPYKLTELKRI
                     LNEWQTKLEGKAWGSLYWNNHDQPRVVSRFGNDSPEFRVLSAKQLATTLHFMQGTPYI
                     YQGEELGMTNVRFESIEDYRDGDSIRFYEDMHVDHQRLNHEDAMRAIYIKGRDNARTP
                     MQWDDSANGGFTNAGVEPWLKVNPNYPQINAEAALDDQDSVFYHYQELAKLRRGELKD
                     LMVYGSFAPVDSVEVPHAEDEAVYAYTRTGGPDGTDANQSLLVVSNFTSDSVERTFSL
                     LDDARAAGASVELVHSNYRDDTGALTDVGTTLRPYEAKVYRIVK"
     gene            complement(242638..243483)
                     /locus_tag="HMPREF0733_RS01045"
                     /old_locus_tag="HMPREF0733_10221"
     CDS             complement(242638..243483)
                     /locus_tag="HMPREF0733_RS01045"
                     /old_locus_tag="HMPREF0733_10221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_013397560.1"
                     /db_xref="GI:503162899"
                     /translation="MNRISTHFLDLEGIKTAYYSTEGEGTPIVFLHGGGVDHAMLSWK
                     TIMQTWTGSQPLVALDLPGYGNSDKPELEYSLSFYTGFLKAFLDTLNAQNVTLCGLSM
                     GGAIALQYALRYPEYIGKLVLVAPWGVSASAPYSLMGRLRVRLPLNQVVYKTLQNRWL
                     AKNIIAGSLIGNREKITPEILDEVQTAAHSKDAARVFQSFQISELWGEHPVGHLIPLL
                     PQIKVPTLFIQGDKDPGVKVGDVKQAAASMPNARVEIFEHHKHWVQKESPERFADIVR
                     DFIES"
     gene            complement(243636..244106)
                     /locus_tag="HMPREF0733_RS01050"
                     /old_locus_tag="HMPREF0733_10222"
     CDS             complement(243636..244106)
                     /locus_tag="HMPREF0733_RS01050"
                     /old_locus_tag="HMPREF0733_10222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoprenylcysteine carboxyl methyltransferase"
                     /protein_id="WP_013397561.1"
                     /db_xref="GI:503162900"
                     /translation="MKRLAAALEHKVPPPLIGALCASLMWLICGMPPLTGRPPLLLVP
                     ALALVVLGLTVDAAGVLSFRRARTTVNPFAPERTVNIVSSGIYRLSRNPMYLGMVCIL
                     TGWAVWLWQVQAVLGVVLFVAWITRFQIIPEERVLTQKFGTEYRQYRQRVRRWV"
     gene            complement(244143..244847)
                     /locus_tag="HMPREF0733_RS01055"
                     /old_locus_tag="HMPREF0733_10223"
     CDS             complement(244143..244847)
                     /locus_tag="HMPREF0733_RS01055"
                     /old_locus_tag="HMPREF0733_10223"
                     /EC_number="5.1.1.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="racemase"
                     /protein_id="WP_013397562.1"
                     /db_xref="GI:503162901"
                     /translation="MKTLGIIGGMSPESTALYYRIINREVNRRLGDNHSADIVMHSVD
                     FEEVVRMQKSGDWEAAGALLAASATKLEGAGAQLLLVATNTMHKVAPAIERATTVPLL
                     HVVDATATAIQRQGLQRVGLLGTTFTMSDGFYTERMAVQGIQTIVPTESEQTDINRII
                     FEQLCLGRVEPEAVQYLQQVITGLKEQGAQGVILGCTELCLAVEADKTPLPVFDSTTI
                     HALAAVEAVLTPPLPV"
     gene            complement(245025..245663)
                     /locus_tag="HMPREF0733_RS01060"
                     /old_locus_tag="HMPREF0733_10224"
     CDS             complement(245025..245663)
                     /locus_tag="HMPREF0733_RS01060"
                     /old_locus_tag="HMPREF0733_10224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H nitroreductase"
                     /protein_id="WP_041321523.1"
                     /db_xref="GI:752672814"
                     /translation="MTLQDLIRDRRSTRYFDPACLISHEEIYRLINCANQAPSSNNSQ
                     PWRVVIVTERHLREKLLPIAYNQQQIMTASAVLILLGDRQAYCADNLSRIHHEEYIAG
                     CFSQEICERLTRAAIEFYEPRSEQEIQKFLGLDCGLWAMTFMLAAQEAGWNTIPMTGY
                     QRAELREMLRLPSRYLDIMMIAVGSGAREGHRTLRHEAERVTVWNAPPSEQP"
     gene            245792..246139
                     /locus_tag="HMPREF0733_RS01065"
                     /old_locus_tag="HMPREF0733_10225"
     CDS             245792..246139
                     /locus_tag="HMPREF0733_RS01065"
                     /old_locus_tag="HMPREF0733_10225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="WP_013397564.1"
                     /db_xref="GI:503162903"
                     /translation="MKKISAIEMAMNLVGGKYKCLILYHLSGGAKRTRDLLRLLEGIS
                     SKVLTEQLRQLEEDELIKRTVYAEVPPRVEYTLSTEGQTFLPVLQLMCDWGWEYDSRH
                     QGIVKPCTSRITE"
     gene            complement(246310..247050)
                     /locus_tag="HMPREF0733_RS01070"
                     /old_locus_tag="HMPREF0733_10226"
     CDS             complement(246310..247050)
                     /locus_tag="HMPREF0733_RS01070"
                     /old_locus_tag="HMPREF0733_10226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004005214.1"
                     /db_xref="GI:490103361"
                     /translation="MKRFENKTILITGASSGIGLAGAKRLIEEGAHVIFTGRTESHVQ
                     AAAAELGDHATAVLDDVSDGNTLERIMPVVERAGALDGVWLNAAYAAGGPLEEMDQAT
                     LDQIFKVNVVAPMIQMGALSPYVKDGGSVLVTSSTAAYEGAPIVSAYAATKAAILAAA
                     RGWASELAPRNIRVNSLVPGPITSNLRSVLPDEMRAQFEERLAEAVLLKRVGDAREAA
                     AVALFLLSDEASYVTGSSYTVDGGLIMQ"
     gene            complement(247308..247661)
                     /locus_tag="HMPREF0733_RS01075"
                     /old_locus_tag="HMPREF0733_10227"
     CDS             complement(247308..247661)
                     /locus_tag="HMPREF0733_RS01075"
                     /old_locus_tag="HMPREF0733_10227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397565.1"
                     /db_xref="GI:503162904"
                     /translation="MNPVLLTINTISALVTIASAVLALCRPGLMVHASSVDANTRFYV
                     YMYAVRAIPAGIAVLIAPFYFRGGAVVLLLATFAVIQAGDAFIGWTRKEWGMVFFPSL
                     SAAAHTVVAFSVPGI"
     gene            complement(247690..248121)
                     /locus_tag="HMPREF0733_RS01080"
                     /old_locus_tag="HMPREF0733_10228"
     CDS             complement(247690..248121)
                     /locus_tag="HMPREF0733_RS01080"
                     /old_locus_tag="HMPREF0733_10228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013397566.1"
                     /db_xref="GI:503162905"
                     /translation="MDASLLSELVVQIFRVNGTLTAWGDRFAAESGLTTARWQVLGAI
                     SMSKEPSTSPQIAERMGITRQGVQKQLNLLRDEGLVMSVENPAHKRSPRYSLTEHGEQ
                     KLAEIRKRWRQQVEQWSGSYQHESVIAALETLEVLSQHLKE"
     gene            248514..248819
                     /locus_tag="HMPREF0733_RS01085"
                     /old_locus_tag="HMPREF0733_10229"
     CDS             248514..248819
                     /locus_tag="HMPREF0733_RS01085"
                     /old_locus_tag="HMPREF0733_10229"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397567.1"
                     /db_xref="GI:503162906"
                     /translation="MLRVVAWICFVATIPWALIFIILGVAVSANLLHVTSIFIINLII
                     TLLAFLAAVSLAALPILGTIKLFKLSRKNPEQPDGGEKFAEKVFNFFGKILDGADYL"
     gene            249550..250242
                     /locus_tag="HMPREF0733_RS01090"
                     /old_locus_tag="HMPREF0733_10230"
     CDS             249550..250242
                     /locus_tag="HMPREF0733_RS01090"
                     /old_locus_tag="HMPREF0733_10230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397568.1"
                     /db_xref="GI:503162907"
                     /translation="MTTNKNLPKPEHGTLQAQDVHEIKKEPKADSTKKQTSFPPSLIA
                     VQTIRTVIEFILVLPLLPLLTIGLGGFLLFLPFGLHFILQAVAWSRAKKETRIAWVVG
                     INIYSLMIVAPIGAFYTWFMMELQVAAPNITGADIGLLWWSLGACVLEAVISIVMIVV
                     MNVIKRNDLRDFQGKRITVTKPRISDDVLEGSNSGAYETDGGLKPLKNHHDKSDAKVP
                     RQHINVRSQKKD"
     gene            250253..250969
                     /locus_tag="HMPREF0733_RS01095"
                     /old_locus_tag="HMPREF0733_10231"
     CDS             250253..250969
                     /locus_tag="HMPREF0733_RS01095"
                     /old_locus_tag="HMPREF0733_10231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397569.1"
                     /db_xref="GI:503162908"
                     /translation="MSTDKNFPIVNDEFAIGQAQNVHEIEKESEADSTEKRNLLLSSF
                     ITVQIIRLILETMILQSVVFSLLASDFDDFEGFLLLLILFSPFIVYILLQIVACIKMI
                     RGTKTAWFLGTNIYSLLVVAPIAAFYTWFVIEMSAPNVTSADIQPLRWLLGACALEAI
                     ISVFTIIAVIIYNWKKKKLSSHNKNMDTDKRPTPDNTLSGFKNAIYETDDLKTLKKHH
                     EDPIVEIPWQRVNVRSQKKD"
     gene            250981..251703
                     /locus_tag="HMPREF0733_RS01100"
                     /old_locus_tag="HMPREF0733_10232"
     CDS             250981..251703
                     /locus_tag="HMPREF0733_RS01100"
                     /old_locus_tag="HMPREF0733_10232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397570.1"
                     /db_xref="GI:503162909"
                     /translation="MSTDKNFSATDNNDPQPPVEKQSASGNNPENAHQDPKYTQLYGL
                     EGIEGKMSLEPQAGSEPQGTKKKEESHERVPKQFDIDPNTRKSLLIAQAIRNVLIIIP
                     VLVLLFIFIQAAIYIMVSERDEFSDLIFAIVAIATVVALPYMIHIFLQVVAFMRFRRS
                     VKFRWIRGANIYGLIVAPISEVTYVPFMLERILDPSSSAESSFTIVGVIVALYEVILG
                     ILMIVVTTNSIKKTTQLSGQKH"
     repeat_region   251423..251675
     gene            complement(252196..253788)
                     /gene="guaA"
                     /locus_tag="HMPREF0733_RS01105"
                     /old_locus_tag="HMPREF0733_10234"
     CDS             complement(252196..253788)
                     /gene="guaA"
                     /locus_tag="HMPREF0733_RS01105"
                     /old_locus_tag="HMPREF0733_10234"
                     /EC_number="6.3.5.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397572.1"
                     /note="contains glutamine-hydrolyzing domain and glutamine
                     amidotransferase; GMP-binding domain; functions to produce
                     GMP from XMP in the IMP pathway; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="WP_013397572.1"
                     /db_xref="GI:503162911"
                     /translation="MTDSVHPDQLEERPVLVVDYGAQYAQLIARRVREAGIYSEIVPH
                     SMSTEKMLAKNPAAIVLSGGPSSVYADGAPRGDRALFEAGVPVFGICYGFQVMAQTLG
                     GTVAQTGSREYGATDATLCAVESSFLTGTPQTQNVWMSHGDSVTEAPAGFEVLAQTPG
                     ASVAAFVDEHRKLGGVQWHPEVKHSDYGQVALENFLYNIAGLKPTWSTDNIIEEQVAK
                     IREQVGEDRVICALSGGVDSSVAAALVHKAVGDQLTCFFIDHGLLRAGEREQVEQDYA
                     ASMGIRVITIDESERFLTALAGVSDPEQKRKIIGREFIRSFEQAERKLIEEAGEEGAQ
                     IKFLVQGTLYPDVVESGGGEGAANIKSHHNVGGLPEDLAFELVEPLRTLFKDEVRAIG
                     RQLGVPEKIVARQPFPGPGLGIRIVGEVTRENLETLRAADAIVREELTAAGQDEHIWQ
                     CPVVLLSGVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWSRLPYDLLAKISNRITNE
                     VKDVNRVVLDVTSKPPGTIEWE"
     gene            complement(253929..254513)
                     /locus_tag="HMPREF0733_RS01110"
                     /old_locus_tag="HMPREF0733_10235"
     CDS             complement(253929..254513)
                     /locus_tag="HMPREF0733_RS01110"
                     /old_locus_tag="HMPREF0733_10235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_004005221.1"
                     /db_xref="GI:490103369"
                     /translation="MSENSEKNTKITPVERTDGRKVTLSQNASKASADGAEHAPQGGF
                     TVRKKFGGTETQIRSALTFYKWCAWISGTFLLLLVVEMITHHGMGYDLVAGAKDAATG
                     SDVSFGVLNRETGNLTGGVNISTWVLIIHGWFYIIYLFSCIRIWLLMRWGIAQLIVMA
                     LGGVVPFLSFIVEKRIHAETLAQLEANPQATKRY"
     gene            complement(254552..255574)
                     /locus_tag="HMPREF0733_RS01115"
                     /old_locus_tag="HMPREF0733_10236"
     CDS             complement(254552..255574)
                     /locus_tag="HMPREF0733_RS01115"
                     /old_locus_tag="HMPREF0733_10236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397573.1"
                     /db_xref="GI:503162912"
                     /translation="MWKLAFTPRWLGGLLLALVFVTGFVALSSWQFNASTSQQVHSDP
                     AKDRVRPYTEILQAHQPVTNLTVDTVVQAKGKYVPGSSMLVAGRLNEGQHGYWVLSEF
                     IPEGTDKAAALGSTKPRAITVARAWIAGEDDHAPSIPAEPTGTVEVAGRVVNAQGAAP
                     YTRMAEKVLESASPAQLTNLWDSPLYDGVLTLSVEVPEDQKIPLTEQHTIAENATIIG
                     QSENLRPIRAAQATNDANINWLNIFYSLEWLIFAAFALYLWGRMLKDAAHRAAEPAEY
                     TQYFEYEGEYFVDETTGRPYYWDPADEQYYFFDEAPEEASVRMEDTPRNAPESGNPQK
                     PADTKD"
     gene            complement(255760..256119)
                     /locus_tag="HMPREF0733_RS01120"
                     /old_locus_tag="HMPREF0733_10237"
     CDS             complement(255760..256119)
                     /locus_tag="HMPREF0733_RS01120"
                     /old_locus_tag="HMPREF0733_10237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397574.1"
                     /db_xref="GI:503162913"
                     /translation="MPSNKMISDFSDKPKTDSFYQAIDGYVMSLGKVKREFRAQVSYS
                     VNRKFLWMWAYEKTKDGTLYFNVTLDRQEENKNIHRVTQVSPNRWNHHVEVKSLQTAK
                     SQWLRTLIDMGFEFSTQ"
     gene            complement(256234..256920)
                     /locus_tag="HMPREF0733_RS01125"
                     /old_locus_tag="HMPREF0733_10238"
     CDS             complement(256234..256920)
                     /locus_tag="HMPREF0733_RS01125"
                     /old_locus_tag="HMPREF0733_10238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321524.1"
                     /db_xref="GI:752672815"
                     /translation="MKRTLVLSALAVASTLALAACGKATESGNTDATTSATSTATTTA
                     ETTETTTATTEADGEISADYNDADIMFAQMMIPHHQQAVEMSEMLLAKEGIPAQVVEF
                     AQGVIDAQGPEIDRMNAMLEAWGQQPVTDSGGMGTMDEMGGMDHGEMGGMSGMMSQED
                     MTALEEAQGTEAARLYLEQMTAHHEGAVDMARDEVADGQNPHAITLAEQIINDQEAEI
                     AQMQQMLTDL"
     gene            complement(256969..259203)
                     /locus_tag="HMPREF0733_RS01130"
                     /old_locus_tag="HMPREF0733_10239"
     CDS             complement(256969..259203)
                     /locus_tag="HMPREF0733_RS01130"
                     /old_locus_tag="HMPREF0733_10239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005508830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_041321525.1"
                     /db_xref="GI:752672816"
                     /translation="MSTPHHSGDHHGDHPAPETDHTHHPAHASHEHHADADTHGQAMP
                     HGHPHSVLDEDHQVHGHGEHAGHSTAMFRDRFWWSLILSIPVVIFSPMVAHLLGYHLP
                     AFPGSTWVPPVLDTIIFVYGGTPFLKGGWKELKSRQPGMMLLIAMAITVAFVASWVTT
                     LGLGGFDLDFWWELALLVTIMLLGHWLEMRALGGASSALDALAALLPDEAEKVIDGTT
                     RTVATSELVVDDVVLVRAGARVPADGTILDGAAEFDEAMITGESRPVFRDTGDKVVAG
                     TVATDNTVRVRVEATGGDTALAGIQRMVADAQESSSRAQALADRAAALLFWFALISAL
                     ITAVVWTIIGSPDDAVVRTVTVLVIACPHALGLAIPLVIAISTERAAKSGVLIKDRMA
                     LERMRTIDVVLFDKTGTLTEGAHAVTGVAAAVGVTEGELLALAAAAEADSEHPVARAI
                     VAAAAAHPEASRRQIRATGFSAASGRGVRATVDGAEILVGGPNMLREFNLTTPAELTD
                     TTSAWTGRGAGVLHIVRDGQIIGAVAVEDKIRPESRAAVKALQDRGVKVAMITGDAQQ
                     VAQAVGQDLGIDEVFAEVLPQDKDTKVTQLQERGLSVAMVGDGVNDAPALARAEVGIA
                     IGAGTDVAMESAGVVLASDDPRAMLSMIELSQASYRKMIQNLIWASGYNILAVPLAAG
                     VLASSGILLPPAAAAVLMSLSTIVVALNAQLLRRIDLDPAHLAPTSPKEEHTTPTPAS
                     TAVH"
     gene            complement(259255..259581)
                     /locus_tag="HMPREF0733_RS01135"
     CDS             complement(259255..259581)
                     /locus_tag="HMPREF0733_RS01135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010933983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal transporter"
                     /protein_id="WP_041321526.1"
                     /db_xref="GI:752672817"
                     /translation="MITSPPRLLPMTSHDCSCCGPASRADTASIPAASDSSAGGSSPS
                     YQVTGLTCGHCAKSVTQALQALPQVDDVQVDLAAGGVSTVTVTGVVPPEMVRRAIEAT
                     GYTVLS"
     gene            complement(259696..260820)
                     /locus_tag="HMPREF0733_RS01140"
                     /pseudo
     CDS             complement(259696..260820)
                     /locus_tag="HMPREF0733_RS01140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006840783.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
     gene            complement(260817..>261083)
                     /locus_tag="HMPREF0733_RS01145"
                     /old_locus_tag="HMPREF0733_10243"
                     /pseudo
     CDS             complement(260817..>261083)
                     /locus_tag="HMPREF0733_RS01145"
                     /old_locus_tag="HMPREF0733_10243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012732540.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="PhoR family transcriptional regulator"
     gene            261075..261791
                     /locus_tag="HMPREF0733_RS01150"
                     /old_locus_tag="HMPREF0733_10244"
     CDS             261075..261791
                     /locus_tag="HMPREF0733_RS01150"
                     /old_locus_tag="HMPREF0733_10244"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397581.1"
                     /db_xref="GI:503162920"
                     /translation="MGDGSVVAVSRDKTYKNTNVDFRIDPTTGEYQSASVDEYPGKES
                     VNITANTLSRFKAEDAGTAPGETKRIIDPASAPEQTRLVSDNTSEAATVSAPKTVYAG
                     QKFTIGGSDWTYGEDYLPSDITVTLDDGKSKVNGQGEMTFKLSEEETSFTRDIEVPAN
                     WKPGEEHSVTISSGKTKGDKQRSLTIKFKVEEYNPKYIDSCTVPTQDAVQATEVPFAG
                     YPKVVGEVPSLNQQPATTKD"
     gene            complement(261976..263106)
                     /locus_tag="HMPREF0733_RS01155"
                     /old_locus_tag="HMPREF0733_10245"
     CDS             complement(261976..263106)
                     /locus_tag="HMPREF0733_RS01155"
                     /old_locus_tag="HMPREF0733_10245"
                     /EC_number="1.1.1.205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005226.1"
                     /note="catalyzes the synthesis of xanthosine monophosphate
                     by the NAD+ dependent oxidation of inosine monophosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-5-monophosphate dehydrogenase"
                     /protein_id="WP_013397582.1"
                     /db_xref="GI:503162921"
                     /translation="MSDIQIGLSKSARRTYALDDVALAPTRRTRDRRDVDTSWQIDAF
                     KFDTPIVGAPMDSVMSPATAIALGKLGGLGVLNLEGLWTRYEDPQPLLDEITELPEAD
                     PASATTRMQQIYAEPIKPELITARLEEIRDSGVIVAGSLTPQNTQEHYETVVQAGADL
                     FVIRGASVSAEHISTSHEPLNLKKFIYELDVPVMVGGVAGYTQAKHLMRTGAAGVLVG
                     FGGGSAMTTRKGLGISAPMATAIADVAAARSDYLDESGGRYVHVIADGGLSRSGDLVK
                     ALALGADAVMIGAPLARASEAPGQGWYWGNEAHSRDFPRGVRTPLGVVGTLEEVLYGP
                     SHHVDGTRNIVGALKRAMANCGYLDLKKFQKAEMTLVPEYRG"
     gene            complement(263308..264825)
                     /locus_tag="HMPREF0733_RS01160"
                     /old_locus_tag="HMPREF0733_10246"
     CDS             complement(263308..264825)
                     /locus_tag="HMPREF0733_RS01160"
                     /old_locus_tag="HMPREF0733_10246"
                     /EC_number="1.1.1.205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397583.1"
                     /note="catalyzes the synthesis of xanthosine monophosphate
                     by the NAD+ dependent oxidation of inosine monophosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine-5-monophosphate dehydrogenase"
                     /protein_id="WP_013397583.1"
                     /db_xref="GI:503162922"
                     /translation="MTVPTALTDDPFGFTGLTYDDVLLLPGNTDVIPSDADTSTRLSK
                     RITLGTPIISAAMDTVTDSQMAISMARLGGMGVIHRNLSIEDQAAHVDRVKRSESGMI
                     INPVTIGADATIGEYDNLCGYYKVSGLPVVTEDGKLEGIITNRDIRYLSRSDYESTLV
                     RDVMTPMPLITGSPNLTKDEAFALLSKNKIERLPLIDEAGKLAGLITLKDFVKTEQYP
                     RATKDDDGRLRVGAAIGFFGDGYERAMALVEAGVDALFVDTANGHSQGVLDMISRLKK
                     DPAAAHVDVIGGQAATREGAQAIIDAGADAVKVGVGPGSICTTRIIAGVGVPQVTAIN
                     ESAKAAIPAGVPLIADGGMQHSGEIGKALVAGADSVMLGSLLAGTAEAPGDLIFMNGK
                     QFKAYRGMGSLGAMQTRGRHKSYSKDRYFQADVSSEEKLIPEGIEGQVPFRGPLSAVL
                     HQLEGGLRQTMFYVGSRTIEELKTKGKFVRITPAGLKESHPHDITMTVEAPNYRR"
     gene            complement(265095..266684)
                     /gene="groEL"
                     /locus_tag="HMPREF0733_RS01165"
                     /old_locus_tag="HMPREF0733_10247"
     CDS             complement(265095..266684)
                     /gene="groEL"
                     /locus_tag="HMPREF0733_RS01165"
                     /old_locus_tag="HMPREF0733_10247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005228.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_013397584.1"
                     /db_xref="GI:503162923"
                     /translation="MAKQLEFNDAARKSLQAGVDKLADAVKVTLGPRGRNVVLDKQWG
                     APVITNDGVSIAREVELEDPYENLGAQLAKEVATKTNDVAGDGTTTATVLAQALVNEG
                     LRNVTSGAAPAEVKRGIEAAVEKVSERLLQDAREVQGPEVAHVAAISAQSDQIGELLA
                     SAFEKVGQDGVITIEDGSSTEIELDITEGMQFDKGYLSPSFVTDAERGEAVLEDSLIL
                     LYQGKISTVAEIMPLLEKVVQAKKPLTIIAEDVDGEALSTLVVNKLRGTLDVVALKAP
                     GFGDRRKAIMQDLAILTGSIVITPELGIDLAQATLEETGSARRVTVTKNTTTIVDGGG
                     SKEAVEDRVQQLRREIEAVDSEWDREKLKERLAKLAGGVGVIKVGAATEVEAKERKHR
                     IEDAVSSTRAALEEGIVSGGGSALIHASKALDGFELDSHDANVGVQIVRRALVQPLRW
                     IAENAGDDGYVVAAKVAEQPVGHGYNAKTGEYVDLFEAGVIDPVKVTRSALQNASSIA
                     ALVLTTETLVVTKPEEEDEDE"
     gene            complement(266814..267107)
                     /locus_tag="HMPREF0733_RS01170"
                     /old_locus_tag="HMPREF0733_10248"
     CDS             complement(266814..267107)
                     /locus_tag="HMPREF0733_RS01170"
                     /old_locus_tag="HMPREF0733_10248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="WP_037231120.1"
                     /db_xref="GI:739370104"
                     /translation="MPMAIKPLEDRVVVKLEQAEQTTASGLVIPETAKEKPQEARVVA
                     VGPGRVDDKGNRVPVDIAEGDVVVFSRYGGTEVKYQGEEYLILSARDVLAIVD"
     gene            267347..268795
                     /locus_tag="HMPREF0733_RS01175"
                     /old_locus_tag="HMPREF0733_10250"
     CDS             267347..268795
                     /locus_tag="HMPREF0733_RS01175"
                     /old_locus_tag="HMPREF0733_10250"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_013397586.1"
                     /db_xref="GI:503162925"
                     /translation="MVDFVPPPPFALPPELPFTRQALDAADALFPYSQEHSLEQVTRL
                     RAQGFTPDETANILSLVKARTRALSKFGDRARTMFLTEHGAQQATRPIVAAEHAAVFA
                     RAGVRSVADLGCGIGADSLEFARASLATVSVELDPLTASFAAANLADFSGSRVVVGDV
                     TNFNPESFRDGNGKVVQGIWLDPARRDLTGVVKSRTERIFDPEAYSPPLSFVVDLART
                     GMPMGVKLGPGMPHEAIARPEDIRSEANPHPRVTAQWVEHEGSLVELVLWFNALAQEG
                     VARTVTVLRQEATGQAEDKGLRIHKTTLRSPYSAEQVTPVDEKQTRFPSPGEYLYEPS
                     GAVVRAHLVQELAQELGANLIDPHLAYLTAAKAVQSPLAQCYEVLEEIPVHEKQLKKW
                     VRERGFTALTIKKRGVDLVPEKLRATLLAGGAGKKSGKKAAKNQGYNPATLVFTRVGS
                     GQRARRIGWHVRPVDFSDAAQVSASDTKSSLV"
     gene            268963..270111
                     /locus_tag="HMPREF0733_RS01180"
                     /old_locus_tag="HMPREF0733_10251"
     CDS             268963..270111
                     /locus_tag="HMPREF0733_RS01180"
                     /old_locus_tag="HMPREF0733_10251"
                     /EC_number="6.3.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397587.1"
                     /note="ATP-dependent carboxylate-amine ligase; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylate-amine ligase"
                     /protein_id="WP_013397587.1"
                     /db_xref="GI:503162926"
                     /translation="MIPFASSAQSTLGVEWEIALIDQHTGELVARAQEVLTRVGERYP
                     ELLEPSLDHAHVTGEFLENTLEIITGVCTTVPQACQQLISVTDKIREVTDELGLDFYA
                     AGTHPTAHWQKQQVSAKKRYQRVVGRGQYWGRHMVIFGVHVHVGVDSRDKVLPLVDAL
                     TNYCAHLLGLSVSSPYWDSVDTGYGSHRTMLYQQLPSNGLPFHFENWQEYSDYLHALV
                     KTGAILEVSEDRWDVRPVPRYGTLEMRYCDGLPSIRDVAAVTALTQCLVEFFSRKIEA
                     GEKIEVLNPWHAQENKWRAARYGLDTEIIVSNEPQVRPLREDIELLVTQLEDVARDLD
                     CLPELQHVRNMLTEGTGADRQRAIYEKTGSFHEVIRDVALQSRARPIR"
     gene            complement(270192..271310)
                     /locus_tag="HMPREF0733_RS01185"
                     /old_locus_tag="HMPREF0733_10252"
     CDS             complement(270192..271310)
                     /locus_tag="HMPREF0733_RS01185"
                     /old_locus_tag="HMPREF0733_10252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA threonylcarbamoyladenosine modification
                     protein TsaD"
                     /protein_id="WP_041321842.1"
                     /db_xref="GI:752673133"
                     /translation="MTEKTLSAAAEPLVLGIESSCDETGIGIVRGTRLLTNTISSSME
                     EHVRFGGVIPEIASRAHLDAMIPALEAALADAHVTLDDIDAIAVTAGPGLAGALMVGV
                     SAAKALATATGKPLYGINHLVAHVGVGLLDDNGTEDGSALLEHARDGGLGALLVSGGH
                     TEILQVRDITQDVRLLGATLDDAAGEAYDKVARLLGLDYPGGPAIDRAARTGNAKAFV
                     FPRGLSNRKFMGTAEAPGAHRYNFSFSGLKTAVARVIEGFEARGEEVPVADIAASFQE
                     AVVDVITKKAVLACREQGLHTLLLGGGVAANSRLRELLSARCTSAGVRLIIPKFTLCT
                     DNGAMVAALGARLVEAGYEPSGIDFTTDSSLPVTTVCF"
     gene            complement(271317..271880)
                     /locus_tag="HMPREF0733_RS01190"
                     /old_locus_tag="HMPREF0733_10253"
     CDS             complement(271317..271880)
                     /locus_tag="HMPREF0733_RS01190"
                     /old_locus_tag="HMPREF0733_10253"
                     /EC_number="2.3.1.128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine acetyltransferase"
                     /protein_id="WP_013397589.1"
                     /db_xref="GI:503162928"
                     /translation="MHSKLQHPELPGALAHGARLRRADINDVPHLFTLEQELFPLDAW
                     NLDMFLAETTHPTRTYYVLERAHSGENPQENPDEKNAPNIIGYCGVMTVADTADVQTI
                     AVLPEYEGNGYGRAMLATMHRRAQDLGAQRILLEVRADNPRAQNLYLRTGYTHIHTRP
                     GYYDDGTDALIMLKDFAADASTTTETT"
     gene            complement(271893..272678)
                     /locus_tag="HMPREF0733_RS01195"
                     /old_locus_tag="HMPREF0733_10254"
     CDS             complement(271893..272678)
                     /locus_tag="HMPREF0733_RS01195"
                     /old_locus_tag="HMPREF0733_10254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M22"
                     /protein_id="WP_013397590.1"
                     /db_xref="GI:503162929"
                     /translation="MLILALDSSATASVALARLDGENPGSTATILAARESADTRSHAE
                     VMSPFVAQVLDKAQVNGQNVDAILTGTGPGPFTGLRAGIVTARTLGFAWNKPVYGLMS
                     LTALAERAFVQDFQGKAAQMTEILVASDARRREIYSAIFTVTENGYTIKTGPQVAPAN
                     ESMPAPGSVSGQNTAGYRAYGYGAELYREQLEQSGAQISSELSQLHPNASDLVRAAAR
                     LGIKNLSTDTRALYLRDSDAKVPAAMLARQSQCASGEPVSSKG"
     gene            complement(272797..273423)
                     /locus_tag="HMPREF0733_RS01200"
                     /old_locus_tag="HMPREF0733_10255"
     CDS             complement(272797..273423)
                     /locus_tag="HMPREF0733_RS01200"
                     /old_locus_tag="HMPREF0733_10255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="WP_013397591.1"
                     /db_xref="GI:503162930"
                     /translation="MHAHPVLEVDLADLAHTRAAAHALAPLLTAGDLLLLSGELGAGK
                     TTFTRALGEGLGVREGVISPTFVLSRVHPNLLDGTRPGGPDLVHVDAYRLSSAEELDD
                     LDLEFSLEKSVTVIEWGRGKAEHLSDSRLELDFTRLTGADASIAYAAENYSPTGEGEF
                     DWDALDDREDESADASEPRLLRITAYGPRWEGEAYRSLEAAMLKLGGE"
     gene            complement(273487..274800)
                     /locus_tag="HMPREF0733_RS01205"
                     /old_locus_tag="HMPREF0733_10256"
     CDS             complement(273487..274800)
                     /locus_tag="HMPREF0733_RS01205"
                     /old_locus_tag="HMPREF0733_10256"
                     /EC_number="5.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="WP_013397592.1"
                     /db_xref="GI:503162931"
                     /translation="MTVPTRPLYTPNLQPGEAERTAIIDLNALEHNTRVLKDMIGERK
                     LIAVVKADAYGHGAYPVARSVLEAGADILGVVHVTEALELRSEGITAPIIAWLHTPQT
                     DFDEALEADIILGASGWDLEAIAEAANRTKKRARVHLKVDTGLGRNGSTFEDWPALVA
                     RALELEAAGLVRIEGIFSHLAVADEPERPETARQITRLNEFVTVARSAGLTPELVHLA
                     NSPGTITGASPLYNTNEAVLADAVRCGIALYGLSPLAGVSSKDLNLRPVMTLGTHVCN
                     VKEVPAGQGVSYGLRYSTDKPTTLALIPLGYADGVPRIAEGAPVRIYPRADAANPVEP
                     RTYRVVGRIAMDQLVVDLEEPGLADPARGILGGSAVLFGSGDNPPVEEWAAAAQTINY
                     EIVTRISPRVIRIYRGGAWVEREVDGLHALGSLFGLDDEQTPETV"
     gene            275035..276351
                     /locus_tag="HMPREF0733_RS01210"
                     /old_locus_tag="HMPREF0733_10257"
     CDS             275035..276351
                     /locus_tag="HMPREF0733_RS01210"
                     /old_locus_tag="HMPREF0733_10257"
                     /EC_number="2.4.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_013397593.1"
                     /db_xref="GI:503162932"
                     /translation="MVKIPESSQSRLPQPVVHVYSLHTDPFAQPGRGDAGGMNVYIAR
                     SIAAMLAADDTLRVEVFTLLTDPDCEHAKPGVQVPTLLNSYRDRVRVHQVLIPQALGA
                     RKNQLAEFTTEFAAQCVSLACWHPQVIHAHYWLSGVAALGAAQTYAAEGTVVPVVFTP
                     HTTAAAKDARRSPDEPEEPHARYESEHRVLEHAALTIVNTSLEGQQLQDYYGADSARM
                     RVIAPGVDTGIFHPLPGVHAEHEGSDTHARVVFAGRPQPLKGPHILVEALALLPADLH
                     VELDIIGKSSSGYELDLLARARDLGIADRVHLRSPVPADILADIFRRADIVASPSSSE
                     SFGLVALEAQASGAAVLATDADGLRFAIENHKTGLLVAPRTPQRWAVAIERLVRAPRL
                     RLTLGANAAARARSFSWEATARKTLCVYSEAITGRHLAQERAEGSA"
     gene            276444..277229
                     /locus_tag="HMPREF0733_RS01215"
                     /old_locus_tag="HMPREF0733_10258"
     CDS             276444..277229
                     /locus_tag="HMPREF0733_RS01215"
                     /old_locus_tag="HMPREF0733_10258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397594.1"
                     /db_xref="GI:503162933"
                     /translation="MSFAMTRDEFAAYLDSARITGDVATPRENNLSHIQGFLDHNEHL
                     EFGVTWSKDWTYDEVFEVMVRRVGLNPDRSHVQGQDTIGAAQCIDALEEYARIFGDAV
                     RARQKILFATGHPAGLFPIYAELARVAERAGATVLRIEQGERFLDGDIRQIMGVVMFE
                     QYGNLQHTHFPGPMRIALAQLRERGELPDLVVSDHGMAGYAASQQKLLTLGIADCNDP
                     GLFIAAEQGDLPVCVPMDDNVPPNRYEPLIDFLVNHASLKQFR"
     gene            277692..279018
                     /locus_tag="HMPREF0733_RS01220"
                     /pseudo
     CDS             277692..279018
                     /locus_tag="HMPREF0733_RS01220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888798.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="polyprenyl glycosylphosphotransferase"
     gene            complement(279117..280718)
                     /locus_tag="HMPREF0733_RS01225"
                     /old_locus_tag="HMPREF0733_10261"
     CDS             complement(279117..280718)
                     /locus_tag="HMPREF0733_RS01225"
                     /old_locus_tag="HMPREF0733_10261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397597.1"
                     /db_xref="GI:503162936"
                     /translation="MKLVYTGTQIRNAERPYLEAPDYDGYLMQRAADALAAEAHDMLA
                     DAGQHSQYTRILLLVGPGNNGADTVYAGTRLHQQGYRIEAVLFDPTGNNLELLARESG
                     EGTRVLDTAQSLRDIASYSLIIDGILGTGAKGAARGEAGEYLAKLRAVQIDGKLPPVL
                     ACDAPTGLDSERGTLHEPSLAAARTVTFIGRKLPAGTHIAEHCGTIKLYDLGVPEALK
                     GYKPMLRVMEREDYRDLLEKPSVFSHKYNRGVLGMLTGSRDYPGAALMSVRAALNTGV
                     GMVRFNGKDDTLRTLMLGQNPETVCFTGPPAHEHVHAWAGGSGTGPETLDHNRYLLNA
                     PEPAILDAGAVDLAADYLMAGHSLGEHKILTPHAGELERFLRRIHEHSPQRWEEMLDG
                     ALVPSREDINAEPFRWVRAACELSGATVMLKGSTTLIAAPVGATYSVHGATGWLATAG
                     SGDTLTGILGALLAQYMAAAQEHHEQVEGCTYASLAALAVYLHNRAALASLEGRKGPV
                     PPSRVAAYLPQAIAGLLDEKAVLDD"
     gene            complement(280759..281193)
                     /locus_tag="HMPREF0733_RS01230"
                     /old_locus_tag="HMPREF0733_10262"
     CDS             complement(280759..281193)
                     /locus_tag="HMPREF0733_RS01230"
                     /old_locus_tag="HMPREF0733_10262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_004005243.1"
                     /db_xref="GI:490103391"
                     /translation="MIIGIGVDTVNIERFERIVTETPAFVRRVFTPNERTRNIRSQAV
                     RFAAKEAVAKVLGAPDGLNWQDCEVASSESGQPYLILTGTIAERARTLGINRLHLSLT
                     HDEPVAVAIATAEYLSATELAHLKRFDPESYSMTVLAEDPTD"
     gene            complement(281394..283277)
                     /locus_tag="HMPREF0733_RS01235"
                     /old_locus_tag="HMPREF0733_10263"
     CDS             complement(281394..283277)
                     /locus_tag="HMPREF0733_RS01235"
                     /old_locus_tag="HMPREF0733_10263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005508416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_004005244.1"
                     /db_xref="GI:490103392"
                     /translation="MCGIVGYVGLDAAPDGNKFDHDAYKVVIEGLRRQEYRGYDSAGV
                     ALVCPDGIEFRKKAGKLINLEHEVEDAPLTESQIGIGHTRWATHGGPTDNNAHPHVVD
                     HGRLAVVHNGIIENFAELRAELLAEGVEFQSQTDTEVAAALIASIYNKLGTKDLTEAV
                     REASNRMEGAFTILAVHADHPDRVVATRRNSPLVIGLGENENFLGSDVSAFIDHTKEA
                     VEMGQDQIVTITGTDYSIIDFAGNPAEGKPFHIEWDAAAAEKGGYNSFMEKEIHEQPT
                     AVEQTLMGRMDEKGNLVLDELNIDDSVLRSIDKIIVVACGTAAYAGQVARYAIEHWCR
                     IPTEVELAHEFRYRDPIVNEKTLIVALSQSGETMDTLMAVRHAREQGAKVISICNTHG
                     STLPRESDAALYTHAGPEIAVASTKAFLAQITAAYLLGLYLAQLRGNKYKDEISAILG
                     ELQKMPAKIQKVIDNDTLVKELGAEMKDTSSVIFLGRHVGFPVALEGALKLKEISYIH
                     AEGFAAGELKHGPIALIEEGQPVIIIVPSAHGRESLHGKVVSNIQEVRARGAFTIVIA
                     EEGDEAVKEYADRLITVPAAPSLLQPLLATVPLQIFACALAEAKGLDVDQPRNLAKSV
                     TVE"
     gene            283463..284419
                     /locus_tag="HMPREF0733_RS01240"
                     /old_locus_tag="HMPREF0733_10264"
     CDS             283463..284419
                     /locus_tag="HMPREF0733_RS01240"
                     /old_locus_tag="HMPREF0733_10264"
                     /EC_number="2.7.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="WP_013397598.1"
                     /db_xref="GI:503162937"
                     /translation="MSSSNFSAASSRFVELERSRWSRLATEISVPLSEEELDALRGLG
                     EPVDFDEVRQIYLPISRLLNLYVNAASSLNHMTNDFLQASHRRVPFIIGVAGSVAVGK
                     STTARLLQALLRRWPSTPKVQLVTTDGFLYPNAELQRRGIMHRKGFPESYDRRALLQF
                     VSDIKSGVPVVRAPKYSHLYYDILPDEQIEVTTPDVLILEGLNVLAPAGTEGPETSDL
                     TLSDFFDFSIYVDANTKDIQRWYVNRFLTLRSSAFTNPDSYFKRYAELSDDQAIELAT
                     GIWKTVNEPNLVQNVLPTRARAHLILQKGSDHKVAQVLLRKN"
     gene            complement(284561..284914)
                     /locus_tag="HMPREF0733_RS01245"
     CDS             complement(284561..284914)
                     /locus_tag="HMPREF0733_RS01245"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321527.1"
                     /db_xref="GI:752672818"
                     /translation="MHRNDSGCDSTDVCSAGFLLSGAEGSSVVPPSGCDFWSLGCEDS
                     ETVASGLAFSDGFVSGVFSFAVGDALGFIVGFDGVELFVTFGVAVGEDDTLAGEVVPV
                     ALGVVEAVADVFPLV"
     gene            284967..285455
                     /locus_tag="HMPREF0733_RS01250"
                     /old_locus_tag="HMPREF0733_10266"
     CDS             284967..285455
                     /locus_tag="HMPREF0733_RS01250"
                     /old_locus_tag="HMPREF0733_10266"
                     /EC_number="3.4.16.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine-type D-Ala-D-Ala carboxypeptidase"
                     /protein_id="WP_013397600.1"
                     /db_xref="GI:503162939"
                     /translation="MPFYGQQLRAEAAAAAQSMMDAAARDGVTLTVSSAYRSFAAQKQ
                     TYQHWVQVNGQKTADTLSARPGYSEHQTGLAIDFGSPEGCLLQECYQDTRAGQWLAKN
                     APDFGFILRFPKNQQHVTGYIFEPWHYRYLGVGLTQEYSASGAKTLEEFFGTGAAPDY
                     LG"
     gene            285658..286026
                     /locus_tag="HMPREF0733_RS01255"
                     /old_locus_tag="HMPREF0733_10267"
     CDS             285658..286026
                     /locus_tag="HMPREF0733_RS01255"
                     /old_locus_tag="HMPREF0733_10267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="large conductance mechanosensitive channel
                     protein MscL"
                     /protein_id="WP_004005247.1"
                     /db_xref="GI:490103395"
                     /translation="MLKGFKDFLIRGNVIDLAVGIIMGTAFTAVVTALVQSVLMPAIS
                     MLVQSPNFDSFLVIGQIKIGVFLTAVVNFLLIAAAVYFAVVLPVQKLNERATRNKGEE
                     EEEETELTLLKEIRDSLAKK"
     gene            complement(286234..287592)
                     /locus_tag="HMPREF0733_RS01260"
                     /old_locus_tag="HMPREF0733_10268"
     CDS             complement(286234..287592)
                     /locus_tag="HMPREF0733_RS01260"
                     /old_locus_tag="HMPREF0733_10268"
                     /EC_number="5.4.2.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="WP_013397601.1"
                     /db_xref="GI:503162940"
                     /translation="MTERLFGTDGVRGLANEIITPALALELAQAAALVLGHEQVAEGT
                     RPRAVIANDSRASADFIVSAMKAGFTSAGVDVLDAGIVPTPAAAYLVAYTDADFGVMI
                     SASHNPAADNGIKFLARGGQKLEDATEDAIERVYREKNFRYPTGGEVGSICALENGTE
                     AYVKHLVSTLEDEKPLTGLKIVLDCANGAAYAASPAAFTRLGAEVIALAAEPNGTNIN
                     DGVGSTHPQTLQAAVVEHGATLGIAHDGDSDRCQAVDEQGNLVDGDQIMAILALAAHR
                     AGHLSQNTLVATVMSSLGLELYLREHGISLVRTAVGDRYVLEEMREHGYNLGGEQSGH
                     VIMSDYATTGDGVLTGIQLAAEVARSGEKLSVLASRMQPTPQRLINVKGVDRAGVSTN
                     AALNAAVADAEKGLGESGRVLLRASGTEPLVRVMVEAATQEQADSVAQHLADVVAKEL
                     AL"
     gene            complement(287694..288749)
                     /locus_tag="HMPREF0733_RS01265"
                     /old_locus_tag="HMPREF0733_10269"
     CDS             complement(287694..288749)
                     /locus_tag="HMPREF0733_RS01265"
                     /old_locus_tag="HMPREF0733_10269"
                     /EC_number="2.7.4.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase"
                     /protein_id="WP_013397602.1"
                     /db_xref="GI:503162941"
                     /translation="MTEKNLQPATEQVESTVPETAPQSSDVADPAVSEKKHAIKEALK
                     PQVRRTSVVEDYAAELDEMASLTHALSGNKKSSRGDAWKIGYPYDEKLGRKAYEKEKR
                     ALQIELLKLQLWAKSTGQKILIIFEGRDAAGKGGSIKRFTEHLNPRGARVVALEKPTD
                     IEQTQWYFQRYIKHLPSGGEIVMMDRSWYNRAGVERVMGYCTQAQYFEFMREVPDLER
                     MLVNSGIKLIKFWFSVTKQEQLARFTSRRTDPVRQWKLSPTDLASLDKWDDYTAAKEA
                     MFFYTHTGDAPWTVIKSNDKKRARLEAMRYVLSQFDYTSKDREVVGTCDPLIVRSATD
                     VFEEEGGSDPEGFPVIQ"
     gene            complement(288919..289416)
                     /locus_tag="HMPREF0733_RS01270"
                     /old_locus_tag="HMPREF0733_10270"
     CDS             complement(288919..289416)
                     /locus_tag="HMPREF0733_RS01270"
                     /old_locus_tag="HMPREF0733_10270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="WP_004005250.1"
                     /db_xref="GI:490103398"
                     /translation="MAQNEEQIVVEEELTSYTSESAAPVAAAAQTSRPALTVAGAAVG
                     RRKEAVARVRVVPGSGNWTINGRSLDSYFPNKLHQQDVNQPFKILELEGAYDVIARIS
                     GGGPSGQAGALRLGIARALNEIDRENNRPALKKAGFLTRDARVIERKKAGLKKARKAS
                     QFSKR"
     gene            complement(289450..289893)
                     /locus_tag="HMPREF0733_RS01275"
                     /old_locus_tag="HMPREF0733_10271"
     CDS             complement(289450..289893)
                     /locus_tag="HMPREF0733_RS01275"
                     /old_locus_tag="HMPREF0733_10271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005269828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="WP_004005251.1"
                     /db_xref="GI:490103399"
                     /translation="MRTYTPKPGEVERQWHIIDATDVVLGRLASQTAILLRGKHKPTF
                     TPNVDTGDFVIIVNAEKVALTGAKLEQKRAYRHSGYPGGLKSVNYAELLETNPVRAVE
                     KAVKGMLPKNKLAAQQIKKLKVYAGPEHPHAAQQPKTYEFNQVAQ"
     gene            complement(290158..291141)
                     /locus_tag="HMPREF0733_RS01280"
                     /old_locus_tag="HMPREF0733_10272"
     CDS             complement(290158..291141)
                     /locus_tag="HMPREF0733_RS01280"
                     /old_locus_tag="HMPREF0733_10272"
                     /EC_number="5.4.99.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="WP_013397603.1"
                     /db_xref="GI:503162942"
                     /translation="MSDQLQEPVPQASQINLDSQPSSGDGDVVLGTQRVRIDCAYEGT
                     WFSGWARQPNLVTVQGVLEDALELVLRAHHRVTVAGRTDAGVHAQAQTIHLDIAAETW
                     QKLTGRDGLADPAESLKRKVSGALKRTLAQAEHTLGIPERMRGLLQGSLVLHQVQPVP
                     QDFDARFSATGRRYTYRILDGQGSSPDPLRRAYAWCIPESLDLEDLNKAAHELTGLHD
                     FLSFCKPREGATTIRELRRIYLTRHDDGVIEATVEADAFCHHMVRSLIGALVLYGTGK
                     RTQTWLRERLENPQRDASLIMAPPHGLALAHIDYPAPEEYGLQARATRAMR"
     gene            complement(291274..291993)
                     /locus_tag="HMPREF0733_RS01285"
                     /old_locus_tag="HMPREF0733_10273"
     CDS             complement(291274..291993)
                     /locus_tag="HMPREF0733_RS01285"
                     /old_locus_tag="HMPREF0733_10273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_004005253.1"
                     /db_xref="GI:490103401"
                     /translation="MPTPTKGPRLGGSPTHERLMLNNLSAQLFQHKRITTTLTKAKRM
                     RPVAERFITFGKKGDLAARRRVLRSITDKSVVHELFTVIAPAMAERPGGYTRITKIGN
                     RKGDNAPMAVIELVMEPVETKGAVAEATKVTEKAAEAPKAEAKKAKAEKAEPKEEAKP
                     AKSEGTEGLPAGAHAPLESGEAPEGFEVKGNADSMKYHVPGSRWYANTIAEIWFDSAE
                     SAEAAGYAPAGGAAAQKVSAE"
     gene            complement(292094..293086)
                     /locus_tag="HMPREF0733_RS01290"
                     /old_locus_tag="HMPREF0733_10274"
     CDS             complement(292094..293086)
                     /locus_tag="HMPREF0733_RS01290"
                     /old_locus_tag="HMPREF0733_10274"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012903063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_013397604.1"
                     /db_xref="GI:503162943"
                     /translation="MLIAQRPTLTEEVVAPNRSRFTIEPLEPGFGYTMGNSLRRTLLS
                     SIPGAAVTSVRIDGVLHEFSTVPGVTEDVTEIILNVKKLSISSENDEPVVAYLRKQGE
                     GELTAADIEVPAGVEIHNPELHIATLNAKANFNAELIIERGRGYVSAAQNKTGDAEIG
                     RIPVDSIYSPVLKVTFSVNATRVEQRTDFDSLTLDVETKEAIAPRDAVASAGSTLVEL
                     FGLARELNVAAEGIEVGPSPADESMAADLALPIEDLNMSVRSYNCLKREGIHTVGELV
                     TRSEADLMDIRNFGAKSIDEVKAKLHELGLALKDSPPGFEPVARAYDDEDGSGE"
     gene            complement(293224..293628)
                     /locus_tag="HMPREF0733_RS01295"
                     /old_locus_tag="HMPREF0733_10275"
     CDS             complement(293224..293628)
                     /locus_tag="HMPREF0733_RS01295"
                     /old_locus_tag="HMPREF0733_10275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_004005255.1"
                     /db_xref="GI:490103404"
                     /translation="MPPKTRAAAARKTRRKVSKNIVAGQAHIKSTFNNTIVSITDPTG
                     AVISWSSAGDMGFKGSRKSTPYAAQLAAETAANRAKEHGVRKVDVFVKGPGSGRETAI
                     RSLQAAGLEVGSIQDVTPVAHNGCRPPKRRRV"
     gene            complement(293697..294065)
                     /locus_tag="HMPREF0733_RS01300"
     CDS             complement(293697..294065)
                     /locus_tag="HMPREF0733_RS01300"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B8HCX6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_005505026.1"
                     /db_xref="GI:491647500"
                     /translation="MARLAGVDIPREKRVEVALTYIYGVGKTRAHETLAATGVNPDTR
                     VKDLTDQELVALRDFIEGNYKVEGDLRREVAADIRRKVEIGSYQGLRHRRGLPVHGQR
                     TKTNARTRKGPKRTVAGKKK"
     gene            complement(294239..294352)
                     /gene="rpmJ"
                     /locus_tag="HMPREF0733_RS01305"
     CDS             complement(294239..294352)
                     /gene="rpmJ"
                     /locus_tag="HMPREF0733_RS01305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005487032.1"
                     /note="smallest protein in the large subunit; similar to
                     what is found with protein L31 and L33 several bacterial
                     genomes contain paralogs which may be regulated by zinc;
                     the protein from Thermus thermophilus has a zinc-binding
                     motif and contains a bound zinc ion; the proteins in this
                     group have the motif; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="WP_004005257.1"
                     /db_xref="GI:490103406"
                     /translation="MKVKPSVKPICDKCKVIRRHGVVMVICENPRHKQRQG"
     gene            complement(294479..294700)
                     /locus_tag="HMPREF0733_RS01310"
                     /old_locus_tag="HMPREF0733_10278"
     CDS             complement(294479..294700)
                     /locus_tag="HMPREF0733_RS01310"
                     /old_locus_tag="HMPREF0733_10278"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5CU84.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="WP_005505018.1"
                     /db_xref="GI:491647492"
                     /translation="MAKKDGVIEIEGSVVEALPNAMFRVELDNGHKVLAHISGKMRQH
                     YIRILPEDRVVVELSPYDLSRGRIVYRYK"
     gene            complement(294909..296138)
                     /locus_tag="HMPREF0733_RS01315"
                     /old_locus_tag="HMPREF0733_10279"
     CDS             complement(294909..296138)
                     /locus_tag="HMPREF0733_RS01315"
                     /old_locus_tag="HMPREF0733_10279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005259.1"
                     /note="23S rRNA m2A2503 methyltransferase; methylates the
                     C2 position of the A2530 nucleotide in 23S rRNA; may be
                     involved in antibiotic resistance; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S rRNA methyltransferase"
                     /protein_id="WP_004005259.1"
                     /db_xref="GI:490103408"
                     /translation="MSETLTGCAAASTDSTSRSTKVPVEISSVRPEPGKIALKAPRRT
                     KPPKHIADFDMAGRREFLKELGYQPFRASQLSKHYFERLVNDPAQMTDLPAQDRDEIV
                     SRAMPQLLTPVRTLEADGGDTLKVVHRLFDGALIESVIMRYDNRVTMCISSQAGCGMN
                     CPFCATGQQGLTRNLSTAEIVEQVVAGARYLKQMKGLDKADGGSEDTRPLRVSNIVFM
                     GMGEALANYKSTMGAVHRLIDPAPEGLGISARGLTMSTVGLVPGIRKFELEKLPITLA
                     LSLHAPDDELRDELIPINQRWKVDETLDAAYDYYRTTGRRISIEYALIRDINDQGWRA
                     DLLGKKLAQRGRGWVHVNPIPLNPTPGSKWTASRKGVEQNFVERLRAHGIPTTIRDTR
                     GSDIDGACGQLAAKEEE"
     gene            complement(296219..297055)
                     /locus_tag="HMPREF0733_RS01320"
                     /old_locus_tag="HMPREF0733_10280"
     CDS             complement(296219..297055)
                     /locus_tag="HMPREF0733_RS01320"
                     /old_locus_tag="HMPREF0733_10280"
                     /EC_number="3.4.11.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="WP_013397606.1"
                     /db_xref="GI:503162945"
                     /translation="MARVEIKTNAQLHHMSRAGIITSRALDAAVAAAKPGVSTAELNK
                     VFERSLEEQGGISNFYGYYDYPASICTSVNHEVVHGIPGDYILQDGDIISIDGGAYII
                     DPATKKQWHGDSARTVLVGHTSQARRDLSDITREALWHGIAALAHAKKIGEVGIAIEE
                     FVRSETGDTYGIIEDYVGHGIGTQMHMAPDVLNYAARDLGPKIKPGMAFAIEPMLVMG
                     NTDTTVLEDDWTVITTDRSDACQWEHSVAVHRDGLWVLTAEDGGASELARFGIIPVPI
                     PK"
     gene            complement(297173..297736)
                     /locus_tag="HMPREF0733_RS01325"
                     /old_locus_tag="HMPREF0733_10281"
     CDS             complement(297173..297736)
                     /locus_tag="HMPREF0733_RS01325"
                     /old_locus_tag="HMPREF0733_10281"
                     /EC_number="2.7.4.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="WP_013397607.1"
                     /db_xref="GI:503162946"
                     /translation="MNRLLIIGPPGAGKGTQAVKIAEELKIPAISTGDIFRKNIKEET
                     ELGKEAKSYIDSGNLVPDSVTNNMVRARLDEADVAHGFLLDGYPRNIAQVHELDAILA
                     DKNQQIDRVLLLVADDDELVARLLNRAAEQGRTDDNEEVIRHRLKVYEEETAPLVAKY
                     RERGIVKEVDGLGEIADVTERILKALS"
     gene            complement(297733..299040)
                     /locus_tag="HMPREF0733_RS01330"
                     /old_locus_tag="HMPREF0733_10282"
     CDS             complement(297733..299040)
                     /locus_tag="HMPREF0733_RS01330"
                     /old_locus_tag="HMPREF0733_10282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_013397608.1"
                     /db_xref="GI:503162947"
                     /translation="MLSAFGRVIKTADLRRKLLFTLGMIVLYRMGTFIPAPGISYGTV
                     QQCLNANQTHGGAYDIINLFSGGALLQLSIFALGVMPYITASIIIQLLRVVIPRFQEL
                     HDEGAQGQAKLTQYTRYLTIALALLNATTIVSMARSGVLLGNCPGIIPQDDVLHILVI
                     IITLCAGTGVIMWMGEQITERGVGNGMSLLIFTSIASSFPNALGSILEQQGPFVFWSV
                     CLVGLAVMLAVVYVEQSVRRVPVQYAKRMIGRRTIGGTSTYIPLKVNMAGVIPIIFAS
                     SLLTLPGIIAQFNTPQGGAAPPEWVNWVNTYLTRGDHPLYIALYFLLILGFTYFYVAV
                     TFDPVEVADNMKKYGGFIPGVRAGKPTERYLSYVLTRITLPGSLYLAVVSMIPLVALV
                     LFNANQNFPFGGASLLIVVGVGLDTLKQVSAQLQQRNYEGLLR"
     gene            complement(299313..299759)
                     /locus_tag="HMPREF0733_RS01335"
                     /old_locus_tag="HMPREF0733_10283"
     CDS             complement(299313..299759)
                     /locus_tag="HMPREF0733_RS01335"
                     /old_locus_tag="HMPREF0733_10283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_013397609.1"
                     /db_xref="GI:503162948"
                     /translation="MADAIKIHDLRPAPGAHKAKTRVGRGEGSKGKTAGRGTKGTKAR
                     YQVRPGFEGGQLPLHMRLPKLRGFKNPFRTEYQVVNLKRIQELFPEGGEVTVEALVAK
                     GAVRKNELVKVLGDGDITVKVNVVVDKASASAISKIEAAGGSVTVK"
     gene            complement(299761..299967)
                     /locus_tag="HMPREF0733_RS01340"
                     /old_locus_tag="HMPREF0733_10284"
     CDS             complement(299761..299967)
                     /locus_tag="HMPREF0733_RS01340"
                     /old_locus_tag="HMPREF0733_10284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_004005265.1"
                     /db_xref="GI:490103414"
                     /translation="MAKRIQPSDAKLEITQVKSYVGQKQNMRDTLRSLGLKRPGNKVV
                     RTADPVTVGMVNTVAHLVKVEEVK"
     gene            complement(299967..300638)
                     /locus_tag="HMPREF0733_RS01345"
                     /old_locus_tag="HMPREF0733_10285"
     CDS             complement(299967..300638)
                     /locus_tag="HMPREF0733_RS01345"
                     /old_locus_tag="HMPREF0733_10285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_004005270.1"
                     /db_xref="GI:490103419"
                     /translation="MSEQNVKETQVSEAVAAETAETSKQREERRNNRGERRGRGDRKN
                     RAREEEKDKYIERVVTINRVSKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAKEVPAA
                     IAKGVEEAKKNFFRVPRIENRTIPHRVQGEEAAGVVMLRPATAGTGVIAGGPVRAVLE
                     AAGIHDVLSKSLGSSNQINIVHATVAALKQLEEPLAVAARRGLPNDEVIPSYLRNTKS
                     DKAGA"
     gene            complement(300638..301000)
                     /locus_tag="HMPREF0733_RS01350"
                     /old_locus_tag="HMPREF0733_10286"
     CDS             complement(300638..301000)
                     /locus_tag="HMPREF0733_RS01350"
                     /old_locus_tag="HMPREF0733_10286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_004005271.1"
                     /db_xref="GI:490103420"
                     /translation="MAIKSKASQRARRHARIRKYVSGTAARPRLCVTRSSRHMFVQVI
                     DDVKGVTLASASTMEAELRAATDLDKTAKAKRVGELVAERAKAAGIETVVFDRGGNKY
                     HGRVAAVADGAREGGLAL"
     gene            complement(301003..301539)
                     /locus_tag="HMPREF0733_RS01355"
                     /old_locus_tag="HMPREF0733_10287"
     CDS             complement(301003..301539)
                     /locus_tag="HMPREF0733_RS01355"
                     /old_locus_tag="HMPREF0733_10287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_004005272.1"
                     /db_xref="GI:490103421"
                     /translation="MSRIGRLPISVPAGVEVKVDGNLVTVKGSKGELSHQVASPITVA
                     LNDNEIAVSRPNDERVSRSLHGLTRTLIQNMIIGVTNGYEKKLEIVGTGYRVTAKGND
                     LEFALGYSHPISVSAPEGVSFAVEGANKLTISGIDKQLVGQVAANIRGLRKPDPYKGK
                     GVRYAGEHIRRKVGKAGK"
     gene            complement(301567..301965)
                     /locus_tag="HMPREF0733_RS01360"
                     /old_locus_tag="HMPREF0733_10288"
     CDS             complement(301567..301965)
                     /locus_tag="HMPREF0733_RS01360"
                     /old_locus_tag="HMPREF0733_10288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_004005273.1"
                     /db_xref="GI:490103422"
                     /translation="MTMTDPVADMLTRLRNANSAYHDTVSMPYSKLKARIAEILKAEG
                     YIADVKEEEAKVGKTLTLVLKYGPSRERSIAGVRRISKPGLRTYAKSTNLPRVLGGLG
                     TAILSTSSGLLTDKQAAKKGVGGEVLAYIW"
     gene            complement(302039..302599)
                     /locus_tag="HMPREF0733_RS01365"
                     /old_locus_tag="HMPREF0733_10289"
     CDS             complement(302039..302599)
                     /locus_tag="HMPREF0733_RS01365"
                     /old_locus_tag="HMPREF0733_10289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_004005274.1"
                     /db_xref="GI:490103423"
                     /translation="MSETKITPRFKTKYAEVVVPALQEEFKYQNVMQTPKFVKVVVNM
                     GVGEAARDAKLMDGAIRDLTAITGQKPVVTRAKKSIAQFKLREGMPIGAHVTLRGDRM
                     WEFLDRLVTLALPRIRDFRGLSDRQFDGNGNYTFGLTEQSMFHEIDQDSIDRVRGMDI
                     TVVTSAKTDDEGRAMLKALGFPFKTN"
     gene            complement(302599..302934)
                     /locus_tag="HMPREF0733_RS01370"
                     /old_locus_tag="HMPREF0733_10290"
     CDS             complement(302599..302934)
                     /locus_tag="HMPREF0733_RS01370"
                     /old_locus_tag="HMPREF0733_10290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_004005275.1"
                     /db_xref="GI:490103424"
                     /translation="MAKIKSGDLVQVISGADKGKQGKVLKVIPKENRVIVEGVKVVTK
                     HTKANPVTGAAGGIQKVEAPIHVSNVAIVDPETEKPTRVGFREETVERNGKQRTVRVR
                     VAKRSGKDI"
     gene            complement(302938..303309)
                     /locus_tag="HMPREF0733_RS01375"
                     /old_locus_tag="HMPREF0733_10291"
     CDS             complement(302938..303309)
                     /locus_tag="HMPREF0733_RS01375"
                     /old_locus_tag="HMPREF0733_10291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005504986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_004005276.1"
                     /db_xref="GI:490103425"
                     /translation="MIQQESRLKVADNTGAKEILTIRVLGGSSRRYAGIGDIIVATVK
                     DAIPGGTVKKGDVVKAVVVRTKKATRRADGSYIKFDENSAVILKNTDGDPRGTRIFGP
                     VGRELRDKKFMKIVSLAPEVL"
     gene            complement(304763..306757)
                     /locus_tag="HMPREF0733_RS01380"
                     /old_locus_tag="HMPREF0733_10293"
     CDS             complement(304763..306757)
                     /locus_tag="HMPREF0733_RS01380"
                     /old_locus_tag="HMPREF0733_10293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_041321528.1"
                     /db_xref="GI:752672819"
                     /translation="MTPSSNHGISRPTQRALASAGVVSLVMASLSAMPASFANEQQPA
                     PHDNSSGCRNIAITADRYQGLPGEYQLAYSNYTRNLYTTFSNGRPPVYTGGIGVWTTY
                     GEIPTLDEVMLPGTVDFVPSGQTEATSKQLASPDGIAIDDAHGTIWVTQTRTNSVTVY
                     DLYTKKELWTSYDAQNPENGSVSRPREVKVDAKSGKAFVSGSGGVTVFDLKSHQVIQK
                     INFTSSDGSADTGMNMELDSEGGRLYVPSLNSGTLKAINTETLAVEQTIELHKDVADA
                     QLRPSDVTIDKSLGEIYVSSQGDMDRETKVSKGNSGITVYDLKTGEYKKSINFGKQTL
                     AITADEEHDVVYATDFATGKIGVIDGRTGSITHEVSTGAEGGANDVLVTPEGEVYAVV
                     RDKFADNVTTGYTLDPTTGKFKEAASAEPKGENGADTPITVNSLVKITPTFTAVPNIP
                     QCDPVQTQQVVATTSTAGAVYPRGTSTVPVQTKTDTPVFSDVPEGSPFYADIQWLAHQ
                     RLSFGWADGTYRPQQTVDRGAMAAYFYRLAGSPEVALPEISPFKDVDSSHPFYKEIVW
                     MSQQGITTGYEDGTYRPGISVDRGAMAAFFFRYAKVTNYEVPQTPQFKDVDRNNPFYR
                     EISWFKDQHITTGWGDGTFRPNEPIQRAAMAAFIHRFAVK"
     gene            complement(307064..307336)
                     /locus_tag="HMPREF0733_RS01385"
                     /old_locus_tag="HMPREF0733_10294"
     CDS             complement(307064..307336)
                     /locus_tag="HMPREF0733_RS01385"
                     /old_locus_tag="HMPREF0733_10294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_004005278.1"
                     /db_xref="GI:490103427"
                     /translation="MSEVKNEERGYRKSRRGYVVSDKMDKTVVVEVEDRVKHALYGKV
                     MRRSSKIKAHDEQNVCGVGDYVLLAETRPLSATKRWRVVEILEKAK"
     gene            complement(307333..307572)
                     /locus_tag="HMPREF0733_RS01390"
                     /old_locus_tag="HMPREF0733_10295"
     CDS             complement(307333..307572)
                     /locus_tag="HMPREF0733_RS01390"
                     /old_locus_tag="HMPREF0733_10295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_013397613.1"
                     /db_xref="GI:503162952"
                     /translation="MAVGSKDLSIDKLAELSNEELAAKLSESKKELFNIRFQEVTGQA
                     NAGRRRTIKRDIARIYTVLRERELGIRPATEGESK"
     gene            complement(307578..307994)
                     /locus_tag="HMPREF0733_RS01395"
                     /old_locus_tag="HMPREF0733_10296"
     CDS             complement(307578..307994)
                     /locus_tag="HMPREF0733_RS01395"
                     /old_locus_tag="HMPREF0733_10296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005504968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_004005279.1"
                     /db_xref="GI:490103428"
                     /translation="MLIPRRVKFRKQHHPKRHGLAKGGTEVSFGEWGIQALSPAYVTN
                     RQIEAARIAMTRHIKRGGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRV
                     MFEIAGVSEEVAREALRLAIHKLPMKARVVRREGGE"
     gene            complement(307995..308792)
                     /locus_tag="HMPREF0733_RS01400"
                     /old_locus_tag="HMPREF0733_10297"
     CDS             complement(307995..308792)
                     /locus_tag="HMPREF0733_RS01400"
                     /old_locus_tag="HMPREF0733_10297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_004005280.1"
                     /db_xref="GI:490103429"
                     /translation="MGQKIHPNGFRLGITTEHVSKWFADSNKPGERYADFVREDVKIR
                     ELLAKNLDRAGVAKVEIERTRDRVRVDIHTARPGIVIGRRGAEADRIRGELEKLTGKQ
                     IQLNILEVSNPDLSAQLVAQSIAEQLAARVAFRRAMKKAIQSAQRAGAKGIRIQCSGR
                     LGGAEMSRSEFYREGRVPLHTLRANIDYGFFEAKTTFGRIGVKVWIYKGDLTDKELAA
                     QQAANNRRGNRRDGDRRRSGGRGPRRERRNENASANTEAKTAENGEA"
     gene            complement(308793..309158)
                     /locus_tag="HMPREF0733_RS01405"
                     /old_locus_tag="HMPREF0733_10298"
     CDS             complement(308793..309158)
                     /locus_tag="HMPREF0733_RS01405"
                     /old_locus_tag="HMPREF0733_10298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005504964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_013397614.1"
                     /db_xref="GI:503162953"
                     /translation="MEAKASARFVRVTPMKARRVVNLIRGKQAEEALAILKFAPQGAS
                     EPVYKIVASAIANARQKATQEGLPFREEELFVSEAFVNEGPTMKRIQPRAQGRAYRIN
                     KRTSHITVVVATPEKEEDR"
     gene            complement(309217..309498)
                     /locus_tag="HMPREF0733_RS01410"
                     /old_locus_tag="HMPREF0733_10299"
     CDS             complement(309217..309498)
                     /locus_tag="HMPREF0733_RS01410"
                     /old_locus_tag="HMPREF0733_10299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013349684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_004005282.1"
                     /db_xref="GI:490103431"
                     /translation="MPRSLKKGPFVDQHLYLKVAAQNEKGTKNVIKTWSRRSMIIPDM
                     LGHTIAVYDGRKHVPVFITESMVGHKLGEFAPTRTFRSHVKDDRKGKRR"
     gene            complement(309511..310347)
                     /locus_tag="HMPREF0733_RS01415"
                     /old_locus_tag="HMPREF0733_10300"
     CDS             complement(309511..310347)
                     /locus_tag="HMPREF0733_RS01415"
                     /old_locus_tag="HMPREF0733_10300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_004005283.1"
                     /db_xref="GI:490103432"
                     /translation="MGIRKYKPTTPGRRGSSVADFVEITRSTPEKSLLRPLHKTGGRN
                     NTGRITTRHKGGGHKRQYRLIDFRRHDKDGVNARVAHIEYDPNRTARIALLHYFDGSK
                     RYIIAPNRLSQGDIVESGPSADIKPGNNLPLRNIPVGTVLHCVELRPGGGAKLARSAG
                     ASVQLVAKEGKYGQLRLPSGEIRNVDVRCRATVGEVGNAEQSNINWGKAGRNRWKGIR
                     PTVRGVVMNPVDHPHGGGEGKTSGGRHPVNPNGKPEGRTRRPNKESDKLIVRRRRTGK
                     KR"
     gene            complement(310390..310692)
                     /locus_tag="HMPREF0733_RS01420"
                     /old_locus_tag="HMPREF0733_10301"
     CDS             complement(310390..310692)
                     /locus_tag="HMPREF0733_RS01420"
                     /old_locus_tag="HMPREF0733_10301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_004005284.1"
                     /db_xref="GI:490103433"
                     /translation="MSVSTKSVYDVIIAPVVSEKSYGQIDEDKYTFEVAPDSNKLEIK
                     QAIETIWDVKVASINTMNRKGKRKRTRFGWGSRKDTKRAIVTLKEGRIDIFGGPQA"
     gene            complement(310692..311309)
                     /locus_tag="HMPREF0733_RS01425"
                     /old_locus_tag="HMPREF0733_10302"
     CDS             complement(310692..311309)
                     /locus_tag="HMPREF0733_RS01425"
                     /old_locus_tag="HMPREF0733_10302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_004005285.1"
                     /db_xref="GI:490103434"
                     /translation="MAVKTLKVDLPAEIFDAQASVPLLHQVVVAQLAAARQGTHKTKN
                     RGEVSGAGRKPFKQKGTGNARQGSIRAPHMTGGGVVHGPTPRNYAQRTPKKMIAAALR
                     GALSDRARHDRIHVVENFISGETPSTKAAKAAFAELTDRKNVLFVIDRAEDVLALSAR
                     NLQKVHVLYADQLNTYDVLVSDDVVFTKAAYDAFVAANQKKEGAK"
     gene            complement(311316..311972)
                     /locus_tag="HMPREF0733_RS01430"
                     /old_locus_tag="HMPREF0733_10303"
     CDS             complement(311316..311972)
                     /locus_tag="HMPREF0733_RS01430"
                     /old_locus_tag="HMPREF0733_10303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_004005286.1"
                     /db_xref="GI:490103435"
                     /translation="MTNKFERQVKGLLGTKLGMTQVWDEDGKVVPVTVVKADSNVITQ
                     IRNQETDGYHAVQIGFGSIDSRKVTKPLAGHFEKAGVTPRRHLVELRTADAAEYSLGQ
                     ELTVEMFEPGQKVDVVGKTKGKGFAGVMKRHGFKGVGASHGQHKNHRKPGSIGGASYP
                     ARVFKGMRMAGRMGAARHTTLNLTIQGVDAENNVLLIKGAIPGPKGGVVLVRTAVKGA
                     "
     gene            complement(311986..312294)
                     /locus_tag="HMPREF0733_RS01435"
                     /old_locus_tag="HMPREF0733_10304"
     CDS             complement(311986..312294)
                     /locus_tag="HMPREF0733_RS01435"
                     /old_locus_tag="HMPREF0733_10304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006547395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_004005287.1"
                     /db_xref="GI:490103436"
                     /translation="MAGQKIRIRLKSYDHEVIDSSARKIVETVKGAGATVVGPVPLPT
                     EKNVYCVIRSPHKYKDSREHFEMRTHKRLIDVVDPTPKAVDALMRLDLPADVNIEIKL
                     "
     gene            312896..316333
                     /locus_tag="HMPREF0733_RS01440"
                     /old_locus_tag="HMPREF0733_10307"
     CDS             312896..316333
                     /locus_tag="HMPREF0733_RS01440"
                     /old_locus_tag="HMPREF0733_10307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041321529.1"
                     /db_xref="GI:752672820"
                     /translation="MSTPNHEFPSGAQPQGSGQSPQTPAGYSCPQAQMPWQGQNPQTT
                     WYSDPSQATMQAPQQTTRSLTRRRAEDLFLNVLLYLGSLLLIGSAALFITSITSQDRT
                     SVILRVAGLGLGSLLFYSAGLITYKTVARLRIASYSFTATGLALLPLTGIATYVLGLW
                     NDGSLIWLLVSLVGTAAIILACSFMRNRVMAYVLISFFVSDALAATNVAALPFVWYFV
                     ALTVLAIILGLLIRLNSRLVPTGLREGLLESSRIFVPVTAIVVLFFIPQMSSSDMGIV
                     FSVMSAHAFVFTALERKLDYYIQARLYPFIALISFGWGLERPITVTIVLMGLYALHLL
                     AVLVGYPLMQREMKANLPKHPIMRWDVRIDTYISIIFAAFVTFIEMPHALLTNIDSFP
                     TGLEFMLLVHLDGVTFPRAWVFAVLCVGIIVAYRKYLLAQEYVYLITGISSGLSLILL
                     GQHESAFYLYFVTAGILMLTARKLQLPQLLVSSTTKIFLFLGTMHLLFTLQLGWGVRG
                     ILLAGALTITALGLFAALRYEMLPQKRSLTAFWEILVYLVMAVVFFLLRSIFTWTPRE
                     IVDPTLDTSLYVVALLAVLALGFLTLRASSAYKDQKIVPLICIYLTLCGLGIAATSMN
                     YLFPAGDWWAVGVLVLTSIYMFGMSYIVPQETSERHIMFMTSRFPMLWSVIVLWASNS
                     IASDQVFLTASGLLLIQGLLSGILYMTRRQPRERIVFYIIFYTACLPGFIAPFAYSDN
                     ALFTAIFCPLAVLVLWGLGEAANLAMLRVCASIALLLTGYTVTNHMLNLNHARFSEYV
                     IYQGLAAALCSAVLYGLTTLLKREIPGKYDSLQPLNVQLENSAKVIQLPLHGPARSSK
                     NYLVSQRNDSTRFYGPHNTFLMVPAIIAIAFWTLASIASEDTVQSALLWGLTALSFAS
                     VSTKRMLPTAIVAAPVAFTTRILLDFSVTGFFQSLLEAAILILLAVVASKILRNLIEK
                     HPAQQGISAALLYTAIGLQGLLTIMAWGTGYLQQGAVIMLLGILLTALVSVVLDRIWV
                     FVSAALVTVDLALLLNGLNPLTLMIISVLLIAGVVWRLLARDQGPSADKRAPALPQNP
                     YQGAPAGFVPPNGASAPYGQAPWAGQQPYQGYNQPNGQAQYPGYSQQHNNPNGNSQA"
     gene            complement(316754..317944)
                     /locus_tag="HMPREF0733_RS01445"
                     /old_locus_tag="HMPREF0733_10308"
     CDS             complement(316754..317944)
                     /locus_tag="HMPREF0733_RS01445"
                     /old_locus_tag="HMPREF0733_10308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013349691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_013397618.1"
                     /db_xref="GI:503162957"
                     /translation="MAKAKFERSKPHVNVGTIGHVDHGKTTLTAAISKVLADKYPDLN
                     EQRDFGMIDSAPEERQRGITINIAHIEYQTEKRHYAHVDAPGHADYVKNMITGAAQMD
                     GAILVVAATDGPMAQTREHVLLARQVGVPTLLVALNKADMVDDEELLDLVEMEVRDLL
                     SSQEFDGDDAPVIRVSALKALEGDPEWVAKVEELMEAVDTYIPDPVRETDKPFLMPIE
                     DVFTITGRGTVVTGRAERGTLKINSEVEIVGIRPIQKTTVTGIEMFHKQLDEAWAGEN
                     CGLLLRGLKRDDVERGQVVVEPGSITPHTEFEANVYILSKDEGGRHNPFYSNYRPQFY
                     FRTTDVTGVIKLPEGTEMVMPGDNTEMSVELIQPIAMEEGLGFAIREGGRTVGSGRVT
                     KIIK"
     gene            complement(318150..320264)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_RS01450"
                     /old_locus_tag="HMPREF0733_10309"
     CDS             complement(318150..320264)
                     /gene="fusA"
                     /locus_tag="HMPREF0733_RS01450"
                     /old_locus_tag="HMPREF0733_10309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005290.1"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_013397619.1"
                     /db_xref="GI:503162958"
                     /translation="MAHDVYTDLNKVRNIGIMAHIDAGKTTTTERILFYTGINHKIGE
                     THDGASTMDWMAQEQERGITITSAAITCFWKDNQINIIDTPGHVDFTVEVERSLRVLD
                     GAVAVFDGKEGVEPQSETVWRQADKYDVPRICFVNKMDKMGADFYFTVQTIVDRLGAK
                     PLVMQLPIGAESDFVGVVDLLEMKAYVWPGDSKGDVTMGAEYETREIPADLQAKAEEY
                     RAELIEAVAESSEELMEKYLEGEELTIDELKAGIRQLTINGEAFPVLCGSAFKNRGVQ
                     PMLDAVIDYLPSPLDVPDVEGSSPSNEEEKLTRKASSDEPFAALAYKVAAHPFYGQLI
                     YTRVYSGHAAQGQQVLNSTKGKKERLGKLFQMQSNKENPVDEITAGHIYAAIGLKDTT
                     TGDTLCDPANPIVLETMTFPAPVIFVAIEPKTKGDQEKMSTAIQKLSAEDPTFTVSLN
                     EETGQTEIGGMGELHLDIIVDRMKREFKVEANVGKPQVAYRETIKKTVEKVDYTHKKQ
                     TGGSGQFAKVQVSFEPLPLDGEELYEFEDKVTGGRVPREYIPSVDAGIQDAMKFGVLA
                     GYPMVGVKATLIDGAYHDVDSSEMAFKIAGSMVFKEGAKRANPVLLEPLMDVEVRTPE
                     EYMGDVIGDLNSRRGHVRSMEDASGVKIVKALVPLTEMFGYIGDLRGKTQGRAVFSMA
                     FDSYGEVPKNVADEIIQKSRGE"
     gene            complement(320337..320807)
                     /locus_tag="HMPREF0733_RS01455"
                     /old_locus_tag="HMPREF0733_10310"
     CDS             complement(320337..320807)
                     /locus_tag="HMPREF0733_RS01455"
                     /old_locus_tag="HMPREF0733_10310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006245075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_004005291.1"
                     /db_xref="GI:490103440"
                     /translation="MPRKGPAPKRPLVNDPVYGSALVTQLINKVLLDGKKSVAERIVY
                     GALEGVEKKTGSDPVVTLKKAMDNIKPSLEVRSRRVGGATYQVPVEVRPGRSTALALR
                     WLVGFSKQRREKTMTERLMNEILDASNGLGAAVKRREDTHKMAESNKAFAHYRW"
     gene            complement(320807..321181)
                     /locus_tag="HMPREF0733_RS01460"
                     /old_locus_tag="HMPREF0733_10311"
     CDS             complement(320807..321181)
                     /locus_tag="HMPREF0733_RS01460"
                     /old_locus_tag="HMPREF0733_10311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006213513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_004005292.1"
                     /db_xref="GI:490103441"
                     /translation="MPTIQQLVRKGRTPKVVKTKAPALKGNPMKRGVCTRVYTTTPKK
                     PNSALRKVARVKLNGGIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYKIVRGAL
                     DTQGVKGRGQARSRYGAKKEKK"
     gene            complement(321727..325632)
                     /locus_tag="HMPREF0733_RS01465"
                     /old_locus_tag="HMPREF0733_10312"
     CDS             complement(321727..325632)
                     /locus_tag="HMPREF0733_RS01465"
                     /old_locus_tag="HMPREF0733_10312"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_013397620.1"
                     /db_xref="GI:503162959"
                     /translation="MSNESSLGLMRIGLATADDIRRWSYGEVKKPETINYRTLKPEKE
                     GLFDERIFGPTKDWECYCGKYKRVRFKGIVCERCGVEVTRSKVRRERMGHIELAAPVT
                     HIWYFKGVPSRLGYLLDLAPKDLEKVIYFAAYMITSVDEEARHEDLPNLQAAHDREKR
                     ELESQRDADIAAISREVEQELARIEAEGGKKTAEKRKLRDNAERQMASVRKRADREIE
                     HLEKVWDRFKNLKVADLEGDEALYRSMIDKYGLYFEGAMGAEAIKKRLETFDLEAEAE
                     ALKEVIQTGKGQKKTRALKRLKVVNAFLTTNNSPLGMVLDVVPVIPPELRPMVQLDGG
                     RFATSDLNDLYRRVINRNNRLKRLLELGAPEIIVNNEKRMLQEAVDSLFDNGRRGRPV
                     TGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLEMHQCGLPKQMAL
                     ELFKPFVMKRLVELSHAQNIKSAKRMVERFRPQVWDVLEEIITEHPVLLNRAPTLHRL
                     GIQAFEPKLVEGKAIQLHPLVCSAFNADFDGDQMAVHLPLSPEAQAEARILMLSSNNI
                     LKPSDGRPVAVPSQDMIIGLYHLTTTREGEKNEGHAFSSIAEALMAMDRHDIELYTKI
                     KVRLSGDEFVAPEGWEAPEGYTPGDPILLECTVGQILFNQTLPKDYPWFSGIADKKGL
                     GKLINDLAEKYPMDIVARTLDNLKNAGFYWASRSGVTVAVSDIATPATKPAIMERYEK
                     QASAIEDEFDVGMIGDDERREELIKIWTEATDTVAEAMRENLSDNGGLNTIYRMVTSG
                     ARGNWMQVRQIAGIRGLVSNPKGEIMPRPIKSSYREGLSVLEYFIATHGARKGLADTA
                     LRTANSGYLTRRLVDVSQDVIVREHDCGTRRGLVLPLIDADGNLHPDVETSIHGRTLA
                     IDVKDSDGNVIASAGEDVSDVLIEKLFKAGVKELRVRSVLTCESSIGVCALCYGRSMA
                     SNVLVDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVASADDITQGLPRIQELFEARTP
                     KGVAPISEVSGRVTIEDTEKSYKIVVTPDDGSEPQSYTVLRRAASKLQTGDHVQVGDQ
                     LAAGAVDPKEVLRIRGPREAQKHLVSEVQGVYKSQGVEIHDKHVEVIVRQMLRRVTVI
                     ESGDTELLPGELVDNIVFQKANRKALVEGKKPAAGRPEMMGITKASLATESWLSAASF
                     QETTRVLTQAAMEAKTDPLLGLKENVIIGKLVPAGTGLARYNDIEVEPSQKAREEQMQ
                     AFDGFGYQSAFTQLGEDPYPYANSGYMAVPLDEYGRGLE"
     gene            complement(325733..329242)
                     /locus_tag="HMPREF0733_RS01470"
                     /old_locus_tag="HMPREF0733_10313"
     CDS             complement(325733..329242)
                     /locus_tag="HMPREF0733_RS01470"
                     /old_locus_tag="HMPREF0733_10313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_041321530.1"
                     /db_xref="GI:752672821"
                     /translation="MVASSTFNHDAANGAENNSDRRISFAKISEPLKVPNLLAIQTDS
                     FDRLVGNERWAKRLENAQATGDTSVPEKSGLAEIFEEISPIRDFQETMQLSFSDPEFS
                     DPKYTMEECKDRDATYAAPLYVKAEFMNLTTGEVKQQTLFMGDFPLMTESGTFVINGT
                     ERVVVSQLVRSPGAYFEKAPDRTSDKDIYSARVIPSRGAWFELEIDKRDQVGVRLDRK
                     RKQSVTVLLKALGWTEAKILAEFGNYDSIRATLEKDSVSTRDEALLDIYRKLRPGEPP
                     TVEAAQALLDNMYFTPRRYDLAKVGRYKVNRKLGVDVPLDSPEASVLSQDDIAQMIHY
                     LCALHAQESSIPGKRDGKEISVKIDIDDIDHFGNRRIRTVGELIENQIRTGLSRMERV
                     VRERMTTQDVDSITPQSLVNIRPVVAAIKEFFGTSQLSQFMDQNNPLAGLTHKRRLSA
                     LGPGGLSRDRAGMEVRDVHPSHYGRMCPIETPEGPNIGLIGSLATYGRINSYGFIETP
                     YRVVEDGKVTDKVRYLTADDEKSVIIAQANAPLTNERTFAEDEVLCRAGDGSGEAVLV
                     APGAVQYMDVSPRQMVSVATALIPYLEHDDANRALMGANMQRQAVPLLESEAPVVGTG
                     MEKYAALDSGDSVLAKKAGVVSEVSADLVLVRNDDGTTSSYPIMKFSRSNPGNCYNQR
                     VVVKAGQRVEERDVIADGPSTDGGELALGKNLLVAYMPWEGLNYEDAIILSQRMVSED
                     VLTSIHIEEHEIDARDTKLGPEEITRDIPNVSEEVLSALDDRGIIHIGAEVEAGDILV
                     GKVTPKGETELTPEERLLRAIFGEKSREVRDTSLKVPHGESGTVIGVRIFDRESDDED
                     DLPPGVNKLVRVYVAQKRKITDGDKLAGRHGNKGVISKILPVEDMPFLEDGTPVDVIL
                     NPLGVPGRMNIGQVLEVHTGWLAKQGWKIEGDPAWLKNMPNFPKESGPTRLATPVFDG
                     AHEDELFDLMDHANPNRDGDRLITRSGKARLIDGRSGEPFPDPISVGYQYILKLHHLV
                     DDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDD
                     VAGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSTDGKTIEMSDSEEE
                     GFRAAEDMGVSLTHEEPSSVDEL"
     gene            complement(329589..330116)
                     /locus_tag="HMPREF0733_RS01475"
                     /old_locus_tag="HMPREF0733_10314"
     CDS             complement(329589..330116)
                     /locus_tag="HMPREF0733_RS01475"
                     /old_locus_tag="HMPREF0733_10314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397622.1"
                     /db_xref="GI:503162961"
                     /translation="MAMKPNNTHDPNIINFNYDADEEFYVSDPVDVPALKKASVTFSF
                     DTKTLDSAGWQRIRAAIDNLRSPDTDIFAQATPYVYQFYRMYFDMADEYGWEQYLPDI
                     PESQVWTLVDPIWDRCTVAWDNNNVLIVVEAETEWDVEHGMMMVLQDGTKLVKVGMVV
                     ESYTNPDGSIFLREE"
     gene            complement(330173..331051)
                     /locus_tag="HMPREF0733_RS01480"
                     /old_locus_tag="HMPREF0733_10315"
     CDS             complement(330173..331051)
                     /locus_tag="HMPREF0733_RS01480"
                     /old_locus_tag="HMPREF0733_10315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013397623.1"
                     /db_xref="GI:503162962"
                     /translation="MELRYLESFEAVVRCGGFTKAAADLHLAQPAISAHVKRLEKELG
                     VTLLNRSRTVTLSAAGEQFLPYARLALANLDEGKRLMQSFHSVSAGHVRVAVTPLTGN
                     FDVAGLLSRFRARYPQVTISLSTGLIAELLGKLEAGQVDVVIGPAGAADKRQGWQRTE
                     ITSERLVLITPLAGRGHVSTLADVAHEPFVCLPSDSGLRHLLNEAFGVIGVEPRVDFE
                     THSPASIREMVAANLGCAIIAQSIVEKQGAAVRVHHIPGLPPHPPISVMSEEEPAPPT
                     ARFLEELEATIREHTR"
     gene            331131..332144
                     /locus_tag="HMPREF0733_RS01485"
                     /old_locus_tag="HMPREF0733_10316"
     CDS             331131..332144
                     /locus_tag="HMPREF0733_RS01485"
                     /old_locus_tag="HMPREF0733_10316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="WP_041321531.1"
                     /db_xref="GI:752672822"
                     /translation="MTLHQHTDSPATRNLGALTTSALGFGCMGLSQGYGSADDTESIA
                     AIHAALDAGVTLLDTAISYGQGHNEALVGRAVASSGMPRNNLQIATKFGIVRGEHGVH
                     LDAHPDRIAGYCDESLRRLGTETIDLYYLHRVDPQVPIEESIGAMSELVSQGKVRHLG
                     VSEVTADQLRRAHAIHPIAAVQFEWSLMWREPEVNIVPAARQLGVGLVPYSPLGRGLL
                     GGSLNTTSVAESPFRANDPRFNGSSLTANMRQVDALASFAQSRSMTVAQLALAWLLAQ
                     GDDVVPIPGTRNAQRAQENAAAMRYHLEAEDLAALESMVPTNGWVGDRQSFAVPVTTR
                     PVF"
     gene            complement(332230..333726)
                     /locus_tag="HMPREF0733_RS01490"
                     /old_locus_tag="HMPREF0733_10317"
     CDS             complement(332230..333726)
                     /locus_tag="HMPREF0733_RS01490"
                     /old_locus_tag="HMPREF0733_10317"
                     /EC_number="4.3.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine dehydratase"
                     /protein_id="WP_013397625.1"
                     /db_xref="GI:503162964"
                     /translation="MALDTGVPSSVQKQAEALEYDISVFELFSIGIGPSSSHTVGPMR
                     ASNRFIAELIDTNLLSRITKVHIDLYGSLAATGAGHGTMSAALKGLCGHVPETICLTE
                     ADSMIERNSVDGTLPLAGYPSSMYGATAPSGEEGKVYGPVLNYRELDITLRPLTVLPR
                     HTNGIKIAAFEGEKMLLERTYFSIGGGFIVEGDEPATGGASLEHPPYPFGSGAELLDM
                     ANEAGMSIAQLKMTNECSLRSEAEVRQGILHIYKVMKECIGSSLSRVGYLPGPLKVRC
                     RAGAWHRDLMTEDPNKSPEYAIDWVNLIALAVNEENAFGGRVVTAPTNGASGIIPAVL
                     HYAMNYTPGIRHCGRGKREDAVIDFFLAAAAIGVLYKKRASISGAEVGCQGEVGSASS
                     MAAAGLAQVLGGTNEQIENAAEIAMEHNLGLTCDPVGGLVQIPCIERNAMAASNAVTA
                     ARMALRGDGAHRVSLDQVIETMRQTGMDMSHRYKETSMGGLAVNVVEC"
     gene            complement(334085..335203)
                     /locus_tag="HMPREF0733_RS01495"
                     /old_locus_tag="HMPREF0733_10318"
     CDS             complement(334085..335203)
                     /locus_tag="HMPREF0733_RS01495"
                     /old_locus_tag="HMPREF0733_10318"
                     /EC_number="2.1.2.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein T"
                     /protein_id="WP_013397626.1"
                     /db_xref="GI:503162965"
                     /translation="MSPKKTALYPVHEKLGAAFTDFGGWDMPLKYANDVAEHQAVRTR
                     AGIFDLSHMGEFRITGPDAAAFLDYALVSNMSVLKPGRAKYSILANDKGGVIDDLITY
                     RLGDEEFLVVPNAANIDNDFAAMSERLGNFDVKFVNESDDTSLIAVQGPRAEEILLAA
                     GASDEDAVRELKYYASVPVTIAGVDVLLARTGYTGEDGFELFVPNANAVKLWDALAAA
                     GESFGLTPAGLAARDSLRLEAGMPLYGHELGLDITPFESGLGRLVEIALEKKTVDFVG
                     RTALTELAKSPSERILVGLKAQAKRPARAGSILVDAEGNQIGEVTSGIPSPTLGYPIA
                     MALVKREFSEVGSEVDVDIRGKRATFDVVSLPFYKREK"
     gene            complement(335398..338250)
                     /locus_tag="HMPREF0733_RS01500"
                     /old_locus_tag="HMPREF0733_10319"
     CDS             complement(335398..338250)
                     /locus_tag="HMPREF0733_RS01500"
                     /old_locus_tag="HMPREF0733_10319"
                     /EC_number="1.4.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397627.1"
                     /note="acts in conjunction with GvcH to form
                     H-protein-S-aminomethyldihydrolipoyllysine from glycine;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine dehydrogenase subunit 1"
                     /protein_id="WP_013397627.1"
                     /db_xref="GI:503162966"
                     /translation="MSFIDRHLGPRSADAEQMLKALGYDSLGALMDDAVPPQIRLHGE
                     LDLPDPLTEQDALAKIAEYAAENKVYTQMIGEGYYDAVTPAVLRRNILENPGFYTSYT
                     PYQAEISQGRLEALLNFQNVVMELTGLDIANASLLDEASAVAEAVVMMHRANRKVKNG
                     FFAIDSRCLPQVLAVVRGRAELLDIPFVVTDFSEGLPEGDLYGVVLAYPASDGEIRDI
                     EPLVKAAKERNALVTVDADLLALTLLKSPGELGADIAVGNTQRFGLPFFFGGPHAAYM
                     AVHKGMERTMPGRLVGVSQDSAGKPSYRLSLQTREQHIRREKATSNICTAQALLAIVA
                     GAYAVYHGPEGLRAIAERLHTNAARVATALESAGFGIAYEHFFDTVVIDASARADELV
                     AKALEAGINIRRINENRVGISVGESHDDRVLERLVKAFGAELPSEADAKFSIPTDLLR
                     TDEYMKHPVFHKYRSETEMMRYLRHLSDKDLALDRTMIPLGSCTMKLNAAAEMEPISW
                     PEFANIHPLVPADQAQGWHKLIKELSDWLVAITGYDVVSLQPNSGATGEYGGLRAIRA
                     YHEANGDHERDTVLIPLSAHGTNAASAALAGLKVAGVATASDGSIDVDDLKAKIEKYG
                     DKIAGIMITYPSTHGVFEPQVSEVCELVHAAGGQVYVDGANLNAQMGFAQPGKFGGDI
                     SHLNLHKTFSIPHGGGGPGVGPLAAREHLAKYLPGDAATADAEGKLPSGAALPIAQAF
                     FGSAGVLPISWMYIAMSGAEGLKKSSEYAVLNANYVAKKLNDKFPVLYTGNANLVGHE
                     CILDIRELTDRSHVTAEDVCKRLMDFGFHAPTLAFPVPGTLMMEPTESESKEELDRFI
                     EAMETIYGEILEVAEGKVAVEDSVLRNAPHTVDVVSADEWDRPYSRTQAAFPVPSLRA
                     NKYFTPVGRIDGAGGDRHFVCECPPVEAFDLEAHAE"
     gene            complement(338743..339987)
                     /locus_tag="HMPREF0733_RS01505"
                     /old_locus_tag="HMPREF0733_10320"
     CDS             complement(338743..339987)
                     /locus_tag="HMPREF0733_RS01505"
                     /old_locus_tag="HMPREF0733_10320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013397628.1"
                     /db_xref="GI:503162967"
                     /translation="MSAPTAESYDLKKGQLFNLLLVTFASTVGFWAWTIVGPLAKYYA
                     KPDQMHLNPGTTSLLVAMPIFIGAIGRIPIGGLTDKYGGRIMMSLVLAVSAPLVLLVG
                     VAGSMKSFPLMLVFSFLLGIAGTVFAVGIPFSSAWYPPARKGFATGVFGAGMVGTALS
                     AFFTPRLMNLVGYMNTHYIIAALCAVTAVISFLFLRDSPATANREVTPLMPKIIRAFK
                     VKSTWQLCFLYSVVFGGFVAFSNYLPTYLNNIYSFNPEDAGARAAGFAAAAVVARPFG
                     GILADKFGPKIITFIALGGVSVLALVTAFQPDAEHVYGPIFLTMAALLGLGSGSVFGW
                     VGRAADPKNVGAVSGVIAAAGALGGFFPPLVMGATYDAAHRNYFIGLTLLAVTAAVAF
                     ASAFLVKHGGKPEHHRADAAAK"
     gene            complement(340023..340856)
                     /locus_tag="HMPREF0733_RS01510"
                     /old_locus_tag="HMPREF0733_10321"
     CDS             complement(340023..340856)
                     /locus_tag="HMPREF0733_RS01510"
                     /old_locus_tag="HMPREF0733_10321"
                     /EC_number="1.7.99.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase subunit gamma"
                     /protein_id="WP_013397629.1"
                     /db_xref="GI:503162968"
                     /translation="MYALASEHAAHAVPVGEPGIVDTLLWGVLPYVTILVLIGGTIWR
                     YRTDQFSWTTRSSQIYESKMLRLGSPLFHYGLAAVFMGHVGGLVVPKMLTDLVVDDHT
                     YHIVALVGGSAAAAATILGLFLLLWRRRRNAQVFSATTMNDKFMYFVLVAVILAGTAA
                     TLISAFDPSGGLPPVNGHEVEFNYRTSIAVWFRSIFYFHPEVALMVNVPVAFKIHIIV
                     AMVLFIIWPFTRLVHALTVPLHYLFRPYTIYRSRGNERVGARRGWDNPQEALPRERVN
                     R"
     gene            complement(340880..341626)
                     /locus_tag="HMPREF0733_RS01515"
                     /old_locus_tag="HMPREF0733_10322"
     CDS             complement(340880..341626)
                     /locus_tag="HMPREF0733_RS01515"
                     /old_locus_tag="HMPREF0733_10322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_041321532.1"
                     /db_xref="GI:752672823"
                     /translation="MAGFFSKLMGKADSGNTPESAQAAHDNIDPFDRDYGAGEDRDSV
                     IYQVSGMLLSYPTEETLDLLPEFTRLAQATENPDFVQAVQTVADWLTARELEEVQSDY
                     VQEYDLSRRHALHLSYWTDGDTRRRGETLLRFKKMYRDSGMLTRLNGELPDYLPLVLE
                     FAALVDRRQGRAALQAYRPSLELLRLALRDGDLPHYGLLQSICNTLPGVSPETQEQVQ
                     QMAGYGPPVETVGLSGYADPRLTQVNPNNI"
     gene            complement(341630..343243)
                     /gene="narY"
                     /locus_tag="HMPREF0733_RS01520"
                     /old_locus_tag="HMPREF0733_10323"
     CDS             complement(341630..343243)
                     /gene="narY"
                     /locus_tag="HMPREF0733_RS01520"
                     /old_locus_tag="HMPREF0733_10323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012903032.1"
                     /note="with NarZV catalyzes the reduction of nitrate; the
                     beta subunit is an iron sulfur cluster containing electron
                     transfer subunit; one of 3 nitrate reductases in E. coli;
                     expression of nitrate reductase Z is not dependent on
                     nitrate levels; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase subunit beta"
                     /protein_id="WP_004005307.1"
                     /db_xref="GI:490103458"
                     /translation="MRVMAQVAMVMALDKCIGCHTCSVTCKQAWTNRSGTEYVWFNNV
                     ETRPGQGYPRRYEDQEKWKGGWVLNKRGRLELKSGNRFQKLFSIFASPIQPELSDYYE
                     PWTYDYQNLTTAPLGDDFPAAKPVSMITGQDTKIQWGLNWDDNLGGAPEHGHLDPLVE
                     KVRKKAEDKIKFEFEQTFMFYLPRICEHCLNPSCMAACPSGAIYKRAEDGIVLVDQDR
                     CRGWRQCITGCPYKKVYFNHKTGKAEKCTFCYPRIEAGIPTVCAETCVGRMRYIGIFL
                     YDADRVTEAASVADEKDLYESQLSLMLDPSDPEIIRLARENDIPEAWITAAQKSPVYK
                     LAKEWKVALPLHPEYRTMPMVWYVPPLSPIVDLLKDQGHDAENSQNLFGAIEALRIPV
                     EYLAELFTAGDTEVVTFVLKRLAAMRAYMRDINLGGEGNEEIANSVGMTGAQMYEMYR
                     LMAIAKYNERYVIPPAHMEDAHNLEEMGCSLSVDGGPGMYGDAFNDMEGRPTPVSTGV
                     YESSNKVSLFSWDGNSRPDGLFPNTTGKK"
     gene            complement(343243..346965)
                     /locus_tag="HMPREF0733_RS01525"
                     /old_locus_tag="HMPREF0733_10324"
     CDS             complement(343243..346965)
                     /locus_tag="HMPREF0733_RS01525"
                     /old_locus_tag="HMPREF0733_10324"
                     /EC_number="1.7.99.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase A subunit alpha"
                     /protein_id="WP_013397631.1"
                     /db_xref="GI:503162970"
                     /translation="MEQASQTKGPDGPLTDQLIKFGKFFSRWDETDDGRAVFREGGRK
                     GDTFYRDRWSHDKEVRSTHGVNCTGSCSWKVYVKDGIITWEAQQTDYPTVGPDRPEYE
                     PRGCPRGAAFSWYTYSPTRVKYPYVRGLLLEMYREAKALHSDPVEAFHSIVSDPVKRN
                     RYVSARGKGGLVRSTWAEALEIVAAAHVHTIKYYGPDRCTGFTPIPAMSMVSFSAGVR
                     FIQLIGGVMTSFYDWYADLPVASPQVFGDQTDVPESGDWWDASYLIMWGSNIPVTRTP
                     DAHWVAEVRYRGTKVVSVSPDYADNTKFADEWLPAQAGTDAALAMAMGHVILKENYVD
                     QRVEFFEDFALTYTDLPFLVTLETREDGTKVPSKFLTAASLAGEQHQENADFKTAMMD
                     RETGEVFVPNGTMGHRYSESDQGKWNLELDGRKPILSIRDLPQGESAAVEIKMPTFDN
                     PKGHGDIMTRGVPVTYVEGQEVTTVFDLMLATYGIGRPGLPGDWAKDYEDWSIQNTPA
                     WQEQITSVPPEAVIRVAREFAQNAIDSHGRSMIIFGAGICQWYHADTTYRAILALLNL
                     TGCQGRNGGGWAHYVGQEKARPLTGLTNMANALDWSRPPRHMIGTGFWYMHTDQFRQD
                     GYSTDYLQSPLGTGELKGVHTADVVARSTRMGWMPFYPQFPENSLDLADKAEAAVARG
                     EAKDNADYVAQRLNSGDLEFSVEDVDNPVNWPRTLMLWRSNLFGSSAKGESYFLKHLV
                     GSMDNVQGADHEESIPREVTWYQEAPQGKLDLLVTSDFRMTTTTLLSDVVLPTATWYE
                     KHDISSTDMHPFLHAFSPAIDPPWEARTDHDTFKALSYEFTRQAKKHLGTRKDIVSVP
                     LLHDTPGQIKQPGGHAPDWKSTPGMLGVPGKNMPNFMTVERDYSAMYDMYTSVGPLFD
                     KVGATTKYVTYDLKDEVAQMAKEFGVMDSGKGAGRPALDTDTKLAESILRISGTSNGE
                     VALKGFKELEKQTGLHLMDLAEGNEERKITFPMTQAAPQPVMTSPEWSGSETGGRRYA
                     PFTVNIEKKKPFHTLTGRMHFFLDHDWMHEMGEALPIYRPPLDMTGLFKEPEIGTTDG
                     VSVAVRYLTPHNKWAIHSQYFDNQHMLTLFRGGQTAWMSPQDAEKIGVKDGEWIECVN
                     TNGVFVGRAVVSHRMPEGVCYVHHAQERMMTPKTETTGKRGGIHNSMTRILLKPTHMI
                     GGYAHQAFAFNYLGPTGNQRDIVSYIRRRKSQEVTF"
     gene            complement(347045..348253)
                     /locus_tag="HMPREF0733_RS01530"
                     /old_locus_tag="HMPREF0733_10325"
     CDS             complement(347045..348253)
                     /locus_tag="HMPREF0733_RS01530"
                     /old_locus_tag="HMPREF0733_10325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein"
                     /protein_id="WP_013397632.1"
                     /db_xref="GI:503162971"
                     /translation="MSFIPDPETTPEPVTQLSAAERAFYARQLILPEIGMAGQLKLKA
                     ARVAVLGAGGLGAPALLYLAGAGVGEIIIIDDDSIEVSNLHRQVIHTYARSGNSKAES
                     ASETMRALNPFITVTVARERLTDTNALNLLTGADAVLDGSDNFEARYAVSAAAQQLGI
                     PHIWAAILGFDAQLSVFWAGHGPVYEDLYPQAPAPGSVPSCSTAGIIGALAGVVGSAM
                     AMEAIKVITGSGKPLLGEVGLYSALTGKWEYIPLLASMQAKPKKSVETHPQESQDTKN
                     HLIFRHNSGKLTGNHHTQKLEDITPVQARQLSQHEKMTLIDVREAIEFSSFAIDGAIN
                     LPLTEILEAAREGSLAARIREKVDPASKYLVVYCTGYTRALEAARDIAAVTDIPVRVL
                     VGGISGWLTV"
     gene            complement(348291..348779)
                     /locus_tag="HMPREF0733_RS01535"
                     /old_locus_tag="HMPREF0733_10326"
     CDS             complement(348291..348779)
                     /locus_tag="HMPREF0733_RS01535"
                     /old_locus_tag="HMPREF0733_10326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin converting factor"
                     /protein_id="WP_013397633.1"
                     /db_xref="GI:503162972"
                     /translation="MTTKPQGLDHSGAHGAEPTGSVVIFTDITEEALEPLAAAAKAQV
                     MTEAMGALVVFDGIVRNHDHGSAVRGLSYSAHPQAKEYIARVVQSVADELEGVRLWAV
                     HRVGPIAIGESALTVLAAAAHRGRAFEACEAVADRVKAQVPIWKEQELTDGSTEWVGI
                     DT"
     gene            complement(348769..349287)
                     /locus_tag="HMPREF0733_RS01540"
                     /old_locus_tag="HMPREF0733_10327"
     CDS             complement(348769..349287)
                     /locus_tag="HMPREF0733_RS01540"
                     /old_locus_tag="HMPREF0733_10327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein"
                     /protein_id="WP_037231153.1"
                     /db_xref="GI:739370137"
                     /translation="MSAEEIQLPENLTGLVIVASTRAARGIYEDKSGPIAVEWLRSRG
                     FKTPDAVVIEDRQIIDYFNSLIADGKKNNNLPTFILTSGGTGLNTDDQTVEAVRPHLD
                     KEIPGIMHAFWANGLQNVSSAVLSRGVAGVIDKTFVMTLPGSRGGVKDGVKTLDPLVE
                     HICRQMEDYHDH"
     gene            complement(349359..349865)
                     /locus_tag="HMPREF0733_RS01545"
                     /old_locus_tag="HMPREF0733_10328"
     CDS             complement(349359..349865)
                     /locus_tag="HMPREF0733_RS01545"
                     /old_locus_tag="HMPREF0733_10328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein MoaC"
                     /protein_id="WP_013397635.1"
                     /db_xref="GI:503162974"
                     /translation="MTEKNLRSDAAQPAQDLTHVRADGSAHMVDVTLKDVTTRTALAE
                     GTVHTRADVIAKIFDADLPKGDALPVARVAGIMGAKRTPDIIPLCHPLPLGKITLDFE
                     RGEDFVRIVASVKTRGVTGVEMEALTAVSTAALTIFDMIKAVDKYAVISNIRVLEKSG
                     GKSGDWAV"
     gene            complement(349911..351290)
                     /locus_tag="HMPREF0733_RS01550"
                     /old_locus_tag="HMPREF0733_10329"
     CDS             complement(349911..351290)
                     /locus_tag="HMPREF0733_RS01550"
                     /old_locus_tag="HMPREF0733_10329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein MoeA"
                     /protein_id="WP_013397636.1"
                     /db_xref="GI:503162975"
                     /translation="MHKPQFDGTPSTEEYRAYLALLLRDTFIGRAENLPLARATDRIL
                     AQDVLARLDVPSFDNSQMDGYALTAEGASRENRIFTVGREIPAGRPLQRSRASDDLTY
                     PIMTGAPIPKGYVAVVPVEHSERIEYPDLPESFGRPSEKIRLPKAPKGQFIRRRGEDV
                     VAGQIMARSGERVTPALLGTLAAQGYTRVTVACGPRVLVCTGGDEIRPTLTEDGDDTA
                     TELAYGQIYDANGPMLTSMLVEDGAVVRRISIGDDPELLIEHLREEYETFAPDIIITS
                     GGISHGKYEVVRNAIAMAPSLGLPIPLSWFGHVSQQPGGPQGVNVLDFNGHRLPMISF
                     PGNPVSTLISYVLMLRPYLRAGGPYGTPHEVASRMATLENAPRGVLVIDKPLTAPANK
                     RQFLRGNLAMVETEPGTYQVELYPDVLPGSHLLHHAATADVLIELAPGTTYTGGEAVR
                     YHRIRLTDN"
     gene            complement(351321..352187)
                     /locus_tag="HMPREF0733_RS01555"
                     /old_locus_tag="HMPREF0733_10330"
     CDS             complement(351321..352187)
                     /locus_tag="HMPREF0733_RS01555"
                     /old_locus_tag="HMPREF0733_10330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter permease"
                     /protein_id="WP_049775414.1"
                     /db_xref="GI:908631381"
                     /translation="MSPQIPKDVPVKKHTAFTAVPRYFVVPALLGFLLILGPLVGLLY
                     NIPWMRLHDIIDKEVLDAARLSLTTASISTLICGLLGAPLALVLSKVLSRSRLKKFGG
                     VLYAIIYTPVILSPVVSGLGLLFFWGRKGMIGEHLYHLGIIIPFTPTAVILAQTFVAL
                     PFFVATAVTTLQAIPEEYEQIARVEGAKSSEITYRVLLPLAAPGIATAFLLSFARALG
                     EFGATVTFAGNVQGKTETIPLGIELAIAGGSMSSALGNALMLISLYVCIFGLLGLFSV
                     VKKLRAKAFYNS"
     gene            complement(352265..353086)
                     /locus_tag="HMPREF0733_RS01560"
                     /old_locus_tag="HMPREF0733_10331"
     CDS             complement(352265..353086)
                     /locus_tag="HMPREF0733_RS01560"
                     /old_locus_tag="HMPREF0733_10331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013397638.1"
                     /db_xref="GI:503162977"
                     /translation="MKTSLKVASASAALFASVAMTGCGSNSSNTDASASASSAASGSV
                     SGKVEVYAAASLRNAGTELKEAFEKENPGVEITYSFEGSSKLVQKIEQGASPDLLITA
                     DTQNMDKAAKLDEFKDAKREVIATNKLVLVTAEGNPGKINSLDDLKNSEGVVAVCKVN
                     VPCGTLADEELKKHHIELKNATTEGNVSEVATKVTTGNADAGFIYTTDLAAAKKDGKN
                     LGSVDLPDVPRNEYPAALTTKGSSSDAAKKFNEWLSSDEAQKILAKYDFESPQAN"
     gene            353268..354491
                     /locus_tag="HMPREF0733_RS01565"
                     /old_locus_tag="HMPREF0733_10332"
     CDS             353268..354491
                     /locus_tag="HMPREF0733_RS01565"
                     /old_locus_tag="HMPREF0733_10332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein MoeA"
                     /protein_id="WP_013397639.1"
                     /db_xref="GI:503162978"
                     /translation="MAYTAGSGRTQLIAGPVLRTLASEQDANTAFVTPENSGDAQKPL
                     HKPARKTPYITNRGPLLDRWGRIATDLRISLIDKCNLRCIYCMPAEGLEWLPKNNLLT
                     SAEIARLADIAIRELGVEEIRFTGGEPLVRADLVDIIGRIHREHPTIPLAITTNGIGL
                     EKRAQALADAGLSRINVSLDTICPETFAELTRRDKLGSVLKGIDGAAAAGLKPIKINA
                     VLMPGINDAQAPELLQWALDGGYQLRFIEQMPLDADHKWTREGTITAAQIRTMLSEHF
                     VLGTVAEKRGDSPAQLWEVYPLGTALDSAGFPREATASLGRVGIIASVTESFCGACTR
                     TRLTADGKIRSCLFSDSETDLLDLLRSGASDREIALRWREGMWFKPRAHGKEDADFDI
                     EEFAQASRSMSAIGG"
     gene            354495..354761
                     /locus_tag="HMPREF0733_RS01570"
                     /old_locus_tag="HMPREF0733_10333"
     CDS             354495..354761
                     /locus_tag="HMPREF0733_RS01570"
                     /old_locus_tag="HMPREF0733_10333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397640.1"
                     /db_xref="GI:503162979"
                     /translation="MQIHFFAAARAASGVAETQMSLTDLAEPTLRALVEKLGEAFTGK
                     TASGMTLAQVMHQCSFLIDGTRSELDAALTDNARVDVLPPFAGG"
     gene            354758..355558
                     /locus_tag="HMPREF0733_RS01575"
     CDS             354758..355558
                     /locus_tag="HMPREF0733_RS01575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein"
                     /protein_id="WP_013397641.1"
                     /db_xref="GI:503162980"
                     /translation="MNSDLWAVVRFWRLLHVFRQDAHHATLAAIIPEGLTSVHTPHDP
                     LRAPDNGTRTQHSVTRAAQIPAFCAIIVAGGKSSRLNHTPKAGLSNGSQTLLERALDA
                     AGQAQQRVVVGPGTLPVPSDTLHTREDPPYSGPAAALHAGLEKIAAAYAAREKAPPAW
                     CLILGVDTPQIAPAVQKLLAHTIDASTETLGYWGVAGGIFQPLIGIYRFAPLREAFAE
                     GSTNASVRSFVKRLAPVAVELDPAHTADVDTWEQAHELGYSTPRWLDY"
     gene            355587..356855
                     /locus_tag="HMPREF0733_RS01580"
                     /old_locus_tag="HMPREF0733_10335"
     CDS             355587..356855
                     /locus_tag="HMPREF0733_RS01580"
                     /old_locus_tag="HMPREF0733_10335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein MoeA"
                     /protein_id="WP_013397642.1"
                     /db_xref="GI:503162981"
                     /translation="MSHHHPPAVSWHEARELLHTAASALTPTLSTEALPLQATIGRYV
                     AEDLTARMPVPHYSSSAMDGYAVAGAPPWRLVSPDYPEDARTNVHRLAVPIAAGEATP
                     ILTGGLLPEGTEAIVREEHSHRYEGAGALGSGIHYLDMAEGYTVPKPGTDIRYAGAEL
                     SPGAILSSRGDLITAQRAAFLGVNGFDELPVLKNVPVRCAFTGNEVITFGMPSPGQVR
                     DAFGGFLEVSLAGAGCEVRPSARLADIAEEFHTFVTTSTARILIFTGGSSTSGVDMVR
                     QTLADIGAEYIFESVRVRPGHPALAAKIPAPKEGMNAGQERLVLGLPGNPLAAYTALY
                     SYLPVILAGLRGLPIPALDRAELATDIPPLRKRSQHRLMPVRVSEGKAYPLDALASHM
                     LSGLAQATHFALVDATGQQAGTHAILVPVF"
     gene            357040..358062
                     /locus_tag="HMPREF0733_RS01585"
                     /old_locus_tag="HMPREF0733_10336"
     CDS             357040..358062
                     /locus_tag="HMPREF0733_RS01585"
                     /old_locus_tag="HMPREF0733_10336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose operon repressor ScrR"
                     /protein_id="WP_013397643.1"
                     /db_xref="GI:503162982"
                     /translation="MAQPKLGDVAARAGVSPTTVSRVLNNRGYLSQKTRDKVFAAIRE
                     LGYRPNAIARSLQERRSHIIGLIFPTVAHPFYGEMVYRLESRLANAGYRVILCNSDEQ
                     PELEHRYLDMLFAHQVDGVITGSHSQVVAQLPQVQAPLVAIDRPETGPYPNIRSDNYA
                     GARQATEHLIGTGARRILHITSTLSEQNLRQRGYTDALTAAGLSPDFLELGFHESAEH
                     QRNMLYEYLDEHRGAQPVEAVFASNDTYASLALAWAQSRRVRVPEEFQVIGFDGTDTV
                     RTLLPELASVVQPIDALADRAVQRLTEAIAAETEEDAEPADARGGEDVLPVTLRLGGT
                     VRPARD"
     gene            complement(358224..358928)
                     /locus_tag="HMPREF0733_RS01590"
                     /old_locus_tag="HMPREF0733_10337"
     CDS             complement(358224..358928)
                     /locus_tag="HMPREF0733_RS01590"
                     /old_locus_tag="HMPREF0733_10337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="WP_013397644.1"
                     /db_xref="GI:503162983"
                     /translation="MNTTPYTVRQARPEEVSQVLDTLTEAFLNDPYMYKVLGEKPQED
                     KLRARFEVQLEGTYMPRGCVDVAVDLDGKILGTALWLSPENQQTDVKQELRDNAKFMR
                     ILGPRTMRHVMAENRELHKYRPKFKHWYLHTIAVRKAAQGLGVGTELLRHAIDRFDGT
                     AAYLEASTPRSAALYERLGFIPMGTFASGDPYMGMLYPMNLETAQDDEHSVSVREEDS
                     HDEGHFMMRELVGSSS"
     gene            complement(359233..361230)
                     /locus_tag="HMPREF0733_RS01595"
                     /old_locus_tag="HMPREF0733_10339"
     CDS             complement(359233..361230)
                     /locus_tag="HMPREF0733_RS01595"
                     /old_locus_tag="HMPREF0733_10339"
                     /EC_number="2.7.1.69"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397646.1"
                     /note="phosphoenolpyruvate-dependent sugar
                     phosphotransferase system; catalyzes the phosphorylation
                     of incoming sugar substrates concomitant with their
                     translocation across the cell membrane; IIB is
                     phosphorylated by IIA and then transfers the phosphoryl
                     group to the sugar; IIC forms the translocation channel;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sucrose transporter subunit IIABC"
                     /protein_id="WP_013397646.1"
                     /db_xref="GI:503162985"
                     /translation="MDHKSVAERVLQDVGGVDNIRAAAHCATRLRLVLKNQDSVDQSA
                     IDNDEDLKGSFLNAGQFQIIVGPGDVNEVFKHMVASGAPEVSKDDLKSIAANQGNIFS
                     RFIKTIADIFIPLIPVLVGGGMLMALDNVLRAKNIFGPKPLIEMYPAWEGFADIVNLL
                     SAAPFAFLPVLVGYSATKVFGGNPYLGLTMGAAMVSPALMNGYKVAASLAHTEGTDPM
                     KYWDLFGLQVQQAGYQGTVLPILLVSFILANIERFFHKILKGTIDFIFTPTLTLLITG
                     FVTFLLVGPPMFQLGTWLGEGVNWLYTAAGPIGGLIFGVLYAPIVITGLHQSFPPIET
                     SLWASGGSFIFVIASISNVAQGAAAAGVALTTKNKKIKGVASASAPSAFLGITEPALF
                     GVNLVLRWPFYIAITSAGLGGALSAILGVKASALGSAGYLGIPSVNPQVGAGWLGFIT
                     CLLVTTALAFAASYFWGLKVARSEASSPDVAVLAADGASKTDTVAAAAQEPEIEGEKT
                     ELTTHLAGTVVPLAEVKDATFSSGALGDGTAVEPTEGKLLAPADGKITVAFPTGHAYG
                     MRTEDGLDLLMHIGMDTVELDGKHFTPKVAKGDTVKRGDVLAEFDIPAIKDAGYVLVT
                     PLVITNAKKLTTAVRDAQTSGASVAAGDNLLQVGLKEKTSA"
     gene            complement(361419..362954)
                     /locus_tag="HMPREF0733_RS01600"
                     /old_locus_tag="HMPREF0733_10340"
     CDS             complement(361419..362954)
                     /locus_tag="HMPREF0733_RS01600"
                     /old_locus_tag="HMPREF0733_10340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sucrose-6-phosphate hydrolase"
                     /protein_id="WP_041321533.1"
                     /db_xref="GI:752672824"
                     /translation="MSPKKTKTSKKASKARPERDLALEAQDVLDTFGAAVRSDRDYPA
                     LHLAPPVGRLNDPNGLVYDGHNYHAFYQYSPLHPERKVYWRHAVSTNLVDWKDVGTAL
                     VPNTRYDSHGCYSGSGIRVKGGFEFFYTGNVKDSKNKRESYQILATAGKDGNPVRQLP
                     PLISGPHDGYTAHYRDPHVFERDGKWWMVIGAQRKDKTGAVVVYTSKDRRDWKFKGEL
                     GIKAKELEKCYMFECPSLLQLRDEVTGEMRDVLIFSPQGLKPMGERYLNIYQSGYIVG
                     KFNPKTLKFKVETPFTELDAGFEFYAPQTISGTGISAAKDAPHEETVMIAWFGNAEQD
                     DQPSWSKRWVHMMTFPRELHLRDGKLYQHPVPQLDEAMPLQPIEPDEKGRLKELKDAR
                     VFRLRGRVNVADERVKIKIKDTHGVALSIVLDQDFVQMDRGGTRYTEGGSLRRRTLKR
                     AKTRQFELLVDGSAAELFVGGKLAASLGAEVFSARTFFKGEKRRVRLTGGKVLSLEYA
                     RKN"
     gene            complement(363273..363650)
                     /locus_tag="HMPREF0733_RS01605"
                     /old_locus_tag="HMPREF0733_10341"
     CDS             complement(363273..363650)
                     /locus_tag="HMPREF0733_RS01605"
                     /old_locus_tag="HMPREF0733_10341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_004005325.1"
                     /db_xref="GI:490103477"
                     /translation="MAKLSIEELIAAFKELSLVEVSEFVKAFEEEFDVTAAAPVAVVA
                     GGAGGGDAAEEKSEFDVILESAGDKKIAVIKEVRALTSLGLKEAKDLVDGAPKPILEG
                     ASKEDAEKAKEQLEGAGATVTLK"
     gene            complement(363767..364297)
                     /locus_tag="HMPREF0733_RS01610"
                     /old_locus_tag="HMPREF0733_10342"
     CDS             complement(363767..364297)
                     /locus_tag="HMPREF0733_RS01610"
                     /old_locus_tag="HMPREF0733_10342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_004005327.1"
                     /db_xref="GI:490103479"
                     /translation="MATQEKIAAVSELKELFEASNAVILTEYRGLTVAQLKELRRALG
                     AETEYAVVKNTLAAIAAKEVGINSFEGQLQGPSALAFIKGDLVDAAKGLRDFAKANPQ
                     LIVKTGYYEGETLTEDDVKRYADLESREVLLSKVAGGAKAAIARVAQAVDALRVKLEE
                     QEGAAPAAAEEASEEA"
     gene            complement(364735..365862)
                     /locus_tag="HMPREF0733_RS01615"
                     /old_locus_tag="HMPREF0733_10343"
     CDS             complement(364735..365862)
                     /locus_tag="HMPREF0733_RS01615"
                     /old_locus_tag="HMPREF0733_10343"
                     /EC_number="3.6.3.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013397648.1"
                     /db_xref="GI:503162987"
                     /translation="MTTQGSTPQPSSTTTHGGLQIRGVAKSFGADTYVLREIDLEVEP
                     GEMVSLVGASGTGKSTLLRIIAGLEEANAGRITYAGQPLSAGQVGFVFQHPILYPHLS
                     VRKNILFPTTLRGYRQKVDKNYYTDLMDALQIGELQHRKPQELSGGQAQRVGIARALI
                     RKAPVVLFDEPLASVDEELSASIRADIARLHVEYKFTGLYVTHDQNEALQLGQRVAVM
                     DAGYLVQVDTPEHLLANPHTLQAARLTASPALNELTLTEGQHLPAGASLYVRATSLRR
                     VEVKAENPVENTIPVQVQGVLPQVGGTLYHAVTQAEATLYTASHDGSARVPLQVSGGQ
                     TLEFFEPDALALPVLTSGERVQVQVPPHHCFIFADGMRHYL"
     gene            complement(365945..366928)
                     /locus_tag="HMPREF0733_RS01620"
                     /old_locus_tag="HMPREF0733_10344"
     CDS             complement(365945..366928)
                     /locus_tag="HMPREF0733_RS01620"
                     /old_locus_tag="HMPREF0733_10344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tellurite resistance protein TehA"
                     /protein_id="WP_013397649.1"
                     /db_xref="GI:503162988"
                     /translation="MSTAAAHPVPLGTPTTTKPFPIPTSYFSVALGTSALGLSWRYGA
                     TANLVPSWVGESILALASATWLALIAAFAVKLITRRDALQSELRDLVMCCFLALVPVT
                     TIEVGISAYPYAALLGYALILIGVLGQLAFSMYRTAGLWRGTHTVAATTPVIYLPTVA
                     ANFASASGLGALGHRDWAMLFFGMGLLSWFSVEAAILGRLRTEPALDPAVRGIIGVQL
                     APPFVGGNAYLAANGGHVDWVFLVLTGYGVLQLLFLLRLVPWVLKAGYTMSLWGFSFG
                     LGAMAGTGIHLVAVSQLVQLGWALWILGTALIAVLWLGMLMLAIRGRLLVR"
     gene            complement(367298..368002)
                     /locus_tag="HMPREF0733_RS01625"
                     /old_locus_tag="HMPREF0733_10345"
     CDS             complement(367298..368002)
                     /locus_tag="HMPREF0733_RS01625"
                     /old_locus_tag="HMPREF0733_10345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_013397650.1"
                     /db_xref="GI:503162989"
                     /translation="MAKRSKAYKAAEAKIEEGKLYTPAEAVALAKETSSAKTDSTVEV
                     ALRLSVDPRKADQMVRGTVNLPHGTGKTARVVVIAAGDKAAAAEAAGADFVGSDELIA
                     KIAGGWTDFDAAVATPDMMGKVGRLGKVLGPRNLMPNPKTGTVTMDVAKAVADIKGGK
                     IDFRVDRNSNLHFIIGKASFSAEQLEENFNTALEEINRLKPSSAKGRYISKATVATTF
                     GPGIPVDPASVVSAAA"
     gene            complement(368125..368553)
                     /locus_tag="HMPREF0733_RS01630"
                     /old_locus_tag="HMPREF0733_10346"
     CDS             complement(368125..368553)
                     /locus_tag="HMPREF0733_RS01630"
                     /old_locus_tag="HMPREF0733_10346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_004005333.1"
                     /db_xref="GI:490103486"
                     /translation="MAPKKKVTGLIKLQIQAGAANPAPPVGPALGSHGVNIMEFCKAY
                     NAATESQRGNVIPVEITVYEDRSFTFITKTPPAAELIKKAAGVAKGSAVPHTTKVGSI
                     TEAQAREIAETKMPDLNANDLDAATKIVAGTARSMGITVE"
     gene            complement(368964..369509)
                     /locus_tag="HMPREF0733_RS01635"
                     /old_locus_tag="HMPREF0733_10347"
     CDS             complement(368964..369509)
                     /locus_tag="HMPREF0733_RS01635"
                     /old_locus_tag="HMPREF0733_10347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_013397651.1"
                     /db_xref="GI:503162990"
                     /translation="MSYELLTNRKTENRHKNYRKVDDIFFLVVHWWDDKKGLSFDSNV
                     NFLCKNNNKVSAHYVSEGGRVAQIAENEDVALHAGNWNMNVASIGVENRPEADSDDFA
                     TLAELIVDIETKIGHTLYIIGHRDVVSRLCPGVYYPRIPELINRVNTIKSQRGNAPAP
                     LTEEQRADMLSRLQNIKNNPG"
     gene            complement(369741..370469)
                     /locus_tag="HMPREF0733_RS01640"
                     /old_locus_tag="HMPREF0733_10348"
     CDS             complement(369741..370469)
                     /locus_tag="HMPREF0733_RS01640"
                     /old_locus_tag="HMPREF0733_10348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination factor
                     NusG"
                     /protein_id="WP_013397652.1"
                     /db_xref="GI:503162991"
                     /translation="MSEQEQVPELEETESVEAAVDTESVEAETADAPVAAENASDEST
                     VSPLEEFKAKLRRQIGDWYVVHTYSGYENKVKTGIETRIQNLEAEDEIFEVQVPMETV
                     VEYKNTVKKTIRRVRVPGYVLVRMDLTDHSWGVVRHTPGVTGFVGQDAYNPVPLRMDE
                     VFDMLLPVFEEEQQSKGLPTPQPVVESDYTVGENVRVKSGPFEGMDATISEIKPESQQ
                     VVTLISVFERDTPVTLEFNQIEKI"
     gene            complement(370562..370843)
                     /locus_tag="HMPREF0733_RS01645"
                     /old_locus_tag="HMPREF0733_10349"
     CDS             complement(370562..370843)
                     /locus_tag="HMPREF0733_RS01645"
                     /old_locus_tag="HMPREF0733_10349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_004005336.1"
                     /db_xref="GI:490103489"
                     /translation="MAKTATVKTTDTDISDDVQPGVFGRMFRFLREVISELKKVTTPT
                     RKELAIYFFGVLFFVVFMILFISGLDWVFGQGSFWVFGNGTLSPNQGGR"
     gene            complement(370910..370985)
                     /locus_tag="HMPREF0733_RS01650"
                     /old_locus_tag="HMPREF0733_t10002"
     tRNA            complement(370910..370985)
                     /locus_tag="HMPREF0733_RS01650"
                     /old_locus_tag="HMPREF0733_t10002"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(370950..370952),aa:Trp,seq:cca)
     gene            371371..372570
                     /locus_tag="HMPREF0733_RS01655"
                     /old_locus_tag="HMPREF0733_10350"
     CDS             371371..372570
                     /locus_tag="HMPREF0733_RS01655"
                     /old_locus_tag="HMPREF0733_10350"
                     /EC_number="2.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase"
                     /protein_id="WP_013397653.1"
                     /db_xref="GI:503162992"
                     /translation="MARISSRIGAIAPSATLIVDSKAKALKAAGRPVIGFGAGEPDFP
                     TPAHIVDAARDALNDPKNFRYSPASGLPELKQAIADKTLRDSGVKVDPSQVLITNGGK
                     QAVYEAFATVIDDGDDVLLPAPYWTTYPECIRLAGGNPIEVFAGSDQDYKVTVEQLEA
                     AYTPATKALIFVSPSNPTGAVYTEEETRAIGQWALEKGVFVLTDEIYEHLTYDGIDSV
                     SILKVVPELADTCVILNGVAKTYAMTGWRVGWLIGPEDVVKAASNLQSHLTSNVNNIA
                     QRAALKALTGSQNDVEEMHAAFNRRRTKIVDGLNAIDGVHCPSPKGAFYAYPDVRGLL
                     GKEIAGKRPQTSAELAELILEEAEVAVVPGEAFGPSGYLRLSYALSDDDLAEGIARLQ
                     KLLGSAR"
     gene            373119..374150
                     /locus_tag="HMPREF0733_RS01660"
                     /old_locus_tag="HMPREF0733_10351"
     CDS             373119..374150
                     /locus_tag="HMPREF0733_RS01660"
                     /old_locus_tag="HMPREF0733_10351"
                     /EC_number="2.7.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005504866.1"
                     /note="catalyzes the formation of D-fructose
                     1,6-bisphosphate from D-fructose 6-phosphate in
                     glycolysis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="WP_013397654.1"
                     /db_xref="GI:503162993"
                     /translation="MKIGLLTSGGDCPGLNAVIRGAVLNGVKKYGYEFVGFRDGWRGV
                     VEGDFMDLPRQKVRGLASRGGTIIGTSRTNPFDGPNGGPENIEIMMERHGIDAIIAIG
                     GEGTLAGAKRLADAGLPVVGVPKTIDNDLRATDYTFGFDTAVSIATEAMDRIRTTGES
                     HHRCMVAEVMGRHVGWIALHSGMAAGAHAILIPEVKVSMDEICHWVKEVHDRGRSPLV
                     VVAEGFIPEGFDEVLANKGTEKDGRPRLGGIGEYLTQEIEERTGIETRNTILGHIQRG
                     GAPTGYDRVLATRLGMGAVDMVHEKKWGMMVSVQGTEIKYVPLEEALDGLKSVPRERW
                     DEAAVLFGR"
     gene            complement(374250..375458)
                     /locus_tag="HMPREF0733_RS01665"
                     /old_locus_tag="HMPREF0733_10352"
     CDS             complement(374250..375458)
                     /locus_tag="HMPREF0733_RS01665"
                     /old_locus_tag="HMPREF0733_10352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="folate-binding protein YgfZ"
                     /protein_id="WP_013397655.1"
                     /db_xref="GI:503162994"
                     /translation="MSTAENTATDAPEYTPTLSPLMQVHGAFAADGPDAGIAAHYGNP
                     LAEQRSLAHDRGATTGEPVVVDRSSLGVVRVSGPDRASWLTSLASQILTDMNPGDSRE
                     FLLLSPQGRIEYAPATVEDGQALWLIVEGAQAEPLTDYLNRMKFMLRVDIENMSGDYA
                     VIETARNPRGEQGAIHPSFADALIWRDPWTALVEGGYHYSATPDAHPGIDYERYLSII
                     PREKLATLTEGAQLAGVWAAEALRIEAWRPRAGTEIDNKTIPQELDYTRTAVHFEKGC
                     YKGQETVARVHNLGHPPRRLVFLDLDGSEHTLPAAGSELFVEGKPRAVGRITSVALHH
                     EAGPIALAVIKRAVDPAAPLRAVDTSEASTDEAPAPATEYAAAQTLIVSPEAGEIARK
                     SLAGQDFLKR"
     gene            complement(375569..376246)
                     /locus_tag="HMPREF0733_RS01670"
                     /old_locus_tag="HMPREF0733_10353"
     CDS             complement(375569..376246)
                     /locus_tag="HMPREF0733_RS01670"
                     /old_locus_tag="HMPREF0733_10353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid-binding protein"
                     /protein_id="WP_013397656.1"
                     /db_xref="GI:503162995"
                     /translation="MAIEIPTNLTPELVPFAWLLGTWEGTGTMWYEGQENTPFGQIIN
                     FTQDGLPYLEYRAESFLLDDNGQKLRPITIETGFWQIDRPLTDADGGFGLVPKDIVPA
                     FADAESVETLRNEDDGFNLIATIAHPGGISENYVGMIKGPVVRMQTGNLLRDEISHDY
                     AGSVRLWGLVNGNLMWDWEIADQEGNLHKHASAELRKTSSMTGDSLGTGMFGSLDDGA
                     EEGSAEN"
     gene            376739..377443
                     /locus_tag="HMPREF0733_RS01675"
                     /old_locus_tag="HMPREF0733_10354"
     CDS             376739..377443
                     /locus_tag="HMPREF0733_RS01675"
                     /old_locus_tag="HMPREF0733_10354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004005341.1"
                     /db_xref="GI:490103494"
                     /translation="MYRIALLSDAPRAQELIPALSLLSHRVIELPLDSPLSTIGTEHD
                     IVILDARQNLLKARNTAQLLKTAGITIPLMIVLTEGGMAAVSASWQVDDIVLDQASPS
                     EMDARLRLLVTAPELKDTDDRSQQIIRIGNLVIDAQTYSAHLNGAALNLTFKEFELLK
                     FVAQHPGRVFSRAQLLSEVWGYDSYYGGTRTVDVHVRRLRSKLGSEHEQMITTVRNVG
                     YSFHAQNTHHDPSAED"
     gene            377568..378707
                     /locus_tag="HMPREF0733_RS01680"
                     /old_locus_tag="HMPREF0733_10355"
     CDS             377568..378707
                     /locus_tag="HMPREF0733_RS01680"
                     /old_locus_tag="HMPREF0733_10355"
                     /EC_number="2.3.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mycothiol acetyltransferase"
                     /protein_id="WP_013397657.1"
                     /db_xref="GI:503162996"
                     /translation="MAASPENFTLDSGHYENMPLNAELLEHFTQFARAVQKHDGTPAF
                     SEQTLVELSKAVHGESLVKPQVFAFTPAADNSELQAVLVAVPSPEDSNEPGVLEAAVH
                     PQVRGQGLGPAFFTRVIQDLGSEAANYNLWVHGSATDTGIESPANELAEAAGFTPVRV
                     LYKMVLPLDEQTRENLAELSDARTLPNSLELRTFTPADENPWLRVNAEAFAEHPEQGR
                     LTLADLRERTGSDWFRPEGFFIISEREDPHNIAAFTWTKIPTAQTEPGQPLDDLVPAG
                     EIYVVGVSPNAQGGGLGRTVTLRALAYLALASDENGEPLHAIELYVDADNAPALKLYE
                     SLGFAVATVDRMYAPERGSGKSSSNGVDAGVLSAVTTAVISTGSI"
     gene            378835..381087
                     /locus_tag="HMPREF0733_RS01685"
                     /old_locus_tag="HMPREF0733_10356"
     CDS             378835..381087
                     /locus_tag="HMPREF0733_RS01685"
                     /old_locus_tag="HMPREF0733_10356"
                     /EC_number="2.7.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005344.1"
                     /note="catalyzes the reversible transfer of the terminal
                     phosphate of ATP to form a long chain polyphosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase"
                     /protein_id="WP_013397658.1"
                     /db_xref="GI:503162997"
                     /translation="MAPHPHTKKNTEPAPMTGLIHIGNDISKIERADTRADRIEAGEK
                     LDLPNIEGDFGAERFLDRESSWLDFNSRVLELAEDPDLYLLERLNFLSIVASNLDEFF
                     MVRVAGLKRRIATGLAVPSAAGLSPDEQMEAISTAAHSLQKRHAQVFHEQILPELKKQ
                     NIHIVGWDDLDADAKTRLRQEFLRDIFPILTPLAVDPAHPFPYISGLSLNLAVLVRNP
                     QTGKELFARVKVPDQLDRMISVDGPRAANTTGKESRYIPLEVIIAEHLDTLFPGMEVV
                     EHHVFRVTRNEDLEVEEDDAENLLQALEKELLRRRFGPPVRLEVEDTINPTILDLLIS
                     ELNIDDSEVYKLPAPLDLRGMGAIVRANRPALHYPKHIAHTSRWLNAAETAKEADVFA
                     ATRDHDVLLHHPYDSFATSVQAFLAQAAADPKVQAIKQTLYRTSGDSPIVDALIEAAE
                     AGKQVVALVEIKARFDEEANISWARKLERAGVHVVYGLVGLKTHCKLSLVVRREGNQL
                     RRYAHIGTGNYHPSTARFYEDLGIITCDEQICEDVSRLFNQLSGYAPKTTYKSLLVAP
                     RSLRSGLIECINREIENHKAGKEARIQIKCNSMVDEAIIDSLYRASQAGVPVDVVVRG
                     ICALRPGVPGLSENIRVRSVLGRFLEHSRVFAFENAGEPIVYIGSADMMHRNLDRRIE
                     ALVRVKDPRHIKYLLDMFTVYMSDESRTWHLSGDGTWKRFDTDADGNPLRDVQSYYLR
                     SRSRKNHDKI"
     gene            381335..382333
                     /locus_tag="HMPREF0733_RS01690"
                     /old_locus_tag="HMPREF0733_10357"
     CDS             381335..382333
                     /locus_tag="HMPREF0733_RS01690"
                     /old_locus_tag="HMPREF0733_10357"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_013397659.1"
                     /db_xref="GI:503162998"
                     /translation="MTTESTYYSAHVYDNSLAITRTRENTAPVVAAGALVWRLHGEKL
                     EVLMIHRPRYNDWSWPKGKQDAGESLVETAIREVGEEVTLRITLGVPLAVTSYMVSGR
                     PKDVFYWAAQLPVGEHPRADEGEVDEIRWVTPKEARKLLSNSTDHEPLDALVAHHKAG
                     TLHTRPVVIMRHAKAKPRSNWTAADDERPLAGTGKRQALAHSRLLEAYSPTRLLSSPW
                     LRCMQTVAPYANDHAIAIKEKKSLSESGAAGHPKRTAKVTESLFVKEVPSLLCTHRPV
                     LPLVFKALKGHLMKGSAKILPTEDPYMEPGDAVILQVSTAEHGGIVSVETIRPVID"
     gene            382566..389558
                     /locus_tag="HMPREF0733_RS01695"
                     /old_locus_tag="HMPREF0733_10358"
     CDS             382566..389558
                     /locus_tag="HMPREF0733_RS01695"
                     /old_locus_tag="HMPREF0733_10358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion protein Rhs"
                     /protein_id="WP_013397660.1"
                     /db_xref="GI:503162999"
                     /translation="MGEYDNMHVLERDVEFDFNHADILLSIFRYLKRKLEIQLPERQR
                     YIGIAQREFKGHFARVFDQNCKYSISECKNLITALGDAATDLQKYIDAAHQENENRKK
                     FREAMANWEEEKRKIRDNIENDNRNTFISFQKDPAAHYPPQPQPNLDNEGPKFDERAP
                     IIKSRNTGRNAEVIGRNRTHRAEKRARDAAQDATETTSAIPGNLVTFAQKNSKSDQRI
                     AELYSNITKSYSSFAEHTSWGVFDAVSLFNSIAKWVDANQSDVRWILTVAEAFATAGS
                     QGMLGPIYSEADFLDYPQYLNTGYIRNYLKEQKISTDRPSIDVSRATITGAVYSAGYA
                     LDPVNVATGNFIEHECDLSFEHAPAASLIKLERMYNSVAVTYPEEAPSGIFGLGWSST
                     LDTQLTLSNTGAVWHTPDGRTLAFPRMGDGFGRVPSESYWLSKTVPGDELYSYVSTAT
                     TKAIKTAENAGRKVSAPTAPAYYWVVYNSKHVRYFYDPSGAWTGVMEGHYATLTLPLY
                     SSDSATGALELTDIVHPASGRGLQIRYGNSPRYNRIRPESASTYLIDHDVQILDTVTY
                     IYDDDDLLAAVNRPDGIRRYTHNAKRLIEEVWDVNGHREVTNTYDGQGRVVHQLTEHS
                     REVSFVYAPGIMTIVADAITGDSSNIWRSDEHGRLSSMTAADGSRQVMRYDKFGNRIS
                     VTERDGSTISRSYDSHSRLAKQLTPEGALSKYTWDEHNRLLTTSVCDFRDRLNPGDPV
                     VVSYTYESTGANPNPITMTDGNGHTTEYSWDEYGNLLSVTDPTGVRTTYTYNARQELI
                     SITNGVGDTVHLEYDKHGRIVQVRDALGHVTSTHWNSAGQLASVTDAAGSRWSLTYPE
                     LAPEELDVPAFVRQNLTSSSTHCIHNTSRPMGQLPVSLTDPYGHVTHFEYNNGNQITA
                     VTDPLGRTNRAVFDAWGNMVKTINALGAVTNYEYDGLSQLIAVTDPLGARSEFDYDLA
                     GEISQITDATGVVTHRTVDRRTGKETTSSGGILGSSFRHVDYLGRVIIEGENNPQNFT
                     SSQPVRRASQNSKSPSASPRNSETVTEFTAYDAAGNPVETLDAHGGLTRRTYDAANRL
                     IREVSAAGRTQTFDYDQAGRLRRIGVGLSVPEQKPTVGENVEWEEPTAWAYTTLTYDA
                     ASRIIARTYPDGTTEHTTYDALGRIVRVQHGARTATYAYDRCSRLIRMSDNSAGTRRF
                     IYDAAGQLVTAVDALGYRTHFEYDAAGQMVRTLDATGQVTTYIYDAAGQLIRTIKGAG
                     STAEITSTYTYDAAGRLLSENNGERTRAYSYDYQGGGLLASLSVNGVCAAEYSYSSGT
                     SSIGHRTVTVRDYASASALRDRDSSAFAGIEKPYLEHRFVYDSSDRLISRSRSGFLRS
                     DDQSNAHADDDIHERLHALNTFIKTGAYTLTYSYDADGYLITSVTPYAKSTRTVDGAG
                     RTVAVTTHATGQPAHDVISSVFSYDPLGRLTRIRVGDMVSSWTHERTTGLISDYVREQ
                     VLADVRGFEESKVLERTQVIRDHNGRVIGLDSTGSDTSPDGLVLYSYDYAGQLVGARS
                     ASHVWEWEYTAGVMMRERVFALDSSNGSERSAAGSRVLEGERIFTHNEANQLVAVEAR
                     AYAGARGGAGELAAHTITDYSYNLAGERSGEVTTDKLTGASYSREYSWGAYGGLTSVT
                     DSVSSRVGISRTSLISDAVGEVSAVSDGEGITVPLMWDARSDIPHLLGAGATSAPSSD
                     GGFSQAGIPGGMMPWHTLNVPGLTGSTLDSALGSTPGLPTDWGVPSASATPVPGMPTG
                     FEFTGAGSLRVAGLDMLGARVYDSPSRRFLSTDPKAAIAGSSWFADVYAYAGNNPLEY
                     VDPRGERPMTVADYRKYQSQEGERFVQQSLRFLALVGVIGSLFIAPTSILLAGGVGFI
                     SGAANGAADGMDFHTPDGNIDWDKVQAYALQEGGKEALTAALIGMLFKAGPPVARATG
                     NQAMKVPVISRTVDRVKTSPVVIKTQNTVNAVKTRINGIQDRIATWTRTSLLGIEHVV
                     PKVHPTPHNSPHQIDIPNGPKPTHTGSLAHRTSGTVHEPNVQLKPVEEPKVENLPPAK
                     GVASDSPSLEKPATDGKHASWVEHPPGSKLQNGDQTATYLAGDDFKKTLVKNTKDSSR
                     YVPAEEPGTYSVYGFDEAKKLEREYYIKLNGGNSPADLSKGKPEFALWRPEVGEPNLD
                     TAMTSFRDVTRHGNTVEAQVGSHKFMVTNLDEYTGTIPDDVVPTAKSLYETGEVHWTG
                     RDYKPEGFGNVPDPLPFDNKEARILPTHDYAGNEIDYTKYRVRRLARTANQVNDPGAE
                     RLIVGSNGSMYYTPDHYKTFVRIF"
     gene            389570..390328
                     /locus_tag="HMPREF0733_RS01700"
                     /old_locus_tag="HMPREF0733_10359"
     CDS             389570..390328
                     /locus_tag="HMPREF0733_RS01700"
                     /old_locus_tag="HMPREF0733_10359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_041321534.1"
                     /db_xref="GI:752672825"
                     /translation="MTYEKKYKDGFIVPVFTQESGYWEKVMKPRLQDQGWYIAEVDCA
                     NVEDIEDCGTRLLRELNFKVPEHGYINAMGVKDNITDIYGINIRKGLFVFYKNFEDIF
                     STHPDLHQGYGAEFMLQLIEHMVYHYSDLRGYIYEEFPVVVGYGVGLPTSYIPQFEDV
                     MGAENVMIAGEGVRYPWSDFEEEQRRNFPNGAPDPLYDKYGELFGVTTHSSQTTGIYV
                     ADPRYYPESPLYDPVLASKVHLVHSEFTEPDPSI"
     gene            390334..391086
                     /locus_tag="HMPREF0733_RS01705"
                     /old_locus_tag="HMPREF0733_10360"
     CDS             390334..391086
                     /locus_tag="HMPREF0733_RS01705"
                     /old_locus_tag="HMPREF0733_10360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_013397662.1"
                     /db_xref="GI:503163001"
                     /translation="MKYKCEYKDEFIVPVFTRESGYWEKVMKPRLQEQGWFIVEVNCA
                     GVDSSHELGRRLLRALGFNIAPDQWVNGFWVMNAVTEADWNDMRQGLFVFYKNFEDLF
                     SVQESCSPFYAPEYALQLAENMVHHYSKFRGNIYEQYPVVVGYGVGLPTSYLPQLEDV
                     MGAENVMIAGEGVRYPWSDFEEEQRRNFPNGAPDPLYDKDGIVYGFTIDDKDSTGVYV
                     EDPRYYPESPLYDPELASKVHLVHSEDVDDTE"
     repeat_region   391054..395070
     gene            391216..391846
                     /locus_tag="HMPREF0733_RS01710"
                     /pseudo
     CDS             391216..391846
                     /locus_tag="HMPREF0733_RS01710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397664.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            391901..392509
                     /locus_tag="HMPREF0733_RS01715"
                     /old_locus_tag="HMPREF0733_10362"
     CDS             391901..392509
                     /locus_tag="HMPREF0733_RS01715"
                     /old_locus_tag="HMPREF0733_10362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397664.1"
                     /db_xref="GI:503163003"
                     /translation="MVFYTDEWDDVFFPVIYVREDGVLERQLELLRQAGWKIIELSCE
                     KLLESSGSAEASVMVFEAIEFPEEIPDMPDDWIHEYLEDLHWLDLSQGFFFALKNYDA
                     LFQSPHDPHYYMAKWAAQLLQTVDTELRYRYSEDEDGEYDPANILYGMEVSQEHLDQV
                     LEFFEGRAIVIPDFDENDPGAEHPLYVKNKDEVLENWKYESK"
     gene            392955..393629
                     /locus_tag="HMPREF0733_RS01720"
                     /old_locus_tag="HMPREF0733_10363"
     CDS             392955..393629
                     /locus_tag="HMPREF0733_RS01720"
                     /old_locus_tag="HMPREF0733_10363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397665.1"
                     /db_xref="GI:503163004"
                     /translation="MPYEALYSKPFNIPVFIRDNNYWENYMLPSLRQEGWHVVIVDCA
                     GVVDAYDFAIRFMNAISFDWSSFPHKFDLKWAEEYAEDIDWLDMRQGLFVYYKNFEDV
                     LSMADGLNMEGYVRYSVDILYIMNAYYPRRPMWRDDEYEVLFGYGLEVSKDSLPRVEE
                     YFGGHEIICAGPDTEYPWSQQEERKKKYFPNGFPDPRYDENGTEWINDPDEYPESTSY
                     TGSKDS"
     gene            393735..394434
                     /locus_tag="HMPREF0733_RS01725"
                     /pseudo
     CDS             393735..394434
                     /locus_tag="HMPREF0733_RS01725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398656.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            394440..394748
                     /locus_tag="HMPREF0733_RS01730"
                     /old_locus_tag="HMPREF0733_10366"
     CDS             394440..394748
                     /locus_tag="HMPREF0733_RS01730"
                     /old_locus_tag="HMPREF0733_10366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397668.1"
                     /db_xref="GI:503163007"
                     /translation="MRFSLYPHNSTGTGFENQSIDQAWVQAYEFDMVKAVQTFTDWSL
                     ENFMLTLTASKEPSLQQYRFSSYAESRLLSAALCSVMDSVDKAGITEIVRSSITYLAD
                     "
     gene            394949..395710
                     /locus_tag="HMPREF0733_RS01735"
                     /old_locus_tag="HMPREF0733_10367"
     CDS             394949..395710
                     /locus_tag="HMPREF0733_RS01735"
                     /old_locus_tag="HMPREF0733_10367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_013397669.1"
                     /db_xref="GI:503163008"
                     /translation="MVYEKEYKDEFVVPVFTRESGYWEKVMKPRLQQQGWYIAEVDCA
                     NVEDIEDCGTRLLRELNFKVPEHGYINAMAVKGNLRDIYGINMRKGLFVFYKNFEDIF
                     STHPDLYNGYGAEFMLQLIEDIVYYYSTLRGYIYEEFPVVVGYGVGLPISYIPQLEEL
                     MGAENVMVAGKGTRYPWSDFEEEQRRNFPNGAPDPLYDKTGQLFGGVINHDPQATGIY
                     VADPRYYPESPFYDPELASKVHLVHSEFTEPDPSI"
     repeat_region   395365..395683
     gene            395716..396465
                     /locus_tag="HMPREF0733_RS01740"
                     /old_locus_tag="HMPREF0733_10368"
     CDS             395716..396465
                     /locus_tag="HMPREF0733_RS01740"
                     /old_locus_tag="HMPREF0733_10368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_013397670.1"
                     /db_xref="GI:503163009"
                     /translation="MGYKYDYKDEFIVPVFTQESGYWEKIMKPRLQQQRWYIAEVDCV
                     GVEDIVDFGRRLLRALNFSVGDNEYISPIWYENLVGEISGVSMRQGFFIYYKNFGDFL
                     SMHHDADPESSAIYAIKLLENMSYHYSDLRGYIYEQYPVVVGYGVGLPTSYIPQFEEL
                     MGAENVMIAGEGVRYPWSDFEEEQRRNFPNGAPDPLYDKYGELFGVTTHSSQTTGIYV
                     DDPRYYPESPLYDPVLASKVHLVHSEFDDPE"
     repeat_region   396592..396780
     gene            396623..396793
                     /locus_tag="HMPREF0733_RS01745"
                     /old_locus_tag="HMPREF0733_10369"
     CDS             396623..396793
                     /locus_tag="HMPREF0733_RS01745"
                     /old_locus_tag="HMPREF0733_10369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease"
                     /protein_id="WP_013397671.1"
                     /db_xref="GI:503163010"
                     /translation="MDFMAPQPKIGENGRVELKPNGKPETTRGDDRLIVGSNGSIYYS
                     PDHYHTFILLAE"
     gene            396808..397458
                     /locus_tag="HMPREF0733_RS01750"
                     /old_locus_tag="HMPREF0733_10370"
     CDS             396808..397458
                     /locus_tag="HMPREF0733_RS01750"
                     /old_locus_tag="HMPREF0733_10370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397672.1"
                     /db_xref="GI:503163011"
                     /translation="MAYKQVRSAEGFIAPLFIREDGYWENHMLPYLEAEGWKVIVVDC
                     AGVETTLDFAYRLVASIESVYAIPDDFNLRWASEDACLINWFDMRQGLFVLYKNFDDL
                     FVMDDEDVSLCVNILEEMEVYYATRQLHGSGLYEVLVGYGFDISRESLPRVKEFFNDS
                     IVIAADGAKYPWSRVERFKKLFFPNGFPDPLYEDGDDWINDPDECSESTSYTGGNS"
     gene            397490..398101
                     /locus_tag="HMPREF0733_RS01755"
                     /old_locus_tag="HMPREF0733_10371"
     CDS             397490..398101
                     /locus_tag="HMPREF0733_RS01755"
                     /old_locus_tag="HMPREF0733_10371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397673.1"
                     /db_xref="GI:503163012"
                     /translation="MGFYKNESDDTFFPAIYITEDKVLERQTQALRDQGWAVIEIHCK
                     NILASQDPQAGALEIIRAVNLPHKLPDDNYMTWTQEIISDLDWLDLSKGVFVILKDYD
                     VLFTPWNSPDHSEAKWMARHLQTVDDNLRYRHSQFAYGDYDPPYVLYGMEVSQEKLDT
                     VLEFFEGRATIIEDFDKDNPGAEYPPLVEYRHKVVRSWQHKNN"
     gene            398223..399131
                     /locus_tag="HMPREF0733_RS01760"
                     /old_locus_tag="HMPREF0733_10372"
     CDS             398223..399131
                     /locus_tag="HMPREF0733_RS01760"
                     /old_locus_tag="HMPREF0733_10372"
                     /EC_number="2.1.1.45"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_013397674.1"
                     /db_xref="GI:503163013"
                     /translation="MSTPAHHASGQQSIPTPYEDLLREILDENRDAIAADAQRADRTG
                     TGTFGVFGRQMRFDLRDSFPLITTKRVHFKSVAVELLWFLRGSSNIRWLQERGVTIWD
                     EWADENGDLGPVYGVQWRSWPTPDGGTIDQIAKVIESLKTNPSSRRHIVSAWNPAEVD
                     EMALPPCHAMFQFYVHERPDGVKELSCQLYQRSADMFLGVPFNIASYALLTYLIAHEV
                     GMEPGEFIWTGGDCHIYSNHLEQVKKQLGYGNDPEGNPYPPREPYPYPKLVIKTKKPS
                     VFDYEYEDFELVDYKHHPGISAPIAV"
     gene            399140..399826
                     /locus_tag="HMPREF0733_RS01765"
                     /old_locus_tag="HMPREF0733_10373"
     CDS             399140..399826
                     /locus_tag="HMPREF0733_RS01765"
                     /old_locus_tag="HMPREF0733_10373"
                     /EC_number="1.5.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="WP_013397675.1"
                     /db_xref="GI:503163014"
                     /translation="MREYESPSLARPCLGAIWAQTDAGIIGRDGTMPWRAPEDLAHFK
                     TVTVGKPVIMGRRTWESFPPRFRPLPERTNIVISRSITGGSAAPLKRDGAFWVPSLDA
                     ALTLASNTPLTPNDNQHPDSPHQQVDAWIIGGGSVYAEALSREDLPSFGRVEIIERTF
                     FYCQEGNEITGDTYAPELAVEGFVAADEPARWRILGESAWEKSERGYLLDASGGKNPM
                     YYSFQTLARL"
     gene            400039..401178
                     /locus_tag="HMPREF0733_RS01770"
                     /old_locus_tag="HMPREF0733_10374"
     CDS             400039..401178
                     /locus_tag="HMPREF0733_RS01770"
                     /old_locus_tag="HMPREF0733_10374"
                     /EC_number="1.2.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887731.1"
                     /note="catalyzes the formation of 4-aspartyl phosphate
                     from aspartate 4-semialdehyde; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="WP_041321535.1"
                     /db_xref="GI:752672826"
                     /translation="MNFNPGDSVGFVGWRGMVGSVLMKRMLEENDFKDISPVFFTTSN
                     VGGEAPTFDGTLEPSTLKDAYDLNELRQHKIIVTAQGGDYTKEIHPKLRESGWEGLWI
                     DAASALRMNDDAIIVLDPINRDVIDRGLESGVKDFIGGNCTVSCLLMGLGGLFKQGLV
                     EWTTSMTYQAASGGGARHMREVLGQFRDLGNEVSAELNDPAAAILEIDRKVLAKQRSG
                     ELDTAQFGVPLSGSLIPWIDSDLGNGQSREEWKSDAETNKILGLEGDNRVIMDGLCVR
                     IAAMRSHSQALTMKLTEDLPVAEIERIIAEDNQWAQVVPNTKDATMEGLTPVAASGSL
                     NIPVGRIRKLAMGPQYISAFTVGDQLLWGAAEPVRRMLKIAVGKL"
     gene            complement(401419..401763)
                     /locus_tag="HMPREF0733_RS01775"
                     /old_locus_tag="HMPREF0733_10375"
     CDS             complement(401419..401763)
                     /locus_tag="HMPREF0733_RS01775"
                     /old_locus_tag="HMPREF0733_10375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397677.1"
                     /db_xref="GI:503163016"
                     /translation="MKTLEDEVTESETSKFHLWLEKKKARMHAHPVLKHLYKPLVIAV
                     GGFCFIAGLIMLVTPGPGWLFIFIGLGIWGTEFAWAHRLNQRLKKLVISLWHRYIAWR
                     EKRKAQKAARKA"
     gene            402042..402854
                     /locus_tag="HMPREF0733_RS01780"
                     /old_locus_tag="HMPREF0733_10376"
     CDS             402042..402854
                     /locus_tag="HMPREF0733_RS01780"
                     /old_locus_tag="HMPREF0733_10376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397678.1"
                     /db_xref="GI:503163017"
                     /translation="MEKLSYTTEFTLWPVPHARPLIDGKPEPGAHPAEYLHPGKLHLE
                     TSDDNYVDLYIVPPLFKPGYPPGYQFYADLIFSNIYIAQDLQFYYRAFHDELQFAVSS
                     DTIWQNRDHQYAVAIVDKDLNLSWTLRDSDPLRMEFIETVINTIHASMFKMPPILAEG
                     EYMEFMNERNILDSAHLCCGDRVLRAIDVKAHTNDPVRVLTETDYSAVIRGTVYPSAR
                     LIWSVPLEDARYWHNAYNVLTVDPVIGAKIPADVRAILEHLPAAPAYTQGHS"
     gene            402895..403098
                     /locus_tag="HMPREF0733_RS01785"
                     /old_locus_tag="HMPREF0733_10377"
     CDS             402895..403098
                     /locus_tag="HMPREF0733_RS01785"
                     /old_locus_tag="HMPREF0733_10377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397679.1"
                     /db_xref="GI:503163018"
                     /translation="MRDGLPVGRDVLAHCQVSQDAVPHAATTRDADNTPQAPLLTWDI
                     VDTNHDRMAYIRAVLRVSPGSRG"
     gene            403281..404609
                     /locus_tag="HMPREF0733_RS01790"
                     /old_locus_tag="HMPREF0733_10378"
     CDS             403281..404609
                     /locus_tag="HMPREF0733_RS01790"
                     /old_locus_tag="HMPREF0733_10378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397680.1"
                     /db_xref="GI:503163019"
                     /translation="MAKTSLTARLETLPFTKKHTKLLGVTGIGWALDAMDVGLISFIM
                     AALTKQWALSPTETSWLGSIGFLGMALGATVGGLLADRFGRRYIFAATLLIYGLATGA
                     SALAGSLAVLMVFRFIVGLGLGAELPVASTLMSEFSPRAIRGRVVVILEAFWALGWIL
                     AALIGTFVVPNPNGWRWALAIGVIPALYSLIIRWGTPESVRFLESKGRIDEAERVVAE
                     FESSAALSTRTHANETNRDNAPEAPANDTQEAASIWSAPLRKRTLALCTVWFCINLSY
                     YGAFIWIPSLLSAQGFSLVKSFAFTLIMTLAQLPGYAVAAYLIEKWGRRATLAVFLAG
                     SAGAAVCYGLSHSDFFIILSGCFLSFFNLGAWGALYAISPEVFPTRLRGTGTGTAAGL
                     GRIASILAPLIVPPLISFGGTGVLFAVFAAAFLLAAVTTFALPEKRGKSL"
     gene            404911..406665
                     /locus_tag="HMPREF0733_RS01795"
                     /old_locus_tag="HMPREF0733_10379"
     CDS             404911..406665
                     /locus_tag="HMPREF0733_RS01795"
                     /old_locus_tag="HMPREF0733_10379"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397681.1"
                     /db_xref="GI:503163020"
                     /translation="MAETPAVTYIPWPIAHTPAPLENGEPVAGRHPAEYLGPGVLHYI
                     GSEFHLMAELNPYPFDPENPHRFRGELVHRYTYFSGNITFSFKADEDYLYFTAHVFLT
                     WQEPSDRTYARARVDRNFAFHWEQHDDDPQRSVYIEAVFMALYRSLSVQHLELGDGEF
                     FDLNEDRQYHSYHMRQGDDIIRLAYVTKCSSRTYLDVTTDYRATVLSYCHPPARLAWS
                     VPTEDARYTFEHTDPLIYPPDTGEDIPEYVRRILPYLPTAPYRRAKRTYAPASAYRAT
                     FTPWPMTVQQGETIHNAQYPWQRLVSGEFLIESRQNTPFSMYLNACEFSMYLDACEFS
                     MYLDACEPDWDSMKGDRQVYAELMPNVGGRRPWFGTDFTLCMRRWQNNLVFSAEHLTK
                     WRAIDWETCAIAILDAEGSLTWELRDEVAGRGSYIEALVGHIVDSLGTEPPVLAPGEG
                     KVLYDQDGQVSSVHVNTGETMLRALITRIWYGVNPATGERAPYLYEARVKDQFDEDSD
                     GGFSTIAWSSLEKFYYWSWDRVPGFVPAVTDPEILRRDEVDLLIPHLPVAPGVPSQEN
                     EDDVAVPWFYEASTATKE"
     gene            complement(406689..407195)
                     /locus_tag="HMPREF0733_RS01800"
     CDS             complement(406689..407195)
                     /locus_tag="HMPREF0733_RS01800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041321536.1"
                     /db_xref="GI:752672827"
                     /translation="MTLIDILVSCALMMLVLRQIRGRKLTIFSLIWPILLVGWAVIEY
                     MTGFPLHNNGWMLIIGCITIGLILGVACGMTTAVYTQNRQIYARAGGWAVVFWLVGMS
                     GRLVFGLYAEHGGAEQIYRFSLDCSIPMDAWASALIMMALCEVMSRTFVLAWKLIHAR
                     QALPAAAS"
     gene            407265..407702
                     /locus_tag="HMPREF0733_RS01805"
                     /old_locus_tag="HMPREF0733_10381"
     CDS             407265..407702
                     /locus_tag="HMPREF0733_RS01805"
                     /old_locus_tag="HMPREF0733_10381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_004005379.1"
                     /db_xref="GI:490103532"
                     /translation="MTLGELYQLARMLRDITITAGSLTHMSVHPSEAMVFEDIVQHPN
                     TTINQVAERTHLAQSRVSTMVNAMITEGAVTVSTDSQDQRRKTLQASPQLLQDIKAID
                     YNKAIRQAIHRLYPSLSEHQIADVTQHLDHIFTLLSADSRRES"
     gene            407706..408242
                     /locus_tag="HMPREF0733_RS01810"
                     /old_locus_tag="HMPREF0733_10382"
     CDS             407706..408242
                     /locus_tag="HMPREF0733_RS01810"
                     /old_locus_tag="HMPREF0733_10382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397683.1"
                     /db_xref="GI:503163022"
                     /translation="MQYILLLRSVNLGKLRKVSMPELKKRLAALGYENVTSYINSGNL
                     LFVSSRDKTTVAQEITDLLAKHYDFEIPFSLLTADEYRKDAHNLPEWWNEDMPRLDAM
                     FFTIDADRDALAAELETLDVPDEVLHIGTCAVYFGNYSTPDYKKAQYGKFMSKKAFAN
                     QLTLRNAKTYNKILDLLD"
     gene            complement(408362..409471)
                     /locus_tag="HMPREF0733_RS01815"
                     /old_locus_tag="HMPREF0733_10383"
     CDS             complement(408362..409471)
                     /locus_tag="HMPREF0733_RS01815"
                     /old_locus_tag="HMPREF0733_10383"
                     /EC_number="1.1.1.158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="WP_013397684.1"
                     /db_xref="GI:503163023"
                     /translation="MTEKLLSEITTAQVGGPARTYIRATTEAEIVEAVSSADAANEPV
                     LIVGGGSNLLVSDAGFDGTVVHIASTGVEELPIPACGGANVRVQAGTVWDDFVQLSIE
                     KEWSGPAALSGIPGTVGATPVQNVGAYGVEVGEFIASVRTWDRETGKFKTFANADLRF
                     GYRDSILKQNMVNGSPRYVVLTVDFQFTLGSLSSPIKYGELAKSLGVQVGKRAESALV
                     RDKVLALRASKGMVLDASDRDTFSTGSFFTNPIVPVSVLDSLPEDAPRFPVVTRTGVF
                     GTEQQESEEYVKLSAAWLIQHAGFEKGFGLEGDAREIAGGRASLSTKHTLAITNRGDA
                     TAEDIFAIARAVRAGVAEKFGVELVPEPVVVNGKI"
     gene            complement(409610..410071)
                     /locus_tag="HMPREF0733_RS01820"
                     /old_locus_tag="HMPREF0733_10384"
     CDS             complement(409610..410071)
                     /locus_tag="HMPREF0733_RS01820"
                     /old_locus_tag="HMPREF0733_10384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl dehydratase"
                     /protein_id="WP_013397685.1"
                     /db_xref="GI:503163024"
                     /translation="MSVNFAELEKGQEIGSRTIDISRASLVRYAGASGDFNPIHWNER
                     FAQSVGLSGVIAHGMLTMGTAVQLVSDWAGDPGAIVDYQTRFTKPVPVPDAPGGDNPD
                     TPTNALTITGKVGAVDEDARTVRIDLTVTADDGEGNQQKVLMKTQAVVKFA"
     gene            complement(410071..410526)
                     /locus_tag="HMPREF0733_RS01825"
     CDS             complement(410071..410526)
                     /locus_tag="HMPREF0733_RS01825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl dehydratase"
                     /protein_id="WP_037231169.1"
                     /db_xref="GI:739370153"
                     /translation="MSINPDIVGRVYPAEGTYAVGREKIREFARAVHAENPLHHDVEA
                     ARAAGYADLIAPPTFAIILSQAADAALIGDKSAGIDFSRVVHADQRFTHHRPIVAGDE
                     LRTEVHVDSVRVMGAGAMLTTREEITDADGKPVTTCISSLLVRADEEGE"
     gene            410647..411642
                     /locus_tag="HMPREF0733_RS01830"
                     /old_locus_tag="HMPREF0733_10386"
     CDS             410647..411642
                     /locus_tag="HMPREF0733_RS01830"
                     /old_locus_tag="HMPREF0733_10386"
                     /EC_number="1.14.14.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkane 1-monooxygenase"
                     /protein_id="WP_013397687.1"
                     /db_xref="GI:503163026"
                     /translation="MSIPFSVLDLMPTRPDDSHPQTMRKTVQAAQAAERFGFNRFWVA
                     EHHNAGSLLSSATVVVMAELAAATERIRVGSGGIMLPNHAPYVVAEQFGTLEAFHPGR
                     IDLGLGRAPGTDPMTAQALRRDNSAAMNFPAEVEEIQRYLGDPSPMRRVHAIPGQGSN
                     VPLYILGSSTFGASLAAKLGLPFSFASHFAPAALQDALNVYRNNFTPSQTLDKPYVIV
                     GAGSLVAETDEQAQRLFTTAQQHALGIIRGRPQFSPPVDDMEKLWSPAEKRHISSMLQ
                     EAVVGSPQTVQSKLEDLVARTGADEVIITSTPWEFEDRIRSYELLSELPIFQKTE"
     gene            complement(411891..411962)
                     /locus_tag="HMPREF0733_RS01835"
                     /old_locus_tag="HMPREF0733_t10003"
     tRNA            complement(411891..411962)
                     /locus_tag="HMPREF0733_RS01835"
                     /old_locus_tag="HMPREF0733_t10003"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(411928..411930),aa:Thr,seq:ggt)
     gene            complement(411964..412037)
                     /locus_tag="HMPREF0733_RS01840"
                     /old_locus_tag="HMPREF0733_t10004"
     tRNA            complement(411964..412037)
                     /locus_tag="HMPREF0733_RS01840"
                     /old_locus_tag="HMPREF0733_t10004"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(412001..412003),aa:Met,seq:cat)
     gene            complement(412067..412138)
                     /locus_tag="HMPREF0733_RS01845"
                     /old_locus_tag="HMPREF0733_t10005"
     tRNA            complement(412067..412138)
                     /locus_tag="HMPREF0733_RS01845"
                     /old_locus_tag="HMPREF0733_t10005"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(412104..412106),aa:Thr,seq:ggt)
     gene            complement(412346..414433)
                     /locus_tag="HMPREF0733_RS01850"
                     /old_locus_tag="HMPREF0733_10388"
     CDS             complement(412346..414433)
                     /locus_tag="HMPREF0733_RS01850"
                     /old_locus_tag="HMPREF0733_10388"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_013397689.1"
                     /db_xref="GI:503163028"
                     /translation="MWLECVGESERRRKACARTPQQNEEKVTENIPAENAEQGATLGN
                     TEETLSVEKTVEESSLETGEKPTNEKADAAESMTAEPREDNAATKKNTEDNTHESHEE
                     GTRFTDLGLDPRVLSALEEVGYEKPSPIQEQTIPLLLDGKDVVGLAQTGTGKTAAFAL
                     PALSRMAELADINGVSRDTQVLVLAPTRELALQVAEAFSSYATHMEDFTVLPIYGGSP
                     YGPQLAGLRRGAQVVVGTPGRVIDHLEKGSLDLSNLQYLVLDEADEMLRMGFAEDVET
                     ILEGTPDAKQVALFSATMPNSIRKIAQQYLNDPTEVRVKTKTTTGANIRQRYMQVMHS
                     HKLDAMTRVLEVENYDGIIVFVRTKKETEEVADKLKARGFQAAAINGDIPQQLRERTV
                     DALRDGRIDILVATDVAARGLDVERISLVVNYDIPHDTESYVHRIGRTGRAGRDGEAI
                     LFVTPREKYMLRQIEKATRQKVEPMHMPTAQDVNSSRKQRFAEQITETIETEDLNFFR
                     KIIEDYENEHDTTAEDIAAALAVIAQQGRAFFLDENDDIARKSRAFADDTKDCGKRGP
                     KKGRNHSDEGMVNYKLNVGRASRVKASAIVGALANEGGIKGSQIGSIDIRQHFTIVGL
                     PEDLPKGFFDRLRDTKVAGEFINIRKDRGPQGGGGRGFRRNDRRDGGFRSRRDDHRGG
                     RDDRRGKSHGKRY"
     gene            complement(414898..416652)
                     /locus_tag="HMPREF0733_RS01855"
                     /old_locus_tag="HMPREF0733_10389"
     CDS             complement(414898..416652)
                     /locus_tag="HMPREF0733_RS01855"
                     /old_locus_tag="HMPREF0733_10389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397690.1"
                     /db_xref="GI:503163029"
                     /translation="MAAEVSAPDSEPTEKSAKTSASQHTGAHRSVTAGRVLVAIMLAL
                     AVFALYCYYSVQQLKHWITPSWDLAIFTQMAQAYSHFGIPIVQIKGTDFNLWGDHFHP
                     ILVLLGPVYAVSPSPLTLLVVQNFMIAASVYMMVRFTQRACAFSSNTKPEPVGTFVGV
                     LLGAAFALSYGVQQAVAAQFHEVAFALPFLCGALGNLVLAGRINADERSRYIIRACLW
                     AAPLAFVKEDMGVTAAMIGIVAFIRTGWIRKGLDELFPQNPEGKPLPRGERIRNTFNS
                     WVKTRGAAESTMLILWGLFWSYAAVALILPLFNANGQFDYGDKVDVYGAFADPLGSAI
                     TIFNYDQKVWTILLLLFCGAIIWVASPFAIVILPTLLWRLLSNTEAYWLSTWHYSLVL
                     MPVAFLALLEVILNLRYGKVLAHPKPLAEDEESEDEPAETGDKPIGWVENLRQSVRRV
                     PLWFFPAVALLVSVIPTVTPTSDQPLADLTKSSFISNRLTASETNRMQAVEAVPQDVS
                     VAADLSTLTQLIPGRTVYWIGHAGEPAPDYVVIDKRGSAWGGNPPQNTAQYAADRYGH
                     PYAQVGTYGSLEVVRKIS"
     gene            416929..418011
                     /locus_tag="HMPREF0733_RS01860"
                     /old_locus_tag="HMPREF0733_10390"
     CDS             416929..418011
                     /locus_tag="HMPREF0733_RS01860"
                     /old_locus_tag="HMPREF0733_10390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="WP_041321847.1"
                     /db_xref="GI:752673138"
                     /translation="MRTSALTARITVGIQALIYPHVPVHVGQTLGRLQRGPTDPTFHR
                     LRAPRSERSRTADDTLWIGARTPSLQLPATLYFTRRFEGATSALNAPVQVCLWAESSP
                     ATPDDAFPTEQVYSELEDFASLIPAWLGLHDPREEFAKLPAFEHLPLKIRRAYRENPG
                     LRLSASGQLTRHMLAAIVEQRVTQPEAFDALRWIIMRYGESAPFSGNPAQPPYLRIYP
                     TAQVLATIPSWDWHRARVDSARYSTVYRFTQRADALKRLGATGRIAHLAAALDDIPGV
                     GPWSVAETLQGFCGHPDAVSVGDYHLAHTVGFAFTGERTDDAGMLRLLAPYAGHRQRV
                     VRLIQEAGIHKPRYGARISIPDYRDF"
     gene            complement(418113..418478)
                     /locus_tag="HMPREF0733_RS01865"
                     /old_locus_tag="HMPREF0733_10391"
     CDS             complement(418113..418478)
                     /locus_tag="HMPREF0733_RS01865"
                     /old_locus_tag="HMPREF0733_10391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_004005389.1"
                     /db_xref="GI:490103542"
                     /translation="MATIEITQQNLTSTVEGNDIVFLDFWADWCGPCKQFAPVYEAAS
                     EKYSDIVFGKVDTEDQSQLAQAAGITSIPTIMGFRGGILVFSQPGALNESQFEQVITS
                     IRELDMDKVREEMATAEQN"
     gene            complement(418654..418738)
                     /locus_tag="HMPREF0733_RS01870"
                     /old_locus_tag="HMPREF0733_t10006"
     tRNA            complement(418654..418738)
                     /locus_tag="HMPREF0733_RS01870"
                     /old_locus_tag="HMPREF0733_t10006"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(418702..418704),aa:Tyr,seq:gta)
     gene            complement(418884..419240)
                     /locus_tag="HMPREF0733_RS01875"
                     /old_locus_tag="HMPREF0733_10392"
     CDS             complement(418884..419240)
                     /locus_tag="HMPREF0733_RS01875"
                     /old_locus_tag="HMPREF0733_10392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005392.1"
                     /db_xref="GI:490103545"
                     /translation="MATQYSSTTGSVNREEARDAETLLFLDLYSSIGSEPENIPEAER
                     VDAVQSEDSSDVVEPPAFEGIGSTLTDPKLVARFEGVRRDLAREIRSEMCTVEQALRY
                     LEHLEITLLMEQDGDL"
     gene            419390..419881
                     /locus_tag="HMPREF0733_RS01880"
                     /old_locus_tag="HMPREF0733_10393"
     CDS             419390..419881
                     /locus_tag="HMPREF0733_RS01880"
                     /old_locus_tag="HMPREF0733_10393"
                     /EC_number="5.3.1.24"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397692.1"
                     /db_xref="GI:503163031"
                     /translation="MASDSSFDIVSKVDKQEVSNALHQAQKEVSQRYDFRGVGAEIDF
                     SGEKILIKANAQERALAVLDVFQSKLVKRGISLKSLDAGDPYASGKETRIECSIKEGI
                     AQDQAKKISKLIRDEGPKGVKATIQGDELRVSSKSRDDLQSVISLLKGADLDIDLQFV
                     NYR"
     gene            complement(419988..420869)
                     /locus_tag="HMPREF0733_RS01885"
                     /old_locus_tag="HMPREF0733_10394"
     CDS             complement(419988..420869)
                     /locus_tag="HMPREF0733_RS01885"
                     /old_locus_tag="HMPREF0733_10394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005394.1"
                     /note="metalloprotease; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="WP_004005394.1"
                     /db_xref="GI:490103547"
                     /translation="MHKHYNGLKTALLLGGMVGLLMLIGGGLSTYFRSSIFIWGFALV
                     SLGTVAYSYWNSDKLALRSMNAYAVTREEVPVLYDIVEELSSRAGQPMPRLYVAPTQT
                     PNAFATGRNPRNAAVCCTEGILQLLDEREMRGVLGHELMHVYNRDILTSSVAAGIATL
                     ITAAAQIVGFGSMMGGNRERGGGNFLSIILMSLLAPIATAVIQMAISRTREYDADEDG
                     AKLTGDPIALASALNKLEKGVSLYPMDPKNQQVVNTSASMIANPFGGLKNLMSTHPPM
                     DKRIARLQQMARDNGQL"
     gene            421162..421740
                     /locus_tag="HMPREF0733_RS01890"
                     /old_locus_tag="HMPREF0733_10396"
     CDS             421162..421740
                     /locus_tag="HMPREF0733_RS01890"
                     /old_locus_tag="HMPREF0733_10396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_013397694.1"
                     /db_xref="GI:503163033"
                     /translation="MTEPLDTNAHPEPEHPLHGCSHTGVLPLAAESATGLLTESWSQN
                     LRAKGRRVTKQRLAVLRAVQAHPHANAEEIVTAVRQEIPTITVQSVYVILTDLTNIDM
                     LRKFEPPGTPGLYETRTGDNHHHAFCIRCGKVQDVDCAVGSAPCLTPSDFHGMAIISA
                     DVLYRGVCADCQTEAEAELAKSQVQAAASVQH"
     gene            421869..423359
                     /locus_tag="HMPREF0733_RS01895"
                     /old_locus_tag="HMPREF0733_10397"
     CDS             421869..423359
                     /locus_tag="HMPREF0733_RS01895"
                     /old_locus_tag="HMPREF0733_10397"
                     /EC_number="1.11.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="WP_013397695.1"
                     /db_xref="GI:503163034"
                     /translation="MYQTPQNPIHPGSYTTTSTGTPVASDDHSLTVGADGPIVLHDAY
                     AVEKLAQFNRERVPERVVHAKGTGAYGYFETTEDVSQYTRAALFQPGVKTELLIRFST
                     VAGESGSPDTWRDPRGFAVKFYTTEGNYDLVGNNTPIFFIRDAIKFPDFIHSQKRMPG
                     SGLRDHDMQWDFWSLNPATAHQVTWLMGDRGLPRTLRHMDGFGSHTYQWINTEGERFW
                     VKYHFKTEQGNEFFTQAQADEMAGKDADFHRRDLREAIERGDYPAWTLYVQIMPYEDA
                     KTYRINPFDLTKIWPHSDYPLVKVGRMVLDRNPQNFFAEIEQAAFSPSNFVPGIAASP
                     DKMLLGRIFSYPDAHRYRIGTNFAQLPVNAPHAAPVNNYSHDGSMRYNFNDPSVPTYA
                     PNSLGGPHADAERAGEGSWESDGELVRTAYTLRPDDDDFSQARTLYEVTMNDEERERL
                     ISNISGHVSAVRSDEIRERAFQYWDNVHPELGSRVREAVSAAASGS"
     gene            complement(423470..424831)
                     /locus_tag="HMPREF0733_RS01900"
                     /old_locus_tag="HMPREF0733_10398"
     CDS             complement(423470..424831)
                     /locus_tag="HMPREF0733_RS01900"
                     /old_locus_tag="HMPREF0733_10398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013709345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397696.1"
                     /db_xref="GI:503163035"
                     /translation="MMVKVAVKQLRRTWRVWVGALVMVIVGATGITAVRLHLATASTM
                     PSEKARAIFSLAYGEVAFLIVASVAMLASTARYAVAATRAEYARLQLVGVLPRQVFTI
                     VLVQLLAVGVIGVVFGCGLGIVCAQPMLDYTVHQTTLQQTVPVVYLAHSIVISALIVL
                     VVTLFSGVRSARAASLMPALWALRETEETPAVKFSCGRLILTLVLAGCTIALAVGIQF
                     VRIDPHQERVGVVISGVIGLGILLGLCLISLLAALAPLLSTGFISVWSAIIPMRLSAS
                     WSIARRFIQHSGGRSAATLTPVLIAVGLPGILYTVYDTIATGMSSGSGPNTGGLSVIL
                     SPALLTATIGSATIIFMGSLSRSRDFALLVLTGVSRAVIARIVVFESLMYALSSFLLA
                     LGVMAVVGFSVSSRFPAETKVTSALGWDVAAVSAGCAWVILCLANLAPVLRYNRLKLV
                     STT"
     gene            complement(424828..425595)
                     /locus_tag="HMPREF0733_RS01905"
                     /old_locus_tag="HMPREF0733_10399"
     CDS             complement(424828..425595)
                     /locus_tag="HMPREF0733_RS01905"
                     /old_locus_tag="HMPREF0733_10399"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003991555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775453.1"
                     /db_xref="GI:908631420"
                     /translation="MAFPHTAEEIITGAGIYKSFPSAGSREQLSVLKGIDLQIQRGSF
                     TGIVGPSGSGKSTLLNCLAGLEPLTSGTVTIGGTDISSLRGNKLVAFRRDHLGFVFQS
                     YNLIPALTAYENVLLPAQLAGLRHAHRRAREALHAVHMLDFSRSLPNRLSGGQAQRVA
                     IARALASGAELIFADEPTGALDTKTGNLVLDILRHLVDEEHRTIVMVTHDLEAASRTD
                     IVYVMRDGTLHETLESPHTPEILAALDRAAAYETDAS"
     gene            complement(425786..427141)
                     /locus_tag="HMPREF0733_RS01910"
                     /old_locus_tag="HMPREF0733_10400"
     CDS             complement(425786..427141)
                     /locus_tag="HMPREF0733_RS01910"
                     /old_locus_tag="HMPREF0733_10400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397698.1"
                     /db_xref="GI:503163037"
                     /translation="MTDTRRSEPTSRAARTQDALNRIGSWLLDVVKAEPGWSEMILDV
                     KPLAGQVYIRVREFRDGEEYIGSVGPLKEDSPVLPDLRKLQRAAYDGNRGTWFTASVV
                     VAANNWPEPKFSVGASYNRDEEPENWGTEGTLSASDVREHLHMFPRDSERIPAWATER
                     MHGRARDVSGLHKETDYEVPNPYLAAALEAFKKDVKERTLINVVRTMLGGDLLVDASG
                     STIVPAGHLDIGPESQLRYQVIRLENGMQALCVFSSAEYVSKSYMRENSDDDELILRE
                     PAVKIFMDFLSNPDLDLIAIDPGSNHECYIERAQVQWVVNSPRNDGAKMALINDNMQQ
                     LLGSLVAPNSILVVAIDPKSEVQGPAFVPDDEGNPTNMLAFTSPIEVAAIDPAIEVRV
                     AHAIEVLTLAEQLNAPGIQINYFNPSAVLDIKQIRELLDIVREQEAVFGASPAGAGAP
                     A"
     gene            427396..428901
                     /locus_tag="HMPREF0733_RS01915"
                     /old_locus_tag="HMPREF0733_10401"
     CDS             427396..428901
                     /locus_tag="HMPREF0733_RS01915"
                     /old_locus_tag="HMPREF0733_10401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013397699.1"
                     /db_xref="GI:503163038"
                     /translation="MTNSLQDLIDASIFISTEYQARLAELIGSADYDVNFAEQSLTFK
                     AADPVSFQPYLLGTESENRGTWIWSWQQLGYFPDSVVSAALQARDTGERDSVLELSTD
                     EIPLSEGLARRLTLATKTVTGLYAHYPLPSGSVRAWCLIDSPELTLDAPTYKGVGRVI
                     AKALQSEDIHDHPLAINSYARQRGFHTAWDTEATVVLTMTDGALRLWFDEGRISGIER
                     AKPEVTAQELEQLASEAEQYRAELAAERAEVEQAAAAEAAEQVALREQQSAERAAARA
                     EAEQAPTAQKPEAAQVAESTPAQENAQQEEAAPAQPQAPAAAAEQAVPAGTAQKPVAG
                     VRTTENLYPDTEAPFDQDPREDSEHGRVTVNTLPGDVVPNAAAAQKTGAPAGQAKSAN
                     PGASETSKSRTSITPRAAGKPGASASQGQTTPQPGAQKPAAAGAQQQPKQAPKPAASG
                     TDASAPQTENTPATAIPVIKPSEQKADQPEEQEQAQETGKKKGFFSRFFGL"
     gene            429147..430256
                     /locus_tag="HMPREF0733_RS01920"
                     /old_locus_tag="HMPREF0733_10402"
     CDS             429147..430256
                     /locus_tag="HMPREF0733_RS01920"
                     /old_locus_tag="HMPREF0733_10402"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein rarD"
                     /protein_id="WP_013397700.1"
                     /db_xref="GI:503163039"
                     /translation="MAQHAHSATASTSAPGTAAHAAQTRNGFICLFTTYAIWGMLPLY
                     FYLMASSSALEIVLSRVIFSLAFCAVLLPIFRLTKPFNQAVRTPRTMGILTVASLLIG
                     ANWMIYVYSTTHGHTIDMSLGYFINPLVSVVLGVVFLHERLRKVQWLAIGISTVAVLI
                     MSVVYGQIPWLGLGVAFTFGTYGLLKARVGSSVHPVVSLSLETFILLPVALVVLWWMN
                     TQGQLTLFSQGPGHFWLLASTGIVTVTPLVLFSAAARALPLSVIGMVQYMGPTIQFFL
                     ALFVLHDRITPDKWIGLSLIWVAIVIFTVDAMRASRTSRPSKLTAVETGMIPIVQISQ
                     SSEGGEDREQNYLLDAVQLSPEDTEDSAASARDKS"
     gene            complement(430541..432151)
                     /locus_tag="HMPREF0733_RS01925"
                     /old_locus_tag="HMPREF0733_10404"
     CDS             complement(430541..432151)
                     /locus_tag="HMPREF0733_RS01925"
                     /old_locus_tag="HMPREF0733_10404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_013397702.1"
                     /db_xref="GI:503163041"
                     /translation="MGTKPAKTPAKREGFSSRRVFLFAAIGSAVGLGNIWRFPAVAYE
                     NGGGAFMIPYIVALLTAGLTFLFFDYAIGHRGRASSPLAFRRLNRKTEFIGWWHMGIS
                     AVIAIYYAAIIAWAVRYMIFSFNQEWGNDAKSFFMKDFLKVGDPKLSFDFNPGILIPL
                     VLVWISLIVIMALGVQKGVGAANVVFMPLLIFMFVGLVAYSLTLPGAMNGLNTLFTPN
                     WGALTNGEVWVAAYGQIFFSLSLGFGIMVTYASYLKPKTDLTGSGAVVGFANSGFELL
                     AGIGVFAALGFMAQAQGIAVGEVVEKGTGLAFIAFPTIISQAPAGALIGFLFFGSLLF
                     AGFTSLISVLEVIIAGVQDKAGTSRLTSTMIVIIPLAIISTLLMPTASGLYVLDILDN
                     FVNNFGILAAGLTSIVVVVYCLRALPTLRDHLNSVSSLKVGWLWMILLAGVTPLILGY
                     SLISTLVKTINKPYEGYPADLLGIFGWGMVVLLIVGSIVISFLPWSHKSRAAEEPPAP
                     PVIGGKLAHTHVDDAALKAHAKAQGEEA"
     gene            complement(432439..433749)
                     /locus_tag="HMPREF0733_RS01930"
                     /old_locus_tag="HMPREF0733_10405"
     CDS             complement(432439..433749)
                     /locus_tag="HMPREF0733_RS01930"
                     /old_locus_tag="HMPREF0733_10405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397703.1"
                     /db_xref="GI:503163042"
                     /translation="MAHKTVTAYQSAAIFFSSVIAAAATFAISVIAAYFLSHSEFRQF
                     QSAFWPLVFGIYGITGAIQQETTRAVGAALLQKPESRTHTNRLSYSAVAALLGLGIAA
                     IVVMTSPLWSSAFPIYPQMSVVLIAFGVVMYAVYAAVSGASAGRDSWYFYAALGSGEA
                     LIRLAATLAAVALSWHLLGFETAVVVASLIWLPCVVFSRTGRRVWYASIDVSSRRYAR
                     NIVMLMLSSAGASILMTAFPFFLQFTTQDQSAQFNALVAAIGVTRSPIMMPLQAFQGV
                     AISAFLKHQDYPLRALARPCLWVLGIGGFGALLAYLIGPFLFDIFYSKYAGLAPGMML
                     AVLTFESAIIAVLVLAGNLAIALNMHRLYVSGWVCAAALALLMLHVPLDVVSRTELAL
                     GAAPLCGFTVILVGILRASKGESGKSTDKSGLFQDAPATRHERS"
     gene            complement(433869..434930)
                     /locus_tag="HMPREF0733_RS01935"
                     /old_locus_tag="HMPREF0733_10406"
     CDS             complement(433869..434930)
                     /locus_tag="HMPREF0733_RS01935"
                     /old_locus_tag="HMPREF0733_10406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="geranylgeranyl pyrophosphate synthase"
                     /protein_id="WP_041321540.1"
                     /db_xref="GI:752672831"
                     /translation="MSTSEQSIAATDLMAGLDFNLPAGFELIASDPQLGPQILTSLAR
                     IEERLAEAISYTDKLADVAARHLLLAGGKRVRPLLTLLAAAVDGQINDDVIEAAVVVE
                     LTHLATLYHDDVMDDAPKRRGVDTAQTIWGNSVAILTGDLIFSRASLLVSDLGTRPMK
                     IQAQTFERLVLGQLYETTGVRENQDILDHYIAVIEGKTGSLIAAAGEYGSLLAGASEE
                     VIQMLATYGELVGVAFQLADDVIDIVSDGASSGKTQGTDLREGVPTLPTILLNRAAEA
                     GDESARQVRTLIEADLSSDDALAAAVSALAAHPVTQEAWQIAYDWADRAIAAIAPLPD
                     STAKAALESFAHAVVHREG"
     gene            complement(434999..435724)
                     /locus_tag="HMPREF0733_RS01940"
                     /old_locus_tag="HMPREF0733_10407"
     CDS             complement(434999..435724)
                     /locus_tag="HMPREF0733_RS01940"
                     /old_locus_tag="HMPREF0733_10407"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /protein_id="WP_013397705.1"
                     /db_xref="GI:503163044"
                     /translation="MSNVEKNVQGTRATLDKKTGDIAAMFDTVAKRYDLMNGILSLGR
                     HIYWRKQTVAAVDARPGQKVLDVAAGTGTSSEPFADAGIDVIAADLSEGMLEVGRKRR
                     PDMTFVRADVTDLPFEDDSFDAVTMSYGLRNVADYPRALSELYRVTKPGGRIVVLEFS
                     TPTFAPFGKVYKEYIMKAIPPVARAISSNPESYVYLAESIIDWPDQRTLAHKFAQAGW
                     QDVKYRNLSGGIVAIHRGFKPQN"
     gene            436028..436861
                     /locus_tag="HMPREF0733_RS01945"
                     /old_locus_tag="HMPREF0733_10408"
     CDS             436028..436861
                     /locus_tag="HMPREF0733_RS01945"
                     /old_locus_tag="HMPREF0733_10408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013397706.1"
                     /db_xref="GI:503163045"
                     /translation="MSIFTAKPSLKKSLALLALAPLVLTGCVSTASDGENGEVNLINN
                     GVLTVCTNTPYMPFEYEENGKIVGIDADIANAIAKDLGAEAQLTSISFEGLDSGTGLT
                     SGQCDIALAGISVTDERKSKMEFTDVYFEDNQAILVPKNSKISSVEDLKNAKVGAQQA
                     TSGESYAKEKGADVVQYEDNELMFSALKTGQVQAVSANLSVISEALTKDPDSFKIAYQ
                     TSENADQIAGAVAPEKKALLDKANKTIQQLKSSGELDKIKEKWTKAKSSSSSASSSSA
                     N"
     gene            436949..437752
                     /locus_tag="HMPREF0733_RS01950"
                     /old_locus_tag="HMPREF0733_10409"
     CDS             436949..437752
                     /locus_tag="HMPREF0733_RS01950"
                     /old_locus_tag="HMPREF0733_10409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013397707.1"
                     /db_xref="GI:503163046"
                     /translation="MAQNKLSPRKKQAMFRYSQYALLAVIAVLIIALADWKTLSSQVF
                     NLEVAQKQFPNVITVALKNTLIYTALGFAVGLSLGLILALMRISSIAPYRWLATIYVE
                     IFRGIPALLVFFAFGYGIPLAFKIRFVDNLIPVTLSLGLVSSAYISEVLRAGLQAVPK
                     GQYEAARSLGMSHTRAMLSVIIPQAFRIVLPPLTNEVILLTKDSSLVYLLGVQIAQYE
                     LAKFGREGITASGAGLTPLVVAGLCYLIITVPLGQLSAYFEKRTGASRK"
     gene            437780..438583
                     /locus_tag="HMPREF0733_RS01955"
                     /old_locus_tag="HMPREF0733_10410"
     CDS             437780..438583
                     /locus_tag="HMPREF0733_RS01955"
                     /old_locus_tag="HMPREF0733_10410"
                     /EC_number="3.6.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_013397708.1"
                     /db_xref="GI:503163047"
                     /translation="MTDTVTSAASVSITGLHKSYGKNEVLRGIDIQVEPGEVVCLIGP
                     SGSGKSTLLRCVNLLEEPNAGTITVGGVEVTDPDADINALRTRMGMVFQQFNLFGHLS
                     VLDNCTIAQIKVLDRDRATAEKIAREQLAKVGLADKENAYPSKLSGGQQQRVAIARAL
                     SMNPELMLFDEPTSALDPEMVGDVLTIMRDLADEGMTMIVVTHEMSFARDVADKVVFM
                     ADGVVVEEGPAERVIGSPQHERTKTFLARVLDPTHVDETPADQDAAANA"
     gene            complement(438800..439240)
                     /locus_tag="HMPREF0733_RS01960"
                     /old_locus_tag="HMPREF0733_10411"
     CDS             complement(438800..439240)
                     /locus_tag="HMPREF0733_RS01960"
                     /old_locus_tag="HMPREF0733_10411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_013397709.1"
                     /db_xref="GI:503163048"
                     /translation="MQILGCAYPKRTTIIGERLELMAGTHEGRVLVFPQLTEVLTPFE
                     TKPQAKKILDADGGSITLMELAAGQSWHEHHSVHPVVVQVLKGKVEYSTKGQSIILEP
                     GKLIHTTAKLLHSVTALEDSTLMVIMLTGESHPEPNITIEVEQV"
     gene            complement(439318..440271)
                     /locus_tag="HMPREF0733_RS01965"
     CDS             complement(439318..440271)
                     /locus_tag="HMPREF0733_RS01965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidic acid phosphatase"
                     /protein_id="WP_041321850.1"
                     /db_xref="GI:752673141"
                     /translation="MSTANYAGYGARPNPAAPGAGVPAEAPIPNDPPSTKVVAQHLGV
                     MVLFGALLYATFQFFIYSRTGQQLDENAFTEYASQFAEYQRPTLAALDNLPTITGVIA
                     VIGIIIGLIWKHRILPAIVGILAGTGACLSVHVLKNYVITKPNFGIQEALLNSAPSGH
                     TAFAASAGAALFIAAPRALRPTIAVLAAMATCATGASTIINGWHRPADVISAILVVAL
                     WTVLGLGVLRYLRRAEFNVPTPRVVGAIAVPLLTIASLFLSFCAVAMYAVTMFSTMPG
                     GVFVASTCMILAVSTGTTAILVRLLRPRNQVSSPYTRVWEY"
     gene            440950..442002
                     /locus_tag="HMPREF0733_RS01970"
                     /old_locus_tag="HMPREF0733_10413"
     CDS             440950..442002
                     /locus_tag="HMPREF0733_RS01970"
                     /old_locus_tag="HMPREF0733_10413"
                     /EC_number="4.2.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylbenzoate synthase"
                     /protein_id="WP_013397711.1"
                     /db_xref="GI:503163050"
                     /translation="MSSVPPLGYGFITEGLALPPLEQVLRAVRVVDIPMRVTFRSVNR
                     RQSALIQGPAGWGEFAPFLEYDDHEAAAWLACALESAWLGAPPARRATIPVNATLPAV
                     SAERIPEVLNNYRGTIHELKIKVAEKGQTLDDDIARVAAARRALPNARLKVDANAGWS
                     VPEALEALAALNEYDLLYAEQPVATVDELAQVRALVGERSLSMLIAADESVRKASDPL
                     KVAQAHAADVLIVKAAPLGGVRRALKIVEQAGLPTVVSSALESSVGIATGVSLAAALP
                     DLPYACGLSTVSLMSADVTDDSLLARDGELQMRRVVPTESALRRVEAEGEVRDAWVER
                     IRRCYLVLQEALPTSL"
     gene            442171..444045
                     /locus_tag="HMPREF0733_RS01975"
                     /old_locus_tag="HMPREF0733_10414"
     CDS             442171..444045
                     /locus_tag="HMPREF0733_RS01975"
                     /old_locus_tag="HMPREF0733_10414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-succinyl-6-hydroxy-2,
                     4-cyclohexadiene-1-carboxylate synthase"
                     /protein_id="WP_041321851.1"
                     /db_xref="GI:752673142"
                     /translation="MLSAVAVLDSLIRAGMRHVVVSPGSRSAPLAYAVAAAEEAGALV
                     AHVRIDERVAAFTALGIAKASRLPVGLVCTSGTALGEYLPAVMEAYHAGVPLAIMSAD
                     RPVRLRGTGANQTTIQTDFFSPFVRASADLTSYPEHNPGQQTADFMACLAALTGSDAQ
                     DWSRTSDEPVGPAHVNVCFDTPLTPSARTAEILPTWATSLAEHIAPGAASYPAELEPA
                     QLSPVEKLWLIQHEQVAQASPLKPEGAPDCPKTVVIAGDGAEPFAAEFARALNLPLLA
                     EPSSQARHGATAIPQYTTVLGEHAASELGQSIERTILCGHPTLSRPISALLARTDVQH
                     AYYAPRRASWYEPGTRAVREIDSPAELEAFALMGSGVRADDSWLDAWVTAGQRAQEAS
                     LTSIEAYRYAKSETVHPQASIPSEECHQDGAYTSQPARIPAQALALQTWNTCAQQHRT
                     LVVGSSSIVRDLDIIAPALGADAPARVLANRGLSGIDGLIATAVGVSLAGYYPTGNAR
                     TAADDSAHVAGAPIPVTLICGDLTFQYDISALNLPMTELLPDLDVVVYDDAGGSIFTA
                     LEHGTLAQNPQFARAIERFFTVQAAPNTDLERMAAGFGEESGIRVRIHRPNDIFDTQA
                     "
     gene            complement(444203..445096)
                     /locus_tag="HMPREF0733_RS01980"
                     /old_locus_tag="HMPREF0733_10415"
     CDS             complement(444203..445096)
                     /locus_tag="HMPREF0733_RS01980"
                     /old_locus_tag="HMPREF0733_10415"
                     /EC_number="3.5.2.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_013397713.1"
                     /db_xref="GI:503163052"
                     /translation="MATTIELADGVYRIATDNYCLNTGLILGLEKALVIDTGAGPRQA
                     TEIYDEVRRITRMPLVVVNTHAHPERYFGNDVFAAMGTEEFWSHPRAARAIKKYGDRQ
                     RLYVETLEPEMAHHQGAATDIVVPNHLVAQSGEGITFTPVDLGERSATLIYLGPGHTE
                     GDILVGIDDVLFTGGLLEQGTDPSFEDSFPDRWVETLGALLELDRYRVYVPGCGDPVE
                     RDFVERFQETMKKAIYAIRHSTIDPNDASTTAAMYHLPYAPGPTRFLLDRMAQLDGTE
                     VPTDSSETTGYTGPITIGSLH"
     gene            445312..446262
                     /locus_tag="HMPREF0733_RS01985"
                     /old_locus_tag="HMPREF0733_10416"
     CDS             445312..446262
                     /locus_tag="HMPREF0733_RS01985"
                     /old_locus_tag="HMPREF0733_10416"
                     /EC_number="6.1.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-Q tRNA(Asp) ligase"
                     /protein_id="WP_013397714.1"
                     /db_xref="GI:503163053"
                     /translation="MHTPSSPGAGRYAPSPSGDLHLGNLRTAILAWLLARQEGLRFVM
                     RIEDLDRVRPGAAEQQLADLKSLGLDWDATPGEDPQRRDHVLRQSTRLAAYDAAVQKL
                     QDAGLLYECYCTRREILEATSAPHGIPGSYPGTCRSLSDAERESRREIRPPALRLRAE
                     ISEFTVQDMFAGEYTGAVDDVVVRRNDGTYAYNLAVVVDDHYQGVTQVVRGDDLLSSA
                     PRQAYLAALLGYELPLYAHVPLALNTEGKRLAKRDGAVTLRQLRDAGFAESDILEWVR
                     ASIPIPDAPQFPKSAQDFLEYFDPKAMSPKPWIITNPLDL"
     gene            446564..448060
                     /locus_tag="HMPREF0733_RS01990"
                     /old_locus_tag="HMPREF0733_10417"
     CDS             446564..448060
                     /locus_tag="HMPREF0733_RS01990"
                     /old_locus_tag="HMPREF0733_10417"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397715.1"
                     /note="involved in the sodium dependent uptake of proline;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline:sodium symporter"
                     /protein_id="WP_013397715.1"
                     /db_xref="GI:503163054"
                     /translation="MTDGTFQVIALAIYFIAMIVIGLWANSKNNDLDDYVLGGRQLSP
                     TVAALSAGAADMSGWLLMGLPGAVYLAGLSKSWIAIGLTIGAWVNWKFIAPRLRSYTE
                     VAGDAVTVPVFLSNRLHDKYNILRIFAGIIILVFFTFYVSSGMVAGGKFFESSFHQDY
                     LTGMLLVAGITMFYTFFGGFMGASYTDMVQGLLMLAALIAVPIVAITNMGGLDHVTDA
                     VANVRPDALGLFAGTTFIGIASALAWGLGYFGQPHIIVRFMALRTPKDAKAGRRIGMS
                     WMLLTVVGSISTAFVGVAYFATHPEVSLTDKESAETVFLDLAQILFHPFIAGMILAAV
                     LAAIMSTLSSQLVVCSSALVEDLYGVFVKKKLSSNQSLWLGRAGVAIVAVIATLMALD
                     KNNSILSLVEFAWAGFGSAFGPIVILSLYWRKLTLPGAVSGMVVGAVVTFFWRQIFNL
                     TETIDVYEMIPGFFLAFLVTVVVSLATYQKNEEIEQEFDKAAELAKAG"
     gene            complement(448171..449553)
                     /locus_tag="HMPREF0733_RS01995"
                     /old_locus_tag="HMPREF0733_10418"
     CDS             complement(448171..449553)
                     /locus_tag="HMPREF0733_RS01995"
                     /old_locus_tag="HMPREF0733_10418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775416.1"
                     /db_xref="GI:908631383"
                     /translation="MSEYTSRTSATPDDSLIHLHAMRHERYAAATALLGESGFATRVG
                     GFNALVRLADEWLADERTPEEQRLAEAQVIIDTFCACIYAPFLPASRHKDYMRLNREP
                     KKRWDSQKKARFRAEQAEFRAEARFRQTVLDTIHLRVMPRYEGPGPWSRLSFDFSGSV
                     FFYPVSFGRSQWEGRLNLRGCTYYAEADFSGSTYTWYLDCSNSAYYTEADFSASTYNG
                     GVNASFCNYRGNVDFSESVYRANASLSYNVYWGEAALNDSIYEGHADLACCTYVGHAS
                     LGNCDYRRGADLFLSTYATFADLDRCTYGGRANLSKSVYYGRAWFWHSTYLQEATFGD
                     SIYNDSVDFSDSHFAGPVNLEDSAYLDTTNFQNTIFEEDSPSFARSVYVPENNEHTGY
                     NYGVVRVLTLDELQHLDQLREPRYEIEQELFNVDDATDAKTYRILRRALLEASHPIQK
                     WCQELMAGTL"
     gene            449782..451146
                     /locus_tag="HMPREF0733_RS10695"
                     /old_locus_tag="HMPREF0733_10420"
     CDS             449782..451146
                     /locus_tag="HMPREF0733_RS10695"
                     /old_locus_tag="HMPREF0733_10420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009057877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397718.1"
                     /db_xref="GI:503163057"
                     /translation="MQILNFRVKNHKSLRDETALELLDSSLTTLKPSANKTWGQYVHT
                     VAGIFGANASGKSNVLDALRYFTAAIENSSTIWQDSSSFPHVPFKLSDTSRTADSAYE
                     LDFLLDDIRYRYGFSVNSEGVNIEYLMHLPKSRWRTIFTREYVEGIDSVDFIARDVKK
                     LEVSHRELVLSRAATLGRKDILGSVAHAITHKIDFVLLSERDQQMRIEAIINALVELS
                     ITRDDIAQLLQVADIGIQKVDIWQSEDNLDVDNLPQDMPRTVQQIILQILATEQKSAA
                     DSNAKLIQRRLEFFHNSADSNSPPLYLSDESDGTLAWLAISFAVLEALRTGKVVCGDE
                     LDSSLHPHLVRLIISLFTDPSVNTQGAQLIFTTHDATILHHYEELGLSPENFWFTEKN
                     RDGATGLFSLADFPKITGANIEKRYLSGRYGAVPFVSHSIFWKILENKKQKLSQVEAV
                     SHGS"
     gene            451136..451783
                     /locus_tag="HMPREF0733_RS02005"
                     /old_locus_tag="HMPREF0733_10421"
     CDS             451136..451783
                     /locus_tag="HMPREF0733_RS02005"
                     /old_locus_tag="HMPREF0733_10421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009741365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397719.1"
                     /db_xref="GI:503163058"
                     /translation="MGRRSRKNSKDLFPNNPRSKDRVPKRNFLICVEGEKTEPKYFKM
                     LTEHIKNLGINTDIKVVKPKGSDPASILKGCLSYLREAENDGNAYDDCFCVVDVDAHA
                     TLDQALRDARSHHISMVVTNLKFEVWLLWHVGDQPGGYANNHQLDTLVKKLSNSGKAP
                     LLTGSNYKGLHPNFPIENYRDAVKIARQKDPQMAFNRKGQNPSSAMPLLIEKLMG"
     gene            451875..452828
                     /locus_tag="HMPREF0733_RS02010"
                     /old_locus_tag="HMPREF0733_10422"
     CDS             451875..452828
                     /locus_tag="HMPREF0733_RS02010"
                     /old_locus_tag="HMPREF0733_10422"
                     /EC_number="4.1.3.36"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397720.1"
                     /note="catalyzes the formation of
                     1,4-dihydroxy-2-naphthoate from O-succinylbenzoyl-CoA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="crotonase"
                     /protein_id="WP_013397720.1"
                     /db_xref="GI:503163059"
                     /translation="MTVTFPPQVSDIFNPQHWRIVEGFEDFTDITYHRQVQRDETGEI
                     LRDLPTVRIAFNRPEVRNAFRPHTVDELYRALDHARMTSDVGTVLLTGNGPSPKDGGW
                     AFCSGGDQRIRGRDGYHYASGDTAESIDPARAGRLHILEVQRLIRTMPKVVIALVSGW
                     AAGGGHSLHVVADLTIASEEYGKFKQTDATVGSFDAGYGSALLARQVGQKFAREIFFL
                     AKEYDARRMYEMGAVNDVVPHAELENKGLEYAAHIARQSPQAIRMLKYAFNLPDDGML
                     GQQVFAGEATRMAYMTDEAVEGRDAFLQKRDPDWSNYPYYF"
     gene            452924..454342
                     /locus_tag="HMPREF0733_RS02015"
                     /old_locus_tag="HMPREF0733_10423"
     CDS             452924..454342
                     /locus_tag="HMPREF0733_RS02015"
                     /old_locus_tag="HMPREF0733_10423"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-succinylbenzoic acid--CoA ligase"
                     /protein_id="WP_041321853.1"
                     /db_xref="GI:752673144"
                     /translation="MGAFSGSLAPLPAPRQDALHPHAVMLSADAPANPQEILRAFERS
                     LTGGLPNGARDNQDPLGQTENPESLALVVGTSGSTGAPKQTALSVQALRVSARATERF
                     FADYPSSGSAKPQRAVSEAPAQWLLALPAHYVAGAQVLARSVLAGTTPVVAASVTDGV
                     SFTPEVFLNAAERLSCARRFISLVPTQVHKLLEAAEASPALGSEIYDALGQFTGILLG
                     GAPASASLLAAARELGLNVVTTYGSAETAGGCVYSGTALPGVRLRVVPEDGSLLDSSV
                     AGDAAAGGPPNIGRIWLGGEHLASGYMGDSARTASHFFVDADGCRWYRTDDYGSLAPA
                     APKNAPEDEGAPMLNIVGRSDDVIITGGVKVSARAVAAVLESHPAVREAAVMGIPDAR
                     WGSAVAAAITLRGASEAQSVLDTSRATCDMLREFCTDKLGAAGTPKYLRILADFPTAS
                     TGKPDRRAIYSMLYREYTNTRG"
     gene            454393..455307
                     /locus_tag="HMPREF0733_RS02020"
                     /old_locus_tag="HMPREF0733_10424"
     CDS             454393..455307
                     /locus_tag="HMPREF0733_RS02020"
                     /old_locus_tag="HMPREF0733_10424"
                     /EC_number="2.5.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-2-naphthoate
                     octaprenyltransferase"
                     /protein_id="WP_013397722.1"
                     /db_xref="GI:503163061"
                     /translation="MATPAEWIEGARLRTLPLALAPIIAGSAAAYEIDAFKPWYAFLA
                     FLVAFFLQVGVNYANDYSDGIKGTDEGRVGPMRLVGSGAASAKSVKYAAFLCFALAMC
                     SGLILVALANQWWFLAIGASAVFAAWGYTGGKRPYGYMGLGDIFVFVYFGLVATLGTL
                     YTQSHELTVTGWVSAIAIGLISCALLMANNVRDIPTDRKSGKLTLAVRLGDWRARIAY
                     CAEMLIALLLGAFVVPHNPWFLVTFILLGPTVHSCVTVLFKQGPALIPVLKQAGIVAL
                     IYSILVAISVWLHGLNLLSNTVEVFTGY"
     gene            455678..456922
                     /locus_tag="HMPREF0733_RS02025"
                     /old_locus_tag="HMPREF0733_10425"
     CDS             455678..456922
                     /locus_tag="HMPREF0733_RS02025"
                     /old_locus_tag="HMPREF0733_10425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397723.1"
                     /db_xref="GI:503163062"
                     /translation="MRHSLQGAVQRAPFFLAASLLVSTSFIPANAVSTPNDSASYTHT
                     VSERSDDSASAVAPLSDDVLNADPQASVVAGQEGENPGAIPEGDPRVITYWTTERMEN
                     AIPADNVEDPQQEINNAVSQMETEEQNPEVVSQEETNESGEEYTPQTLTQEADEPETT
                     AESVDPVLPEQKDARNGVQLQGASKVTNFSHTNGKIFYTDASDGKNYVCSGAAINTPT
                     KRTVVTAGHCVHGGKNKTWHRNIVFVPGYNRGVRPHGTFSAQYLRVANDWVQYGQPTG
                     GTGDSYKHDVAFIKTNTNEKGQLLVNMVGGHGLNVDRSPIFESTVFAYPGNKESGRVM
                     HACWGNTHTIRITPYYFPTLSGCEFAGGSSGGPWLADYNNATGLGKVQSVTSFATNNN
                     TSVSGAIFDRPVWDIYQKAAQD"
     gene            complement(457118..457405)
                     /locus_tag="HMPREF0733_RS02030"
                     /old_locus_tag="HMPREF0733_10426"
     CDS             complement(457118..457405)
                     /locus_tag="HMPREF0733_RS02030"
                     /old_locus_tag="HMPREF0733_10426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005418.1"
                     /db_xref="GI:490103571"
                     /translation="MNLFKYTLLRLGLVVVLFYLFMLIDAGIFIAGPAAILCAFALAY
                     IFFPKLHAAASADMRKIFKRAPTIKNKDEAENRTLEDQLVDEHKKVSGEDF"
     gene            457532..457966
                     /locus_tag="HMPREF0733_RS02035"
     CDS             457532..457966
                     /locus_tag="HMPREF0733_RS02035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397724.1"
                     /db_xref="GI:503163063"
                     /translation="MIRAMMIIGAFALVVGLTLYTLLDALRTHQDQMRTFPKWLWIIA
                     VIFFPVVGPLLWLLLGRPRAVRAPKTQQGGGFTSSRRGTPPPATSSPDDDEEYLRWLK
                     TKADRQRRSREKDTGTGPADGGTGGRSEGESNDSDGKDDSKH"
     gene            complement(458297..459409)
                     /locus_tag="HMPREF0733_RS02040"
                     /old_locus_tag="HMPREF0733_10428"
     CDS             complement(458297..459409)
                     /locus_tag="HMPREF0733_RS02040"
                     /old_locus_tag="HMPREF0733_10428"
                     /EC_number="4.4.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein"
                     /protein_id="WP_013397725.1"
                     /db_xref="GI:503163064"
                     /translation="MLNDSLARSSELFMYIAALIYTVVFIAFTSDVVANSRVTRRLEG
                     RSEGTAQKSTVKAKIKVGAGAVSGASATTNTAADTVRTGGTEQGTGERGMGYKGAAAR
                     ALEGEVADSAMLYTGVRRPAARIAVVVMVLAALVHTAAVIMRGIAAQRVPWGNMYEFC
                     TTGALMVSAVFLITLIFRDVRFVGTLVSGLVLIMLCAATIGFPTPVGHLKPALQSYWL
                     VIHVSIAVLASGVFTITFAMAVLQLVQTRREQRILNGKSGGWAFMRLVPSAQALENFA
                     FRMNALAFVMWTFTLAAGAIWANHAWGRYWGWDTKEVWTFVIWVVYAAYLHARATRGW
                     AGPRSAWLSIIGYACIIFNFTVVNIFFSGLHSYSGL"
     gene            complement(459413..461167)
                     /locus_tag="HMPREF0733_RS02045"
                     /old_locus_tag="HMPREF0733_10429"
     CDS             complement(459413..461167)
                     /locus_tag="HMPREF0733_RS02045"
                     /old_locus_tag="HMPREF0733_10429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein ResB"
                     /protein_id="WP_013397726.1"
                     /db_xref="GI:503163065"
                     /translation="MVSEHSDDENTSTEAKDTNTANRKAGKTADAGRAVNASEKTKKT
                     GKSARKDAPALGFVGMLRWCWTQLTKMNTALMLLLLLAVAAVPGSIFPQRVQDPTKVT
                     DYIKNHPGWGEFADKIQLFDVFSSAWFSAIYLLLFISLIGCVTPRAIKHAKDWRKPPA
                     RTPRNLSRMPVHRQLEIPVADAGLNLSAKGAIEDAARILKKSHYRVEIRDEENEHYSV
                     GAERGYLREIGNILFHVAMIGILVGVAFGSLYGYRGQKILVQDETFVNSLIGYDSFTP
                     GTNYNPDWLTPYAVTLNNFQVRYDRQQDSHTYGQDLDYKAELTVHDPQGSTEQKTLKV
                     NEPVDIGGTSIFLSGNGYAPVVRVTDGEGKVAYEGTVVGITTDGKYTSSVVLKVPDAK
                     PSQLGFVGMFLPTGDYARGTTVPHSVDSAPANPMLIFQSYSGDLGLNSGQPQNVYVLD
                     TSKLQELNSMAQGNGIVLSAQNPEAVLPDNKGKIEFLGYKRYVGLDVRHDPGQNIVLY
                     SFVVAFVGLIVSLFVARRRVWVRAHTADGVLVVEYGLLARGEDPRLANEAERLTDAFA
                     AAWGLEFDDDNHDENEGK"
     gene            complement(461183..462199)
                     /locus_tag="HMPREF0733_RS02050"
                     /old_locus_tag="HMPREF0733_10430"
     CDS             complement(461183..462199)
                     /locus_tag="HMPREF0733_RS02050"
                     /old_locus_tag="HMPREF0733_10430"
                     /EC_number="4.4.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein"
                     /protein_id="WP_013397727.1"
                     /db_xref="GI:503163066"
                     /translation="MPSVPHTPVQPLIAIAGVGVLPVASISSTVLDGSLWLSVPLAAL
                     AGFISFASPCVLPLVPGYLGYVAGLTGANIPATGASQADGHAEEPVDAKTFALVNSAA
                     ARRLASTVPQTQDVVDNHSASAPITTESKAQTPNEYAVTRRKTTWRLLAGVALFIAGF
                     SAIFVLLSVVLAQLGTAPWLKGQSWVTMILGALVVLMGVVFLGGFSIFQTDKRLHRRP
                     VAGLWGAPILGITFGLGWAPCIGPTFAAVQTLVYTGGSGTGKAVVLTLAYCLGLGVPF
                     LLVAWGMGRGVSTLAWARKHRLGIQRVGGAVLILIGVLLMTGLWTELMSWIQAALPAY
                     ELPI"
     gene            complement(462192..462824)
                     /locus_tag="HMPREF0733_RS02055"
                     /old_locus_tag="HMPREF0733_10431"
     CDS             complement(462192..462824)
                     /locus_tag="HMPREF0733_RS02055"
                     /old_locus_tag="HMPREF0733_10431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide isomerase"
                     /protein_id="WP_041321856.1"
                     /db_xref="GI:752673147"
                     /translation="MPKPTTPNTPLTRRALLHTGAGICATAAGAVLLSACSSSDDSLA
                     KQANSGDNKGYIAGDGSVTEYQEAERGDPVAFTGELFDGKTVTAESLRGKPVLLNFWY
                     AGCAPCRAEAPDLQKLSEEFKDKIAFYGVNVRDEKNTAEAFERSFNVTYPSFKDVTGK
                     VLLSLSKYVPAQAVPTTVILDEKGRVASRVLGQANPSILKTLVETVTKGA"
     gene            complement(462904..463593)
                     /locus_tag="HMPREF0733_RS02060"
                     /old_locus_tag="HMPREF0733_10432"
     CDS             complement(462904..463593)
                     /locus_tag="HMPREF0733_RS02060"
                     /old_locus_tag="HMPREF0733_10432"
                     /EC_number="5.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose 2,6-bisphosphatase"
                     /protein_id="WP_013397729.1"
                     /db_xref="GI:503163068"
                     /translation="MTTQLTVTVHLMRHGEVHNPERIVYGRLPHYALSEKGQQMVRMS
                     AQEFAQRAQDGAKIVHLVCSPLLRTRESAAPITELLGLEAHADQRVIEADNYFEGEHV
                     TRQGLLRNRKHWGKLYNPLRPSWGEPYLDQVKRMASAIQDAARTAYDKGGEGAQAIIV
                     SHQLPIWVTRLGLEGRLLQHDPRTRQCNLASITSLDFKSTDFDHEMPQVSGYSEPASP
                     LYGGVIQLPGS"
     gene            complement(463650..463904)
                     /locus_tag="HMPREF0733_RS02065"
                     /old_locus_tag="HMPREF0733_10433"
     CDS             complement(463650..463904)
                     /locus_tag="HMPREF0733_RS02065"
                     /old_locus_tag="HMPREF0733_10433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_013397730.1"
                     /db_xref="GI:503163069"
                     /translation="MPEPVIELLTRPGCHLCEDARLTVSEICAEYGLDYTELDITDNP
                     DLLKRHKTEIPVLCIDGEAKDFWRINPKRMRKILDKKLAR"
     gene            complement(464564..467482)
                     /locus_tag="HMPREF0733_RS02070"
                     /old_locus_tag="HMPREF0733_10434"
     CDS             complement(464564..467482)
                     /locus_tag="HMPREF0733_RS02070"
                     /old_locus_tag="HMPREF0733_10434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013397731.1"
                     /db_xref="GI:503163070"
                     /translation="MAIHRKILRWLETELFEGNIQLGQSLPDDQRIAHAIGVGRSRTR
                     DALKTLEDMELMRLYSGRGKEIIPYLYEEPAAAAAGPIRLHMSTSRYPTRDMLQTRIL
                     LESWAVSNIDPDKVSFDEVDEALETLQDDTLSIGEFLDQLLTFHHRLVRLAGNELVVG
                     LLVAIRQSSFDSLLSLMGRLPLWSSTMTRIRVENRAIVDAVKDGDARTARELIAHQLQ
                     ELYSEAGIELDQAANTPNGMPGDPSEDDEEFQEEEYSEESTDSSEEPEADADVEEHEE
                     AEAEQDTDENIPESEYKAEQEKSPAAQLPKIIREGSTVSRRRQGRMRVPTPVAVGFEE
                     DEAEETASAESTGDTPTADIPEQQETVESTHESPIDPLEETAAHEPQLESVQPEFEDD
                     VLPVDESSESASDDAQDKEPAEEITAEKAPDKSADGSEKSKSSEEAQGTSQDDSASHE
                     DSIESTEDKDAEETPDEQEHVREVYVEKAPVGKISAEELVATGLIPWRTMGQQAENGT
                     STQTEAEGEDDVIRAPLRRNVPPVRPAQFSPRKSEKPEKAEKPASERISLIRRVRHYF
                     GLDLPHTQAVKLVEAQEAAEQKAADNAKFATEPPKVEPKSASASSPEDAPAAASAETS
                     KSSAAEQEREASTEPKKPAAQPSPAKAAEAPKPAEAPKSSKPSSDATSKSAEPAPEAA
                     PSDKTDSKPAKPAEKSASAPAQSVDSAKREKPAVETPQTDSSDAVKADPSDAPVQRAA
                     ANVELEETPEEIRSELQSAITLDEPSPDSVPTPTAEPVAVKRPNRKDSDSQAPAKNVS
                     VAAAAIPQPVPAVARPETANLSGVDSTPVASAVNETENKPADSQPKQKAQADTEKTPV
                     KPAPSPSEIAQASAKPASKKPETKKPAPVAGSASKSASANKKALTAVDANGAPNPFEG
                     FDVLGAVERAHAAEAAAAQKKQAKTQGSASEAKKPAQNGTSKGASALSKGKKNRKRRH
                     "
     gene            complement(467592..470072)
                     /locus_tag="HMPREF0733_RS02075"
                     /old_locus_tag="HMPREF0733_10435"
     CDS             complement(467592..470072)
                     /locus_tag="HMPREF0733_RS02075"
                     /old_locus_tag="HMPREF0733_10435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_013397732.1"
                     /db_xref="GI:503163071"
                     /translation="MQSDVFSVIADPTRRNIVHLLAEQTRTVGAVVEHLNMSQPTISK
                     HLKVLREARAVTVLVEGQRRLYSLNPEVFDEITAWVADIQAIAHSTKEQRESQIKQAS
                     VIEVVDVVESSDDDTAKTEKTEKPSAEAKTEKEVKTEKTAHAGESDTDEHQQRDAEQR
                     PKAIGKTTDETAGEAATAHAQDVQDQDKTSDSDAPAQPVESSSVVEQPEPTPQERVSK
                     ALSQRKRFEAFPGSTGSANAGVKPGASLSGERDAEKASGQKDRDGQGASHEAGAHDSH
                     AEGESSAKKKTTTAAIAKPAIFDDEARSAESSVTSGLGPKTSTKSAARIVSKPAQQAA
                     PAASEEGTETAGTVEENEFIPMRPFTPSGSSYQEKPQQSYGYDDGIDDGQQGFSPEAR
                     GFVPRSKSQDRTTAQAKPEAVKSEKTDKGVSAQKDAEPSVKGAEQTKAPARSHDTKQP
                     HVEAQTQEHTHVSGAQQPAQQSESAKPAKPSSAESKQASHVAKAEAQKPVKDAHKSAQ
                     TKPQKPESPSPQAQTAAKTESAQAQSIREEVSAPKPGSERAAQAHTGKPGAKTEAHTG
                     SQETPAQAAKPAESPIQAAASEKKPEDKPAETTATNAQTATQPGTSSTVSYGIDTAEK
                     STENGERAVQGTAQKKQTEKGQGNAGSPDTKEPAKPATVRSAKGTASTGAAAKTQEPE
                     KKPAAQVEESLSTAQEPQKSGAETPVEAAPAAAQNMTQAQSEEAKAVEAKLAENAPVK
                     SDSVTFTAVLPVVTPEMSSVQGARPQEDEEAADASDKMKSAASEKSGKNEELPYQTQT
                     EYTSAFGTADTPKEPPRGLLSRVFGRRR"
     gene            470498..471907
                     /locus_tag="HMPREF0733_RS02080"
                     /old_locus_tag="HMPREF0733_10436"
     CDS             470498..471907
                     /locus_tag="HMPREF0733_RS02080"
                     /old_locus_tag="HMPREF0733_10436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter Trk"
                     /protein_id="WP_048752922.1"
                     /db_xref="GI:881033498"
                     /translation="MMYEQEEVTRRFNPFDIRSYEKLRNLIDTTVFSSPSRTAIASFF
                     LVIVFFTVTLSLPISSVTGEPAPFHHAFFTATSAVTVTGLTTVSTAAQWSVFGQVMIL
                     LACQIGGLGALTMTSLLALAIGRKMGLRSKLIAQEELSIGRLGEVGSVLRTVAYTSIG
                     IESTIALVLTPRFLLLGENLPTSLWHGIFYAISSFNNAGFTPHSDGLVPYGHDFFVLA
                     PVSIAVFLGALGFPVLMTIQQKPFRPRDWTLTTKLTVTTTSILFVLGALLWGIAEWAN
                     PRTIGNYGAGEKILSSIFASIMTRSGGFNLVDMNDIRPVTGLITDVLMFIGGGSASTA
                     GGVKVTTIAVIMLAIIAEARGDQFVMTFGRTIPVSALRIAISVTMMSTGIVLVGTGVL
                     LAITDQPLVRVLFEVISAYATCGLSNGLSTELPPSGIYVLSLLMFIGRIGTITAATGL
                     ALRSRRRLYKYPEERPVIG"
     gene            471900..472562
                     /locus_tag="HMPREF0733_RS02085"
                     /old_locus_tag="HMPREF0733_10437"
     CDS             471900..472562
                     /locus_tag="HMPREF0733_RS02085"
                     /old_locus_tag="HMPREF0733_10437"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_004005437.1"
                     /db_xref="GI:490103591"
                     /translation="MASNHNAPVLIIGLGRFGSATAAQLHAQNKEVLAIEKDPEIAQK
                     WTGVLTHVVSADARDIDALRQLGASDFGSAVVGVGTSIEASVLITANLVDLGVERIWA
                     KAITPSHGKILERIGAHHVVYPEADAGRRAAHLVSGRMLDYIEFDDDFAIAKMRPPKE
                     THGFTLAESDIRAKYGVSVVGIKSPGEEFTYADAATRIHSRDILIVSGQVDLIERFAA
                     RP"
     gene            complement(472652..473500)
                     /locus_tag="HMPREF0733_RS02090"
                     /old_locus_tag="HMPREF0733_10438"
     CDS             complement(472652..473500)
                     /locus_tag="HMPREF0733_RS02090"
                     /old_locus_tag="HMPREF0733_10438"
                     /EC_number="1.5.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="WP_013397734.1"
                     /db_xref="GI:503163073"
                     /translation="MTEHIAFLGTGSMNGSIAAGLIAGGYPAEAIRATVRSKNSIDRL
                     RHQLGPKGRDAVVIGCELKPEANREAVSGASVVLLGVKPYGIVELAREISPALAPDAL
                     VISVAAGVTLDTLQKALPAGQPVIRCMPNTPSSVGKGVLAISVSENVTEKQLALAEKI
                     LETVGLVVQVREDQMDAVTAVSGSGPAYGFLLAETMASAGVKLGLDEETAQRLASATI
                     AGAGYLLDSNPDAAALRKAVTSPNGTTERAINTFIDKGLFDLTEDAMRACAARSAELS
                     EQYTAD"
     gene            473660..475030
                     /locus_tag="HMPREF0733_RS02095"
                     /old_locus_tag="HMPREF0733_10439"
     CDS             473660..475030
                     /locus_tag="HMPREF0733_RS02095"
                     /old_locus_tag="HMPREF0733_10439"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="voltage-gated chloride channel"
                     /protein_id="WP_013397735.1"
                     /db_xref="GI:503163074"
                     /translation="MKTRLIRCAHLLLCTVLIGAATGGGAIILHYLLDIMQEVTFGHT
                     EAEHPIVTDHSDIVRRVLVLIAVGVVVSIIWFLLQRRTKLVSIKAQIRGETPQERHPG
                     FLRQTLHSLTQIVAVGAGAPVGKEVAPRELGALFAGRLADLMRIPQTVRPVLVASAAA
                     AGLAAVYQVPVGGFVFLFEALGLALSLRNIFTGAVLVLVATCTANLVISDAPTYPVPQ
                     LQTTGESLLLAVVLGLAITPLALWFRAASQRAESRKTTNRNVLWRLPLVLALVAVTSI
                     FLPEILGNGRPLTQHIFDAASGLSSSSGRLDATALGQALLYALALLAAKVILVVASLR
                     NGAYGGTLTPGLALGSACGFVLTGALILVFPTLLQLPPGAGAFHASELLGIAGLLGAV
                     TFLSLSMNAPLSACALILGFAGQDWQAYAPFTVAVGTAWGVKYLWMRLGNKTQHAPQT
                     VAPSQR"
     gene            475329..475526
                     /locus_tag="HMPREF0733_RS02100"
     CDS             475329..475526
                     /locus_tag="HMPREF0733_RS02100"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321543.1"
                     /db_xref="GI:752672834"
                     /translation="MLYADLEISLAILKEPNISGVFRQLVPVLGTIAEVIPRNSSSQP
                     SHTANRALAELLPVPSTRWIF"
     gene            475709..476962
                     /locus_tag="HMPREF0733_RS02105"
                     /old_locus_tag="HMPREF0733_10442"
     CDS             475709..476962
                     /locus_tag="HMPREF0733_RS02105"
                     /old_locus_tag="HMPREF0733_10442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397738.1"
                     /db_xref="GI:503163077"
                     /translation="MQHAQEESPAQNSLPPQDAGPDATAQTPQAAQDPQDAKTQESAQ
                     KSAEDSSAESAHATQSTPWGSQTSKPQPAEAESAQPAAVEIDTNTPAEALPQSISRPD
                     ADEAVHHENTQTRQLPVQSRPEQGPLSSYLSEKPQDSEAPDPAAAHAEAPEAEPVDNI
                     PQSISRPDADEAGDAEDVRTRQLPAQAQEQGAFQSIADTMSAARAERGSSAPADSAAS
                     EAQASAEKTGAKKVYEDTMPASAIPIITANTPAVSVGAPASGQIAATTGSVPAGAEKT
                     PEQKRSRELKTIVTVTAIRTVLLAACLVMYGFGFGGGGTFNMMLGYGGAVYMLVQIVA
                     CIFAVRSKSTKGMRILNGISAGLGIILLIVTAIVYAGWSGEDSSAGAYIFIMADIILS
                     VIIASARSIIEQPKEDVEPERLARE"
     gene            477399..477887
                     /locus_tag="HMPREF0733_RS02110"
                     /old_locus_tag="HMPREF0733_10443"
     CDS             477399..477887
                     /locus_tag="HMPREF0733_RS02110"
                     /old_locus_tag="HMPREF0733_10443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005442.1"
                     /db_xref="GI:490103596"
                     /translation="MSTRAASAGAYTALGGVERAHGIPQRGSGEVTFRHTLASVGYTV
                     RVLFMVLPYVMTFFALLVSGDLTSDWSHILFHPMGQFILVYALGHIVANVCFNFRMGT
                     GLVRSVNALGAVLCVAVSPLWFRLLTSGNLALDALWTLTIVPLEFVACLTFYMHAVRR
                     DG"
     gene            478275..480092
                     /locus_tag="HMPREF0733_RS02115"
                     /old_locus_tag="HMPREF0733_10444"
     CDS             478275..480092
                     /locus_tag="HMPREF0733_RS02115"
                     /old_locus_tag="HMPREF0733_10444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397739.1"
                     /db_xref="GI:503163078"
                     /translation="MDDHRLNAESRIQSITEPPLLEPSKQRTARPIAWSILICAILCV
                     IAAIIIPFLTKQTTLSLVLYAIGGVLTVLALIVFTRRNRSSVATVAHKSVDIFGVTRA
                     ERESIYQQATAQLEDQQAKTRQKSLYTLLALVDKCLEDETLSYEDRNKEGQRIVNKIS
                     GYIQSPPIFDPHALELTHGAFHAKSALLREEAELRFGLMQQIRDRLRAPSDAGGYQDG
                     PWTNFEYDFSGSTFFYPIEFSRVFFNKTADFSGCTYRYEADFSGTIYRNWADFRGSTY
                     LAHANFSGSSYHGAASLNDSVYRSTADFSGNLYLDQANFSGSTYHEAVTFVNSTYRNW
                     AVFRNSTYLGAVDFSGSVYHNQANFHNSVYTGTVTFNSSVYHNQANFHNCVYTRVASF
                     GDCTYHRADFSGSVYTDDVHFNHCRYGGDVYFRRSVYNGWADFQGSVYSKWANYTSSL
                     YYGLAGFQNSTYADKALFRGSVYGNAVTFQGSVFTGAAPAFMNVEAWAQYISFFAPTE
                     NVFSLGQGYSIDTGASGLPSECPPLAVEHRQYLAHKNGELHEITQHLHGDDARSTDRL
                     GLTKELSGRLKSTVEELHAWREKITTIPLQEQDRQQVGV"
     gene            480273..481844
                     /locus_tag="HMPREF0733_RS02120"
     CDS             480273..481844
                     /locus_tag="HMPREF0733_RS02120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397740.1"
                     /db_xref="GI:503163079"
                     /translation="MKSKKQLYMEYQPEENPRLHKAWSWTKRWWLPIAIVLITSVGLV
                     CALSIPQKVFQTPANPDDKSASVLLAQSNLRLAFLYITGGAIAVLGLIETFRRNNNEK
                     LKNDQEKEKHDKEHRRQVRAERRERYTKAVEQLTHKEAPARIGGIYTLVGLVTEWLED
                     ENLSEYEKTREGQFIINNLCAYIRSPFALSSHYDELMQDKPTGSYQEKPDKFYSDKAT
                     LNAEKDVRLIIIKEIRDRLQKSTQEESGTWSNFEYNFSGSTFFYIVDFKGSYWNNLCN
                     MKNCTYLEDADFSGSKYTGLLYRKNCKYKKKVSFESSIYNQPKLENSQKYYFLSFEGS
                     VYEDTVTFKWSHYYVNVKFSSPESPSKYKNVADFTDSTYKEEVYLEYASYMSSALFYI
                     STYYSLASFANSIYHDQVDFSQSTYMNIVKYDHNIYIKSVDFSYSNYYYTPSFSTHYN
                     EGSLFSYLHLSSFMVSKNSNSLIVHPNESLPPNCRKISTKENTAYNYMRENSSLEELE
                     KWLRELQSAQNSNES"
     gene            482640..484170
                     /locus_tag="HMPREF0733_RS02125"
                     /pseudo
     CDS             482640..484170
                     /locus_tag="HMPREF0733_RS02125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888112.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="mucin"
     repeat_region   483317..483735
     gene            complement(484396..484956)
                     /locus_tag="HMPREF0733_RS02130"
                     /old_locus_tag="HMPREF0733_10448"
     CDS             complement(484396..484956)
                     /locus_tag="HMPREF0733_RS02130"
                     /old_locus_tag="HMPREF0733_10448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397743.1"
                     /db_xref="GI:503163082"
                     /translation="MPIYTSEEYPAVIERIKAKIAQKNIDLGPTVSEADIIAFERACN
                     TRLPQAYRLFLLEVGDGWNDPATEGISTSSIHRLAEIERKDLSLPMTLTDGWLWEVEE
                     DEEQLSDDSFEHKLGNQGVELMDEGCGMTYELITAGSCAGEVWSFSDVGVSPCCERQD
                     FLGWFELWLDSDGDPDYFKDYVYQEK"
     gene            complement(485182..486153)
                     /locus_tag="HMPREF0733_RS02135"
                     /old_locus_tag="HMPREF0733_10449"
     CDS             complement(485182..486153)
                     /locus_tag="HMPREF0733_RS02135"
                     /old_locus_tag="HMPREF0733_10449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolyphosphatase"
                     /protein_id="WP_013397744.1"
                     /db_xref="GI:503163083"
                     /translation="MRLGVLDVGSNTVHLLLLDGHPGARPEPYASHKIPLQLVQYLTP
                     SGDISDEGRAALTEFVKSARDFAIENNAEDLLAFATSAIREAGNGAEVLQHVRLKTGV
                     SLSEISGDQEAAITYFAVRRWQGWGAGRILNFDIGGGSFEFSTGTDALPDAAMSVPLG
                     AGRLTREFFDEQPPSPKQTKRLRRYVREQIEPVAQRLLAFGEPNMVVGTSKTFRSLAR
                     ICGAAPYSAGPHVKREMHVTDLRLWTRRMEAMAPAERADLPGVSRMRADQVLAGAMAA
                     EAAMETFGIETMRVSPWALREGLILRRLEHLAEGTSTPLDPKTLVGE"
     gene            complement(486730..489531)
                     /locus_tag="HMPREF0733_RS02140"
                     /old_locus_tag="HMPREF0733_10450"
     CDS             complement(486730..489531)
                     /locus_tag="HMPREF0733_RS02140"
                     /old_locus_tag="HMPREF0733_10450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="WP_041321546.1"
                     /db_xref="GI:752672837"
                     /translation="MPTKAKNGKALLIVESPSKVKTISGYLGNEFLVDSSMGHIRDLP
                     QPSELPENLKKGPVGKFAVNIDDDFDPYYVVNPDKKKKVAELKRKLKDVDALYLATDG
                     DREGEAIAWHLKEVLKPKVPVYRMTFPEITREAIERAFGELRDIDLHLVDAQETRRIL
                     DRIYGYEISPVLWRKVGRGLSAGRVQSVATRLVVERERERMAFVAANYWDLTGHFITT
                     SNEGFDAKLVAVDGTRVATGKDFADDGTLTSTKVTHLSEADARTLAEALTAAPFAVRS
                     VETKPYKRRPAAPFTTSTLQQEAARKLRFSSRVTMQVAQRLYESGYITYMRTDSVALS
                     DQAVKAARRQASELYGTEYVPSAPRTYASKSKNAQEAHEAIRPAGDKFRTPDAVRGTL
                     SNDEYRLYELIWKRTIASQMADATGSTASVRLGATASNGRDAEFAASGTVITFRGFLA
                     AYEEGVDATRLAERDAKNAEKRLPALAQGDSLTAEKLEATGHETLPPPRYTEASLVKT
                     LDELGIGRPSTYAAVISTIMDRGYVQVRSGSLVPSWTAFSVVRLLETSFGPYVNYEFT
                     AQMEEDLDRIARGEESRVEWLGDFYFGGGVQKKRGLKPIVDNLGDIDARDINSIRIAD
                     GIVLRVGKFGPYLEAEGTVNTETGEVSDPVRANVPTDLAPDELTAEKAKELLEQGKSD
                     GRVLGTDPASGNQIIARDGRYGPYVTEVIEEMTEEQIQAYLDAQPTEYYKNGKPKPKK
                     KPKPAKPRTASLFKSMDLATLTLEDALKLLSLPRVLGTDAEGNEITVQNGRFGPYLKK
                     GTDSRSIGSEEEIFTITLEQALDIYAQPKQRGRAAAKPPLAELGVDPNSEKNIVVKDG
                     RFGPYITDGVTNITVPRSETIESLTHERAVELLAEKRAKGPAKRKTAAKKTTAKKSTA
                     KKTTAKKSTTAKKTAAKKE"
     gene            complement(489748..490191)
                     /locus_tag="HMPREF0733_RS02145"
                     /old_locus_tag="HMPREF0733_10451"
     CDS             complement(489748..490191)
                     /locus_tag="HMPREF0733_RS02145"
                     /old_locus_tag="HMPREF0733_10451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="WP_013397746.1"
                     /db_xref="GI:503163085"
                     /translation="MTMQDTPDTTKKMSAEDCWAHLQANNLGRLVLTDGNFVDVLPVL
                     YGVADHEIYLRTTRGDRFSAVVMSRRVSFEIDEELENGIRSVIVQGVAHWLPPEMTPP
                     LVHTFGLRHYESGHLMQWVRIVPRKVYGREYPLLPAQGEGYFPYN"
     gene            complement(490282..492009)
                     /locus_tag="HMPREF0733_RS02150"
                     /old_locus_tag="HMPREF0733_10452"
     CDS             complement(490282..492009)
                     /locus_tag="HMPREF0733_RS02150"
                     /old_locus_tag="HMPREF0733_10452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_041321548.1"
                     /db_xref="GI:752672839"
                     /translation="MADELYSRIPDTPISDDTARLERIRGALERLNYSYDGVRELLGE
                     RAFEAMARDQVVPGTWRVQNILDDAHTTDPDRRLGRMIGFFLFARTLTRTELADALGG
                     EPALNDLIAAHLVEPAESDNARTPENPGEEPQYRAVFDLRPHSADDGTELWVASDLGA
                     HQRPGVLRKDHVLGIGQASLTLAQITERTPVARALDVGTGCGIQTFHLLAHADHVTAT
                     DISPRALAFARFNLLLNAPALKLDPQNLEARVSLRQGSLLDPVAGEQFDLVVSNPPFV
                     ITPRRADESSDDQFTYRDGGLPGDDIVSTLIRRIPEVLVPGGRAQMLGNWEIHRDNTG
                     EAQPWDARLRTWFAESATGTPSEAWVIQREVLTPESYAETWLKDASENRDRDHYENTY
                     RAYLDDFKNRNVHSIGFGMLWLRRRAHTTETAPLNRFEDITYPIAQPIAQSITEAVAR
                     FDRLTALTDQALAEAHLVLAEDVTEERHGRPGAEHPNVILLRAGSGLCRTILLSTETA
                     GFVSACDGELSIGQILGALAVLLGWEDYTPDARAAFGTENEHPRDTLLVAIRELIEKS
                     FLHFADENS"
     gene            complement(492128..493213)
                     /locus_tag="HMPREF0733_RS02155"
                     /old_locus_tag="HMPREF0733_10453"
     CDS             complement(492128..493213)
                     /locus_tag="HMPREF0733_RS02155"
                     /old_locus_tag="HMPREF0733_10453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkane 1-monooxygenase"
                     /protein_id="WP_041321549.1"
                     /db_xref="GI:752672840"
                     /translation="MTMNASDTQKTELAVQNLEPQPGTEKKLGFLSFGHWAEIPGSRV
                     NSASESLHQAIDLAVGAEDIGLDGAFFRVHHFDQQQATPYPLLSAIAAKTSRIELGTG
                     VIDMRYENPLYMAELAAMADLISAGRLQLGVSRGSPESVIRGFESFGYFPAEGEDESA
                     MARRHLDIFMKAIQGEGMAPSARVQGKYAPVQPQSPGLSKRIWWGAGTDSTAVWTAQQ
                     GLNLMSSTLMLEDKGVPFDQQQAEQIRLYREEWVKAGYTRVPRVSVSRSVIPIIDADS
                     ARYFGRRAQEDSQDYTGIIDNTFSRFGRSYIGEPDLIAEELARDAAVQAADTVLLTVP
                     NQLGVDFNLRMLESIVKDIKPALTVKA"
     gene            complement(493635..494126)
                     /locus_tag="HMPREF0733_RS02160"
                     /old_locus_tag="HMPREF0733_10454"
     CDS             complement(493635..494126)
                     /locus_tag="HMPREF0733_RS02160"
                     /old_locus_tag="HMPREF0733_10454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397749.1"
                     /db_xref="GI:503163088"
                     /translation="MLVATVVAEAMFWACLVLGCVFRYTLKMPRTGIVLLAATPVIDL
                     LLLVFSYITLSQSGAAEFMHGFAAFYIAFSIVFGRSIIHAFDRKFSGSASEGVAVSSA
                     QQLRKCVAACLIAAALLIAGIFVTGLKGSFWLVYWLIAVAFTPLMWWGVGKWYARKAS
                     KES"
     gene            494483..494950
                     /locus_tag="HMPREF0733_RS02165"
                     /old_locus_tag="HMPREF0733_10455"
     CDS             494483..494950
                     /locus_tag="HMPREF0733_RS02165"
                     /old_locus_tag="HMPREF0733_10455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine dimer DNA glycosylase"
                     /protein_id="WP_041321550.1"
                     /db_xref="GI:752672841"
                     /translation="MRIWSAHPSLLDRRALIACWRESLLAQKVLRGLTRGYTNHPQLI
                     RFRAHSQPVEAIGAYLHGLADEAHLRGYSFNRSLIATERGKNLRSSIPVTEGQLAYEL
                     SFLAHKVAGRDVDWEPILTERLAKFTQAGKPAVHPVFEVVPGEIEAWEKTKEF"
     gene            complement(494961..495467)
                     /locus_tag="HMPREF0733_RS02170"
                     /old_locus_tag="HMPREF0733_10456"
     CDS             complement(494961..495467)
                     /locus_tag="HMPREF0733_RS02170"
                     /old_locus_tag="HMPREF0733_10456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013397751.1"
                     /db_xref="GI:503163090"
                     /translation="MSESVQAPVTVSPARIEKHGSLLVAGVSQVYKLGDDFTPLWDEL
                     NQKASPAMLDILAVTQYIGVCTQPSTDGFVRYTAGILVDDRASAHKLGLGLLDLPEST
                     YAVVEITGPISRSIPAGFESFEREFFPSHPQYRPLGGLEVYGRGDMQAADYTMELWVP
                     LLEVPASA"
     gene            complement(495464..496378)
                     /locus_tag="HMPREF0733_RS02175"
                     /old_locus_tag="HMPREF0733_10457"
     CDS             complement(495464..496378)
                     /locus_tag="HMPREF0733_RS02175"
                     /old_locus_tag="HMPREF0733_10457"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397752.1"
                     /db_xref="GI:503163091"
                     /translation="MAQNRIILYYQFAPITDPVAVMLWQRALCEKLGLRGRILISKHG
                     INGTLGGEISAVKAYTKETRQYPGFKNMEFKWSEGGAEDFPRLSVKARDEIVAFGAPD
                     ELKVDENGVVGGGVHLKPEEVNKLVEERGDEVVFFDGRNAFEAKIGKFKNAVVPDVRT
                     THDFIREIESGKYDDLKDKPVVTYCTGGIRCEILSALMKNRGFKEIYQIDGGIVRYGE
                     KYGDKSLWEGSLYVFDKRMHMEFTPDTVTIGQCERCSAPSNKFENCSNESCRELVLLC
                     PECATDDAKRRCVPECAVDRQSAHAGIS"
     gene            complement(496383..496604)
                     /locus_tag="HMPREF0733_RS02180"
                     /old_locus_tag="HMPREF0733_10458"
     CDS             complement(496383..496604)
                     /locus_tag="HMPREF0733_RS02180"
                     /old_locus_tag="HMPREF0733_10458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397753.1"
                     /db_xref="GI:503163092"
                     /translation="MFRSPRQIGIRYQKTAKPAGAMGQKNDETYLMVKKPHAIHHRGR
                     IPRENRDYRPRYGTSSAATAHTMYPESVK"
     gene            496768..499293
                     /locus_tag="HMPREF0733_RS02185"
                     /old_locus_tag="HMPREF0733_10459"
     CDS             496768..499293
                     /locus_tag="HMPREF0733_RS02185"
                     /old_locus_tag="HMPREF0733_10459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_041321858.1"
                     /db_xref="GI:752673149"
                     /translation="MPKLPGDGSLPPQITHVHRIPAREGQYSPWPHWLHPRVIEAFES
                     LGVHKPYTHQVQAAQAAHCAFDAALAEDAHRLSFGRASGQGHDESGTTARHVIVATGT
                     ASGKSLSYLMPAFDALYRGAHREPLSTTAADTSSTGFHQRANVLYISPARALSADQLN
                     AITAYHLPGLNAATYDGDTPAQERRWVREHANFVLTTPDMLNYGILGNHRQWANFLRG
                     LRYVVLDEVHSYRGVFGAHIANLLRRLRRVCALYRVSPVFYGASATSANPAESFAKLI
                     GVPEGNVDAITTSTAPRGESTVILWEPEFLPDTQVTDKLAVGASAFDTRSEAEKQAPQ
                     RISAIEQGAQMLTDLVLSRTRTLAFTRSRRGAELISQRAQRYLDETEAGLAHRVAAYR
                     SGYMPEERRELEHRLRTGELLGLASTSALELGIDISGLDAVLVAGWPGTRASFIQRIG
                     RAGRGGQDALAVLIAGDDPLDTYLVHHPQAIFGQSVEATVFDPTNPYVLSPHLCAAAA
                     ESPLRAEELSLFGEHTEALLNRLVQQNYLRRRADGWYWTHAESATNLVDLRATGGGPY
                     QLIDAEDGSLIGTMDSAQAMTQGHPGAIYIHQNAQYLVESLDEAARVILLSRVYPDYY
                     TRAIEATEVKILQEKAGVRYGFDGTQPDTAGLTLHRGRVQVTDQVMGFQRFSVYGSEY
                     LGDEPMEMPPSILMTEAIWFTFEPSYLFAAGVAEPDAPGTLHAAEHAAIGLLPLIATC
                     DRWDLGGLSTLYHADTERPTIFVYDAAPGGAGFTQRGFEAVRTWLGATLDAIDSCGCE
                     SGCPSCVQSPKCGNRNEPLSKAGAQNLLRAILHSLDEAERDML"
     gene            complement(499894..500316)
                     /locus_tag="HMPREF0733_RS02190"
                     /old_locus_tag="HMPREF0733_10460"
     CDS             complement(499894..500316)
                     /locus_tag="HMPREF0733_RS02190"
                     /old_locus_tag="HMPREF0733_10460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397755.1"
                     /db_xref="GI:503163094"
                     /translation="MRLIHRMIRAWRLRARDEGAVTAEFAVALPAVIAVLALCLSAAA
                     VGMAQSRLEESSRVAARAFARGDNLAAVQHEVSRIDPSINLQVQTVEETSGARQVRVQ
                     VERAAPGVIGSVTGWKLQATATARVEGSSDNATTAGGE"
     gene            complement(500377..500886)
                     /locus_tag="HMPREF0733_RS02195"
                     /old_locus_tag="HMPREF0733_10461"
     CDS             complement(500377..500886)
                     /locus_tag="HMPREF0733_RS02195"
                     /old_locus_tag="HMPREF0733_10461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397756.1"
                     /db_xref="GI:503163095"
                     /translation="MTVVHSSLALHTAHRSTQECLEAYARTEENPVLLGQALDEYTNM
                     YLQRLEPHLAQQLAQALAAGCTLNKCAAECRSLSEHEELFAEIRTDEAAELHEMTLPT
                     DEVEYADENDPEEGASTAEYGIVMLAAVGFAGLLVAILKSDEIRGMLVDMVKNALATG
                     GSGLTFGLF"
     gene            complement(500971..502395)
                     /locus_tag="HMPREF0733_RS02200"
                     /old_locus_tag="HMPREF0733_10462"
     CDS             complement(500971..502395)
                     /locus_tag="HMPREF0733_RS02200"
                     /old_locus_tag="HMPREF0733_10462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion protein F"
                     /protein_id="WP_013397757.1"
                     /db_xref="GI:503163096"
                     /translation="MSLMVDHKTHAAGSSQRTARKNAGDSMAFGEYLPATTQPRLRTR
                     FQRLIPPTPPTSTEMRLWPQALRGISATLDAGLSLREATAENRTRHPPDAGDLTVHGS
                     AAQSWQTGNTDGNEPEKSSLLRRALHRLTGSRGERAYRQTQDDIDELLDTLAREEQLG
                     FAAGTTLGALNARRAHSRERIRELGLCLRMNETTGAPLAQTLRAAAEHAEEHLDALLG
                     RESALTGPKTTGKILSWLPFIGLAMGWLMGTDPVGALTGSLAGLLTGFFGITLALLGR
                     RWTARLVHRAERSSVLAEDPAPKNARAQATRRRRREKKPPKEPAGFSGSAETEPLDPA
                     LMLELLAAQLRAGLGLTGALQALGRALAHEERAISDALEHITLTLTVSADWQAAWDGY
                     DHPLLRELARILAPAYSAGTPSSALLRHCAATYRLEERRAAERASAKLAVALVLPLGL
                     CSLPAFICCGIIPIVISLLPGLLA"
     gene            complement(502392..504182)
                     /locus_tag="HMPREF0733_RS02205"
     CDS             complement(502392..504182)
                     /locus_tag="HMPREF0733_RS02205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II/IV secretion system protein"
                     /protein_id="WP_013397758.1"
                     /db_xref="GI:503163097"
                     /translation="MAALPPPPQAVFRTGTAEHGVFRAFSRGADSAYRSGSAETVGAD
                     VAPEQTDFVACGNYAPPETLSIVGTCMPPQELMAPDFSAETRERLGLTPIPVFEDHHA
                     RRIARHALTYLLARPPSPHTETVHASPAASADGENPRLWSSKDLTLAVQQACEEDMYG
                     DENHEFPVEHEPDLVSRALSCLHAELYGLGALETLTHIPGITDIYVNSPQDVWVQAHG
                     QTQPVTLTFETEAQVRQLANRLIRAHGGRLDAAHPADDVHDDSGRRIHAVIPPLVENT
                     HLSIRLPAQSCLTLTALRESGMFDAATEQALRTMIAHRQNFVVSGGTGTGKTTLLNAL
                     LGECEAWERLMILEDTPELNPQHPHTVSLKTRAANAEGAGEITLGDLLVQALRMAPDR
                     LMVGECRGSEILHLLNAMNTGHQGAGTTLHANSAFAVPHRLAALGALAGLDERTVALH
                     ASTAFDRIIHLEQVQGMRRIAGIYRLDLRQDALVVTLCEPAGELLADGGSTADNSAGG
                     ALPEETGENLPPSSPTDAISPGTHAAHESSTVVQPAHEHRGAHPETPTAPTACTYGYD
                     PGVRTDSDVPPYTTAPREQTDRSSQGGEEL"
     gene            complement(504518..507001)
                     /locus_tag="HMPREF0733_RS02210"
                     /old_locus_tag="HMPREF0733_10464"
     CDS             complement(504518..507001)
                     /locus_tag="HMPREF0733_RS02210"
                     /old_locus_tag="HMPREF0733_10464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate water dikinase"
                     /protein_id="WP_013397759.1"
                     /db_xref="GI:503163098"
                     /translation="MTTPHEQETTAFISWFRRGHPSGDAQVVSVGGKGANLITMHRAG
                     LNVPPGFCVTTDAYRAAVAPIAEDIIHEATGTNSHAARELILKQEVPRAVRDAVIEAY
                     RALGSPVVAVRSSATTEDLDSASFAGQQDTYLGVQGEESVVDALRRCWASLWTDRAVA
                     YRTEAGFSHESAELAVVVQEMVAADVAGVLFTADPISGMTDRMLVSASYGLGESVVAA
                     HVNPDTFTLDSQGHAVETIIGDKETRIDLDHTGGTKRSPVPPNDRAASCLSDSDLRRL
                     HALGRQVSAYYNAPQDIEWGICGDELYLLQTRPITSLSNLSNTDSGHGPAQSKILQMM
                     RDDLIEHYPAPYPLDIMPVRKVQQEVQQVLGSFGVDTPPVDRVIRISDDGIASVHATW
                     PRVSPRIVTHLPRTIRQAFSSVNPDWDADSLDWKHELEAFQADNRTLESITDRDLIAR
                     SHRAVDAAAELTRARFSRYLMPLMFKRAEADVMIKIARLGPSITTEDLFANLDFVTAH
                     IDREISRLCERARELGLDDVLVETDNAVESLSKHANGPTFLEEVQQTLSRIGARTPRM
                     YLPYSSRSWGENPEAFFTLIAAGIRGRHTMDADRADKRQLVRSRLPRFLHKRWDKTVT
                     ALRALHVAREGSLYLIEEWFVEARRVMDEIAHRLVERSILANPSDVTYALFDEVESAL
                     LAEEPSSDLQQRISHRKQKRTTAETLWWDRGNHRSETDGIKGVGASPGVTMGTARVIH
                     GPEEFGLLEPGEILVCRYTDPTWTPLFNVAAAVVADTGGPLSHAAIVAREVGIPAVLG
                     TQSGTQDIVSGQTIRVDGNTGLVTPVESE"
     gene            507202..509154
                     /locus_tag="HMPREF0733_RS02215"
                     /old_locus_tag="HMPREF0733_10465"
     CDS             507202..509154
                     /locus_tag="HMPREF0733_RS02215"
                     /old_locus_tag="HMPREF0733_10465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed DNA polymerase"
                     /protein_id="WP_013397760.1"
                     /db_xref="GI:503163099"
                     /translation="MYILVVPLDAPASGSVIPLDAHPARAHTGTGTSGLGSPSSPAFW
                     GVFHVESLAPAQLSGPHTKLNILRADRVSTGNLPAYVREVERRSDPRINPESKQPHAR
                     WIWADTRTIAPILLRKGVRVQLCHDMRLVQRILRTASTHPSGHVRYDPVLDLAQDTVE
                     KPAGKLPVARQIAGQGELFGDDFLTAAEENTVSGHEAAPPTLTSADTELVHQHLDEFT
                     AQLRAIATGAHPERLRLLAAAESAGSLVAAEIEYYGIPFDTAAHDAHLTEILGPRPPE
                     GEHPAKLMELAEQIRADLFAPHLNPDSPQELLRALHAAGVNVPSTRSYVLKGWAEETA
                     TQRERRWALIEPILRYKKLYRIFTANGWSWADSWVRNGRFRPHLEVGGAATGRWGASG
                     GGALQLPAEIRSAILAPEGEVFLVSDGSQIEPRILAALSHDEALASAGRGTDMYAGIA
                     ELARLEGVALTERAQAKVGLLAIMYGGRSGEIGALLPHVAKLFPRAMEFTERAARIGE
                     VGGQVTTFLGRTSPAPDERFKRTVADRSTPAAESRAVSLSRSYGRMTRNFVVQGTAAE
                     WALCWMGRVRSRLLTETVFGMPMRTKIVYFLHDELLLCGPKLEAERVERILRESAAEA
                     ARLLFGTVPVEFPVSVTVTTNYAEGK"
     gene            complement(509220..509987)
                     /locus_tag="HMPREF0733_RS02220"
                     /old_locus_tag="HMPREF0733_10466"
     CDS             complement(509220..509987)
                     /locus_tag="HMPREF0733_RS02220"
                     /old_locus_tag="HMPREF0733_10466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_013397761.1"
                     /db_xref="GI:503163100"
                     /translation="MPNTLNTAAEQARDALANLAAGKLDFKIESLMRYAPTSTLSKEA
                     AVLVLFGVLDDEPSASADFDGCPDCVGENLDVLLLVRADTLRSHAGQPAFPGGKIDPE
                     DYELARQQGVPVGRIAALREAVEETGLDPAGVEILGELPTLPLAVSDFRVTPVLGWWA
                     SPTRVGVVDTNESALIARVPVRDLLNPANRHTAYVKRGRITHKTPAFEVVHSGGDARV
                     EFTVWGFTAIVLDKIFDALTWTVPWDASVLKPAPVSG"
     gene            complement(509980..510906)
                     /locus_tag="HMPREF0733_RS02225"
                     /old_locus_tag="HMPREF0733_10467"
     CDS             complement(509980..510906)
                     /locus_tag="HMPREF0733_RS02225"
                     /old_locus_tag="HMPREF0733_10467"
                     /EC_number="4.2.99.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease III"
                     /protein_id="WP_013397762.1"
                     /db_xref="GI:503163101"
                     /translation="MSASAPKSTTDTAPELQLTEEERELLSIRTVPEFEAAQAARRRA
                     KALAKAPESHLATVRRARKINRILGETYPYAVAELDFTNAFELLIATVLSAQTTDVRV
                     NQVTPALFARYPDAPALAAATEEEVEPYIQSLGFYRAKAKSIVKLARQLTDDYDGEVP
                     GTLDKLVKLAGVGRKTANVVLGNAFGVPGLTVDTHFGRLARRMGFTTEDDPVKVEHDV
                     AELIEPREWTDFSHRMVYHGRRICHARKPASGVCPIADLCPSWGEGETDETKARKLMK
                     YEMAPGRERLHLRFLTGATRRQLHAEGYPLSA"
     gene            511018..511461
                     /locus_tag="HMPREF0733_RS02230"
                     /old_locus_tag="HMPREF0733_10468"
     CDS             511018..511461
                     /locus_tag="HMPREF0733_RS02230"
                     /old_locus_tag="HMPREF0733_10468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="WP_004005487.1"
                     /db_xref="GI:490103641"
                     /translation="MSATIFVLNGPNLNLLGQRRPEVYGYTTLHDIELMVRERAALHG
                     FDIEFMQSNHEGVLVDEIQRARTRGAAIIINPAAYTHTSVALHDALEAAELPVVEVHL
                     SNVHRREEFRHHSYVSPQATAVIAGAGAYGYVMAVDFLAQHLESE"
     gene            511595..512347
                     /locus_tag="HMPREF0733_RS02235"
                     /old_locus_tag="HMPREF0733_10469"
     CDS             511595..512347
                     /locus_tag="HMPREF0733_RS02235"
                     /old_locus_tag="HMPREF0733_10469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate sugar epimerase"
                     /protein_id="WP_013397763.1"
                     /db_xref="GI:503163102"
                     /translation="MKIALVGATGTAGRATAHAAQQAGHEVIALSRATGIDLHTGEGL
                     AEALNGTQVVIDTSNAFPADPAASLVDTFSDVTKTLEKACQHAGVQHLVHLSICNIDH
                     PAFDDFDYYLAKRAQEKVLEDSSLPHSIVRSAQWMEFALNPAAVTQTETNVKVQNWLI
                     QPIAVETVAKVLVQTATESPRNRQIAGPEQIWLPELTQTYLHAIGDRREVSVVDPVLD
                     ALAEGVLLAPKNAELLGPTVAQWAEDQTPTNR"
     gene            complement(512541..513734)
                     /locus_tag="HMPREF0733_RS02240"
                     /old_locus_tag="HMPREF0733_10470"
     CDS             complement(512541..513734)
                     /locus_tag="HMPREF0733_RS02240"
                     /old_locus_tag="HMPREF0733_10470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin V production protein"
                     /protein_id="WP_004005488.1"
                     /db_xref="GI:490103642"
                     /translation="MSATFSPLDIIIPVILVLYFIAGLRSGFFTTLGTFIGLALGVCA
                     AAWLIPLAVAAVGSKWGLITAIGILILCLTLGQWLGLIGGRSLRRVTDITPLKGVERF
                     FGGVLNVAACALVLVVLTLTMRTVPLPQFNAALNNSKTLSWMVENTPDGLRNGIENIR
                     NDVLASGTIPEVRQLIAPETSAPTQGVETEALNNASASVVQILGAAEQCGYTSTGSGF
                     VVDHGLIATNAHVLSGVNSPMVRDQRGRTWQGEVVYMDTAQDLAFIRVPGMNLDPLPI
                     GRNANPGETVTFMGYPQGGPFKALPATVQGVGNTQTIDVETGKPNPMRQVYQLAADVQ
                     HGNSGGPVLDENGNVVGVVFGKAPDGESSTGQTGYAITASTLKQALEAGGSNTASVAT
                     GTCKN"
     gene            514106..514783
                     /locus_tag="HMPREF0733_RS02245"
                     /old_locus_tag="HMPREF0733_10471"
     CDS             514106..514783
                     /locus_tag="HMPREF0733_RS02245"
                     /old_locus_tag="HMPREF0733_10471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005504653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_004005489.1"
                     /db_xref="GI:490103643"
                     /translation="MDLDILRRSPLFATLDDAAFKLLTDDIQEIDLSRNAVLFYEGDQ
                     GDQLFAVLSGKVKLGRTAADGRENMVALMGPGDVFGEMALFDPSPRSTNAVAVSETRL
                     AAIKHESFKRAQRQDPSISDQVIKTLARRLRHSNEALADLVFSDVPGRLAKALLDLAD
                     RFGRPATDGILVAHELTQEELAQLVGASRETVNKALAEFVSRGWIRLEARAVVILDLP
                     RLRQRSR"
     gene            complement(515213..515848)
                     /locus_tag="HMPREF0733_RS02250"
                     /old_locus_tag="HMPREF0733_10472"
     CDS             complement(515213..515848)
                     /locus_tag="HMPREF0733_RS02250"
                     /old_locus_tag="HMPREF0733_10472"
                     /EC_number="1.5.1.30"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-flavin reductase"
                     /protein_id="WP_013397764.1"
                     /db_xref="GI:503163103"
                     /translation="MKILVSGATGNVGHLVVEQALARGHEVVALARNPQNLQLEHPNL
                     TTGAVDILDAQVLKPWLQGVDAVISTVGIGTSKTPTTLYSAGTKNLLDAMQEHGVSRL
                     VVISSEVAEHWAHQGLFKLWVVLPLLQHFLGATYDDMRRMDVVLWESTAQWTAVRAPR
                     IQPMKAKGSYRLDAHKPLRRGWMITPADMATALLDIAEREDLNRQHVYVAN"
     gene            complement(515864..516862)
                     /locus_tag="HMPREF0733_RS02255"
                     /old_locus_tag="HMPREF0733_10473"
     CDS             complement(515864..516862)
                     /locus_tag="HMPREF0733_RS02255"
                     /old_locus_tag="HMPREF0733_10473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_013397765.1"
                     /db_xref="GI:503163104"
                     /translation="MIRKIQYNAYGDPSVLEMVESDEPTPGEGEVRVTVKAVGLNPID
                     LKTFEGYKPLRVAETSNRLRHPSWWFGRGPARFPKGVGRDFSGVIDALGPGVNNVAVG
                     DTVLGTLRSTPGSGVTKGSLAEKLVTSAQNIVAKPENLNFEVAAALGVAGESACGAFR
                     AIDLKPEDVLVISAASGGVGAVAVQLAVHRGATVIGIASEKNAEFVRSLGAIPVAYGD
                     GLKERILKAAPTPVTKMLDCYGGDYIPLGAELGLKGSAMGTLIPTPKAMIKGAQFTGA
                     RHAQPGDLKEVADLVASGDIDVTLAHVYPFKLESIRDGYKELGTGHVRGKLVVTIP"
     gene            complement(516946..518007)
                     /locus_tag="HMPREF0733_RS02260"
                     /old_locus_tag="HMPREF0733_10474"
     CDS             complement(516946..518007)
                     /locus_tag="HMPREF0733_RS02260"
                     /old_locus_tag="HMPREF0733_10474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_013397766.1"
                     /db_xref="GI:503163105"
                     /translation="MTTTPSQKLYTGVVPVVGEERKPRIFTGRSSAPAARTEQIQRLY
                     KIPEFMRTAAETWASEGGEDAGACSLRQAASVIFVRDGEDGLETILTYRPGSSPLGVV
                     AFPGGTVTPGDDDATPWYGPTPDEWSAKFKFKNVTCARRTVIAAIRESFEETGLLLAG
                     EDGQNVAESGAGEEQMSQREAIADQDKSFGQFLTSSGLKLRTDLLRPVSRWQSPDFFH
                     KRYDIAYFTTVVPVGQNAKLLEGKGVWGSWVNVRTLMESRDTSELGDRIGQPNTVGKT
                     LEELVTPAVMCMLESLAASETGVSWLAKRRTVEVKKPVLVKNDGACMLSFTEVVPVSS
                     KTGTLGTVGPLKSASVATS"
     gene            complement(518021..518503)
                     /locus_tag="HMPREF0733_RS02265"
                     /old_locus_tag="HMPREF0733_10475"
     CDS             complement(518021..518503)
                     /locus_tag="HMPREF0733_RS02265"
                     /old_locus_tag="HMPREF0733_10475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP family protein"
                     /protein_id="WP_013397767.1"
                     /db_xref="GI:503163106"
                     /translation="MTESRYELSIRELGYQLPEVAAPVAAYVPAVVSGNYVYTSGQLP
                     FVSGQLPATGKVSDSGDSTFVTPQDAKKYAAIAVLNALAAVKSVIGDLDRVKKVVKVV
                     GFVASDPEFTGQPGVINGASELLGEIFGEAGTHARSAVGVPVLPLDSPVEVEIIVEYV
                     "
     gene            complement(518633..518839)
                     /locus_tag="HMPREF0733_RS02270"
                     /old_locus_tag="HMPREF0733_10476"
     CDS             complement(518633..518839)
                     /locus_tag="HMPREF0733_RS02270"
                     /old_locus_tag="HMPREF0733_10476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005495.1"
                     /db_xref="GI:490103649"
                     /translation="MKKWEYLTVPLIVHTTKAILDNYGEEGWELVAVLPGAPAPSGPN
                     PAGNMVAPTQGNPIAYLKREKVEG"
     gene            519159..521309
                     /locus_tag="HMPREF0733_RS02275"
                     /old_locus_tag="HMPREF0733_10478"
     CDS             519159..521309
                     /locus_tag="HMPREF0733_RS02275"
                     /old_locus_tag="HMPREF0733_10478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="WP_013397769.1"
                     /db_xref="GI:503163108"
                     /translation="MASRKKSRAQRRRPSDFLQFVAFSIIAGFLVAIIVVPPAVGVGM
                     VANASMAWFQDLPEDISEGPFSRPSTLYASDGKTELATFFEENRTEVKLDQMSPHMRN
                     AIISVEDRDFYNHGAVSAIGIGRAFANNFLNPKKRQGASTLTQQYVNNLIVDSDVQRG
                     ADPTTLGGNKGYLDKIKEMKLAISMEQNKSKDEILEGYLNIVNLGGTNYGVEAAAQYY
                     WGISAKDLSVAQSALLAGLVQSPNTYDPTTHPDLARERRDVVLGTMLRDGKISQQEYD
                     EAIASPIKLNVHPPEKGCSVAGESSFFCNYVVNYVALDESFGATPEERLNLLNRGGFK
                     LVSTLNPEAQKIAKQSVEAVQPGSTNTNNVNAALTSVEPGSGRVVAMAQNAEWGKPKD
                     ANDHSQTQFNFNVDSLYGGTPGFQPGSTFKPVVLSQWINSGRGVNAQIDGTALSYPSN
                     FGWNARCVEGGKYYYRDSANGWSFKNAVQGYQSWGTVAYGIRVSANSYLYSMVSKLDL
                     CDISDMANKLHLHDGLGQQLYDPGLLSANIGGTRYGATPLTMASAYATFASEGKYCEP
                     RPLEKITKSDGSPMKTYESKCEQAISPDIANGVSYVLKGVLASGGSAPKRAIGLPDAS
                     AAKTGTNDNSSQTWMVGYTRGLATASWVGSNDLGYRSMNGIAINGRVLEYVDGATYAG
                     AQWQQFMQAMAPKYNTEKFTEPPASVTSTNVNGN"
     gene            521336..522316
                     /locus_tag="HMPREF0733_RS02280"
                     /old_locus_tag="HMPREF0733_10479"
     CDS             521336..522316
                     /locus_tag="HMPREF0733_RS02280"
                     /old_locus_tag="HMPREF0733_10479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_013397770.1"
                     /db_xref="GI:503163109"
                     /translation="MCENASGARASVAASEAARGSHFTQGMVKFAAAGLALGAATAAY
                     GRFVELNNFQVREETLAVLPVGSPNFRILHISDMHMIPGQRAKTEFMHSLAGLNPDLV
                     VNTGDNLSHVGGLDPLLEALDPLLDFPGVFVPGSNCYFAPVLKNPARYLWQARTPQEI
                     EEGSRMPLPIERMHNAFESRGWTGLINRYDGITLSRLRLEFSGVDDPHLRYDAHPGFS
                     PQAFEPSDVPSIRVGVAHAPYMRTLHRFVQDGAELILAGHTHGGQVCLPGGRALVSNC
                     DLPPSRAKGVSYQGNVPVQVSAGLGTSRFAPVRLFCPPEAVLVTLTAKDG"
     gene            522467..523165
                     /locus_tag="HMPREF0733_RS02285"
                     /old_locus_tag="HMPREF0733_10480"
     CDS             522467..523165
                     /locus_tag="HMPREF0733_RS02285"
                     /old_locus_tag="HMPREF0733_10480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_013397771.1"
                     /db_xref="GI:503163110"
                     /translation="MRYNDYQQPIGDALPDYRAGDTPSIDSLQGRYCRLEKLDAERHG
                     NDLYEVYGPEAPEQSFTYLSLNPVADRAELETLLKRMEESTDPYYLAVIDQDGRAVGT
                     LALMRINPAHRVIEVGSVTYGERLKRTRAATEVQYLLAQYVFETLRYRRYEWKCDALN
                     EPSRRAAERLGFTYEGTFRQAVVYKGRNRDTAWYSMLDTEWEQRKHRLLQWLDPKNFD
                     AHGQQRTSLRDIAL"
     gene            523256..523804
                     /locus_tag="HMPREF0733_RS02290"
                     /old_locus_tag="HMPREF0733_10481"
     CDS             523256..523804
                     /locus_tag="HMPREF0733_RS02290"
                     /old_locus_tag="HMPREF0733_10481"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H oxidoreductase"
                     /protein_id="WP_013397772.1"
                     /db_xref="GI:503163111"
                     /translation="MKTLVIVTHPSIHDSMVSKTWVHMLRQHPDRFTVHELYSEYPDG
                     VIDVEREQALVEEHQNIVLQFPVYWFNCPPLLKQWCDEVLTYGWAYGSKGKAFENKKL
                     GIAVSLGAPAPEYSAEGSVGYTVAETLRPFELTANYISADYQPLFAFHTIDTYESYDE
                     AAAQQVADSADDYLAHLNTYYA"
     gene            524081..526198
                     /locus_tag="HMPREF0733_RS02295"
                     /old_locus_tag="HMPREF0733_10482"
     CDS             524081..526198
                     /locus_tag="HMPREF0733_RS02295"
                     /old_locus_tag="HMPREF0733_10482"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013397773.1"
                     /db_xref="GI:503163112"
                     /translation="MNYDAGERAPLKFLPYIAPIRWRWAIGMLVAIGAAILEISIPQM
                     LRFIVDELVQNTTEAGVWIGGGLVLLIGVGNASLAYWRRWLIVDPTSTLEIRMRMNFF
                     DRILRAPLSVLDRWSSGQLLTRSMSDLSTIRRWLSFALVQMTSVVVMFVTGGYFMVTA
                     SAPLAVIFVVAIPVLVLSFISYVRKYEAYTREIQRLTSDLSTRIEESVRGIRVVKALG
                     RSPEQITEYTRDAEHLNEVEHRRAMLVARVGFYQRVIVGAVTMLALLVGAPQVASGSL
                     SLGAMTAYFAVLTVVLGHVLRSTALMASYLNYRVAFERHVEVMADPGDEQVRLVEEET
                     VAYPSGGAISVACEAVSFSYAEQASAVDATDSDAEARAHEDSAENQARTADVSEEHSG
                     QDEASTDHAEQSGLGGFLAKILGFAKDSQDHQDSAGSAQEADPDPAAFPELQADMQEP
                     SPEPTEQEREFARAQQKAATSKTPSVLHDITFKAFAGEILALVGATGSGKSTILNLIP
                     RFYEPSSGKILLGGRDAADMPLPEVRAQMASVFEEAVLFSGSVRENILLGVHDLSSSE
                     EADQRVRAALTIAACDFVDDLPEGVNTIIGEEGLSLSGGQRQRLSLARALAVRPSVLL
                     LDDPFSALDVHTEEKIIEALRTGHEGLGGATTLLTAHRPSTVALADRVLLLEDGRITA
                     QGTHTELMKLPQYRRLMSLQDED"
     gene            526198..528072
                     /locus_tag="HMPREF0733_RS02300"
                     /old_locus_tag="HMPREF0733_10483"
     CDS             526198..528072
                     /locus_tag="HMPREF0733_RS02300"
                     /old_locus_tag="HMPREF0733_10483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013397774.1"
                     /db_xref="GI:503163113"
                     /translation="MPTRLVPNSDERTNLTPEERRQARERSYRLLREILRPHRLSLAI
                     SVAAVILGAIASAVQPWLIARVLDTAIEPLTRGDSAPLIFFVVLFGATVLANGTLTWV
                     NVVYTVKVSLGVLLSLRTRVFQHSQSLSVSFHESYTSGRVISRLTSDIDTIRTFLDSG
                     ISQLATTLLGIAFSVIAIFLLDWRIGLLLVAMTIPIWLITRWFRTRSETAFRAMRNES
                     AQLTSRFVETYTGIRAIKGFGAEADARASYARNAERYRVAVMDSIKLFGIYSPVLILL
                     GNIFVAAALVIGGYAVLGGTMQVGTLLALIIYANRVFEPIMTLSEFYNVLQSAFSALE
                     KVSGFLAEKPQIQDPQHPVSLPQSPATPVGTESSVEAAPLGEIVLEDAAFGYTAGQHA
                     LMPTSLRIAPGQTVALVGETGAGKSTIAKLFARFYDVDTGRVLLDGVDVRSLTDQELR
                     RNVVMLTQEVFLFSTSIAENIRLGNPQATDDQVRRAAQAVGADEFIQTLPQGYGTMLG
                     RGGVNLSTGQRQLVSFARVFLANPRVLILDEATASLDIPSERAVQRALNALLAGRTAV
                     VIAHRLSTVLSADRVLVVSAGSIVEDGSPQELIAAGGEFAAMYTSWEDARQDSSSPST
                     "
     gene            528244..529074
                     /locus_tag="HMPREF0733_RS02305"
                     /old_locus_tag="HMPREF0733_10484"
     CDS             528244..529074
                     /locus_tag="HMPREF0733_RS02305"
                     /old_locus_tag="HMPREF0733_10484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_013397775.1"
                     /db_xref="GI:503163114"
                     /translation="MEENMSRNDARKFLAQGTASALTLALGLTFAAQPAFAETAKAAD
                     PAPSASAAPSAPAAATNPGLSVDPTPAAPVVAPAPSDGPSPEAPAPAPSEKPAAVVFK
                     DVPQTHMFYQEITWLGETGISMGWPDGTFRPSQNIERAAIAAYFYRMAGSPDVVLPKQ
                     SPFTDVAPSDPFYKEIVWMHQQHITTGWSDGTFRPHDSVTREALAAFFYRAANMNDDA
                     APAQDPFTDVTSANPFYREIAWFKAQKITTGWPDGTFRPHEPVTREATAAFVFRFAKI
                     "
     gene            529313..529389
                     /locus_tag="HMPREF0733_RS02310"
                     /old_locus_tag="HMPREF0733_t10007"
     tRNA            529313..529389
                     /locus_tag="HMPREF0733_RS02310"
                     /old_locus_tag="HMPREF0733_t10007"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:529347..529349,aa:Pro,seq:cgg)
     gene            complement(529474..529959)
                     /locus_tag="HMPREF0733_RS02315"
                     /old_locus_tag="HMPREF0733_10485"
     CDS             complement(529474..529959)
                     /locus_tag="HMPREF0733_RS02315"
                     /old_locus_tag="HMPREF0733_10485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NTP pyrophosphohydrolase"
                     /protein_id="WP_013397776.1"
                     /db_xref="GI:503163115"
                     /translation="MTYFAYRVVGKTEYNGFDVPQTPQSFADDTEQRLTDPDFLEGDK
                     RFALVVWALPEGVNHVDDVPQDSVAHGNYIQCAGSTRAMTVEIRVTAEDGSYEQYTVA
                     RKPVTDPDAWTAITWVGNRMPVQVHPEEVFTGEQAASIFRAYIEDGVIPPRELLRTLD
                     I"
     gene            complement(530049..531122)
                     /locus_tag="HMPREF0733_RS02320"
                     /old_locus_tag="HMPREF0733_10486"
     CDS             complement(530049..531122)
                     /locus_tag="HMPREF0733_RS02320"
                     /old_locus_tag="HMPREF0733_10486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397777.1"
                     /db_xref="GI:503163116"
                     /translation="MLPETNTRRDTGLDSARAFALLLMLIPVSVSLNLVPGKHMSWLS
                     QVLPQALNLFTVILGAAAYLYSRKVAFPQFFASSIVRFLAFCVLGWILAQLPHSTFAD
                     QAFSGWKDFPIRFDMLLPLAVLTLLSIGLVYMPFWVQLAVTVLASPAVPFTYERLSVG
                     GWTADDWLHRTIPAIVNESAGTMFQDGFKLIWLMGLGMVLWRGYEKLGARLGTPVALG
                     SLAVSIYLWVYPHAQLGPLTWPIILTIVGVAGTICTWGEFARLSAGKGVLEPFARLGR
                     MSLSASIVMLGLAFYGGGRLVTMVAGEGYRAPQQGSVYSYALWFGFLLVWWVLAMMLC
                     TLWEKIQQRGPLEMALALMSGRG"
     gene            531457..532926
                     /locus_tag="HMPREF0733_RS02325"
                     /old_locus_tag="HMPREF0733_10488"
     CDS             531457..532926
                     /locus_tag="HMPREF0733_RS02325"
                     /old_locus_tag="HMPREF0733_10488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_013397779.1"
                     /db_xref="GI:503163118"
                     /translation="MNVLDVSQLAQPLAAAHTHILAAGPHEASGVEGTAQYVSIFWVT
                     LAALLSPIMSRLTGKRIPDVVFLLICGVLIGPNALGLASGSDGGIPLLKELGLGMLFL
                     IAGFEINVDSLRNRQGKSAIATWFVCFALGVLGAALITGFAKGFNTYIAVGIALSSTA
                     LGTLLPMLKSHGAAGTRVGNAVLVHGAVGELFPIFAMSLLLSSYSPGLAILILLGFMA
                     IAVVTAIIPHRLLQKVPGLRQIMAVETNTTSQLVLRLAMFLLATLIMFTALFGLDAVL
                     GAFAAGIIMRSLTPVGALHMITARLETVGFTFMIPLFFVVSGMGINPSVVASSPLLLA
                     MVVIGILLVRGVPVFIAERFTNTGSGLQSMSEKVELALYSAAGLPIIVAVTSIATSSG
                     LLESSTASLLVAGGALTVLLFPLWAAAIKRAFRSQTAENESGVSKRAQIDALKAHRNA
                     TVKLTTGMIPAVKPTKETHSPLRGNDSSGSSKTQKPPEN"
     gene            complement(532958..534802)
                     /locus_tag="HMPREF0733_RS02330"
                     /old_locus_tag="HMPREF0733_10489"
     CDS             complement(532958..534802)
                     /locus_tag="HMPREF0733_RS02330"
                     /old_locus_tag="HMPREF0733_10489"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397780.1"
                     /db_xref="GI:503163119"
                     /translation="MSNDMDLRTSYKKFIQDLPQLLADKGPEQVYALYKAENYGSLRA
                     GGFREEIERLASPAPHWCDQGFFRLAELYDGLQLNHDDGYFLALMNLNVSLRQSLLRH
                     DRQFRDELLWHLFTVEGTPERSFATVDKNTFRNTWQRELLDASAEGLIPREYLLDACL
                     ASLARDFATYRAGWFSRMYAALKPTAAESAQRQDTLVNLLGSPVGTTVTLAVKQLSAV
                     HRAGLLDADWFVRGCAPALLTSKANALAILKLLASLRGTVGDTPVAETSVVGLNHAHP
                     QVQVAAAKLLHQAKATETLHQHVQNLSPVARQELEDAELLKRTEEGTAQHTALKAPAQ
                     TEQTAGDTDHDAPPPDYVRSGKSTGKVPNILESIRVSWDYRESEAKRPNGKPENVWWS
                     PTVHLPAAEPHHMPDEKHLLTLHYATTSCEELARLCPSSTVPVAVGLLERWVFLDEED
                     GHHYMHDMVQTLRNHPGQWNFITSQALAVLATSKHHIDRAGAAELLAENLGGRLSYED
                     ATTGFSQAAPALMFTRWAHTFEDMAAIDPRITLRFLGGLLPHCERTQHGMGKLLGVYA
                     QEYVRAHGAKRSVNDSPQLSPEMTAWLGGFKGSSQAAKHARAILKTLT"
     gene            535708..537264
                     /locus_tag="HMPREF0733_RS02335"
                     /old_locus_tag="HMPREF0733_10490"
     CDS             535708..537264
                     /locus_tag="HMPREF0733_RS02335"
                     /old_locus_tag="HMPREF0733_10490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004005513.1"
                     /db_xref="GI:490103667"
                     /translation="MHQTLMMSAGGVALDFPAWLRITHFINFLMIGLLIRSGWEVIAS
                     HPRFYWNNHCTPGSEWLKFTKDKVSTVPGEYTARDDQRSLSPLISLPGKAQIGLGRAW
                     HALTTVIWIANGLVYVSLLFITGQWRRIVPTSWDIFPEAWQSIQIYAGFQIPSIEHFQ
                     PYDALQKLMYFTVVFIVAPLMIATGPIMSPAFCGRFPRYVRLFRNRQTARSIHFLGMA
                     FYCVFTIMHVALVLIVHPQYNIAHMMLNKNYNEIDAAQFAQAVTMLIVGVVVVLAVWI
                     GASYWSHRDLRFAQTFVWGLTQPVRNLFLDRISSRQVKKQTFTDADISPFHWVNTRPP
                     TERESTEWNRLREQDFVDYRLELGGLVKEPKSLSIDDLKSLGKEVNITMHTCMQGWTG
                     IAKWEGVRLRDVLALVEKDDNARYVMVTSFGHVGHTYDGRPTEPYYECLDISMAMEDE
                     TILAWGMNDKPLPDVYGGPLRLRADSMHGYKMVKWVQKIEWISDYRDVGDGQGGSRED
                     SGLQHFDARA"
     gene            537637..538356
                     /locus_tag="HMPREF0733_RS10700"
                     /old_locus_tag="HMPREF0733_10491"
     CDS             537637..538356
                     /locus_tag="HMPREF0733_RS10700"
                     /old_locus_tag="HMPREF0733_10491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012903683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397781.1"
                     /db_xref="GI:503163120"
                     /translation="MSSVHLPTRRTILTLGLTATTITLSGCAPSTRSQEKPSPSYPSP
                     TQSFVREPEYGYGYDGIIRLDNYEKSGKYTPATHDHKALNVPKPLKPEYINEYSHDGI
                     CAFLAYWIESTNYAYLTGDLKPLSQITDPYKIIHPEILKMYEDNTGWVIGPQHIYTLE
                     LVTPASGNDFKDSTIYEWQSVLRVSPEATVYVTANKSEKLFTDFIGAREKADISSDVR
                     YTDGEWHLVNDDGSNSYKKPL"
     gene            complement(538363..538761)
                     /locus_tag="HMPREF0733_RS02345"
                     /old_locus_tag="HMPREF0733_10492"
     CDS             complement(538363..538761)
                     /locus_tag="HMPREF0733_RS02345"
                     /old_locus_tag="HMPREF0733_10492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005506301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397782.1"
                     /db_xref="GI:503163121"
                     /translation="MSALNYLLLTGETEPLKIIDPELKTARPDIVKLYEDETGWVISQ
                     HLSPMESPIKLELLDPKPVETPEGSKNYMWRARLSIDASASVFYADTKETRPLADVLG
                     LQPGEVQLQIAYVEGKWRSETAYDVVYQIS"
     repeat_region   538405..538507
     repeat_region   538630..538901
     repeat_region   538930..539200
     gene            539178..539900
                     /locus_tag="HMPREF0733_RS10705"
                     /old_locus_tag="HMPREF0733_10493"
     CDS             539178..539900
                     /locus_tag="HMPREF0733_RS10705"
                     /old_locus_tag="HMPREF0733_10493"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397783.1"
                     /db_xref="GI:503163122"
                     /translation="MNSTHLPTRRTILALGLSISGTFTLSSCARPEGRTSQYEYSEVY
                     PTPSQTFEQNRGADYSGTIQLGTYEKHGKYVPGTQEHKAQNVPKPLQPHYINEYSSDG
                     MYAFLAYWVESVNYAYLTGDIKPLSQVTDATATIPSAVLDLYQKNTGWVIGPQHIFTI
                     ELSTPGSHDVTLKSPDRIWQSVINISSEAQVYDSTNNSTQSFLKVIDRVEKEEVNARL
                     RYLDGHWNLVKEDGSINQRKPL"
     gene            complement(539908..540438)
                     /locus_tag="HMPREF0733_RS02355"
                     /old_locus_tag="HMPREF0733_10494"
     CDS             complement(539908..540438)
                     /locus_tag="HMPREF0733_RS02355"
                     /old_locus_tag="HMPREF0733_10494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397784.1"
                     /db_xref="GI:503163123"
                     /translation="MKFGDYQTVGKFEAGTVEHPAVSTPIPRPHQTFQDYYVSNIYSA
                     VGLWVSALNYLLLTGEVEPLKVIDPELKTARPDIVKLYEDETGWVMSQDKSPLKGELL
                     EPHPAETLEDSKVFTWSARLNVDADALVFYADTKESRPLADVLRLQSGEVQLQIAYVE
                     GKWRSDTAYHSIYTVS"
     repeat_region   539950..540291
     repeat_region   540463..540734
     gene            540712..541425
                     /locus_tag="HMPREF0733_RS10710"
                     /old_locus_tag="HMPREF0733_10495"
     CDS             540712..541425
                     /locus_tag="HMPREF0733_RS10710"
                     /old_locus_tag="HMPREF0733_10495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397785.1"
                     /db_xref="GI:503163124"
                     /translation="MNPTHLPTRRTFLTLGLGIGTLALGACAPTTRSAPKARATYPKP
                     TQSFDIGSKYDYDGPVRLDTYEKHGKFIPATTEHPAQNVPKPLMPDYINEYSNNGFYA
                     SIAYWVEAVNYAYLTGDLKPLSQITDARLTLNSEIIKLYEEKTGWVIGPQHPCSVEFE
                     TAGSNNNLNDPSIREWQSIIRISPETKVYNSTTGTTTPFLEFSDQKAEKKSAIGLRYS
                     NNEWYFVNDDGSNIEKKKL"
     gene            complement(541432..541818)
                     /locus_tag="HMPREF0733_RS02365"
                     /old_locus_tag="HMPREF0733_10496"
     CDS             complement(541432..541818)
                     /locus_tag="HMPREF0733_RS02365"
                     /old_locus_tag="HMPREF0733_10496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005506138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397786.1"
                     /db_xref="GI:503163125"
                     /translation="MSALNYLLLTGETEPLKIIDPELKTARPDIVKLYEDETGWVMSQ
                     DKSPLKGELLEPHPAETLEDSKVFTWSARLNVDADALVFYADTKESRPLADVLRLQSG
                     EIQLQVAYVEGKWRSETAYDVVYQVS"
     repeat_region   541474..541958
     gene            complement(542141..548389)
                     /locus_tag="HMPREF0733_RS02370"
     CDS             complement(542141..548389)
                     /locus_tag="HMPREF0733_RS02370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775419.1"
                     /db_xref="GI:908631386"
                     /translation="MEIAVEGGNAIISYLEQLERSINQINRSAYDERRNRQKAREYED
                     DWWGLHKSWDEFWGFAPPVDEIIPPNVHIEVVRQPSREFPRIGENTEQGMSVSSLRPS
                     RLMISAMQTESLVSGLSYFPNKIREKAAEFSAGSQWGSVDCEDFIKAFETWNEENRQD
                     HRWADTIANEFEKAGAAGEFITLSDAALQNSLDLKGIRSNRADLTIPAPMVTGKTPSS
                     GFANDPVNVATGNFIEPEIDLEYSGLASSCALTRMYNSVALLDDSMDAGVFGPGWSSN
                     LDVKLFFEDEGATRIFPDGRHIFYARQGEGFARAQREAQWLERISLEEHHDIDSTLEF
                     ILNTTEQHVGVLYCAQDNQGTRTYFSPSGTWLGATTGPGTTIAALRNSEGQIVQLIHE
                     LGRHIKIQYRDGRVSYVTTSTGEHAEYMYGGLAERTAGHLTGVNTARGTRTYEHDENN
                     LIYRVIAADGTVEVTNSYDERARIIQQLTHYGRTVRYSYLNHGITDIANTDGTDANVW
                     VSDEYGRLVALHDAGGGRTTFSYDTFGNRRLVTERDGSRIHRYYDERGRQIREITAEG
                     AETLTTYDEFDRVTSQIISTFEVDQRKRYETYIAHLNGEGTEDSTPQVLATQTFTYAS
                     PEDRYPSAVTDAQGNTATFTWNQGMLIRTENPEGVGVNFTYDKFGQPVTMSNDLGETT
                     RLEYTPSGQLAAVTTPLGYRTTLTYDNAGNLICYEDPTGALWKFEYAEGARLTATVDP
                     LGARQEYTYGASGDVVQLRDALERITTRTFDLYGNMSSETLPGGRTFTYIYDGLARLV
                     ETVDPAGGSWKRAYDAASTLTSTIDPTGVQVKNIANRTHRTVTQRDGSGTAIRVKLDQ
                     LGRPVAREEIPSPTETVQERAASGEERIVYDAVGNPVEILDAEGGLTRYEYNRAHQLV
                     REVSPAGRVKTYAYDRAGRLASVTDGNGNTTELEYDADSRPVARKFADGTVERMTYDR
                     ASRIISVVGGSQLPTHYTYDAAGRVTSIRDGKYGTRSFVYDAAGQVITMINGVGGRTH
                     YTYDEAGNVVSMMDPAGAITSYEYDVLGDMVRRVDPVGAVTEYSYDGASRLVSKTNPD
                     RRVHAWEHDANGEVTAYRVDGELMAQIARNLRGRSITVRDWTAVGGKNSGQKPWVTRT
                     HRDRLDRVVSVRHGVGESVLSSETSVADISQTFLSEGTYELVYIYDADGYRTGLISPY
                     GMQSYTYDNAGNLVSTGDYLQGETASFAYDAVNNLVRARVGDIVRRWNYTDGLITEYS
                     EESASSGDVYRHAQIMRDSEGRIIGVDSPAGLVMYSYDGSGQLVSARRGNEYMTWNWG
                     SAGTLEREVYALVEPENAENPGLLQVVAARVRLFTYDAAAQLHNVCTYTLDVSSDEIA
                     HADEFLKQHGLEHPQAFTLGALPLDNTLTEPIELSLSQVRVFTYDANGHRTGERTSDG
                     SQIDVDFNPAGYLAAVSRVNAAAAEGTVSAAASYEGEIYRVTGADGVSVPVVWDDLLG
                     VPTLMGVGSASAAELPEGIADSALDFSLSQDREFSIPMLAPGTGSLDPFSAYSPQSSA
                     PSPAQTSMMPDALSLISVPRAGGIRIAGVNVLGHRMVDGSTASFLSRDPLPAIPGAGW
                     VGNEYSLVGNNPVGLIDPWGLSPISVEELKKLREIHNGWNYFQAWWKQTLLEAALKWD
                     GIVSDIKLCTTLGMLAITKISIDGLSWIGQNLEKVILTLGKIILMPVDWAYRIGTAFF
                     TAYVYVSNAYMYISGYVQGFTLSFLASKNQPLIVSLVNSHYFGLKVANASPKLEDSKR
                     TPKIEYLNIEEQIDKPEMPDISPSPQEPPRRLDEIAERMKQVDSAEYVKEMEKRDNRG
                     YSGVQLDIYKNKSTGKKIVYVYISGTDFNHKTGELGSIGSNLGISGGESSDKIDDMSP
                     YPRLVAESLNKEKISPDDQVVLVGHSQGGAVAYNLANNEEFNNKYNVSNVVTYGAPID
                     NLQGQNKNLPHQFNLTQVENRYDPIPSATPYPLFSYGKPEGAKITVESSPYEALSPMH
                     YHDMSVYDRATREYIKNHQNEPQISVESGVLEPETKLYTGTNTAVENPALRWAEENSQ
                     SYKGYYGK"
     gene            complement(548899..549546)
                     /locus_tag="HMPREF0733_RS02375"
                     /old_locus_tag="HMPREF0733_10498"
     CDS             complement(548899..549546)
                     /locus_tag="HMPREF0733_RS02375"
                     /old_locus_tag="HMPREF0733_10498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397788.1"
                     /db_xref="GI:503163127"
                     /translation="MSSAKEDILTRIRESLSDAPEAPTPVRNYRRVSELNREQTIEML
                     VDRLIDYKANVFNATESNIAEVIAERLGENSRYVVPTGLNPEWLPEDTATRVHVTDSG
                     STLEPGALSVHELDAVDAVVTSSTVSCAETGTIFLNSTPQEGRRAISLVPDHHVCVVP
                     ESTVVELVPEAIERITYERPVTMISGPSATSDIELIRVEGVHGPRILDVVILEGK"
     gene            complement(549546..551171)
                     /locus_tag="HMPREF0733_RS02380"
                     /old_locus_tag="HMPREF0733_10499"
     CDS             complement(549546..551171)
                     /locus_tag="HMPREF0733_RS02380"
                     /old_locus_tag="HMPREF0733_10499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster-binding protein"
                     /protein_id="WP_013397789.1"
                     /db_xref="GI:503163128"
                     /translation="MMTSTAIPLGMPKVVHYGEGNIFENEPFPEYAKRELKNDQLRNN
                     LRFVTHAIRNKRARVTSELPDWQELRNTGEMVKNYVLFNLPQMLEQFERNFTARGGHV
                     HWARDAREANQIALDLIREQGVDEIIKIKSMATAETGLNEFLEENGINAIETDLAEEI
                     VQLGEDRPSHILVPAIHRNRREIRDIFLKKIEGINPDITDEPAELAEASRNRLREKFL
                     STKVAVSGVNFGIAETGTMTIVESEGNGRMCLTLPDTLISFMGIEKLLPTFQDYEAFL
                     QLLPRSSTGERMNPYTSMWTGVTPGDGPQNLHVILIDNGRTAVLADELGRQALRCIRC
                     SACMNVCPVYERAGGHAYGSTYPGPIGAILSPQLSGIEAAHNNSLPYASSLCGACYEV
                     CPVKINFPEVLVHLRGKDVEAKHAKKHAPTQMDAMMYGAKKLFSSGKMMAVAERGLPM
                     SRLISGKKHKITKVPGIVGGWTDYRDIPEPPKESFRNWWKKEKSGAPARDSAERVDIA
                     ALIEANKGKVAEAAANAQAAAEAQAAREGKENA"
     gene            complement(551183..551974)
                     /locus_tag="HMPREF0733_RS02385"
                     /old_locus_tag="HMPREF0733_10500"
     CDS             complement(551183..551974)
                     /locus_tag="HMPREF0733_RS02385"
                     /old_locus_tag="HMPREF0733_10500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S oxidoreductase"
                     /protein_id="WP_004005516.1"
                     /db_xref="GI:490103670"
                     /translation="MRIALFSTCIVDGMYPRVARATVEILERLGHEVVYPPGQTCCSQ
                     MHVNSGYFDDAYPVVKNHVESFEAWDWDVAVAPSGSCVASLGHQQPMIARHQGDEDLA
                     VRAEQIAARTFELSQLLIDVLGITNAAEQLGSYFPEHVTYHSSCHGMRLLHLGSRQSD
                     LVRTVEGIKYTEIEGLDQCCGFGGTFSFKNADVSGAMVEDKATNVEKTGASVCTGGDC
                     SCLMNIGGALSRRGSSVKTVHFAEILASTKENPLKIDGNVELAFA"
     gene            552764..554437
                     /locus_tag="HMPREF0733_RS02390"
                     /old_locus_tag="HMPREF0733_10501"
     CDS             552764..554437
                     /locus_tag="HMPREF0733_RS02390"
                     /old_locus_tag="HMPREF0733_10501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactate permease"
                     /protein_id="WP_013397790.1"
                     /db_xref="GI:503163129"
                     /translation="MNTFFAEPNAVGGSLGLSALVATIPLLTFFIMLLVVKARAHWSA
                     LVALAASILVASLGFTMPFDLAGLSAVRGAIYGLVICWVILGAIWFYQVTVLAGRFED
                     LRRTFDRLGGGDLRIQAILIAFCFGGLLEALAGFGAPVAITATMILALGVKPLKAAIT
                     VLLANTAPVAFGAVAVPIVTAGDVGGKDPHVIATIVGHQAPFLAMFVPVILLFILDGM
                     KGVKDAWLPAFVIGISFGIAQWITAATPAYNLTDVVACIVSMGAAVLFLRFWKPRGVE
                     GVRERYGLPSQVEEKEALPAVRVWMALLPYLIVVVIFGLVNLSAELKAWLKTVAIKID
                     IPALSSRLVTKDGTKVKDAVYSFTWLSNPGTLLIISGLIVGVIYFLFNEKGRYGFKFP
                     ALFTEFGSVVYRMRWSILTIASVLALAYVMNFSGQTVAMGTFLAGLGPVYAILAPALG
                     WIGTAVTGSDTSANALFSKLQVSAAENLHQAGISGATPELLLAANTTGGVVGKMISPQ
                     SLAIAATSVDMEGKESDILKAVVPWSFAMLVVVCILVFLQTNVLSFLIP"
     gene            554634..555458
                     /locus_tag="HMPREF0733_RS02395"
                     /old_locus_tag="HMPREF0733_10502"
     CDS             554634..555458
                     /locus_tag="HMPREF0733_RS02395"
                     /old_locus_tag="HMPREF0733_10502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005518.1"
                     /db_xref="GI:490103672"
                     /translation="MTHLTDSTSRIQERSYSIILETFERRLRLGELRVGDKLPSERAL
                     AEKHGISRPSVREALRILNALGLIRSSSGSGPKSGAIVISEPSDTLSWALRMHIATRN
                     LPVKDVVSTRLLLEGPAARAAANAPDSPERDLALENAREHLREMDLPQVSNERFHFCD
                     TRFHYELSKLGGNIVLDTVIDSLHMATISYVQEAVPLLRDWDSVKQTLQDQHRGIYEA
                     ISTRDEDAAYERVCEHIKWFYSLSDRARDQQRERQAQVMDADALPHQVVLHEEHLA"
     gene            complement(555550..556476)
                     /locus_tag="HMPREF0733_RS02400"
                     /old_locus_tag="HMPREF0733_10503"
     CDS             complement(555550..556476)
                     /locus_tag="HMPREF0733_RS02400"
                     /old_locus_tag="HMPREF0733_10503"
                     /EC_number="6.3.2.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="WP_013397791.1"
                     /db_xref="GI:503163130"
                     /translation="MNSRNNPPMIPGWTHVYSGKVRDLYVPEESRYDAAGLTVSDDAE
                     IRAGSVMVVASDRISAFDKILPTEIPDKGKILTQMSLWWFQQLSHIPNHVISTDVPES
                     VAGRAMICKSLNMFPVECIVRGYLTGSGLTSYRDTGSVAGIELPAGLVDGSRLETPIF
                     TPTGKAEVGQHDEPVTREELYAEVGHAIGNRLEELSLELYSTAEKIAREQGIILADTK
                     VEFGTDSYRGEITLGDELLTPDSSRFWDASEYEPGKSQPSFDKQFVRDWLRSPESGWD
                     GSDNVPHLPEDVVEKTRARYVEAYERLTGTKF"
     gene            complement(556729..558012)
                     /locus_tag="HMPREF0733_RS02405"
                     /old_locus_tag="HMPREF0733_10504"
     CDS             complement(556729..558012)
                     /locus_tag="HMPREF0733_RS02405"
                     /old_locus_tag="HMPREF0733_10504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="WP_041321865.1"
                     /db_xref="GI:752673156"
                     /translation="MKVLVLGPGGREHAIIRALMRDPQVTEVHSAPGNAGIAQDVPVH
                     AIDANSPEQAVALARELAADLVVIGPEAPLVAGVSDVLREAGFAVFGPSAAAAQLEGS
                     KAFAKQVMEEANVPTARAFVATTDAEAAQALDEFGAPYVVKDDGLAAGKGVVVTENRD
                     AALEHANACFAAGGSVVIEEFLDGPEVSLFVISDGKNVLPLSPAQDFKRIFDNDEGPN
                     TGGMGAYTPLDWLPAGFVDEVIEKIARPTIARMAERGTPFVGVLFCGLAVTSRGVRVI
                     EFNARFGDPETQAVLARLRTPLGQLLLAASRGEIAEDTCLEWDPRTAVDVVMAAEKYP
                     GTPRKGDAIAGLESASAMPDVHVVHAGTAVAGEEIVTAGGRVLAVVALGDTLAQARDA
                     AYEGVHAITWEGAQYRTDIALKAVQGAITVPELRN"
     gene            complement(558193..558738)
                     /locus_tag="HMPREF0733_RS02410"
                     /old_locus_tag="HMPREF0733_10505"
     CDS             complement(558193..558738)
                     /locus_tag="HMPREF0733_RS02410"
                     /old_locus_tag="HMPREF0733_10505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397793.1"
                     /db_xref="GI:503163132"
                     /translation="MSEDPAALGNNPHSKRPVTVGKYPKIYLPAKFRLLITGIALIPV
                     VIVAGLNPERYDLIMIALLITVITASLANAYQRLLVTHEGFILLYMPLFRRRIAWDEV
                     TDIQVLPEYDVVHETVGIGLRLAPGTGLIFGNLRHGPALKIQARIKDHEKTYIFIFPP
                     AEQKAYEAFVGEVRYRASWGS"
     gene            559038..559241
                     /locus_tag="HMPREF0733_RS02415"
                     /old_locus_tag="HMPREF0733_10506"
     CDS             559038..559241
                     /locus_tag="HMPREF0733_RS02415"
                     /old_locus_tag="HMPREF0733_10506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_048777974.1"
                     /db_xref="GI:881060323"
                     /translation="MYVFYFPQIIGNINGHKGDWIQPLVAGINCTLWVAYGLWREKKD
                     WPIVIANAPGIIFGGTAAITALM"
     gene            559288..560349
                     /locus_tag="HMPREF0733_RS02420"
                     /old_locus_tag="HMPREF0733_10507"
     CDS             559288..560349
                     /locus_tag="HMPREF0733_RS02420"
                     /old_locus_tag="HMPREF0733_10507"
                     /EC_number="3.5.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-asparaginase"
                     /protein_id="WP_013397794.1"
                     /db_xref="GI:503163133"
                     /translation="MTSPQLSLTDAELVFQTRNDLIETTHHGIVVVLSPEGTTDLALG
                     DMSQPFFARSALKPLQAIGTLKSGAPLRGAQVAIACGSHQGTFEQMRAVQDVLQGAGV
                     DATALLCPTAYPADAHAHEQMVRADLAKTPLAHPCSGKHAGFLWACAAQLDRSVVDPD
                     SRQWTMKDYCDPEHPLQRMIAEEIASFTGEPVGTSGIDGCGAPVAAVSALGLARAYST
                     LGTAIRNMDADARASTVATAMVDYPELIQAPGMPDTVLSEQLDAVVKSGAAGVLCVGL
                     RSGASVVVKISDGATRAAYPVALWALEATGHLPSEQVQQLLPQVTRPVIGGVQDNAPR
                     EVGSWVPGADLEPLVGESA"
     gene            560346..560777
                     /locus_tag="HMPREF0733_RS02425"
                     /old_locus_tag="HMPREF0733_10508"
     CDS             560346..560777
                     /locus_tag="HMPREF0733_RS02425"
                     /old_locus_tag="HMPREF0733_10508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397795.1"
                     /db_xref="GI:503163134"
                     /translation="MSVRRRVSEADGAAAFAQVRQVFDTVLSGEKPLISAENRDDIEQ
                     SFARLPRSARATAVRYALEELATLAPGNSVEVRVPPYGVTQCIAGPRHTRGTPPSVVE
                     TNGFIWCALAAGALTWDDASASGLLTASGERSNLSRYFPLF"
     gene            560921..561292
                     /locus_tag="HMPREF0733_RS02430"
     CDS             560921..561292
                     /locus_tag="HMPREF0733_RS02430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321555.1"
                     /db_xref="GI:752672846"
                     /translation="MSSAHTPSNSHSDSSEPESPTPEAEASPETEVEYSQVRVRRAPS
                     VVAFMMLGLVIGLIAAFISVIVGPGDPSYSETSVFGVIAVIYGAVGVALGALVALWLD
                     RRSLKKSVTARVEPESKEEDE"
     gene            561512..563311
                     /locus_tag="HMPREF0733_RS02435"
                     /old_locus_tag="HMPREF0733_10511"
     CDS             561512..563311
                     /locus_tag="HMPREF0733_RS02435"
                     /old_locus_tag="HMPREF0733_10511"
                     /EC_number="2.4.2.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397798.1"
                     /note="Catalyzes first step of the de novo purine
                     nucleotide biosynthetic pathway; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="WP_013397798.1"
                     /db_xref="GI:503163137"
                     /translation="MIRPDGKLTHDLDPIDHGPKDACGVFGVWAPGEDVAKLTYYGLY
                     ALQHRGQESAGIATSNGKRIHVYKDMGLVSQVFDEATLSSMPGEHAIGHARYSTTGAS
                     HWANAQPTLGTTPHGTLCLAHNGNLTNSADLYDKLLQKNGGKPPAFGELAQGNTTDTA
                     LVTALLAEHDFDSLEEAVLDLLPTLRGAFCLTFMDEQTLYAARDPQGVRPLVLGRLER
                     GWVVASETAALDIVGASFVREVEPGELITIDENGLRSHRFAEAKPAGCVFEYVYLARP
                     DTTIAGRSVYESRVEMGRQLAREHQVEADLVMPTPESGVPAAIGYAEQSGIPYGNGLV
                     KNAYVGRTFIQPSQTIRQLGIRLKLNPLKSVVAGKRLIVIDDSIVRGNTQRALVRMLR
                     EAGAKEVHVRISSPPVKWPCFYGIDFASRAELIANGLSVDEICASLGADSLGFISEDG
                     MMAATEQPAKSMCTACFTGKYPIELPSEERRGKSLFNAEEGKGGPLAGKAAEVTVERP
                     VPNKPEHAEAVSIETRTGTDTLENKFDTAALPVVQAQAGSGASAPVESAQEAQQPAPG
                     MCNPGPDADLEALLTEEDLVPAHVNSRPITPKD"
     gene            563319..564464
                     /locus_tag="HMPREF0733_RS02440"
                     /old_locus_tag="HMPREF0733_10512"
     CDS             563319..564464
                     /locus_tag="HMPREF0733_RS02440"
                     /old_locus_tag="HMPREF0733_10512"
                     /EC_number="6.3.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole synthetase"
                     /protein_id="WP_013397799.1"
                     /db_xref="GI:503163138"
                     /translation="MSENSTSVTYASAGVDVEAGDRAVELMKDAVKATHNASVVGGVG
                     GFAGLYDLSALSSYRKPYLATSTDGVGTKVAIAQALDIHDTIGYDLVGMVVDDIVVCG
                     AKPLFMTDYIATGKVVPERIADIVRGIAGACKVAGTALVGGETAEHPGLLAEHEYDVA
                     GAATGLVEADELLGPDRVREGDVLIGMASSGIHSNGYSLVRKVIDVAGWGLDRQVDEL
                     GRALGEELLEPTRVYAADCLDLAAAFPVNGAEGQTGHGIRGFSHVTGGGLAANLARVL
                     PQGLEGRVDRSTWQIPAIFSLVGSLGKVPLADLERTLNLGVGMIAIVDPAVADAAVSR
                     LNERGISAWIMGDVVKAGTPDLNNPDYVQGAKGVDGGAVRLYGSYAV"
     gene            564979..567162
                     /locus_tag="HMPREF0733_RS02445"
                     /old_locus_tag="HMPREF0733_10513"
     CDS             564979..567162
                     /locus_tag="HMPREF0733_RS02445"
                     /old_locus_tag="HMPREF0733_10513"
                     /EC_number="3.4.21.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine metalloprotease"
                     /protein_id="WP_013397800.1"
                     /db_xref="GI:503163139"
                     /translation="MSLIEHPTVKRTRIAALSVAGIASLMVGLCAPSAHAAPASPVST
                     KTGIPASSQTEDILTATSVQQQEQGYDRFIINYADQAKNNLDIAGLESGEYSEFVPEL
                     YQGIEKSVNSLDELLGIKTTYVRDTAQNDSVVSLSKPLNAQQAKQYMQTLAENPQVDS
                     VEPDLKRQPTGSLPGSDKVDFNDPKMSRLWGFTTIKADYALKHAGDHQVTVAVIDTGV
                     TKHSDLNENVLPGYDFVSDASAARDGNGRDNNPQDEGDWTTEGQCGSGAKATNSTWHG
                     THVAGTIAAVGNNNIGIAGVAPKAKIVPVRVLGACGGYDSDIIDGLIWASGGSVRGVP
                     ANQHPAQVINMSLGGAGKCSRTYNRAIESVNKRGSIIVTSAGNSNQNASAQIPGSCNG
                     VINVGASNPGNSRALYSNYGSTVAVSAPGGDFRQSGVGVLSLVNKGKTVPEKEDYAEY
                     EGTSMAAPHVAGTIAIMRSKYPNLSYEKALDILKSTANPITCDRDYCGAGIIDAAKAM
                     DKVDELVESEKQPNPTPTQPAPSEPSKPEPAPSDSSTPAPAETSNPEPAPTPTPTPAP
                     SKPVRPIAPPPSKPLPTLPPYEEQLPVLPIKPKPSPKPTKPAPVETPKPSPAPVETKK
                     PTPAPSESYKPAPPSWWYWYDYPGQGYYSPSPWYDPWSGYGAWNRWDYGYGSWGGWGY
                     HRGHRGSWHNTPWMHRSGHPWWASYPYGWGNSYRGYGYYNVGYRY"
     gene            567485..568768
                     /locus_tag="HMPREF0733_RS02450"
                     /old_locus_tag="HMPREF0733_10514"
     CDS             567485..568768
                     /locus_tag="HMPREF0733_RS02450"
                     /old_locus_tag="HMPREF0733_10514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013397801.1"
                     /db_xref="GI:503163140"
                     /translation="MSKHSLLRANIPLRRTVFAIGANQLSDAMSYISVPLIMLFLTGS
                     PENASLALFATGVTRILASFLTGVIVDRYKPTYTLTLSCMGQCITWIVLTLCVLANVG
                     SVPILIGILCVMALASSFDYPSEQAIIARVVPTKQLGYASGLGETRESAANLIGSPLA
                     GLLASTSLILTACVHAFVNFTAFLAAPSSSTVVHAERKHRQAGSETTVSDTVIDTQST
                     GFFADLAQGLMYVVKNRVLVAIASVACCANFAATGLPLVFIYYYAEQGIAAYSIGIFA
                     CVFGAGVLLGSLTVGWMTERFALGTLGVLAVGMMVICYMTAAFTHDYFWITCALMLIS
                     GVPLPAFNSSIVAYINASTPVDMIGRVHSAQGIPNMLLAPVAALLAGIMYVQWGISRT
                     VLFYGSFMVLALILMLSQRSLRTLPKLSEMAPASD"
     gene            complement(568854..569969)
                     /locus_tag="HMPREF0733_RS02455"
                     /old_locus_tag="HMPREF0733_10515"
     CDS             complement(568854..569969)
                     /locus_tag="HMPREF0733_RS02455"
                     /old_locus_tag="HMPREF0733_10515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dolichyl-phosphate beta-D-mannosyltransferase"
                     /protein_id="WP_013397802.1"
                     /db_xref="GI:503163141"
                     /translation="MIVLIPAYKPDESLVQLAEQITELDAHAEILVVDDGSGSTYVPI
                     FTELAIRGITIITQPANRGKGAALRTGLAWARTHRPDHIVVTADADGQHLPRDILRVG
                     AKTERMASIGTRALVLGVRTLPDTRAEFTEPTVPLRSRLGNALTVGFFTLATGTRIAD
                     TQTGLRGFTTQMIDWALSLRGDKYEYEFSMLLRASRAGVELIELPIVKVYELGNPSSH
                     FRPIRDSARIYAPLLGFLVSSCTGFIVDALALFALVGVGFALLPAIVLARIISALTNF
                     SINRILMNDGADRPSRAVSLGRYAILAVGILLANAALMEVLTAFGVVLIVAKILTELT
                     LIPLSFAVQRRWVFLPAPPPQTTEQNERSRELATHSL"
     gene            complement(569966..571012)
                     /locus_tag="HMPREF0733_RS02460"
                     /old_locus_tag="HMPREF0733_10516"
     CDS             complement(569966..571012)
                     /locus_tag="HMPREF0733_RS02460"
                     /old_locus_tag="HMPREF0733_10516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide biosynthesis protein"
                     /protein_id="WP_013397803.1"
                     /db_xref="GI:503163142"
                     /translation="MKNGNTTATLPVEQVEETSEISQKPKKKKVTRRVLLGGGLGTLA
                     VAGVGAGWAYNRYLAEHTQIDDTVSYEKSQQAKNNNSSSDGASSPSELTNVKVTSDGL
                     SASEGSITITKSTEGSGNNAVVSFTAEIKLNAMTLLRGAFANNKFGQNIIDTPSNIAA
                     QHNGIWAINGDYYGFRDTGIVIRNGVAYRDSGAREGLAFYQDGSVKLYDETGTNAQQL
                     LNEGVWNTLSFGPALVRDSEVVSGIDQVEVDTNFGNHSIQGNQPRTGVGVLGQNHLVF
                     IVVDGRSDGYSRGVTMPEFAYMFKELGCVSAYNLDGGGSSVMVFNNQLVNKPMGGTKE
                     RGTSDILYIAGSAS"
     gene            complement(571257..571910)
                     /locus_tag="HMPREF0733_RS02465"
                     /old_locus_tag="HMPREF0733_10517"
     CDS             complement(571257..571910)
                     /locus_tag="HMPREF0733_RS02465"
                     /old_locus_tag="HMPREF0733_10517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013397804.1"
                     /db_xref="GI:503163143"
                     /translation="MMGTKDDIVRIATDYIQRNGVNAFSYADIARKMNIKKPSIHYYF
                     PVKSDLVRAAFEKYSADFFETLHQGVDAARSLREELEAYMRPYRANLEQGYKLCLCSM
                     LALESLGQSASAYDAEEEKKTVKRGTHINATFVPLRAQAENREPAEINTADFQAKNIR
                     WLAERFEHAGYDPEHSQAEAESLFCTVQGAQLIARSAQSLDLFDSVTKRHLDNLTGA"
     gene            571964..572149
                     /locus_tag="HMPREF0733_RS02470"
     CDS             571964..572149
                     /locus_tag="HMPREF0733_RS02470"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321558.1"
                     /db_xref="GI:752672849"
                     /translation="MRIRLVITAVTEDNSRECDFIGGNIQVGTDLIRVLYIFVGDTIV
                     SIPQDARQHQQMRKQAN"
     gene            complement(572261..572467)
                     /locus_tag="HMPREF0733_RS02475"
                     /old_locus_tag="HMPREF0733_10519"
     CDS             complement(572261..572467)
                     /locus_tag="HMPREF0733_RS02475"
                     /old_locus_tag="HMPREF0733_10519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397806.1"
                     /db_xref="GI:503163145"
                     /translation="MGRGRQKAKATRQAREMKYFSPETDYSALERELNAKNTKSSESS
                     SRRYDDEDDYSAYAEKYAKYDDEV"
     gene            complement(572809..574698)
                     /locus_tag="HMPREF0733_RS02480"
                     /old_locus_tag="HMPREF0733_10520"
     CDS             complement(572809..574698)
                     /locus_tag="HMPREF0733_RS02480"
                     /old_locus_tag="HMPREF0733_10520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397807.1"
                     /db_xref="GI:503163146"
                     /translation="MNKKMLTSATSVTLLAALALTGCSTTSNALASGTTAADSSVGTT
                     ATTSSATATNTAASSSSFSTNVKSGEKLDVDTHYSEQDLSWDTSSETAIDLSNPTATD
                     GVTVEDGTLTITKAGTYKLSGEYQGQIKVETADSDAVRLVLDNANITNSSGAALNVVN
                     ADEVILYSASGTTNTISDGADYTATGEDDPDAVVYSKADMTIAGEGTLKVNGNHEDGI
                     HTSDGLVIASGTLEVNAANTGIKGKDYVDILGGTINVTAQQDGIKSTNDTDEGKGWTR
                     LSNGTVTVNAGDDGFKASRVVEISGGSLTVEQSDEGIEAQYINVSGGDVNVTSADDGM
                     NASLKTSNSESTDSSENTSDTANQQQNNQQQGSLPGGQQSGTSNQQQQGMGQPPAMPG
                     GNAQDGTSQKGASGTAQQQNNTQNQGNQNMGQPPAMPGGNAQDGTSQNGTTGTGQQGM
                     GQPPQGGMPGGGGGGTFEVIDAAINVSGGHVTVNAEGDGIDSNGVTTLSGGTLIVNGP
                     SQGGNAALDTNGDLLLNGATVLSGSTADMFEAPSTNSTSGYLKLTNSSGFEQGSTVQV
                     ADSSGKVVANYKVTKSNVQLVLVSSSSIVKGQSYTAYTTTSAVDSNAASLASGATELG
                     SFTAS"
     gene            complement(574965..576611)
                     /locus_tag="HMPREF0733_RS02485"
                     /old_locus_tag="HMPREF0733_10521"
     CDS             complement(574965..576611)
                     /locus_tag="HMPREF0733_RS02485"
                     /old_locus_tag="HMPREF0733_10521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397808.1"
                     /db_xref="GI:503163147"
                     /translation="MVEAIFTEILNPYRRGTPFEMFKNRFTSVLTCAFAASLALAGCA
                     ISGNPDNSKATVTAQEQGKELKSGVYTSNTKNGEKIDAQTHFTQEDVTWNQDAVLPLN
                     LADPTTTDGVSEQNGTITITKGGTYRMSGDYTGQVKVQAPKTDKVQLILDGVNITNET
                     GSAINVASADEAVIYTSRGSTNNLSDGPEYAVQGKKEADSTIYSTANLTLAGDGTLNV
                     AGKFDETVHTTKGLVVAGGALNINSSKTGLKGKDYVDIQGGTLRIEAAKDAIKATNTE
                     KQGLGWVRVAGGDTVLRAGDDGIKALRTLEILDGKLTIEGSEEGLEGQYVNIHGGNTL
                     INSNNDGVNASLKDQLPNDQEYEDQKEDSDQPDASPVPLGGARDTTEVIDTVINMTGG
                     NVTLNVGADGMDSNGHEFYTGGELLINGPQDDANDPIDPNGDITVSNDARISFGGGGV
                     ELFKRPIDDSTNGYLRIADNDTFPQGQSVQAVDSAGQVVANYRVITPGVKQVFFSNPS
                     IVKGQEYTLYLAPTLVDPKTTTLAPGAVERGTFTASTPDL"
     gene            complement(576722..577558)
                     /locus_tag="HMPREF0733_RS02490"
                     /old_locus_tag="HMPREF0733_10522"
     CDS             complement(576722..577558)
                     /locus_tag="HMPREF0733_RS02490"
                     /old_locus_tag="HMPREF0733_10522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_013397809.1"
                     /db_xref="GI:503163148"
                     /translation="MSIVPTYWQSISLDELNEKAAMQTRVDRKYIVDADYAASILAEL
                     PADEAAVLEIDGQREFAYDSVYFDTPDLVSYKASAIGSRNRFKVRTRSYLDSDLSFLE
                     VKTEGAREFTVKERIPYSIENRDMLTAEGKEYVATALEQLTDASVDDLEPVVRTGYRR
                     TTVYLPQSEQNPVDSRLTIDTSLTWTPLSESALVYTADGSEGPTKYQVGTEYTAPGTV
                     IIETKSGSAPSIADKYLWRAGIRPVKISKFATGMAALNPQLPANKWKRTIQHWMQLEP
                     AA"
     gene            complement(577754..578350)
                     /locus_tag="HMPREF0733_RS02495"
                     /old_locus_tag="HMPREF0733_10523"
     CDS             complement(577754..578350)
                     /locus_tag="HMPREF0733_RS02495"
                     /old_locus_tag="HMPREF0733_10523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005538.1"
                     /db_xref="GI:490103693"
                     /translation="MDILMMGLADLVAIGTLCTLYMIRHKTRELMISYAVINAGVFTV
                     TVALAHAGSTAGAMGLGLFGVLSIIRLRSTSLSQREVGYYFVSLALGLISGVRLDPPY
                     IAFILMVVLVGIIALLDSPIFEAKNQPRTQTVTVDRAISDEGTLKAYLESRLGYEVVS
                     AKILELDLLNDTTQVTITYKELPQLQEHLNANYEYYAS"
     gene            complement(578840..579850)
                     /locus_tag="HMPREF0733_RS02500"
                     /old_locus_tag="HMPREF0733_10524"
     CDS             complement(578840..579850)
                     /locus_tag="HMPREF0733_RS02500"
                     /old_locus_tag="HMPREF0733_10524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397810.1"
                     /db_xref="GI:503163149"
                     /translation="MRTKKIATFGAVAALSCGLVGGFTTIPAAFATNSLPGNSVSTSV
                     PGNSEHSHSDKAKISFPNEWKEGQELTFQGSGYTTEDGSAGSTLVLKDHEGSIVGTYD
                     ADAQGYVSGNIKWNAAYAERDYVEITVLTGKKAGDVRRSETVKVKVVASEKSGSLPGE
                     GGQGGMGAVGGGSTPSSTPTVTPSSTPEATTPASTPSASTTAEATSTPSAAATETAQV
                     TNGSETHQFATCKEANEAGFKDIQRNDAAYADHLDSDHDGVACESNGGNGEHGTASNG
                     NGGAGYVSDNNGGSNNASSNSNGKLANTGANGALTVAGLGMVALGVGGATVAALRKRK
                     RA"
     gene            complement(580104..581072)
                     /locus_tag="HMPREF0733_RS02505"
                     /old_locus_tag="HMPREF0733_10525"
     CDS             complement(580104..581072)
                     /locus_tag="HMPREF0733_RS02505"
                     /old_locus_tag="HMPREF0733_10525"
                     /EC_number="3.5.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent protein deacetylase"
                     /protein_id="WP_013397811.1"
                     /db_xref="GI:503163150"
                     /translation="MEKWTDTQNFADAGEKSTLIASAHRAAIRSIERVVTETVTPHDP
                     QYAAEGIEKMLRIGGVLALTGAGVSTESGIPDYRGPSGALLDHRPMTYQEFRYDAAAR
                     QRYWARSYVGWRRMRRASPNRAHYALAELEHAGAVNGLITQNVDGLHVSAGSKNVLAL
                     HGDLSSILCLDCGMRESRESLDVRLDAANPGYLERLESTELQVNPDGDVELDNDYIRS
                     FQMVGCTACGSTKLKPDVVYFGESVPADRKARQQQMLADSSGVLVVGSSVAVMSSYKI
                     VLDALRADKPVGVMNGGPGRADARVTYLWRTGVGEALEEMLDRLDI"
     gene            581223..581759
                     /locus_tag="HMPREF0733_RS02510"
                     /old_locus_tag="HMPREF0733_10526"
     CDS             581223..581759
                     /locus_tag="HMPREF0733_RS02510"
                     /old_locus_tag="HMPREF0733_10526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004005541.1"
                     /db_xref="GI:490103696"
                     /translation="MATPTIDAMILGALHEHPMSAYEMNKMMDQRGVRSWARISSPSV
                     YRNLVQLYKQGYVESTTVKDSAMPERTVYSITLEGKERLHELLYDIASSPARVDFNFV
                     SVIANIRMVDEKMGHELLQSIADTYSEWADRLEQAAASIDDQIEAKATLELCSDTYRL
                     IADWARKFEKDFYQNRKK"
     gene            581941..582954
                     /locus_tag="HMPREF0733_RS02515"
                     /old_locus_tag="HMPREF0733_10527"
     CDS             581941..582954
                     /locus_tag="HMPREF0733_RS02515"
                     /old_locus_tag="HMPREF0733_10527"
                     /EC_number="1.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH:quinone reductase"
                     /protein_id="WP_013397812.1"
                     /db_xref="GI:503163151"
                     /translation="MIFMSNTMKTIAMLRSLPISDPEALIEAEIPIPVPGAQDLLVRV
                     KAVSINPVDVKVRTGAGVQQDPKILGWDAAGIVESVGENVSGFVPGDEVYYAGDLTRP
                     GSNAEYQTVDYRIVAKKPASLGFTEAAAIPLTAITAWETLFDHMGLTKDTSGNLLVIG
                     GAGGVGSMVIQFAKARTSLRVIASASRRESAEWCKKLGADDVVDHSKDLGQQVQDLGG
                     ADYVFSAYTEHREEDIASAMNPQSQLVFIDDPQTLNIGAFKPKSISVTPEFMFTRSMF
                     ATEDIAYQSDLLRQVADMIDSGQIMGTLTETLTGLSVESFREGHQKVESSHMIGKLVI
                     SYS"
     gene            complement(583531..586128)
                     /locus_tag="HMPREF0733_RS02520"
                     /old_locus_tag="HMPREF0733_10529"
     CDS             complement(583531..586128)
                     /locus_tag="HMPREF0733_RS02520"
                     /old_locus_tag="HMPREF0733_10529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein disaggregation chaperone"
                     /protein_id="WP_013397814.1"
                     /db_xref="GI:503163153"
                     /translation="MDAKFTTKSQEALSAANMNAQTAGNPSIEPAHILKALMDQREGV
                     AVAVLKAAGLDIDAISEAASAEIKKLPKASGASVQNANFSRSALAAIQSAQTHAQKFG
                     DTYISTEMLLLGIASGDSDTARALENLGATAKVIEETIPQVRGDRTVDTPDPEGTFQA
                     LEKYGTDLTALAREGKLDPVIGRDSEIRRVVQVLSRRTKNNPVLIGEPGVGKTAVVEG
                     LAQRMVSGDVPESLRGKTLISLDLGSMVAGAKYRGEFEERLKAVLEEIKKSEGQIVTF
                     IDEMHTVVGAGASEGSMDAGNMLKPMLARGELRMIGATTLDEFRENIEKDPALERRFQ
                     QVYVGEPSVDDTIGILRGLKERYEAHHKVQISDAALVAAAALSNRYIPSRQLPDKAID
                     LVDEAASRLRMEIDSAPEEIDQLRRAVDRLTMEELALKNETDPASKERLAALRKDMAD
                     KKEQLDALNARWEAEKAGLNRVGDLKSEIDELRSRAEVAQREGNLADASRLLYGEIPA
                     KEKELEEAQRAETEAHGEAMVSEEVTADDIAEVISSWTGIPAGRMLQGESEKLLEMEK
                     RIGERLIGQEAAVVAVADAVRRARAGISDPNRPIGSFLFLGPTGVGKTELAKALAEFQ
                     FDDEHALVRIDMSEYGEKHSVSRLVGAPPGYVGHEEGGQLTEAVRRRPYSVVLLDEVE
                     KAHPEVFDILLQVLDDGRLTDGQGRTVDFRNVILILTSNLGSQYLVDQEMPFEERTEK
                     AMQVVHQAFRPEFLNRLDDIIMFEPLSSEHLGQIVNLQIQGMGKRLTDRRLTLDVTPA
                     ALEWLGLAGYDPAFGARPLRRLVQREIGDRLAKGILSGAIHDGDTVEVDVNPDVAMDG
                     LSVTSKRDD"
     gene            complement(586353..586952)
                     /locus_tag="HMPREF0733_RS02525"
                     /old_locus_tag="HMPREF0733_10530"
     CDS             complement(586353..586952)
                     /locus_tag="HMPREF0733_RS02525"
                     /old_locus_tag="HMPREF0733_10530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397815.1"
                     /db_xref="GI:503163154"
                     /translation="MNEKSEHAGSHPHANSLAARTLAVIQVATLYAAYPMAFVSAAWI
                     TVGRALFGAAGDLVPIFAISFGPALAVILCLGAWWMFRDAHRRVDGGEHLRVGASWGF
                     VFSVWACWVLAFLFGMFIPDYRAGVPVSGIGALAGADYVGYGAGFGNTFGILTFAMAI
                     TAAVIAFNANRRSARIQQGVTDEVLEEQARQQSPYDFLD"
     gene            587131..587808
                     /locus_tag="HMPREF0733_RS02530"
                     /old_locus_tag="HMPREF0733_10531"
     CDS             587131..587808
                     /locus_tag="HMPREF0733_RS02530"
                     /old_locus_tag="HMPREF0733_10531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_013397816.1"
                     /db_xref="GI:503163155"
                     /translation="MKILALGASGRTGSLFTRKALEEGHTVTAYVRNPDKTVELLGEH
                     QNLMVVPGALNDSERLATISSGQDVMVSILGQKATVREFLSTKFMQKRLPLIMDSVVG
                     AGVKHCVIMSAYGVGDTLRSASFFMRVGCKIMMRSIFTDRAKADAMVAKYQPYISRVH
                     PGLLTDKPGKGGVKVFDVASVARVPGIPMIAREDVADALLSIAGNPLNAGTDFLVTID
                     DVVLRAT"
     gene            587831..588487
                     /locus_tag="HMPREF0733_RS02535"
                     /old_locus_tag="HMPREF0733_10532"
     CDS             587831..588487
                     /locus_tag="HMPREF0733_RS02535"
                     /old_locus_tag="HMPREF0733_10532"
                     /EC_number="3.1.3.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycolate phosphatase"
                     /protein_id="WP_013397817.1"
                     /db_xref="GI:503163156"
                     /translation="MTNNSSFPAAILFDHDGTLVDTEPVWAAAKVALAAEFGGTWTEQ
                     DTLDCLGLSMKFTLDRLRERGVDLPDEQINEHLVAKVREALAHQQVEFLPGIERFLTQ
                     VRDAQIPAAIVTNATTSIAQRTADAAPEGTFSVIIGNDETTHPKPDPQPYLLAAQRLG
                     VEPSRCVALEDSPSGVRSATAAGMKVIVVPGELEVPAELGNARMLHTELTLDAVRALG
                     "
     gene            588766..589266
                     /locus_tag="HMPREF0733_RS02540"
                     /old_locus_tag="HMPREF0733_10533"
     CDS             588766..589266
                     /locus_tag="HMPREF0733_RS02540"
                     /old_locus_tag="HMPREF0733_10533"
                     /EC_number="1.16.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase sliding clamp subunit"
                     /protein_id="WP_013397818.1"
                     /db_xref="GI:503163157"
                     /translation="MTFAQYTAPGLTLDEGKEISEVLQARLHDLNELHLSLKHAHWNV
                     TGPDFIAVHEMIDPQVDTVRNFVDDIAERMATLGATPNGLAGALVAARNHEDYPVGRA
                     RVTEHLHALNDVYTRVIEDHRKAIEFAGKVDPITEDLLIGQTAELEKFQWFVRAFLEN
                     SAGEIK"
     gene            complement(589342..591603)
                     /locus_tag="HMPREF0733_RS02545"
                     /old_locus_tag="HMPREF0733_10534"
     CDS             complement(589342..591603)
                     /locus_tag="HMPREF0733_RS02545"
                     /old_locus_tag="HMPREF0733_10534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775420.1"
                     /db_xref="GI:908631387"
                     /translation="MKGDIMRLYGKKNNSGSSARYPSGEPSEINSSNLHAVGSSHGGI
                     IRGVALWSARRPIWALLVWVLLIGLTVSLSTLIPTRMAGEVDSLNGQSREAAVMARDA
                     GKHNAAEENVLLKRSDGAEISEEQDGVAIEDLHRQLGTASHVESVKDPVPSEDGKSVL
                     ITASIEGNPDTASERVEGVHSAVSDFSSHHSEYTTVNTGNATINSDFQTWLGEDLNHA
                     TVVTLPITLIILLIVFGAWIVAGLPLLVGLASVFSATGLWAVASQVFPDQGLISHVIL
                     LIGMAVGVDYSLFYVRRFREERTVGHQRLEATHIAAETAGHSVLVSGIAVCLSMAGLL
                     LVQDVLSTGAAIGAILVVLVAMMSSLTVLPALLMLLRGAVDRPRVPFVWRLSQGTGGS
                     KLAHRIIGPVSRYPWVALAIMAVLFGALAAPAASMSLKMTTVDDYPRYLSSMQALDDI
                     REAFPGSKSSANVVLEGEPEQVRQAVDKVTQHAGEDTQTYAGVSNTWTSADQRTAVVD
                     IAVKHTSDSAQAHQAVNRLRSDVAPSLGVSRWAVGGDIASGMDYTQNLSSKIPWVVGI
                     VIGVTFIFMFGAYRSIPLAGITIVLNLASTLAAFGAVTAIFQGTWAENLLGFTSTGHV
                     VSWIPLMLFVILSGLSLDYHILVVSRIREFAAAGYSTQDAIREGITRTAGVITSAAVI
                     MIAVFCVFGGLSFIEMKQIGIGLAFAVLLDATVVRLVFLPALLMVCRRFLWWPSKNIG
                     QGIKTSYEMLPRS"
     gene            591917..593125
                     /locus_tag="HMPREF0733_RS02550"
                     /old_locus_tag="HMPREF0733_10535"
     CDS             591917..593125
                     /locus_tag="HMPREF0733_RS02550"
                     /old_locus_tag="HMPREF0733_10535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397820.1"
                     /db_xref="GI:503163159"
                     /translation="MTSAEPHKTQSEHLLTAQTEGARTASEDSSPAVGHIPARHQPVT
                     QPSDTQIRRWRRYLADEESEARIYRYLAQRAEGKDREILMQVAEAEKRHQQHWRDMLG
                     EHAGKPSRPSLSSAILQFLARHFGSVFILAMAQRAESRSPYAEDPDATEEMAADEAIH
                     EEIIRALATNGREKLSGNFRAAVFGANDGLVSNLALTIGITASGASSSMVLLSGVAGL
                     LAGALSMAAGEFVSVRSQRELLDASQPTQVTLRVAGDLDIDANELELIYRARGMDEEA
                     AHHRALERFGYLDCDCDPSLSHRADEEGEEENVALGTDIGAAAASFSFFASGALVPIL
                     PYIFGISGVWAMVLSLLFVAMALGFTGGIVGLLSGSSPMRRGLRQILIGLGAAGITYL
                     LGLAFGTTLG"
     gene            complement(593506..594423)
                     /locus_tag="HMPREF0733_RS02555"
                     /old_locus_tag="HMPREF0733_10536"
     CDS             complement(593506..594423)
                     /locus_tag="HMPREF0733_RS02555"
                     /old_locus_tag="HMPREF0733_10536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA synthetase subunit alpha"
                     /protein_id="WP_004005553.1"
                     /db_xref="GI:490103709"
                     /translation="MSIFVNKDSKVIVQGITGGEGTKHTARMLAAGTNIVGGVNARKA
                     GTTVTHKAKDGSDVELKVFGTVAEAIAETGADVSIVFVPPAFTKAAVLEAIEAKIGLV
                     VVITEGVPVQDTAEFWAAAKASVDENGKQITRIIGPNCPGIITPEECLVGITPANITG
                     KGKIGLVSKSGTLTYQMMFELADIGFTTAIGIGGDPIIGTTHIDALEAFEADPETEGI
                     VMIGEIGGDAEERAAEYIKANVTKPVVGYVAGFTAPEGKTMGHAGAIVSGSSGTAQAK
                     KEALEAAGVKVGKTPSEAANLMREIFANK"
     gene            complement(594453..595619)
                     /locus_tag="HMPREF0733_RS02560"
                     /old_locus_tag="HMPREF0733_10537"
     CDS             complement(594453..595619)
                     /locus_tag="HMPREF0733_RS02560"
                     /old_locus_tag="HMPREF0733_10537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006887662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA synthetase subunit beta"
                     /protein_id="WP_004005554.1"
                     /db_xref="GI:490103710"
                     /translation="MDLFEYQARDLFAKHGVPVLKGIVATTPEEAKAAAEEIGGLTVI
                     KAQVKTGGRGKAGGVKLAKNPDEAYEYAQQILGMDIKGHTVHRVLVAQGADIAEEYYF
                     SILLDRANRSYLAMCSVEGGMEIEQLAAERPEALAKVEVDPLVGIDSAKAQEIVEAAG
                     FSAELQPKVVEVLVKLGDVFNKEDATLVEVNPLVQTPEGDILALDGKVSLDDNAEFRQ
                     PDHVALVDKSAENPLEAKAKQHDLNYVKLDGEVGVVGNGAGLVMSTLDVVAYAGEKHG
                     NVKPANFLDIGGGASAEVMAAGLEIILGDEQVKSVFVNVFGGITSCDAVAEGIVKALE
                     ILGDSATKPLVVRLDGNNVEEGRRILSEANHPLVVQATTMDSGADKAAELANKA"
     gene            complement(595847..598720)
                     /locus_tag="HMPREF0733_RS02565"
                     /old_locus_tag="HMPREF0733_10538"
     CDS             complement(595847..598720)
                     /locus_tag="HMPREF0733_RS02565"
                     /old_locus_tag="HMPREF0733_10538"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase PcrA"
                     /protein_id="WP_013397821.1"
                     /db_xref="GI:503163160"
                     /translation="MSEPTNSASGVEPAADTLFADLENTQPPYDPEYDAHIPPEDTSA
                     PEEDPFAHESFMPELNPEAVNAQTVTAHEDALGEFMPPAYRVGGYGSEYNPEDPYGER
                     TYSLGTIDPATLIDGLNDRQREAVLHSGSPLLIVAGAGSGKTRVLTHRIAHLLATGRA
                     TPGQILAITFTNKAAAEMRERIQALIGPRAQHMWISTFHSFCVRVLRREAKALGLKST
                     FTIYDSADSQRLLTLIIKELNLDTKKFAPKAVGHRISALKNELVSAEEYSAAAANNPW
                     EKTIAQIYTVYTQRLRAANSLDFDDLIGKTVFLLKKFPEIANYYRRKFRHILVDEYQD
                     TNHAQYALVRELVGAHPQGNAREQGPYPDAPPPGELTVVGDSDQSIYAFRGADIRNIT
                     DFESDYPNAHIILLEQNYRSTQNILSAANAVIERNPNRRPKKLWTASGEGTKIVGYVA
                     ESEHAEARYIAQEIDRLADEHGIKPSDVAIFYRTNAQSRALEELLMRAGLPYRVVGGT
                     RFYERKEIKDALAYLRALTNPDDDVSVRRILNEPKRGIGAKSETVVADYASAQRISFF
                     AAARAAAAEPGSVPGLGAAAVKKYAEFVKLMDDLAQIARTESAATTLEAVLEQSGYLA
                     ALRESKDIQDESRVENLSELLDAMVEFEAENPGADLEQFLEHVSLVADADSIPSRGAS
                     ADGQTPSAAQIAAEAAEAKAQGMITLMTLHTAKGLEFPVVFLTGLEHGLFPHQRALTD
                     EGEMSEERRLAYVGLTRAMQRLYVTRSETRTMWGKSQFNPPSPFLEEIPEELIEWRRL
                     GGFAGFGASGMGAYANGASGYGGYGQGGYRGASGYNSGGGRNADGRGLDKGSAGGYGT
                     GYDESRSRASREPSTAAVNGSASYGLAAAASASGAVRNRSRVHQGKEIPQLKVGDTVR
                     HTKFGEGRVLALEGTGDKTVAKVRFASEEKRLLLRYAPLEKVS"
     gene            598867..599715
                     /locus_tag="HMPREF0733_RS02570"
                     /old_locus_tag="HMPREF0733_10539"
     CDS             598867..599715
                     /locus_tag="HMPREF0733_RS02570"
                     /old_locus_tag="HMPREF0733_10539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-demethylubiquinone-9 3-methyltransferase"
                     /protein_id="WP_013397822.1"
                     /db_xref="GI:503163161"
                     /translation="MDQVITPAIWCDGTADKAAQFYADVFRDASVTEQAPGIAATVSI
                     HGFKLSLVNGGNQYAPNPSISCILNFDPLLFGGEEQARAYLDELYERLSTGDVLMELG
                     EYPFSPRYAWVRDRFGMTWQLMLTDPDGDPRPFVIPSFMFGGTNHANAEEATDAWIAL
                     FDNARRGALYRYEEGGPLDAGAVMFTDFTLRGTWMAATDSGTFHDFTFTPGVSIIVSC
                     RDQEEIDRYWAGLSAVPEAERCGWCVDRWGVSWQIVPHNITELMADAATRDKILHMGK
                     IDLTKL"
     gene            599861..600571
                     /locus_tag="HMPREF0733_RS02575"
                     /old_locus_tag="HMPREF0733_10540"
     CDS             599861..600571
                     /locus_tag="HMPREF0733_RS02575"
                     /old_locus_tag="HMPREF0733_10540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397823.1"
                     /db_xref="GI:503163162"
                     /translation="MEGMGLSQGQKKRLYGEQAQQGQSRPQSGRKPQEHKIHELKQVM
                     DDRAVRANAPAEQQRSKTFLYVAVTISLLLGAYVAFWVLPSYGRLANAQVPDLSPVTS
                     AEALSAFASGLGDNLGAYTYAHRSVGIVFALFFGLSLAFLAYTSRLPKVLRTLFTAAP
                     VGYLLVHIATIFMLDAALADPAHQPGALNMLLPVDWALLLLSLAGIAYQLVRSIKDAA
                     STFITGGPNVEADGKPEE"
     gene            complement(600677..601522)
                     /locus_tag="HMPREF0733_RS02580"
     CDS             complement(600677..601522)
                     /locus_tag="HMPREF0733_RS02580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall anchor protein"
                     /protein_id="WP_041321563.1"
                     /db_xref="GI:752672854"
                     /translation="MSSLFDRRTALLVLGSSAGAVFLSACAPKVNGIEATSPASSSSS
                     SSSSSSSSSSSSSSSSSSSSASRSASSSPSPSIDMSGSYKGDINFESVLEYEKSGTFE
                     PATKEHAQRNTPKPKKPGSLTEKSLKGMRDTIAYTAATVEYAINTGDYSLIENGPMST
                     SEKNHFLDSEMKDLLQRARDGKRWVDNAKITYTLDEDKPVWDGEVYSWKRTFTMNYGK
                     FEVDDGKVEDVSDGGGDAKREYKGHLLAEYRNGSWVVAGIASQFEDDDDPVTPSSSPS
                     ASAGI"
     gene            complement(601745..602578)
                     /locus_tag="HMPREF0733_RS02585"
                     /old_locus_tag="HMPREF0733_10543"
     CDS             complement(601745..602578)
                     /locus_tag="HMPREF0733_RS02585"
                     /old_locus_tag="HMPREF0733_10543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397826.1"
                     /db_xref="GI:503163165"
                     /translation="MSSIFTRRNALFVFGTGAGAALLSACGGNSTAESSGSGSASSSD
                     VSPSASSSSSSSSSSSASASSSSASEASSPESSPSQSGATDIDMSGSYGGKINFESVL
                     EYEKSGTYEPATKEHPAKNVPKPKKPAGADEKSLKGLHLSIAFAVAATQYAYNTGDYS
                     LLEQSSMSEPERNYFLREEKERLDKTREGTFWPDNITIEYTLTEESPRLEGDGEYIWD
                     REFIVEYGKFEVVDGKVEYPSDEDHDMIYRDKFIGNLTAQYINGAWITSAVAIQPKSK
                     S"
     gene            complement(602784..602856)
                     /locus_tag="HMPREF0733_RS02590"
                     /old_locus_tag="HMPREF0733_t10008"
     tRNA            complement(602784..602856)
                     /locus_tag="HMPREF0733_RS02590"
                     /old_locus_tag="HMPREF0733_t10008"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(602821..602823),aa:Arg,seq:cct)
     gene            602921..603901
                     /locus_tag="HMPREF0733_RS02595"
                     /old_locus_tag="HMPREF0733_10545"
     CDS             602921..603901
                     /locus_tag="HMPREF0733_RS02595"
                     /old_locus_tag="HMPREF0733_10545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397828.1"
                     /db_xref="GI:503163167"
                     /translation="MSIFIDPPVWPAHGTVFSHLISDTSLAELHDFAAKTGISPRAFD
                     ADHYDVPAYRYEGLVRAGAREVSGSQLTRILIDSGLRVPLRERPNKIRPRLMRAWDSL
                     LPGHTALGEDLLERYEQPHRKYHTSVHLSEMLTALKTLYKRHHTATPRAVLLAAWFHD
                     AVYEANPGDDEAASADLARTALTPLASTGFLTNRGVTAIAHLIELTASHQLADGIEEY
                     TSGALTRADAEFFLDADLAILAADSPRYTRYVAGVRAEYAHYAPDAFTRGRAAILQGF
                     LNRTAIYASDTAHLLWDAPARLNLRTELEGYRAALGEQPAKEGALNCARR"
     gene            complement(603903..604151)
                     /locus_tag="HMPREF0733_RS02600"
                     /old_locus_tag="HMPREF0733_10546"
     CDS             complement(603903..604151)
                     /locus_tag="HMPREF0733_RS02600"
                     /old_locus_tag="HMPREF0733_10546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397829.1"
                     /db_xref="GI:503163168"
                     /translation="MPTQFESPKNSSDQEFTYLAVGMVAGAIPGIVIGLLVALPLGNP
                     AMWVSVVGGIGIIIGMVSARMIYRKKTRARKNPRSEQD"
     gene            complement(604289..605083)
                     /locus_tag="HMPREF0733_RS02605"
                     /old_locus_tag="HMPREF0733_10547"
     CDS             complement(604289..605083)
                     /locus_tag="HMPREF0733_RS02605"
                     /old_locus_tag="HMPREF0733_10547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation factor (SUA5)"
                     /protein_id="WP_013397830.1"
                     /db_xref="GI:503163169"
                     /translation="MENTSSTPIREDWTGEASPTAVATLSGTGGLIVAPTKVGYILMA
                     TDGEGLERKFDAKLRKREKPGVVLCASLEQLDKLAQMTPEIREFYRKHWDDDILLGCI
                     LPWREDAEKYLPDETTKELARDARATSCFVVRFGTPAEQIVRALWENEGKLTFASSAN
                     PSGIGNKGRVTGIGDRIENSVDVIVRGDEYVKSIQPDKTDETRHEQGVMVSMVDAEGN
                     LVPEQHGERGVTPAPTLIRKGLDYEEIMRHLSDSFPSWDYRHGMYY"
     gene            complement(605370..606023)
                     /locus_tag="HMPREF0733_RS02610"
                     /old_locus_tag="HMPREF0733_10548"
     CDS             complement(605370..606023)
                     /locus_tag="HMPREF0733_RS02610"
                     /old_locus_tag="HMPREF0733_10548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_004005562.1"
                     /db_xref="GI:490103718"
                     /translation="MAKKIVRNAGIVAVAGAAVIGSNIPANAFAEVPAATDLSYDYSS
                     YEYDYSSYQTPATSYVAPQAEQQTEYVAPAQQTAQVETTSAQAPAPAADKTPAPATNN
                     ATRDAIVSAAKAAQGTGYVWGGRSYGAWDCSGFVSYIFAQQGIKLTPYTYTMSTELRA
                     TANPQPGDIVFTNGYNHVGIYVGNGQMVSALNPSQGTQLTPVDGNGYMPVDGYYTAF"
     gene            complement(606876..607580)
                     /locus_tag="HMPREF0733_RS02615"
                     /old_locus_tag="HMPREF0733_10549"
     CDS             complement(606876..607580)
                     /locus_tag="HMPREF0733_RS02615"
                     /old_locus_tag="HMPREF0733_10549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DtxR family transcriptional regulator"
                     /protein_id="WP_013397831.1"
                     /db_xref="GI:503163170"
                     /translation="MTDLIDTTEMYLRTILELEEEGITPMRARIAERLDHSGPTVSQT
                     VARMEKHGLLTVEPDRHLELTDEGRKKAVEVMRKHRLAERLLSDVIGLDIEYVHDEAC
                     RWEHVMSDHVERRILDMLNQPKFSPYGNAIPGLEELGIDSEKNDERTVPMALAARDSG
                     PEDRFTISRFPESIQTDIDLLKVLADAGITFGASVSVVGGDNNDVIVRADGEDASISL
                     DLDVANAIVVKRASAL"
     gene            complement(607794..608396)
                     /locus_tag="HMPREF0733_RS02620"
                     /old_locus_tag="HMPREF0733_10550"
     CDS             complement(607794..608396)
                     /locus_tag="HMPREF0733_RS02620"
                     /old_locus_tag="HMPREF0733_10550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397832.1"
                     /db_xref="GI:503163171"
                     /translation="MRAKTSHEPLAVIALGDALIGSMSEQVNQQPDESTVPTLEHDAE
                     TTAAAHDPFVVEEDELPTGEPTLGPAHRRRRTTKVDDILAEAKDIALTGVEAVAPHNS
                     IGLVHHLRGEEERLTTHLFECLLPGYRGWFWFATLSRAPRSKVATICEVGLIPGDDAL
                     LAPEWVPWADRLQASERDNNGAEDEGASTEEQKRFSVSFC"
     gene            608506..608772
                     /locus_tag="HMPREF0733_RS02625"
                     /old_locus_tag="HMPREF0733_10551"
     CDS             608506..608772
                     /locus_tag="HMPREF0733_RS02625"
                     /old_locus_tag="HMPREF0733_10551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397833.1"
                     /db_xref="GI:503163172"
                     /translation="MSSKSVSSSEPVEAAAALPYTRAIRWLGAGGGILAVVCVICGVV
                     MLLMKWAGAHPPALMSQIPLILLPVAFLALMVSIVLAVLRRRAS"
     gene            608833..609537
                     /locus_tag="HMPREF0733_RS02630"
                     /old_locus_tag="HMPREF0733_10552"
     CDS             608833..609537
                     /locus_tag="HMPREF0733_RS02630"
                     /old_locus_tag="HMPREF0733_10552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_013397834.1"
                     /db_xref="GI:503163173"
                     /translation="MSAEAKLLVVDDEFNILELLATSLRFAGFEVVTAGNGREAIEKA
                     ENEQPDLIVLDVMMPGMDGFEVTRRLRDAGRTYPVLFLTAKDATEDKVAGLGAGGDDY
                     VTKPFSLDEVIARIRAILRRSRNAQEEDDAILRVDDLSLNIDTHEVFLGDEEIDLSPT
                     EFNLLHYLMLNANRVLSKAQILDHVWEYDFNGDSSIVESYISYLRRKIDNNREGHEPL
                     IHTKRGVGYMIRGSRS"
     gene            609544..611034
                     /locus_tag="HMPREF0733_RS02635"
                     /old_locus_tag="HMPREF0733_10553"
     CDS             609544..611034
                     /locus_tag="HMPREF0733_RS02635"
                     /old_locus_tag="HMPREF0733_10553"
                     /EC_number="2.7.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013397835.1"
                     /db_xref="GI:503163174"
                     /translation="MPLKPVDRLPHSLSLRTQLVLVTSVLIALAIAVTSLVAISALRA
                     QMVHQLDEEMKASSSSLVSSVGTSQTRQDGAVGSYRVYVLDQHGNVLYSIAGADQQAE
                     NEPVLTGWDSEKVKKYHETGTTVNSRTGSNDWRIMPISLESSTNGQASSMVIALPLKQ
                     TNQVVALVGVLTFAFGLATLAAAIAMTWVIVTRTFEPLARVEQTAAKIAAGDLSQRIE
                     DYNPSNEIGNLAISLNTMLAQIESSFNAQAKSEAKMRRFVGDASHELRTPLVSIRGYS
                     ELYRQGALPNDEAVATAMGRIESESKRMGQLVEDLLTLARIDERRESKLAPFDLFHLA
                     VDASNDAYATSPDREVSLVGLTDDVAPTSAPVIGDESRMRQVVANLLTNAMRYTPAGT
                     PLEIAVGVREDVPGYPLSVIEVRDHGPGIHGEDRERVFERFYRTDTSRSRETGGTGLG
                     LSIVAAILEQHDGSVHIEETSGGGATFVISLPFYPAPVMTDNGVSQ"
     gene            611308..611598
                     /locus_tag="HMPREF0733_RS02640"
                     /old_locus_tag="HMPREF0733_10554"
     CDS             611308..611598
                     /locus_tag="HMPREF0733_RS02640"
                     /old_locus_tag="HMPREF0733_10554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VII secretion protein"
                     /protein_id="WP_004005567.1"
                     /db_xref="GI:490103723"
                     /translation="MAQFVVDSETIAAKAAQAKTQVANISAEVTGMTASLQDLQGSWT
                     GSASTNFQAVLDNWRGTQKRVEESITQINEALDRAGVNYAETENANAAMFVG"
     gene            complement(611767..613089)
                     /locus_tag="HMPREF0733_RS02645"
                     /old_locus_tag="HMPREF0733_10555"
     CDS             complement(611767..613089)
                     /locus_tag="HMPREF0733_RS02645"
                     /old_locus_tag="HMPREF0733_10555"
                     /EC_number="3.1.26.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease H"
                     /protein_id="WP_013397836.1"
                     /db_xref="GI:503163175"
                     /translation="MQNQIIAAADGSALGNPGPAGWAWYIDENHWAAGGWEHGTNNMG
                     EIKAVLDLFEATAHRAESKLLIYCDSQYVINSLTQWMPGWKKRGWKKADGKPVQNRDL
                     LEALDAASTGRDYEMVWVKGHAGHELNEAADARANAAAQAFKEGREPETGPGFPGSPH
                     TAGEQSTPSTQAAQTRETENHAHAQDPDTLAADAHLSLEDFTETEVERARQGFDSLKL
                     NGILKSASAIAAPDPQAVQERKTKLAEASARAAEREAQVQQRVLAEQELAESEAEENE
                     EFEGEEFEEAEQESNSQGSVTENAVPEEPASAPTEIAASVPAQPDPSAPNPEDAMHAE
                     RELEMRGGSMSEPEISALLHERLVWVTATGRSVSRADTIAYRARAFTQQGNPAKQGVQ
                     VVDDHNVLIMAAVQTARGRVNRSSLWHYDTTAAPNGWRLRFRQETTAS"
     gene            613204..614262
                     /locus_tag="HMPREF0733_RS02650"
                     /old_locus_tag="HMPREF0733_10556"
     CDS             613204..614262
                     /locus_tag="HMPREF0733_RS02650"
                     /old_locus_tag="HMPREF0733_10556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="WP_013397837.1"
                     /db_xref="GI:503163176"
                     /translation="MTIHSISSGDADVSRTHISVFTLPTRTFTGGLRFTWLDYVGEEA
                     RRKAASIHSPSASVSYLATEALMRALAAPRLGISGRSARTITVDRSCRLCTSGKPHGK
                     PRITGVNFNMSQVPSLAAGGFCAQQQVVLGIDLEAVQASLFPGFARVALTIDERAAYE
                     SLPPGQQQAAGVAIWTAKEAVLKATGHGLSVSPQTVQIECDDATLAMVSALCEPANPL
                     DAPGRQDRPCEHELSVSPRVSVRATLTLPEDSDTSTEETSAGGEDAGKHQTPKNRDIS
                     GENTPTNSERSFFITWSVLTLSPVAHPTADTAGRAAHPERFLLAVATEDTVPVVDVHS
                     VATPLDVKRLLEPPAAAY"
     gene            complement(614225..615355)
                     /locus_tag="HMPREF0733_RS02655"
                     /old_locus_tag="HMPREF0733_10557"
     CDS             complement(614225..615355)
                     /locus_tag="HMPREF0733_RS02655"
                     /old_locus_tag="HMPREF0733_10557"
                     /EC_number="5.4.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismate synthase"
                     /protein_id="WP_013397838.1"
                     /db_xref="GI:503163177"
                     /translation="MSNNLPDFMFATGTRVMRTAGSLRQVTLEDARAAAEAAGTAVVG
                     LIPFDPNAPAHLFVPERLQIDDIPVPEHEVTLAEPKQIEGRENPGYRQAVATAVERMK
                     AHQLDKVVLSRLLRADYAPGTLDLAGVYNNLRAQQPNTFVFSVKLPQDHRGLEHPYLM
                     GASPELIFSTEPDTGEGSAFKTHPLAGSAPRIAEHGSAEDEALGQRLMASRKDRGEHA
                     TVIADIRAQLEPMTRQLTIPEAPSLLQTPQLWHLGTPISGVLKRGMTCLDGARAIHPT
                     PAICGAPTEAARRMIAELEPFSRDYFGGLIGYMNADGSGQWALVLRCAEVDAQTAILY
                     AGAGIVAESDPVLEHTETGTKLGSFGRALGINTLPQVVPADA"
     gene            complement(615377..616144)
                     /locus_tag="HMPREF0733_RS02660"
                     /old_locus_tag="HMPREF0733_10558"
     CDS             complement(615377..616144)
                     /locus_tag="HMPREF0733_RS02660"
                     /old_locus_tag="HMPREF0733_10558"
                     /EC_number="1.3.1.28"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase"
                     /protein_id="WP_013397839.1"
                     /db_xref="GI:503163178"
                     /translation="MSWVIVTGANGGIGAATVHELIKNNCSVYAADLANKPHESFAAY
                     GDAIFRYRSVNVSDEESVRALAHAAAEVGEPIQGAVLAAGIVHSKPLLETSFEDWKRL
                     HAVNADGVFLCLREFARVMIEQIQTSPENTRSLVTVASNAARVPRAEFGAYGASKASA
                     VRVSSSFGLQLARHGIRVNTVCPGTTRTPMVTDAWNGEDLSALPVAGSPETFRLGIPL
                     GRIADPADIAAVNAFLISDASRHITMQNIVADGGATF"
     gene            complement(616141..616839)
                     /locus_tag="HMPREF0733_RS02665"
                     /old_locus_tag="HMPREF0733_10559"
     CDS             complement(616141..616839)
                     /locus_tag="HMPREF0733_RS02665"
                     /old_locus_tag="HMPREF0733_10559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase"
                     /protein_id="WP_041321566.1"
                     /db_xref="GI:752672857"
                     /translation="MALPKIAPYSYREQEHQNRVNWRVDPARSALLVHDMQRYFVRAF
                     ELERDGQPLPDAQINIAIANIRRLLDAAHAANIPVYYTAQPPRQNPADRRLLTDFWGD
                     GLQDDENARILDELAPTEADTVLTKWRYSAFARSPLEEQLKDLGRDQLIIGGIYAHIG
                     CLTTALEAFMRDIQPFMVADALADFTEKEHRMACEYASGRCSRVLNTAEVLEHINASD
                     LVTADEPELRKVCV"
     gene            complement(617051..618457)
                     /locus_tag="HMPREF0733_RS02670"
                     /old_locus_tag="HMPREF0733_10560"
     CDS             complement(617051..618457)
                     /locus_tag="HMPREF0733_RS02670"
                     /old_locus_tag="HMPREF0733_10560"
                     /EC_number="1.16.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="WP_013397841.1"
                     /db_xref="GI:503163180"
                     /translation="MTTARLHFDMVVIGFGKGGKTLAGAYAKTGKNVALIEQSSNMYG
                     GTCINIGCVPTKALVHRADEFRASGEKNAEAADAAYESAVIFRDKLTGAMRAKNREIL
                     ESNATAKLIDGHARFLSDTEVEVTAGEDKLVVTADCFIINTGAVATIPPIPGARESKR
                     VLTSTELQKLTPRPKRLGIIGGGPIGVEFAGIFSSYGTEVTLLEGAPALFGRYDDDVA
                     QAAREIIADQGITAHAGVRIETVTDNADSVTVNYLDSEGASKHLEVDYVMVATGRKPA
                     TEGLGLENTSIETTEHGAIAVDEHLRTTAPNIFALGDVNGGPQFTYISLDDYRVVLSQ
                     LLGDGSRSTKDRQAVAATIYMNPPLSSVGLTERDALAAGHTIKVAAKPVAAIAAMPRA
                     KTLENPRGIMKFVIDAETDQILGAQLLVVESMEVINLVALAMRHNITASQLRDEIYTH
                     PSITEGLNEVLANAVPVN"
     gene            618470..618685
                     /locus_tag="HMPREF0733_RS02675"
                     /old_locus_tag="HMPREF0733_10561"
     CDS             618470..618685
                     /locus_tag="HMPREF0733_RS02675"
                     /old_locus_tag="HMPREF0733_10561"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397842.1"
                     /db_xref="GI:503163181"
                     /translation="MKFEVFIIRVWCSGELQQAAYGIYSWFLQENIKFFDAALGAGRL
                     PYLMQPKKSLYVNKALEIPLYSHKGSF"
     gene            complement(618849..619109)
                     /locus_tag="HMPREF0733_RS02680"
                     /old_locus_tag="HMPREF0733_10562"
     CDS             complement(618849..619109)
                     /locus_tag="HMPREF0733_RS02680"
                     /old_locus_tag="HMPREF0733_10562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_013397843.1"
                     /db_xref="GI:503163182"
                     /translation="MTITDKIAPIHPGEVLLEDFIEGFGITQNKVAVAIGVPPRRINE
                     IVHGKRGITADTAARLARYFGTTPQFWLNLQTTYELDMVEDL"
     gene            619338..619871
                     /locus_tag="HMPREF0733_RS02685"
                     /old_locus_tag="HMPREF0733_10563"
     CDS             619338..619871
                     /locus_tag="HMPREF0733_RS02685"
                     /old_locus_tag="HMPREF0733_10563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397844.1"
                     /db_xref="GI:503163183"
                     /translation="MDARDVLREAASRPATEAKALVNTLPEGVLNAHAGGHTNSIAWL
                     LWHAGRQMDVQLAQLTGKPQVWHSQGFDARFNLGELGDTVGYGHTAEQARAVVVEDAA
                     LLVEYLGATTAALSEYIAGLSEADLDDVIDTSWTPHVTRGVRLVSMIDDAAQHVGQAA
                     YVVGILAGGAASSDKEG"
     gene            619946..620389
                     /locus_tag="HMPREF0733_RS02690"
                     /old_locus_tag="HMPREF0733_10564"
     CDS             619946..620389
                     /locus_tag="HMPREF0733_RS02690"
                     /old_locus_tag="HMPREF0733_10564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321867.1"
                     /db_xref="GI:752673158"
                     /translation="MKIIDILHEFYGDFDFIKEKWNEDYEGLLIKTKEEQKYKRCRLA
                     KRTPKKEGYFTVFWKKDQNNNNVPYTNEDLGDELVIVVIDSYNSGLFIIPKEVAVNKR
                     ILSTRDSKGKMAMRFYPPWCTNLNKTAQSTQKWQLEYFRSYKIGN"
     gene            620615..621004
                     /locus_tag="HMPREF0733_RS02695"
     CDS             620615..621004
                     /locus_tag="HMPREF0733_RS02695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018377077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397847.1"
                     /db_xref="GI:503163186"
                     /translation="MRWSCLRRRLFPKWALEPVANIEPYGGYLFEVTAGDIILLWRIS
                     FSTFNTQSWFPKYFEHTYGIDAAFDLRMLVEAGFVKVESAANSLDLVTAPALRKALKD
                     AAVSGLNSTKKANLMSLARERLSPRPT"
     gene            complement(621101..622444)
                     /locus_tag="HMPREF0733_RS02700"
                     /old_locus_tag="HMPREF0733_10567"
     CDS             complement(621101..622444)
                     /locus_tag="HMPREF0733_RS02700"
                     /old_locus_tag="HMPREF0733_10567"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321569.1"
                     /db_xref="GI:752672860"
                     /translation="MDYSAHEVISFVPKFVPLDQSTLTGFCALVLALFINVRGEVKDI
                     DELPRNAQIRAVSYKKFANLVIYIVSFIVFSHSVNSVYKMLVDEYPVENFNPSFLTLI
                     LFASFMLVISALPGEYRLSLEGQWKDKLNDLIVFNNINIKNKLDFQDISQSAPEGFYK
                     YYSSYSYNKPYLSYFASLSGYISLRKYLYIYIIYYFCISLLFIFPILALYVSDLIYDP
                     VPLFKLCLLGFIGNFLISLVCFFIYPLPILFSSYNKDSLLVYYPLQILHYVVLSILWG
                     GALSYTGIRLIEVFNKKYNMGYYNIFELLGIVWYLSLVIFIPATWWFLRRIFIKYIGQ
                     KSLGVSKISVGNVLYFAESWYKWIEAKAIYEEAFFYRNSMSIDNSEIPETDYGEFLDY
                     YTEYKSKLRELNKRKKYKDNNSYKQILPGNTRVTATFNPDLANTEVNCAEPEVDP"
     gene            complement(622679..623275)
                     /locus_tag="HMPREF0733_RS02705"
                     /old_locus_tag="HMPREF0733_10568"
     CDS             complement(622679..623275)
                     /locus_tag="HMPREF0733_RS02705"
                     /old_locus_tag="HMPREF0733_10568"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321571.1"
                     /db_xref="GI:752672862"
                     /translation="MFLQPVSYTYVEEQIKSGKTTEEIVTSKLPYYFKGKYGSRDIET
                     SVVENPLYENGSSFPEKVEVTTYPYLMIAVQIDYKYIGDSENKTKYFVTNPGGKYDID
                     GNRYNNIIKYISENSYMEIKMEDIKSSQETGKKESVYKSAHRKAIDILNNAKNKEERK
                     QLFKLIGGIEGGYGGILKDLNYMATGIDVIGEYGRREY"
     gene            complement(623300..623656)
                     /locus_tag="HMPREF0733_RS02710"
                     /old_locus_tag="HMPREF0733_10569"
     CDS             complement(623300..623656)
                     /locus_tag="HMPREF0733_RS02710"
                     /old_locus_tag="HMPREF0733_10569"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004182951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase F1 sector subunit delta"
                     /protein_id="WP_013397850.1"
                     /db_xref="GI:503163189"
                     /translation="MSKRKKNNKKTVKSEKYIQKSENAPEATLEMEISKKNNVRKYIL
                     NIFPIFISIVALILSFITHVTNENRVNYQESESFNVVQNLWNDSPEYILYNESTKKLS
                     EIPSPTYIMFVPTKVK"
     STS             623399..623846
                     /standard_name="D1S3696"
                     /db_xref="UniSTS:474274"
     gene            complement(624200..625330)
                     /locus_tag="HMPREF0733_RS02715"
                     /old_locus_tag="HMPREF0733_10570"
     CDS             complement(624200..625330)
                     /locus_tag="HMPREF0733_RS02715"
                     /old_locus_tag="HMPREF0733_10570"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="WP_013397851.1"
                     /db_xref="GI:503163190"
                     /translation="MECAYYRESLCRSCTSIETPYPAQIAAKQADARRLLAAYPHLTW
                     LEPVASDEAHFRNKAKLVVGGSAQNPSLGIVDYRSGRATDLSECPLYIEPIERAIPVL
                     HELIQRADLTPYDIPARRGELKNILVTASDTGELMVRFVLRSKKLLVPIRRQLGWLQE
                     RLPKLAVLSVNLLREHVALIEGDEEIILTDRQTLPMRVNGMSLHLRPQSFFQTNTQIA
                     QAMYAQGREWVAQVQPRTLWDLYCGVGGFALHAAQVMHGEVTGIEISAEAIRSAQRTV
                     AEQGLEGVKFAAGDATEFAVNARETPEMLVVNPPRRGIGERLCAWVEGSEIEHVIYSS
                     CNAKTLASDLARMPSYKPVAARVLDMFPHTNHYEVMTLLRRG"
     gene            complement(625440..625697)
                     /locus_tag="HMPREF0733_RS02720"
     CDS             complement(625440..625697)
                     /locus_tag="HMPREF0733_RS02720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005525847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321868.1"
                     /db_xref="GI:752673159"
                     /translation="MGSRNSFLSIGSVNSVCSIGSVNSAFSIGSVFSFGSIGSAFSSL
                     SIASCLSFMSVLSVLSEASVLSARSYRSVLKAGQQKKAKKP"
     gene            complement(626035..627657)
                     /gene="groEL"
                     /locus_tag="HMPREF0733_RS02725"
                     /old_locus_tag="HMPREF0733_10572"
     CDS             complement(626035..627657)
                     /gene="groEL"
                     /locus_tag="HMPREF0733_RS02725"
                     /old_locus_tag="HMPREF0733_10572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005589.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_013397853.1"
                     /db_xref="GI:503163192"
                     /translation="MAKLIAFDEEARRGLERGLNTLADAVKVTLGPRGRNVVLEKSWG
                     APTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDIAGDGTTTATVLAQALVREG
                     LRNVAAGADPLSLKRGIEKAVEEVTKTLLDSAKEVETEEEIAATASISAGDQEIGKLI
                     AQAMEKVGKEGVITVEESNTFGLHLELTEGMRFDKGFLSGYFVTDPERQEAVLEDPYI
                     LVVNQKISNVKDLVPVLEKVMQSGKPLLIIAEDVEGEALALLVLNKMRGSIKSVAVKA
                     PGFGDRRKAMMADIAILTGGQVITEEVGLSLDTATLEMLGKARKVVVTKDETTIIEGA
                     GDAAALEGRVAQIRAEIANSDSDYDREKLQERLAKLAGGVAVLKAGAATEVELKERKH
                     RIEDAVRNAKAAVEEGIVPGGGVALIQAGTKVFDKLDLKGDEATGANIVRVAIDAPLK
                     QIATNAGLEPGVVVDKVRSLPEGTGLNAATGEYEDLMAAGINDPVKVTRSALQNAASI
                     AGLFLTTEAVVANKPEPASAAAPAADPMGGMM"
     gene            complement(628031..628582)
                     /locus_tag="HMPREF0733_RS02730"
                     /old_locus_tag="HMPREF0733_10573"
     CDS             complement(628031..628582)
                     /locus_tag="HMPREF0733_RS02730"
                     /old_locus_tag="HMPREF0733_10573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013397854.1"
                     /db_xref="GI:503163193"
                     /translation="MSQYPHDEFDDIDENTARRGTYRGVIDDPSKSPKGIIPVVVAGI
                     LSLVIGGAMYINHPRSSSPEAAARAKSYSAPASPSESSSPSASASEQAKDANVAVYNA
                     SAPGGSAAKASAALEGYTITETANWSGTPPESSTVYYKDEAKKSQAEAIAKTLNITTV
                     QESSDASILGENDIVVVLAADYS"
     gene            complement(628724..629116)
                     /locus_tag="HMPREF0733_RS02735"
                     /old_locus_tag="HMPREF0733_10574"
     CDS             complement(628724..629116)
                     /locus_tag="HMPREF0733_RS02735"
                     /old_locus_tag="HMPREF0733_10574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397855.1"
                     /db_xref="GI:503163194"
                     /translation="MPIPSSETPEPSPAGGSDAAEPAAAVPADSSEPSPTTQPASSAP
                     GTSETRETGGKTENTRKSALTDLERAMIALEKRHWKYQGTKEKAITALGLTPIAYYQK
                     LNTMIDSQRVIAAEPILMHRLREVRDRS"
     gene            629218..629892
                     /locus_tag="HMPREF0733_RS02740"
                     /old_locus_tag="HMPREF0733_10575"
     CDS             629218..629892
                     /locus_tag="HMPREF0733_RS02740"
                     /old_locus_tag="HMPREF0733_10575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase"
                     /protein_id="WP_004005592.1"
                     /db_xref="GI:490103749"
                     /translation="MTNPPLTDIMSEDWAQALAPVEDKIHAMGEFLRTEHAAGHRTFP
                     TGQNIFRAFSRPMNEVKVLIVGQDPYPTPGNAMGLSFSVQRDMPLPKSLINIYRELSD
                     DLGIEPAQHGDLSSWSDEGIMLMNRVLSVREGAPGSHRNKGWEEVTECAIRALAARNK
                     PLVGLLWGADARRTAPMLEPYPCVESAHPSPLSAHRGFFGSRPFSRVNTLLVEQGAEP
                     VDWTVK"
     gene            complement(630000..>631718)
                     /locus_tag="HMPREF0733_RS02745"
                     /old_locus_tag="HMPREF0733_10576"
                     /pseudo
     CDS             complement(630000..>631718)
                     /locus_tag="HMPREF0733_RS02745"
                     /old_locus_tag="HMPREF0733_10576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397856.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(632156..633256)
                     /locus_tag="HMPREF0733_RS02750"
                     /old_locus_tag="HMPREF0733_10577"
     CDS             complement(632156..633256)
                     /locus_tag="HMPREF0733_RS02750"
                     /old_locus_tag="HMPREF0733_10577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methicillin resistance protein"
                     /protein_id="WP_013397857.1"
                     /db_xref="GI:503163196"
                     /translation="MHEITARFATPAEIQEWDTHVIANPDGGNLLQSASFAKVKADYG
                     WKPRYIVYEGTVDRNGERQPFASYSLAFEKNIPLLGKLWYFIKGPAVHDADELPALLQ
                     ANRRLITEQKLGVFAVKIEPEIVADEHAQQVIAGTELIRTADIQPNDYTAILSTEGTE
                     EEVLKSLSSRGRNAVRRATREGCEVKRVELTDENMRAMYALMDTVGQGKVSLLLRPYE
                     YYRDFWRAFENAGQGRLYFTYEDGKPSVGAYVINYGTKGTYKDGGSKPRRKQYGDSHL
                     VQWTAITDLMKEHGISTYDFCGTPPAAELKNKEHPYYGLGLFKTSFTKNVTDFVGVYD
                     QPISELKYKLWNAGVERLMLRLWVKKHHYSFY"
     gene            complement(633612..633890)
                     /locus_tag="HMPREF0733_RS02755"
                     /old_locus_tag="HMPREF0733_10579"
     CDS             complement(633612..633890)
                     /locus_tag="HMPREF0733_RS02755"
                     /old_locus_tag="HMPREF0733_10579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase"
                     /protein_id="WP_013397859.1"
                     /db_xref="GI:503163198"
                     /translation="MAEVIATIASRVGLHARPAAIFAEAAGDLPVEVTIAAEGEPADE
                     AMDAASILSLMSLGAKHGDRVVLRAEGEGADEALETLKKILETDHDAE"
     gene            complement(634080..635774)
                     /locus_tag="HMPREF0733_RS02760"
                     /old_locus_tag="HMPREF0733_10580"
     CDS             complement(634080..635774)
                     /locus_tag="HMPREF0733_RS02760"
                     /old_locus_tag="HMPREF0733_10580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012902843.1"
                     /note="Phosphotransferase system, enzyme I; transfers the
                     phosphoryl group from phosphoenolpyruvate (PEP) to the
                     phosphoryl carrier protein; part of the
                     phosphoenolpyruvate-dependent sugar phosphotransferase
                     system (PTS), a major carbohydrate active-transport
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate-protein phosphotransferase"
                     /protein_id="WP_004005598.1"
                     /db_xref="GI:490103755"
                     /translation="MTTYKGVGVYAGRVIGPVLQMPEPIQEPKAGLRLDGESPEEAGQ
                     RIQDASVRVKEDLLARAENAGRDGKAVLKSTSQMATDRALIKSAVKLVETQQMAPERA
                     IWEAATSFADQMAALGGYMAERVTDIHDVRARIVAELTGQQAPGIPFAEEPFVLAAVD
                     LAPADTATLDPKNVIALITSDGGPQAHTAILARGLGLPAIVAAKGVTDIPDGTEVYVD
                     SNAGIVNTEPTDEDREAAEKYANRKPIADFDGKGVLADGTRVPLYANVGDGKSAEKAA
                     SLNAEGVGLLRTEFGFLGHDAEPSIEAQAATYKSVFDAFPGKHIVVRTLDAGADKPLP
                     FLNVNPEENPALGVRGFRTDWTVPGVLTRQLEAIKQASEDSDADIWVMAPMISTTSEA
                     RNFAKMLKEVGLPVHGVMVETPAAAVNAEAILGEVDFVSIGTNDLTQYTMAADRLLGD
                     LAHLNNPWQPAVLKMIKLTVKGAKRASVNAGEKKYVSVCGEAAADPALAVVLVGLGVD
                     TLSMNAGAIPAVAAVLKSVTLEQARHIANKALEQISSAEAKAAARAELPILDELGL"
     gene            complement(635816..637894)
                     /locus_tag="HMPREF0733_RS02765"
                     /old_locus_tag="HMPREF0733_10581"
     CDS             complement(635816..637894)
                     /locus_tag="HMPREF0733_RS02765"
                     /old_locus_tag="HMPREF0733_10581"
                     /EC_number="2.7.1.69"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS lactose transporter subunit IIC"
                     /protein_id="WP_013397860.1"
                     /db_xref="GI:503163199"
                     /translation="MSELITPELVLLDQNLGETKFDVISKLAHAVVDASRATDYDQLY
                     AAAEARESKTDTGIPGGIAIPHCRSAAVTEPTLAMARPKPGVSFGAKDGPADLIFFIA
                     APDGADQEHLKLLSTLARSLMKKSFTASLREAQTPEEIVDLVNDALGTGAPKKAPASN
                     DSAASNAQEAGAGASAQAATAQTDSAEATASEKPATKKIVAVTACPTGIAHTYMAADA
                     LKYAAEDLGYDFKVETQGSSGNETLTQADIDEADAVIFAVSVNVRDRNRFAGKPYVES
                     PVKRGIDEPQAMIEEALAEAENPNGKRVSAAASSGEDTSSAAEGSWGSRIYKAVMTGV
                     SYMIPFVAAGGIIVALGFILEAITMPNLGDVDTEKILANATIYNLGDTHWTLYLGAVL
                     QTIGKFGLDLMVPALAAFIAYGLAQRPGIAPGFIAGSVAVAVKAGFLGGIVGGLLAGL
                     IAYGLGTLKLPRWLGSMMPVVITPLITSLVAGGIMYLLLGAPLAWVLESLQNWLTSMS
                     GASALVLGLILGAMMASDLGGPINKAAYLFATAGLSSGADVNKEIMAAVIISGMVPPL
                     AMALATTLRPKLFTEPERENGKAAWLLGASFISEGAIPFASADPARVIPSSIVGGAIA
                     GAISMNAHVASPAPHGGIWIIGLSNNIPMFLLAVVAGTVVSAIIYVLLKSMGAKSRQT
                     ATETPAKTAA"
     gene            complement(638037..638987)
                     /locus_tag="HMPREF0733_RS02770"
                     /old_locus_tag="HMPREF0733_10582"
     CDS             complement(638037..638987)
                     /locus_tag="HMPREF0733_RS02770"
                     /old_locus_tag="HMPREF0733_10582"
                     /EC_number="2.7.1.56"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphofructokinase"
                     /protein_id="WP_013397861.1"
                     /db_xref="GI:503163200"
                     /translation="MILTLTANPSLDRTIELGSPLAHGAVQRAVGAVQDPGGKGVNIS
                     RALHTSQVPTVAVVPGEATDPVLTALAASGVQFANLPTGEPIRSNITVVDPDGTTTKL
                     NAPGIEFTPKLRDALDALVIAQSENADWVVLAGSLPGGLEATYYAELCAKLRASGYEG
                     KIAVDTSEAPLIATVAGQIKPTLIKPNSEELAQLTGAENWEELESSPELTARTARTLV
                     NDGIPYVLATLGGSGAVLVTAEGAWHAQHEPVKVRSTVGAGDSSLSGFLYAYERGESP
                     QQCLVQAVAHGSAAASLPGTQMPSAAMTTPEKVTLRQLSS"
     gene            complement(638984..639775)
                     /locus_tag="HMPREF0733_RS02775"
                     /old_locus_tag="HMPREF0733_10583"
     CDS             complement(638984..639775)
                     /locus_tag="HMPREF0733_RS02775"
                     /old_locus_tag="HMPREF0733_10583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_013397862.1"
                     /db_xref="GI:503163201"
                     /translation="MFAEERRAEIAKLVSSARRVNGADLARRYDVTMETVRRDLAALE
                     EAGKLRRVHGGAVTVEQSTSLESSIASRQGMNTPEKRRIAAKAYEYLRDSDVGSIVLD
                     AGSTIEILADYIGSENFSLKTGSDRIIITHALHIAVKLAEAEGVTLELVGGQLRKMTW
                     AAIGARAAEYFATVRPDIAFLGANGIDAEFGVSTPGMNEAIVKTAICKSARRVVLLCD
                     SAKFGQESLVRFADFENIDTMITDRAPDGALAQALEAAHVEVLIA"
     gene            complement(640210..640686)
                     /locus_tag="HMPREF0733_RS02780"
                     /old_locus_tag="HMPREF0733_10586"
     CDS             complement(640210..640686)
                     /locus_tag="HMPREF0733_RS02780"
                     /old_locus_tag="HMPREF0733_10586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="teicoplanin resistance protein VanZ"
                     /protein_id="WP_013397865.1"
                     /db_xref="GI:503163204"
                     /translation="MNGAVLSGRSGRVFRVIGWALFALYCVAVATIVFAPQHVDDNEA
                     GSRLASLIDTGHAQGWLPGFITYASIEQLSNVIMFAPGGFLLMLLLFCRARPWRRVGV
                     ITLGAVAVSAGIELIQTAMLERTGDPIDVLMNGTGAFVGSLFAWGIRAFLMRWVKR"
     gene            complement(640661..641926)
                     /locus_tag="HMPREF0733_RS02785"
                     /old_locus_tag="HMPREF0733_10587"
     CDS             complement(640661..641926)
                     /locus_tag="HMPREF0733_RS02785"
                     /old_locus_tag="HMPREF0733_10587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="WP_049775454.1"
                     /db_xref="GI:908631421"
                     /translation="MTDAQTHHEHAETPGKIFLLRHGQTDWNINHRFQGRTDIPLNDT
                     GREQIRGAVPQLREMAQHGVQIDGVVSSPLERAAESGQIVARALGVPYLGAYAGLEER
                     SFGDLEGEAATPELVAASRTDGHKYGVEEREALVSRALTALNRVRREHEGKNIVVATH
                     GMLIAVTMTVLLEGREHEGYETIDGMFPIPPNASLTELPIDYLDDAIDAHVLVSRQPK
                     LHAEPFPKNLAGGSLTLIRHGQTEWNKNQLMQGISDIPLNDTGRAQARETGAKLRRLG
                     LSYDRVISSPLSRAYETAQLVGEDFGLPVSETYPDLVERNYGAAEGVNIPVPERRAPD
                     RYYPQVETERDVYVRAVRVLREIVRQYPGEHIIAVSHGSLIRRAISAAQGYEHTQTVP
                     NAEPLEVDLKGLFAFDENTVFDERGRLVW"
     gene            642090..643136
                     /locus_tag="HMPREF0733_RS02790"
                     /old_locus_tag="HMPREF0733_10588"
     CDS             642090..643136
                     /locus_tag="HMPREF0733_RS02790"
                     /old_locus_tag="HMPREF0733_10588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_041321870.1"
                     /db_xref="GI:752673161"
                     /translation="MNTSYTSYAPVISVRNLTKSYGQHTVLRDISLDIYPGESVAVMG
                     PSGSGKTTLLHALSGIIRIDSGTIQVLGGGPEIPGGRVELGALSEKQRTSLRANSFGF
                     IFQQGLLIPELTAEENVSLAAMISGMSREQARGASANLLARLGLGDMCEKRIGELSGG
                     QAQRVAIARSQITGAPITFADEPTGALDSVTAQEVMDLLLTLVPQQGKTLVIVTHDPQ
                     VAAQCSRTIHLHDGQIVQDNRQDSAAPGQQGGDSAQYRAPAPPSQPVPPQDAAPAPSA
                     QPGVFQPGNPAVNPPQTYNRVSVQTQLPANVRYSPAHTPGTAHTAVSRNHAPAPYKPA
                     RRLFSMRGLLGKGA"
     gene            643139..644566
                     /locus_tag="HMPREF0733_RS02795"
                     /old_locus_tag="HMPREF0733_10589"
     CDS             643139..644566
                     /locus_tag="HMPREF0733_RS02795"
                     /old_locus_tag="HMPREF0733_10589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_013397868.1"
                     /db_xref="GI:503163207"
                     /translation="MQTFKLLARRTLPTSQAVLPVLAFAASAALFLLIAGGIHAFYTW
                     LGGDASTATSVEAGSGTKNTAHTMQPLYLMLAWISGFLLLTPLFTLGASAARLSARRR
                     DDRLATLRLLGASTRRLTLYTMLDSVIYAAVGFVLGFIVYLILVLPFGMLRFQNIPLG
                     PENMLLPLPIVLVCGIVCLIIAATSSLFGLSKVTISPLGVRTRSDKPSLGKRALILGC
                     ALLVVGFVGAIASHIMNLAADSMGSNGFVLVLVTTIMFGLPILLTMLAVDLIGGFVVG
                     LYARIRVRTARTPATLLAYRSIMESPRAAWRQVSGVAMTTFIAAFVGPILGMVNSAPG
                     VEEGSAESYLIGDILQGLVLVLFLSYLLVALSALLNQSAAIYERGSLYSSLRMMGTEA
                     TVLKRSRRIVVFGPLLLVSCMSAVVALPLFVLLLGSALTETGLLYTAALVFGSIAVGL
                     GLVFAALAATGPVMEQVSRKPVSAV"
     gene            complement(644678..645097)
                     /locus_tag="HMPREF0733_RS02800"
                     /old_locus_tag="HMPREF0733_10590"
     CDS             complement(644678..645097)
                     /locus_tag="HMPREF0733_RS02800"
                     /old_locus_tag="HMPREF0733_10590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="WP_013397869.1"
                     /db_xref="GI:503163208"
                     /translation="MYLADTNVISELRKYHSGRIHPSVRRWVEHVDVNDVYISVISMM
                     EIRTGILRHARKDAAQAQVLQQWFSHEFAPEFAGRILPVSLEVALTCAELYVPHKKSE
                     YDALIGATAREHHLMLVTRNVADFQGMDLDILNPFEF"
     gene            complement(645101..645406)
                     /locus_tag="HMPREF0733_RS02805"
                     /old_locus_tag="HMPREF0733_10591"
     CDS             complement(645101..645406)
                     /locus_tag="HMPREF0733_RS02805"
                     /old_locus_tag="HMPREF0733_10591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death protein"
                     /protein_id="WP_013397870.1"
                     /db_xref="GI:503163209"
                     /translation="MTTTVSAREFNQNASAALRLAAEEPVFITKRGTPTNVILSIEDY
                     QRLAQPQPRRSLADALSTMSAEAGEIDFDIDREPSIPNPHREVDFAGDGDFFGSEEN"
     gene            645574..646332
                     /locus_tag="HMPREF0733_RS02810"
                     /old_locus_tag="HMPREF0733_10592"
     CDS             645574..646332
                     /locus_tag="HMPREF0733_RS02810"
                     /old_locus_tag="HMPREF0733_10592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_013397871.1"
                     /db_xref="GI:503163210"
                     /translation="MFEHTVPASWFPRCAIFDCDGVLLDSETAWNRVQRELFNRWNIP
                     FSDDLEEQLTGLSAHQVAETLAHLSYTGDPNNTQEYAQHQHNTLTELARIEADIINAG
                     VDLVPGAQEFLSYLGEHMPVAVASNSTAGILDIKMHTYGYAPLVRTWVSCDDVPHGKP
                     APDIYREAARRLGFAGPDALSIEDSPAGAQAARDAGTKVLIYAPHGDFATAPRGFGHF
                     DTFTDPQLWRTARDWVARLEDSAVKASTTLMAES"
     gene            646334..647161
                     /locus_tag="HMPREF0733_RS02815"
                     /old_locus_tag="HMPREF0733_10593"
     CDS             646334..647161
                     /locus_tag="HMPREF0733_RS02815"
                     /old_locus_tag="HMPREF0733_10593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397872.1"
                     /db_xref="GI:503163211"
                     /translation="MTPQNPGKDARNEQNFGDQPEKNSERNQTEQARPNQHEQNPRGH
                     YQSGQGRYGLRFENMSAEELEYYRPFWEEKPDPDAVPPELIDHLKVRARRRLVNALSL
                     IAVAVGVTLTLSGMLSSALYLSLPGALTFGTGIFGWVAVRRRLFAWLRLPGESALKRG
                     ERSRWWILPHVLAAAGTASILGCFSVVPIIYAHVDDTLRRNHIVMWGEIGTTLLIFAA
                     LIYGMMALGEYTQQDDDERVLRPTDYAQQKGTSGDAPQIPRYRPGMLNPRHKDDSSS"
     gene            complement(647573..648280)
                     /locus_tag="HMPREF0733_RS02820"
                     /old_locus_tag="HMPREF0733_10595"
     CDS             complement(647573..648280)
                     /locus_tag="HMPREF0733_RS02820"
                     /old_locus_tag="HMPREF0733_10595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter ATP-binding protein"
                     /protein_id="WP_013397874.1"
                     /db_xref="GI:503163213"
                     /translation="MSALVTTLPLAASTRSVNWDTFIPDKLVPAIFDTLYMVSVTMVI
                     AGLLGLIMGALLYTTRTGNIFQNRFAYTVLNVLVNIVRPIPFIILIAALGPLTSAVVQ
                     TRLGINAAIFAMTFGASFAIARIVEQNMVSIDPGVIEAARAMGASKLRILFTVMIPES
                     LGPLILGYTFIVIGVVDMSAMAGYVGGGGLGKVAIVDGYQRFQDQITWAVVAVIIVLV
                     QLVQLIGNMLAKKALRR"
     gene            complement(648280..649404)
                     /locus_tag="HMPREF0733_RS02825"
                     /old_locus_tag="HMPREF0733_10596"
     CDS             complement(648280..649404)
                     /locus_tag="HMPREF0733_RS02825"
                     /old_locus_tag="HMPREF0733_10596"
                     /EC_number="3.6.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter ATP-binding protein"
                     /protein_id="WP_013397875.1"
                     /db_xref="GI:503163214"
                     /translation="MSEQAAPWAKNPEPGATTPKGTNTLISPGAADTGAEPMVTIDNV
                     SKIFGKGKKEVAAVKNVSLTVKKGEIFAIIGYSGAGKSTLVRLINGLESTTSGTLTVD
                     GFEISGKRDLELQKVRTNIGMIFQQFNLMNSRTVAQNVEFPLKVAGWSKGERTKRVQE
                     MLEFVGLADRAKYYPSQLSGGQKQRVGIARALATKPSLLLADEATSALDPETTHEVLE
                     LLKEVNRELGITVIVITHEMDVVSSIADRVAVMEEGRVVETGSVYEVFSNPQTEVAQR
                     FVATTVKQSPTGDAAAALRKNHKGYLVNVEIVEGNQELGKILAYLGSRNVRFNIVHGG
                     IETLQGKAYGTLTLELLGDVTSIDAAVAELKTVTRVQEVR"
     gene            complement(649595..650461)
                     /locus_tag="HMPREF0733_RS02830"
                     /old_locus_tag="HMPREF0733_10598"
     CDS             complement(649595..650461)
                     /locus_tag="HMPREF0733_RS02830"
                     /old_locus_tag="HMPREF0733_10598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine-binding protein"
                     /protein_id="WP_013397877.1"
                     /db_xref="GI:503163216"
                     /translation="MKKFVAALAVVPLVFSLAACGSSSNNGNGNNKKVTIGVVGTEKA
                     NDVLKEEAAKQGIDIEYQEFTDYNQPNPSVESGDTDLNRFQHIAYLASYNVNSGKDLQ
                     IVGSTNIYPMALFSQKHKKVDEIPQDGTIAVPNDPVNEARAILLLKAQNLVTLKSDVH
                     SPTHDDIDTEKSKVKVTPVDASQTVVSLDSVDASVINNTFLADAGLNPSDALAQDDPN
                     NPDARRYVNLFVAQKDKVDDETYKKVVEIFHTQPVQDAVKEDSKNTAVEVNLSQDELK
                     QALQKEESALRK"
     gene            complement(650710..654039)
                     /locus_tag="HMPREF0733_RS02835"
                     /old_locus_tag="HMPREF0733_10599"
     CDS             complement(650710..654039)
                     /locus_tag="HMPREF0733_RS02835"
                     /old_locus_tag="HMPREF0733_10599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease-methyltransferase fusion protein"
                     /protein_id="WP_013397878.1"
                     /db_xref="GI:503163217"
                     /translation="MQDINIDSILDSFKNQTFANEDDIKIHTYSSIIEPIRKIYAPHV
                     KFLSEHNFKKGGRADATVGNIVIEYKKYNYFSKNTGINEALYGRKSKINDSGLYQYII
                     NSIENNDVDDSILDTFGVGFDGKQWIISRFMKSGDLQDIDLTRTRFESSQSSLRKLPY
                     KFVHKVYNLREGIKEIISLFNAMNKLKMSKNNLVSLFGPEKVYVSNAIKNIYSIILDN
                     YNKYNYDKSPTRIMTLFNEWDRSFGVMFGDVSQETEFNATSDAIRELYNIDNTVDYKL
                     FLFSTQTYFNLVLKLLINSFIKIVSDPTIDIGFNLKWSDIIEIFEGNETYNSKKINNF
                     FEIHYYEWFTYIGGDNFSKEHQIMMQDVINDVQENINKLDLATFKLKPETVQDILQEI
                     YMSLIPDKVRHLLGEYFSPDWIVEHALDRVGYTGDIEARLIDPTCGSGAFLIQALKRV
                     VSKKEYNIGTEDIKNIVNNIVGFDLNPISAISAKANYILTLFSSIDEEILTKDLNITI
                     PIYIADSVLSPVVYSEQKSELVVASTSVGDFEIPKFDTFSEASEFLDGVTESIANSRG
                     YAIFSIMVLDKFNLTETQKEAVKTMYEDLTLLHRSARDSFWGKILKNSFAPVLLKNKF
                     DYVVGNPPWISWKSMSRTYRHGTLEVWKSYGIFEKNAYDKKTTHDDFGMAVTYVALDQ
                     YLNFGGKLYFLLPWTFVKSTKGGHGFRKFRITRNDQDIPIKVCLVDDYNTLQIFKPKH
                     TVRTIGILLEKGTQNTYPMNMWYEWNYKANKEIFDAHDTWDEVSGKIYKTRKSVKPID
                     SSDIQSSWATLSAEKINMVDNILLHGKKPYYRGRKGIEPAGAKGVYILKRPEPLGDNL
                     ISVVNDMSRQRRKDIKDRGEHPGIIEDTYVYPMLGGRNIHRWKVVSNEFMLVPHTPET
                     PYGMDEVGMAKTAFLTYKWLEYYREGLNASRKQNGKFYDPKIHPWYRLDNVGKYTFSD
                     YKVVWKEQASSSSAVAIGPYSTLPMSDLSIFGGQDKPVVIDSKVLMVSTESMLEAYYL
                     SGVLNSPSVRTLIDTYGVGLNRGVDVLKNIMVPQYDSNNEIHQQVARLSEEIHILASQ
                     GDDISLHESILDTFVMRMYLS"
     gene            complement(654111..654932)
                     /locus_tag="HMPREF0733_RS10715"
                     /old_locus_tag="HMPREF0733_10600"
     CDS             complement(654111..654932)
                     /locus_tag="HMPREF0733_RS10715"
                     /old_locus_tag="HMPREF0733_10600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015612943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheinyl transferase"
                     /protein_id="WP_013397879.1"
                     /db_xref="GI:503163218"
                     /translation="MVNRVKAAFDEMKGSENTGGTENSRGLEHLMSTAENTGESLMRS
                     LLPPDIYVAETTGDFGHLRDAEREYFASAVPKRVREATTARSCARLALKRLYLREPEP
                     TEPPTEPVFVPRADGSPAWPAGVVGSMTHCAGYRAAAVASAHRYAGIGIDVEPAVPLS
                     AAVQELIVRDEEKRFAFGVYSKVLFSAKEAALKTWYPLGFRGFDVSDISVACDVESAA
                     GRRGEDARGTFTARILTMPDAPVLPGGWVIEGGFVATAVVFYQPLNNVRSDSIII"
     gene            complement(654966..655775)
                     /locus_tag="HMPREF0733_RS02845"
                     /old_locus_tag="HMPREF0733_10601"
     CDS             complement(654966..655775)
                     /locus_tag="HMPREF0733_RS02845"
                     /old_locus_tag="HMPREF0733_10601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_013397880.1"
                     /db_xref="GI:503163219"
                     /translation="MTNNTADNPAVLLERRGSIAYVTLNQPENRNTLSRHLATELREV
                     LNRLHEDDTLKAAVLTGAGQDFSLGGSYDDFAEGMSREKEESLAYSRELARLLEDIIL
                     GIVAAPIPFIAAINGQAAGAGMSLALACDLRVAEPRTKLNIAYGMIGASTDGGMSWFL
                     PRYAGFSAATELLYTQPILRAARAQELSLVHRVSEPGELNACAEQLAEQIAGSASHTV
                     RAAKSMLAARYVVELEEHMHAEHEFFARGVLTEDFRNAVHAMQRGEIPSFD"
     gene            complement(655768..656217)
                     /locus_tag="HMPREF0733_RS02850"
                     /old_locus_tag="HMPREF0733_10602"
     CDS             complement(655768..656217)
                     /locus_tag="HMPREF0733_RS02850"
                     /old_locus_tag="HMPREF0733_10602"
                     /EC_number="4.2.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_013397881.1"
                     /db_xref="GI:503163220"
                     /translation="MTAERTADLSARIGEPLGETPWMRISQQNINRFGELTGDTQWIH
                     TDPYRAAHTPFGGTIVHGAYLLSLAITFAGQLLPAEGTSMLVNAGVSAARFRSAVPVD
                     SQVCGSASIVSAEDFGDATLAEIRVAVHVKGQSKPATTATVRMVLHD"
     gene            complement(656214..656867)
                     /locus_tag="HMPREF0733_RS02855"
                     /old_locus_tag="HMPREF0733_10603"
     CDS             complement(656214..656867)
                     /locus_tag="HMPREF0733_RS02855"
                     /old_locus_tag="HMPREF0733_10603"
                     /EC_number="2.3.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase complex E2,
                     dihydrolipoamide acetyltransferase"
                     /protein_id="WP_013397882.1"
                     /db_xref="GI:503163221"
                     /translation="MTDTPNASSAPSPDPLPPEGSDASGYPFTFYLPDLGEGLRSGEI
                     IEWLISEGQQVELDQVLVVVETAKSTVEIPSPVAGTVVRLLEPVGQVVDVDAPLIELR
                     TPTPQAQAPTAGAETPAKDSADKLPAKPGAGESKHLVGRGKMPIKPGGTGTALPPKSA
                     KTQGGKARSGAKVSPAVRRLARSLGVDLKTVTGTGAGGAITPEDVQTAADQAAGGAS"
     gene            complement(656879..657958)
                     /locus_tag="HMPREF0733_RS02860"
                     /old_locus_tag="HMPREF0733_10604"
     CDS             complement(656879..657958)
                     /locus_tag="HMPREF0733_RS02860"
                     /old_locus_tag="HMPREF0733_10604"
                     /EC_number="1.2.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoisovalerate dehydrogenase subunit beta"
                     /protein_id="WP_013397883.1"
                     /db_xref="GI:503163222"
                     /translation="MSQQAADTQVRGAKTASDTAPQAPESTQSRSDAVQRTSMVGALN
                     LALGHEMQHNDRVVMFGVDVGTLGGVFRVTDGLTERFGEERCFDTPISEAGIMGAAIG
                     MAMYGFRPVIEMQFDAFGYPAFEQMVSNLAKMRNRTRGDLSMPVVVRMPYGGGVGAVE
                     HHSDSSEGYAAHTPGLHVYTPSNPSDAYHMLRQAIRSDDPVIFYEPKRLYWEEGDLDT
                     SADPLPIGQARICRPGEDVTLISYGPTVPMALAAAETAAEYGYSVEVIDLRTLTPFDE
                     HTVCESVMRTGRAVMVHEAPQTGGFGAEVVARITSRCFDYLERPVERVTGLDVPYPPP
                     GLEHLYLPNEEKILGAIATLYAEND"
     gene            complement(657955..659001)
                     /locus_tag="HMPREF0733_RS02865"
                     /old_locus_tag="HMPREF0733_10605"
     CDS             complement(657955..659001)
                     /locus_tag="HMPREF0733_RS02865"
                     /old_locus_tag="HMPREF0733_10605"
                     /EC_number="1.2.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase E1 subunit alpha"
                     /protein_id="WP_013397884.1"
                     /db_xref="GI:503163223"
                     /translation="MPNTLQSPPQQVQNGVSDDLLITAHAAMIAGRHFNQQASNLAKQ
                     GYMGAYPSSLGQEACQVAAALALEPADWLFPTYRDSVAVMSRGIDLAEVLSPFHGSSH
                     CGYAPTKTHTAPEATPLATHTAHAVGLAMAAKFAGDSTVALAMCGDGSTSEGDFHEAL
                     NLAAVFEAPVVFLVQNNGYAISTPVSRQMRAASIAAKGEGYGMPAYRVDGNDFEQVYP
                     RLHEAVERARAGGGPTLIEAMTYRMGPHTTSDNPDRYRSREEVEQWRGRDPLTRIQHQ
                     MYQRLPNAKTHIENAILAAEKIASEARTSMMQLQMPDPQDLFAHVYANPPATLSAVAE
                     EYAQQHAAQNGENA"
     gene            complement(659128..660081)
                     /locus_tag="HMPREF0733_RS02870"
                     /old_locus_tag="HMPREF0733_10606"
     CDS             complement(659128..660081)
                     /locus_tag="HMPREF0733_RS02870"
                     /old_locus_tag="HMPREF0733_10606"
                     /EC_number="2.3.1.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_013397885.1"
                     /db_xref="GI:503163224"
                     /translation="MSVTISGVGAAVPNDPIPNSEFAALGVDDEWIASRTGVRQRHHL
                     RQEQTLAELALEASEKALADAGISAEEIDFVLAATTTADQVSPGLAPVVAAGLGAPQV
                     GAVDLNAACSGFLYALDYAASKIEQGSIDRALVIGADAMSRLTNPEDAGTAVLFADGA
                     GAAIVQAAPEVSEDEYPYMCSFGSDGSQAQALYISDSTQQVVMDGAEVYMAAVDAMSE
                     EITYVLDSCGIDPERIDQLVCHQANGRIMAAVARRLRWDSSKVLSYIDRYGNTSAASI
                     PITLAIGQQEGHVKPGDLLALTAFGAGFTWGAGVIGFKTTA"
     gene            complement(660100..661281)
                     /locus_tag="HMPREF0733_RS02875"
                     /old_locus_tag="HMPREF0733_10607"
     CDS             complement(660100..661281)
                     /locus_tag="HMPREF0733_RS02875"
                     /old_locus_tag="HMPREF0733_10607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397886.1"
                     /db_xref="GI:503163225"
                     /translation="MSTRQPPEDAPQAAGRASADPRYAAYLGCAYPPAPGTAPDANLT
                     QAEKPAAEDPAHDGEYRVFLRYDTRIAPDVSGPVTLSVTDVEYLQDLHRQGIEALGRE
                     ALGVKSADHFVLRGAGLRFTPHVLGGDVRSSDTTGANEPIELSLHVPVSTIRRRRGQP
                     CYAISGAITLWAGDTCLAESDGAALFLTADTFEELRGELGNTAEIQDAASAGGASAEP
                     PKAVRVWGTPYGHVQAAPASLCGVSDASQVLIGDVHHDDTTHGTENAQEQAEESQVST
                     SERSPQNPPGAPVLAQCRIVPTAPPRHFDRPLDHYPGLMMASAARQFAVAALAHRTGA
                     DPAGLRVAEESHEFFEFVELTEIPTLNLLRCEKHRDTYQIEITVNQGGAVKARSRFTF
                     M"
     gene            complement(661278..662519)
                     /locus_tag="HMPREF0733_RS02880"
                     /old_locus_tag="HMPREF0733_10608"
     CDS             complement(661278..662519)
                     /locus_tag="HMPREF0733_RS02880"
                     /old_locus_tag="HMPREF0733_10608"
                     /EC_number="2.3.1.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_013397887.1"
                     /db_xref="GI:503163226"
                     /translation="MSTRVVITGIGAVTPLGVGAETLHERAVAGLSGLNDENENGLGG
                     KVGRCLDFDVKNPLSRREMRRMDRYTQLAVAAADEAIAQAGWGGGLPCDARRITCYIG
                     TAIGGLDTLETQHLVMHTEGAEEVSPLTVPMMMANAAPAHISMRHGLHGETTAIVTAC
                     SSGAQAIVAGVRSILLGEADAAVVGGAEAGTTRFTRAIFNAAGAISPDGNSTPFDEER
                     NGFNLGEGAGILVLESAENARARGAEILGEIAGYGLSSDAHHITAPNPDGMYAAYALN
                     RALETAGATPEQVSYVNAHGTGTELNDTTEVNVLRQALGDALENIPVSSTKSAIGHLF
                     GAAGAVETIATLQALRHGQAPPTLGLKNLDKRLGRVRISGEPQDLAPGTVSAEDGTPK
                     RLGLSNSLGFGGHNVTLAIRA"
     gene            complement(662516..662773)
                     /locus_tag="HMPREF0733_RS02885"
                     /old_locus_tag="HMPREF0733_10609"
     CDS             complement(662516..662773)
                     /locus_tag="HMPREF0733_RS02885"
                     /old_locus_tag="HMPREF0733_10609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_004005620.1"
                     /db_xref="GI:490103778"
                     /translation="MTETPVNTASLEEFVTQQVIDMGVPASTVKLDAKIDSMGLDSLD
                     VVELTQAVKKQLMIPVKPKDFENAATLQDAVDIIREKAQEK"
     gene            complement(662890..663654)
                     /locus_tag="HMPREF0733_RS02890"
                     /old_locus_tag="HMPREF0733_10610"
     CDS             complement(662890..663654)
                     /locus_tag="HMPREF0733_RS02890"
                     /old_locus_tag="HMPREF0733_10610"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="WP_013397888.1"
                     /db_xref="GI:503163227"
                     /translation="MTHQKRPGCALVTGASGDIGAQIALRLAQDGWNIAVGYATGIER
                     AEEVAGCIRECGVSAMPIKIDVTSTTSVDDAFDALEDSLGQVTVLVNNAGIRSDGLVA
                     GLSDDEWDAAISTNLSSVFRTSRRALGPMIRARFGRIINISSILAGRTIAGTGSYSAA
                     KSGILGITRAMAIEVARRGVTVNAVCPGLVETSMTEEVETFTQSVQRAVPMARPAQAR
                     DIAECVAFLASDRADYITGQSIAVDGGLSAQAFSLN"
     gene            complement(663779..664279)
                     /locus_tag="HMPREF0733_RS02895"
                     /old_locus_tag="HMPREF0733_10611"
     CDS             complement(663779..664279)
                     /locus_tag="HMPREF0733_RS02895"
                     /old_locus_tag="HMPREF0733_10611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397889.1"
                     /db_xref="GI:503163228"
                     /translation="MGKWGNIIEDMMAQMPEDLRTVALGVAEIFTNMDIETARKYIHP
                     DFVDHEASEGVGGGPEGYLATAKYMNQAFSDASWKPQKIVASADGKHYTMAIKFSGVH
                     TGEFMGVPATGKPFEIHHLHLFRVEDGKAIEHWGGRDELGLLRQIGVLNSEYPTPADA
                     GQAAFA"
     gene            complement(664319..664987)
                     /locus_tag="HMPREF0733_RS02900"
                     /old_locus_tag="HMPREF0733_10612"
     CDS             complement(664319..664987)
                     /locus_tag="HMPREF0733_RS02900"
                     /old_locus_tag="HMPREF0733_10612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_013397890.1"
                     /db_xref="GI:503163229"
                     /translation="MTRIFMSPNYNTAKYVWTDFGGVLTPPVSHTMRVFCQKYGLTES
                     QLRAGFEAVARNHNLTDPLELVDTPLMSEKEWLSEISEQVGGAFQLDTLADDWFRDRE
                     PNASWVAYLHEIKAHGVKVGLISNMVPTWDNHWRAMLNEPDLFDDIVLSFEVGYRKPQ
                     RGIYEYAAELAGVNPAQCILIDDLARNCEGARAAGWDAIEFTTTEECVKQLHPLLSPA
                     EETV"
     gene            complement(664988..665962)
                     /locus_tag="HMPREF0733_RS02905"
                     /old_locus_tag="HMPREF0733_10613"
     CDS             complement(664988..665962)
                     /locus_tag="HMPREF0733_RS02905"
                     /old_locus_tag="HMPREF0733_10613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ScbA protein"
                     /protein_id="WP_013397891.1"
                     /db_xref="GI:503163230"
                     /translation="MTLIYESAPELDETITIDPDIENLHYDRTVDRHKVHRAAVSEVF
                     LTDIRQQSAQHVLVAAQLPSSHSFFHDSIYNDAEGTPDALLLLEIARQATIASAHEVG
                     VDAGNTLISNEFGLTIYPHEIAALNPEDTNLLIRNYFDWTSIRRGAPRSGRCYQQLIM
                     GNRVIAEHFSGGRILTKNQLQALRSEYRGTPPPTTANLHELTFTDVQDPIAPERVGRR
                     NPLNVVISQLNTTETPSAQVTPNVANKALFDHAYDHITMQILTEAARQLYLATRSDSE
                     RAPEISSIRGNFLAFAELDSPVQIRATAPGEFVVEQDNRQIADFALKS"
     gene            complement(666504..667919)
                     /locus_tag="HMPREF0733_RS02910"
                     /old_locus_tag="HMPREF0733_10614"
     CDS             complement(666504..667919)
                     /locus_tag="HMPREF0733_RS02910"
                     /old_locus_tag="HMPREF0733_10614"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397892.1"
                     /db_xref="GI:503163231"
                     /translation="MSVTTPHPKRWAILGFMCLALVVTGLDSLIVAVAIPSMETGLQA
                     TGEQLQWVVAAYSLAFAAPLLFFGGLADRIGHKLSFLAGMFILLLGSILAAFSINAEV
                     LIFSRVIMGLGSAFIMPSTLALIRDIFPDHERAKALGIWVGMSSLGIPLGPIVGGLLL
                     KSFSWGSIFLVNVPIIAVAFLACLMLAPESSKKHSSRLDFFGLILSIFGPALLVYGII
                     AAPEAGWTSSLTLTLLIAGVVLSLIFIVWEHRSASPMLSHEVFRNRRFGGPLLTISSV
                     FFGVFGGLFIMTQHLQFVLGLDPFISGLHMLAMCSAVLVAPISPKLVEKFGLGPVSAT
                     GPLMVALGMVLLAISPSPKSGQVMVALFTFGLGVGFGAPASVNSIIESTPKKQTGAGS
                     AVADVAMQLGGALGIALMGSIGIATATAQSPRGVAAACWVGAAVGLLGAVAVFTVLPK
                     TGEPAVERAVAPEPEPAAKLP"
     gene            complement(669078..669437)
                     /locus_tag="HMPREF0733_RS02915"
                     /old_locus_tag="HMPREF0733_10616"
     CDS             complement(669078..669437)
                     /locus_tag="HMPREF0733_RS02915"
                     /old_locus_tag="HMPREF0733_10616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397894.1"
                     /db_xref="GI:503163233"
                     /translation="MTTKQTILDYFASIHAGNWQDYISDTMAYGFNTTEQKLNKDEYF
                     QSAGSFYDATTKVELSQIITEGDKAAVIACYTAQSPAGATRIFEVPEFFTVKDGKIVA
                     STIFFDGPAFMAFMKDE"
     gene            complement(670180..670647)
                     /locus_tag="HMPREF0733_RS02920"
                     /old_locus_tag="HMPREF0733_10617"
     CDS             complement(670180..670647)
                     /locus_tag="HMPREF0733_RS02920"
                     /old_locus_tag="HMPREF0733_10617"
                     /EC_number="3.2.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysozyme"
                     /protein_id="WP_013397895.1"
                     /db_xref="GI:503163234"
                     /translation="MHQISPDGIAFLEEKEGFRSDAYYDVAGVLTIGYGHSTRAPSIE
                     QYPVYEGQHITEEEGEEILRADLKPTEAAVNSAVTREITQKQYDALVSFTFNLGAGTF
                     KSSDVLELTNKGNYQAAGDAMLQYSHAGGEFIPGLYKRREEERAMYLSSLPQA"
     gene            complement(670794..672590)
                     /locus_tag="HMPREF0733_RS02925"
                     /old_locus_tag="HMPREF0733_10618"
     CDS             complement(670794..672590)
                     /locus_tag="HMPREF0733_RS02925"
                     /old_locus_tag="HMPREF0733_10618"
                     /EC_number="6.2.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397896.1"
                     /note="activates fatty acids by binding to coenzyme A;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty acid--CoA ligase"
                     /protein_id="WP_013397896.1"
                     /db_xref="GI:503163235"
                     /translation="MTDPQYHDSHPHDAQASAQESQRPAPAQTTPDTASGQNPLAHRP
                     WLKNYSPGVAVDVHLPETSLSHLIDDAVRDVPHKIALEFFGATTTYAELGSQIDRAAE
                     GLRLAGVQAGDRVALILPNCPQHIIAFYAILRLGAIVVEHNPLYTGAELRHMFEDHGA
                     KAAIVWDKISGHITGLPADIRPAHIYAVNLIKAMPALTRAALKLPVKKARSSREKLEG
                     AAPGTTSWAHLLKSPPIDPDFKRPTAHDVALLQYTSGTTGLPKGVMLTHRNLESNGRM
                     GEAWIQPGNDESIYSVLPLFHAYGMTLGVTIAALCRARLVLFPTVDMGLITKAMKKTR
                     PTILPAVPPVYRRLMDVAKEQGISLQGVRYAVSGAMNLPPELVAEWEDASGGYMVEGY
                     GLTECAPLVSCNPLNDTRRAGSIGIPFPSTDIRVVDPETLQDVPLGEEGELWVHGPQC
                     FAGYWKREEDTQKTITADGWLRTGDIVRLDEDYFIQIVDRIKEVIITGGFNVSPTEVE
                     TALKQHDSVADAAVVGIPQASGGEMVVAAVIPAEGHAVDEHALREHCYARVTRYKVPR
                     KIVAVDDLPRSMLGKILRRKVREQLIASGEFD"
     gene            672671..673330
                     /locus_tag="HMPREF0733_RS02930"
                     /old_locus_tag="HMPREF0733_10619"
     CDS             672671..673330
                     /locus_tag="HMPREF0733_RS02930"
                     /old_locus_tag="HMPREF0733_10619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium channel protein"
                     /protein_id="WP_041321577.1"
                     /db_xref="GI:752672868"
                     /translation="MPRAVFEVSSTIHSLPLATSLYTTTYTPCISTHRNVTVENMSEK
                     SFGNNPTQQNSSSQILAAGTARPALPLRKLYGMRLGLAGITLALMAQTFLAIFYPSSL
                     NYFPVYTSSPILVTVLYWALQITATVFYLRSRYLGFILGANIVGALHHGLDLFMLIFL
                     GLLYHPDGIGHYLEGANAVYIIAYWLGQAVTLIDFTLCIVFIIVLMRVFSRRRQSKVQ
                     P"
     gene            673571..674245
                     /locus_tag="HMPREF0733_RS02935"
                     /old_locus_tag="HMPREF0733_10621"
     CDS             673571..674245
                     /locus_tag="HMPREF0733_RS02935"
                     /old_locus_tag="HMPREF0733_10621"
                     /EC_number="2.3.1.79"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose O-acetyltransferase"
                     /protein_id="WP_013397898.1"
                     /db_xref="GI:503163237"
                     /translation="MSKPNRQNLSEAFERMTAGKAYRSTEENKQVGDSIYQAVKFFEQ
                     YYARGEHAHGMHVLRDYLGSLGEHTQMRPPVAFDFGVNTHIGKYCFFNFNTTFLDVAP
                     ITIGDYVFVGPGCQFLTPTHPINVQDRINFWEGALPITVGNNVWIGGGAIILGGVTIG
                     ENAVIGAGSVVTKDVPENTIVAGNPARVIRTIDPQQRPAHPHQYSEQEMMQAQEFYAR
                     LEADNF"
     gene            674326..675492
                     /locus_tag="HMPREF0733_RS02940"
                     /old_locus_tag="HMPREF0733_10622"
     CDS             674326..675492
                     /locus_tag="HMPREF0733_RS02940"
                     /old_locus_tag="HMPREF0733_10622"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397899.1"
                     /db_xref="GI:503163238"
                     /translation="MPTTDMEETMTSTPKNTSGPHHNTPAEENTVHAKNKTNQSELRE
                     NSHDAWDAAFESDDPTVVLSPKDVPVDDISEEKTRPLSAADQRKYLEESSSSANAQMK
                     TDAGTAKDRSHDGDSSFGWLEDSDESAGSDSVDQLRPAVPSSMVTYSTEALPPLPEHP
                     TTPREDGDSDAIVAVSAPSPAQNYLIEDGEDTDEHAPILTAATAFELQKARYGRLQVI
                     PGLMGWFAAMGVLQFLLWVTATVVEANHGAPYDSMAPIVRGLFSGNDALALWQGIGTG
                     AAYLVAYCIGGYVAGRMARFSSAKQGISVWLWQVMIMFAASLLTYFTPQVFQGSSANL
                     SVQWYTQHGTASAILSVALVLCITFIAAVLGGLMGGIYHRRVERYAQNYVDQEL"
     gene            complement(675717..677207)
                     /locus_tag="HMPREF0733_RS02945"
                     /old_locus_tag="HMPREF0733_10623"
     CDS             complement(675717..677207)
                     /locus_tag="HMPREF0733_RS02945"
                     /old_locus_tag="HMPREF0733_10623"
                     /EC_number="2.3.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain alpha-keto acid dehydrogenase
                     subunit E2"
                     /protein_id="WP_013397900.1"
                     /db_xref="GI:503163239"
                     /translation="MSQIFNLPDVGEGLTEAEILTWKVSVGSEVSINDVLVEIETAKS
                     VVELPSPYTGTVDKILVSEGETIEVGTPIIAISGSAASTADEPQDAPAASADEGESGN
                     QALVGSGPKADSVKRRARKRPASARAQNAAPQVQVSPAQEMPVAHTPSSPEPRNQGLF
                     SELAERASKFVENSPFNTVVQRFQGGAEVPVVTAQPTQEPVPHRPSLAAPPVRLAAKE
                     LGVDLANVTATGSRGQVTKQDLLNYVAHLNDVQESTSQRFWQSPSAPGDRMQHIPVRG
                     VRKATAKAMVSSAFSAPHMSIFVDVDASRTMEFIKRLKKSRHFEGVKVTPLLVLAAAV
                     IWAAERNPQVNATWTDSEIQIKRFMNLGIAAATPRGLMVPNIKDAQELSLRELAIALN
                     NLTTRAREGKTQPAEMANGTLTITNIGSLGIDTGTPIINPGEVAIVAFGTIKQKPWVV
                     DGEVIPRWVTTLGGSFDHRVVDGDLSARFMADVAAILEEPAMLLDM"
     gene            complement(677285..678280)
                     /locus_tag="HMPREF0733_RS02950"
                     /old_locus_tag="HMPREF0733_10624"
     CDS             complement(677285..678280)
                     /locus_tag="HMPREF0733_RS02950"
                     /old_locus_tag="HMPREF0733_10624"
                     /EC_number="1.2.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoisovalerate dehydrogenase subunit beta"
                     /protein_id="WP_013397901.1"
                     /db_xref="GI:503163240"
                     /translation="MSEQNAQVERLTLAKAITRGLDDAMADNRKVVLIGEDIGKLGGV
                     YRVTEGLLAKHGQKRVMDSPLGEAGIVGTSIGMAMRGYRPVAEIQFDGFVFPAYNQIT
                     TQLAKIHNRSDKKYVVPVTIRIPYGGVIGAVEHHSESPEALFAHTAGLRIVTPSSPHD
                     AYWMTRKSIECDDPVIIFEPKRRYWLKGEVNFADTDFDPFQAQVVREGTDATIVAYGP
                     LVPVALAAAEAAVEDGRSIEVIDLRSISPMDVPTVAASVVKTGRLIVAHEAPTFGGVG
                     GELAAAITERCFYSLQAPVLRVGGYYMPYPVPRTEDEYVPDIDRILEAVDRSFEY"
     gene            complement(678283..679449)
                     /locus_tag="HMPREF0733_RS02955"
                     /old_locus_tag="HMPREF0733_10625"
     CDS             complement(678283..679449)
                     /locus_tag="HMPREF0733_RS02955"
                     /old_locus_tag="HMPREF0733_10625"
                     /EC_number="1.2.4.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase E1 subunit alpha"
                     /protein_id="WP_013397902.1"
                     /db_xref="GI:503163241"
                     /translation="MHENEKYPGVPERIQLMDENGKVHENPTFSSYVQDVDAEQLREA
                     YRLMYITRRIDDEGTALQRQGQMALWVPSRGQEAAQVGSALAFAPNDYIFPSYREHAV
                     AFARGVDFRELITVFRGSHTHGWDPKKHNFHVYTKVLAAQIPHAVGYAMGLNFDADIA
                     AETGQLQTGQGQATNPDTDTVKPAVGVYFGDGSSTEGEAHEAMAFAASYDAPVLFFVQ
                     NNRWAISVPFDVQSRVPISTRAQGYGFEGLRVDGNDVLGTLAVTRYALDKIRRGEGPV
                     LIEAETYRLGPHTTADDPTKYRDDEELQQRLNADPLIRLEKYLRENGHADDAFFEKLA
                     EEAQELANGVREAAIASEPYEFDRFFDRAYAEEHLQVEEEREFYRNYVAGFEED"
     gene            complement(679747..680886)
                     /locus_tag="HMPREF0733_RS02960"
                     /old_locus_tag="HMPREF0733_10626"
     CDS             complement(679747..680886)
                     /locus_tag="HMPREF0733_RS02960"
                     /old_locus_tag="HMPREF0733_10626"
                     /EC_number="2.6.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_013397903.1"
                     /db_xref="GI:503163242"
                     /translation="MDMSESHQPQTSPIPPRHIFANLPAYVAGKPAPQVAGLTQYKLS
                     SNENPLGPVPKVAEILSTFDAVHRYPDPLSTKLREALAKRFNLDAENIVTGAGSLGAL
                     NQILKAFAGVDADGVQDEVIYAWRSFEAYPILVGLLGAKSVQIPNLPNGAHDLQGMLD
                     AITDRTRVILVCTPNNPTGPAVTEKQIREFLAQVPPHIVVVLDEAYFEFCTVSPVPDG
                     EDAPLDGLRLYREYPNVIVLRTFSKAQGLAGLRVGYSVSHPQLTQYLRVSATTFAVTA
                     VAEAAAVASIEHEDQVMERVQHLVSERERVVARLHELGYNIPQTYANFVWLPLGEHTA
                     EFTELARANALAVRAFDSEGVRVSIGEDEANDRFISICEQFPHRV"
     gene            complement(680967..683144)
                     /locus_tag="HMPREF0733_RS02965"
                     /old_locus_tag="HMPREF0733_10627"
     CDS             complement(680967..683144)
                     /locus_tag="HMPREF0733_RS02965"
                     /old_locus_tag="HMPREF0733_10627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397904.1"
                     /db_xref="GI:503163243"
                     /translation="MNTPGQQIAAGGDDKTISVLLEELPQLAQNVHQLGGDCGSLPLP
                     MGGIAAQLMLFLGTNEHGRQASVMTTSAAATLGERAVKLEATASAIDACSKGYHQAEE
                     AAKGLFNRIGLTQDGKMPNGMSQEEWIRNALMHPQGAFNDMWSWEKYELGYSAAESIF
                     GWGMRSGNPYIMSFSALTAITLFGAIAYQDMRANPEMARRRIARKLEKMGIPREIAER
                     IVNGKMPWLGKKEQDNKNRGELKNWHRDKAEPTDKMPRTRAEIAQNMERVSKGDLSKK
                     YEGEDKDGKGYSGIEVQVYRDPQTGRKIVYAYIPGTDFSNKPGEPDGIQGTLQIGADT
                     PNASIQDSHIMMRALDRALRDQGVTSADDVILVGHSQGAAIAYNAANNNEFASRYHVS
                     DVYTFGGPVQALPDRGNKTFRVHQTKDKGDPIPAIISGQTWRERPGDSTVITDRRSFR
                     QGGDPKPHEMTHDMRFYRESLERDANAQKPMVAVPQGNYTYEGGNVYNATSEGGPSLW
                     ESGAATLSNERGVNPQVLGNIGVDLAQDKARSWTPDFLKPSMDALDPRKPVDYTDPKI
                     SGLPAPVQNPGTTDTQHSPAAWHAPESLENISGPKPMPYSHHGEGIIPSGAGSHAEPY
                     YAPRLLDDLHLPKLDIPHSTGGGENLLPNLDLKTQEGYLPPLGEHLMNNPAETPHLHI
                     PQNQLQPDGETVTPADTGSRMPTNTPNPEIRTSHDPRLLGAPA"
     gene            complement(683172..683786)
                     /locus_tag="HMPREF0733_RS02970"
                     /old_locus_tag="HMPREF0733_10628"
     CDS             complement(683172..683786)
                     /locus_tag="HMPREF0733_RS02970"
                     /old_locus_tag="HMPREF0733_10628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397905.1"
                     /db_xref="GI:503163244"
                     /translation="MTAIAPAPTPQPHTGDVPPGAHPPTSADILRAAGDMGIGTSAAT
                     SFAASLQGLAGQARSKGQELAANLEQHAASIQTMLHKAHGMRAEHWKSSAGRAYRNAL
                     DQHEKSLTETHQQVQHAAEDAHRAGEEVAAALESQANTILGAAAGLDGMLKGLLNTTA
                     DTLENLNPADIIKSSGALNAQHALDQLLNYSQVPTGLLQSSGIH"
     gene            684221..685660
                     /locus_tag="HMPREF0733_RS02975"
                     /old_locus_tag="HMPREF0733_10630"
     CDS             684221..685660
                     /locus_tag="HMPREF0733_RS02975"
                     /old_locus_tag="HMPREF0733_10630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005639.1"
                     /note="Catalyzes two discrete reactions in the de novo
                     synthesis of purines: the cleavage of adenylosuccinate and
                     succinylaminoimidazole carboxamide ribotide; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="WP_004005639.1"
                     /db_xref="GI:490103798"
                     /translation="MSHPENTLLPSGRIDLGTSNLALGPLDGRYAPVTAPLTNYLSEA
                     ALNRDRIHVEVEWFIYLCEHAVLPGLTPLTDEQKSGLRAIVTEFNADSVTELAEIEAV
                     TVHDVKAVEYYIGRRLEALGLGHLVPLVHFGCTSEDINNLSYALGIKDAVENVWLPAA
                     RDLVQVLLDLAETGRDVPMLSRTHGQPATPTTLGKEMAVLAYRLKRQISHVAATEFLG
                     KINGATGTYAAHYASVPGADWQAISRGFVEHLGLSWNPLTTQIESHDWQAELYSDVAH
                     FNRVLHNLCTDVWSYISIGFFRQIPVAGATGSSTMPHKVNPIRFENAEANLELSNAIF
                     DSLASTLVTSRWQRDLTDSSAQRNIGVAFGHSVLAISNVIKGLQRLDIAADVIAADLE
                     SNWEVLAEAIQMVMRAEAIAGTPGMENPYERLKELTRGHRVDAVRLKEFVGTLGLSAE
                     AQERLSNLTPHTYNGIAAQLVDHAKDAQG"
     gene            complement(685938..687680)
                     /locus_tag="HMPREF0733_RS02980"
                     /old_locus_tag="HMPREF0733_10631"
     CDS             complement(685938..687680)
                     /locus_tag="HMPREF0733_RS02980"
                     /old_locus_tag="HMPREF0733_10631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013397907.1"
                     /db_xref="GI:503163246"
                     /translation="MILSERRRDLEKQVAEILASYRDGQLHANRESASIDFKEEAGRR
                     GAGGILLPGETRNAEAASKLADEVACFANTPGGGALILGVEDSHGTVLGTELDTEWLR
                     QRIDEAVQVAPDIVEHHLGGAQGLRVLVLYVPQAKEPVYDTGNKLRWRVGDHCKPIDR
                     SLWWEHRENMREYDEMAQSTRYTPEDIPRSTMNYVRALLGADTALTDREVLQRLGALR
                     SDGKLSQAAALTLCPASRTLLELTIFDVPAGSILNTVRPDADLPLLEQIRQIEQALQN
                     VNTQITLPTGFAHRTVRQVPENAVREAILNGIIHRDWNSSEPTDIRWITLDNTLVVRS
                     PGGFYGGVTADNVLSNRSARYPALADLFRALTLVEKQGVGVDRMYQSMMVLGHLPPIF
                     AEVAGPHIECTLVGGTPVLPVLEVASAIVPTARQKDVGIAIILSYLMQHPFITLKTLA
                     ERLQSSEESAALTLRAAEQTVIEGVPLVTRLKEQQVWVLGEGALNLAQNARGENDHYV
                     LPYLSRSSQAMHDVIRTWCDLTGAITTGDLMELTHIARGTAKRALDALVDEGTLRQEG
                     QGRSTRYVMVHQGR"
     gene            complement(687941..688828)
                     /locus_tag="HMPREF0733_RS02985"
                     /old_locus_tag="HMPREF0733_10632"
     CDS             complement(687941..688828)
                     /locus_tag="HMPREF0733_RS02985"
                     /old_locus_tag="HMPREF0733_10632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397908.1"
                     /db_xref="GI:503163247"
                     /translation="MLDPKKSLFDDNGNPRPALTKTLDTVLRVQRPLALSMVKSLRAA
                     HPDETPEKILRRLERNYLRDVTAIGGVTGASAFVPGIGTVTSMSLSALAVGGYLERTA
                     LFAQAVAELHGVHVENPEVARSMVMAIMLGEEGSQLMNTVLLQTGKASGVSNRWGMLL
                     GGKSAGKTFSVERTIRNMFIKRFLTRQSGALLGRALPFGVGAVVGGGANLALGRDVVK
                     SARNAFGDAPAFFPAELMLTPRAPKFTSDEQKNSHGPKVTRALTGKFKRTKADTKNHD
                     AHAHGLQNPGAQHRKTMGN"
     gene            689270..690340
                     /locus_tag="HMPREF0733_RS02990"
                     /old_locus_tag="HMPREF0733_10633"
     CDS             689270..690340
                     /locus_tag="HMPREF0733_RS02990"
                     /old_locus_tag="HMPREF0733_10633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_013397909.1"
                     /db_xref="GI:503163248"
                     /translation="MSAPASARSPLATQGLGMAYAIGAIISAQFGSALAKTMMGDLGA
                     WGVVALRMITSSLLLYLFFRPQVRQWTRPQWLAVIVLGVALFGANAFFYVAIQQVPLA
                     IAVAIEFMGPLVLATVLSRRKLDLIWILLSFTGMAILTAESQSKPEDFALIGIFFAIL
                     TAVSRAAYILATERVGATIPGMGGMVMGNLVSTLLVIPFPFFITGNHLGKVITDPALL
                     ALGFAMGLLASALPALGEISALRMLPSNVYSVVLSLEPAAAALVGVIILQEPTDAVRW
                     IAIALLITASIGITISHARVERRALEEGTAETITHFLPGAVDSIGADLVQKTGVITLP
                     TTEQIRLDRQAKETRSEGSSPT"
     gene            690451..691488
                     /locus_tag="HMPREF0733_RS02995"
                     /old_locus_tag="HMPREF0733_10634"
     CDS             690451..691488
                     /locus_tag="HMPREF0733_RS02995"
                     /old_locus_tag="HMPREF0733_10634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397910.1"
                     /db_xref="GI:503163249"
                     /translation="MTSLTPHSRRKRPSVGIIFVIISCLSLQFGAAFAVHLFPLFGPW
                     LVTVLRLLLAAITVGAAVWIAGRWRAHRAGAQTAYMAVPATTSDGFLGWSSRQWRAML
                     IFGVTLGLMNGFFYNALARIPLGLAVAVEFTGPLVLASILTRRKRDLVWVFCAAAGMA
                     VLGFEAVHGQETDLLGVLYALIAGAFWALYIRSSASVGELVPGASGLAVAMVVGAICV
                     APGTLLFPGPVALWSVTHDTQLVLFIIGTSLLASVVPYSSELAALRHLPEQVFSVLLS
                     LEPAIAALAGWALLGQETGLMRWVAIILLITASIGITQTTGGSASTDEVSGSYRRNEP
                     PEHTSPLPLPE"
     gene            complement(691550..692395)
                     /locus_tag="HMPREF0733_RS03000"
                     /old_locus_tag="HMPREF0733_10635"
     CDS             complement(691550..692395)
                     /locus_tag="HMPREF0733_RS03000"
                     /old_locus_tag="HMPREF0733_10635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_013397911.1"
                     /db_xref="GI:503163250"
                     /translation="MDERQRERAALGVHLSVSGQRGRILEDGFSEHGYVLEIGGAEQS
                     HVDAADATVVFYEYLRRIANVLDVLEPPREPVTALHLGAGALTLARYVQATRPGSSQV
                     AVDYEPQLMGFVTEVLPLPAGTRCEFVVADARAVLPEIPTLFCAHAASDDGIFRGIDA
                     IILDIFTGMDAPEHLANAGYYAELRELLSARGVLAVNVGDDAGLPFFQQQARALLDTF
                     EHVWCLCDSSMLSGEHEGNLVLIATARELDEDTADALFARGPHPAEVLGTEELRDFLG
                     YLAGQ"
     gene            complement(692405..693226)
                     /locus_tag="HMPREF0733_RS03005"
                     /old_locus_tag="HMPREF0733_10636"
     CDS             complement(692405..693226)
                     /locus_tag="HMPREF0733_RS03005"
                     /old_locus_tag="HMPREF0733_10636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="WP_013397912.1"
                     /db_xref="GI:503163251"
                     /translation="MTSMLNRRTALSLGVPALAVVFSACGNATSNSGSSASASGSSSS
                     NASSSGSASSAPSGDASGSASAGGEASASGSASASGDSAKMTATKVGERDEVGYHLNT
                     PKQGAPTVTLYTDYQCPYCAKAEPTYEKVAKDLEGTMNVTVRNMPLSQIHKNAIAAAQ
                     AVQAAELQDKHLEMANKLFETQDSWKNITEQTEFAGVLLSYAQELGLEEEKFKTDMTD
                     PKTIDLIKSDFEYGRKIGVKGTPQFAVNDKPLENVDSSTSAEDMVKEFKKAAGLS"
     gene            693386..693460
                     /locus_tag="HMPREF0733_RS03010"
                     /old_locus_tag="HMPREF0733_t10009"
     tRNA            693386..693460
                     /locus_tag="HMPREF0733_RS03010"
                     /old_locus_tag="HMPREF0733_t10009"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:693418..693420,aa:Thr,seq:cgt)
     gene            693766..694368
                     /locus_tag="HMPREF0733_RS03015"
                     /old_locus_tag="HMPREF0733_10637"
     CDS             693766..694368
                     /locus_tag="HMPREF0733_RS03015"
                     /old_locus_tag="HMPREF0733_10637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013397913.1"
                     /db_xref="GI:503163252"
                     /translation="MVMDSRTRLVEATQDLLWEQGYSATSPKDIMRRSGAGQGSMYHH
                     FTNKQELAVVALECSAHSMRHDTEKLLATDGSAYEIATAYLRRQRDVLKGCRMGRMTF
                     DADVLNTPELIEPVKRTFVWLLEALTVLFERGRDQGEFAADIDARNLASLVVATVQGG
                     YVLARATRDTDAFDAAVEGAAALLRKATVPLTTEASDHSE"
     gene            694406..694975
                     /locus_tag="HMPREF0733_RS03020"
                     /old_locus_tag="HMPREF0733_10638"
     CDS             694406..694975
                     /locus_tag="HMPREF0733_RS03020"
                     /old_locus_tag="HMPREF0733_10638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321580.1"
                     /db_xref="GI:752672871"
                     /translation="MYSMQYRVQLPTNYDMEIIRDRVRRTGHLMDGYPGLEFKAYLIQ
                     EKAKGAMENCYAPFYVWNDTEGMRSFCWGEPGYSSIVRDFGRHPIQDWTVHKLLKGNT
                     PLTQARSLNIQTVTLPEFTAPSEIIEPLTADFLNGQNANTLCRLAAVDITTWKLIQVE
                     LSSANPDHAQPKTTSYEVLHVSTADIDSR"
     gene            695289..695483
                     /locus_tag="HMPREF0733_RS03025"
                     /old_locus_tag="HMPREF0733_10639"
     CDS             695289..695483
                     /locus_tag="HMPREF0733_RS03025"
                     /old_locus_tag="HMPREF0733_10639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397915.1"
                     /db_xref="GI:503163254"
                     /translation="MRHKKQTQRFGLVFVLLLIPCCALWFFYRWIFGEDTIIAVPIVL
                     GVVTSYICAYAFTGGRTPYN"
     gene            complement(695578..696453)
                     /locus_tag="HMPREF0733_RS03030"
                     /old_locus_tag="HMPREF0733_10640"
     CDS             complement(695578..696453)
                     /locus_tag="HMPREF0733_RS03030"
                     /old_locus_tag="HMPREF0733_10640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="WP_004005648.1"
                     /db_xref="GI:490103807"
                     /translation="MLEFHRNERARQLRPSLSRSWLLVRPNSAEKDFEEAFASEADSI
                     ILDLEDGCPEDEKDEARSRVVKMLNSGVVAWVRINAITTEHWWKDVKALKNTKGLRGV
                     MLATAEHATDIDRTASELPAGTPIIALIESALGVHNAVEIASAIGTFRIAFGAGDYRR
                     DTGSSDTPMALAYVRSQLVIASTLGGIPGPIDGPSVGKYKAALTEACTYATAHGMTGK
                     LTLDSDQADTINQAFSPSDHEIAEAHKMLDVPIDGPHDGSYLPRYLRAKKVKELAKVY
                     GLWGKTESDAQRANV"
     gene            complement(696722..697240)
                     /locus_tag="HMPREF0733_RS03035"
                     /old_locus_tag="HMPREF0733_10641"
     CDS             complement(696722..697240)
                     /locus_tag="HMPREF0733_RS03035"
                     /old_locus_tag="HMPREF0733_10641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397916.1"
                     /db_xref="GI:503163255"
                     /translation="MGLKDFLQSRRDDAELGRGLWRRAHDRFIRGIDRFHQVLERLAD
                     TEMIELIVPDANTLADLIPRVRAVAMEAQRIAPSDGMDIPASPEGTFSDLHRALSKAG
                     NAVALCAEALAMARCFGECSVQCHRKITVERRVQSVVEHVENAERLIARARDEKAAQA
                     RNENPALQTTSV"
     gene            complement(697405..698415)
                     /locus_tag="HMPREF0733_RS03040"
                     /old_locus_tag="HMPREF0733_10642"
     CDS             complement(697405..698415)
                     /locus_tag="HMPREF0733_RS03040"
                     /old_locus_tag="HMPREF0733_10642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-quinone oxidoreductase"
                     /protein_id="WP_041321874.1"
                     /db_xref="GI:752673165"
                     /translation="MRAIVEKEHGDPEVLTLSEVPIPAPAPGQVLVRVHAAGLNRADS
                     LQRRGHYPPPAGASSVYGLEIAGVVEAVGEGVDPALVGERVMALLAGGGYAEYAAVDV
                     RHTLPIPNGMSMVEAACIPEVAATVYSNLVLLCGMSLDPAQNNPAEDEQTSLLVHGGA
                     GGVGMHAIQLARAAGVRVFATVGDDEKAQVVRALGAHPINYRTESFRQVIQRESAGHG
                     VNYILDVMGAKYLEDNLRSLADGGHLATIAVQGGRRAELDLGLMLTKRLSVHGTSLRS
                     RSADEKAKIMAGVHENVLPLLERGVLSANFDREFPWWQAAQAHEYFDAGQHRGKVVLR
                     VM"
     gene            698565..698652
                     /locus_tag="HMPREF0733_RS03045"
                     /old_locus_tag="HMPREF0733_t10010"
     tRNA            698565..698652
                     /locus_tag="HMPREF0733_RS03045"
                     /old_locus_tag="HMPREF0733_t10010"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:698599..698601,aa:Ser,seq:tga)
     gene            complement(698723..699055)
                     /locus_tag="HMPREF0733_RS03050"
                     /old_locus_tag="HMPREF0733_10643"
     CDS             complement(698723..699055)
                     /locus_tag="HMPREF0733_RS03050"
                     /old_locus_tag="HMPREF0733_10643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397918.1"
                     /db_xref="GI:503163257"
                     /translation="MSENYNFQPQQNPQDGYPQQGYQQPYPPTIDPEAIKAEKNAKIY
                     SITSLVLGAVGIGIFAIGFGIVAVVSCIRGLIANKGKNAGYTAMALIGGILGVFDIVL
                     WFLSRLVS"
     gene            complement(699276..699845)
                     /locus_tag="HMPREF0733_RS03055"
                     /old_locus_tag="HMPREF0733_10644"
     CDS             complement(699276..699845)
                     /locus_tag="HMPREF0733_RS03055"
                     /old_locus_tag="HMPREF0733_10644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsK"
                     /protein_id="WP_013397919.1"
                     /db_xref="GI:503163258"
                     /translation="MSEHHAGEQPSQSQNPHQGEDAYEKTRPLSDSLPEYTKLYQNQQ
                     QPAPRQQDYQQTVPQQYYHQSAPQQYYQQPAPQHYYQQPVYVQPVPMMTVVPKTPQQI
                     AGEQAAQTSLALGIVGLVLALFWVTSVIPLGLGIWGAVKGAQASRVGVPAGGGLATSW
                     IALSLGAIETLFFFIPMVAFVIAAIASTR"
     gene            700074..700165
                     /locus_tag="HMPREF0733_RS03060"
                     /old_locus_tag="HMPREF0733_t10011"
     tRNA            700074..700165
                     /locus_tag="HMPREF0733_RS03060"
                     /old_locus_tag="HMPREF0733_t10011"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:700108..700110,aa:Ser,seq:gct)
     gene            complement(700358..700879)
                     /locus_tag="HMPREF0733_RS03065"
                     /old_locus_tag="HMPREF0733_10646"
     CDS             complement(700358..700879)
                     /locus_tag="HMPREF0733_RS03065"
                     /old_locus_tag="HMPREF0733_10646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine phosphatase"
                     /protein_id="WP_004005656.1"
                     /db_xref="GI:490103815"
                     /translation="MVENSLRDVKRLIIMRHAEADWGMDDFDRPLTKRGHRQAADAGS
                     WLKQKGYIPEQLMSSAALRTRQTTTWISDALGEQAPTPHLDEGLYEVPASRVLARING
                     VSESVRTLMVVSHLPAVQDVTLQLASPDSDYNSLMDASYGFSPSSVAVFEVPGEWALL
                     DGADARLIDFMSF"
     gene            complement(701003..701770)
                     /locus_tag="HMPREF0733_RS03070"
                     /old_locus_tag="HMPREF0733_10647"
     CDS             complement(701003..701770)
                     /locus_tag="HMPREF0733_RS03070"
                     /old_locus_tag="HMPREF0733_10647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004005657.1"
                     /db_xref="GI:490103816"
                     /translation="MSGAVPGYVHISQRGRAAKRQVPQQNRTQGSAATLRPMTFSSGD
                     QQGTQKAGAQENEARGFVLYVGLNEELAAANGTSLVRIVQDLRTYAHHLAPEAESYAA
                     VALAPVHAEGSDLEVVRNALGDPTAVFYQAELHKQAREAEQPATPSSNGVLIDLARRE
                     VFLDGEQLMLTFKEFELLAHLVENSTRTVGRDELLESLWSAGDEHPHERTIDVHIRRL
                     RSKLGRLSGTVRTVRGQGYRFFEHPEVVVWAAPEYSI"
     gene            complement(702313..702951)
                     /locus_tag="HMPREF0733_RS03075"
                     /old_locus_tag="HMPREF0733_10648"
     CDS             complement(702313..702951)
                     /locus_tag="HMPREF0733_RS03075"
                     /old_locus_tag="HMPREF0733_10648"
                     /EC_number="2.4.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="WP_013397921.1"
                     /db_xref="GI:503163260"
                     /translation="MRIKILDHPLVAHKISVLRDKNTPSPTFRQLVDELVTLLAYEAT
                     REIRVEQRPIETPVARTMGTVIANPKPLVVPILRAGLGMLEGMTRLVPTAEVGFLGMA
                     RNEETLDIVTYAERLPEDLTGRQVYLLDPMLATGGTLIEAIKFLRERGAESITCVCLI
                     AAPEGIAALEKGVEGLRNIDLFLAAKDERLNERAYIVPGLGDAGDRLYGLAQ"
     gene            complement(702999..703640)
                     /locus_tag="HMPREF0733_RS03080"
                     /old_locus_tag="HMPREF0733_10649"
     CDS             complement(702999..703640)
                     /locus_tag="HMPREF0733_RS03080"
                     /old_locus_tag="HMPREF0733_10649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397922.1"
                     /db_xref="GI:503163261"
                     /translation="MELTDLIRALIPVLPVVIISLAASVIPRFISTKPPVFELKKEVI
                     FRLHWIYKISVLVIDIICLLVAIFLIWGSIMSGPRVLVAPMFWVIIAIFSILFLYIHK
                     SFSDVYVRIDSQGITVRKFYGRRKNIPYTDISEYIFKPHSDKLIIKDFRGRKTLIRPL
                     KTSSQLSLFHLAFRITEGRWAQPHSTDDRRKLEESIETNSGVQYLLDHSHGKL"
     gene            complement(703654..704295)
                     /locus_tag="HMPREF0733_RS03085"
                     /old_locus_tag="HMPREF0733_10650"
     CDS             complement(703654..704295)
                     /locus_tag="HMPREF0733_RS03085"
                     /old_locus_tag="HMPREF0733_10650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397923.1"
                     /db_xref="GI:503163262"
                     /translation="MILNIALVLAVTQMLSCVLIIKGHRNWNYLCYKFPYRGTKDGFF
                     GFISKVVLVLCGIMTLISILLVKYDPNFKNAPVWFLLLVSGGWYISLALYLDRKNFYL
                     QTTTEGISWGNLLSISYDASYEDITKFSYETRGIYGLTWLVVKTNHGKTLRFDPLLTG
                     SGSLIPQLAFRVENGYWAKSADPEDQQLLQNFIDKPEKAREILMSWSPCVIER"
     gene            complement(704292..705347)
                     /locus_tag="HMPREF0733_RS03090"
                     /old_locus_tag="HMPREF0733_10651"
     CDS             complement(704292..705347)
                     /locus_tag="HMPREF0733_RS03090"
                     /old_locus_tag="HMPREF0733_10651"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321586.1"
                     /db_xref="GI:752672877"
                     /translation="MRVAGLDVMGARVFDGASKRFLSTDPLAQVPGTGFFADVYAFCG
                     NNPVGLMDPWGLKPMSPDEFQKYSQEQYDKFWKGVRNVGEWVLAGTMIVAGALLSVAS
                     FAGPIGILAGGLGGALLGAGSEMFMQKLEGRENLDWSAIGREALIGGVSGLAGGIAAT
                     GMKAIGKVERGVKAANVASKGKKAAEAASKGVIAEQKAQKLSPMRKALSSQYSQDVAK
                     GTVSNGVSTAETYRYNSMASGNFDPVAYLGAGSAGAGTGFMVSTFTGGLNRGITGVAP
                     NMGRGSQALVKGTINAAGAYGTANANLGLSEALKPKEARKSGEDMLKASGRSSTSAET
                     KSVAKDTAGYLLKGLKK"
     repeat_region   705112..705375
     gene            complement(705438..706271)
                     /locus_tag="HMPREF0733_RS03095"
                     /old_locus_tag="HMPREF0733_10652"
     CDS             complement(705438..706271)
                     /locus_tag="HMPREF0733_RS03095"
                     /old_locus_tag="HMPREF0733_10652"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397925.1"
                     /db_xref="GI:503163264"
                     /translation="MSSELIFGLFCLVFVVGTFWLSAVFEGRRREREQKTQQVVEETS
                     DPRAVVRVLASVRLQASWFIKMLLWVTLLLLLFLASLLGLMTIATLVSQDYKPGYTTS
                     EWVELGLIIVGFPSVVWGLWVCRVSYREILPEKLMRVNNRGRKQVLHYWQIDSSYFTL
                     LGDENGLFELTDTAGVVYRFKPHIEPCRYLGSQVAFRLDYGYWADPNNTQDAEILVQY
                     IREKLWVQRLLEVPTVSGLAHDGVGQEYRPVGGPDFGPEFRIRQSVSGDFTWAKNFVL
                     T"
     repeat_region   705442..705920
     repeat_region   706064..706436
     gene            complement(706261..709362)
                     /locus_tag="HMPREF0733_RS10720"
                     /old_locus_tag="HMPREF0733_10653"
     CDS             complement(706261..709362)
                     /locus_tag="HMPREF0733_RS10720"
                     /old_locus_tag="HMPREF0733_10653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004006371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775421.1"
                     /db_xref="GI:908631388"
                     /translation="MLSLLAWAITRLEYDAASQIIKRINPDGTVEKITYDVCGRVTGV
                     EAGARVASYEYDLCGRLIGVRDSSFGQRRFKYDAAGQIIRATDGLGFRTHFSYTATGQ
                     VCRVVDAAGQVTDYEYDALDRLVRVIKAAGTDDESVQEYAYDAAGRLIRAHDGVREYT
                     HTYDYAAGGRLAHTCVDGVKAAEFGVEDQGRTVWVRDYASAQALEAGASEDAFVQHRF
                     VYDARGLLMERSRSGVITDTAGPCSGTADVDAQVQVLNTFTNTGAYTLTLGYDADGYR
                     TRMVTPYGETAIAHDGAGRVVSMSRADQDAHRESPAAQYSYDAMGRLIRAQLGDILSR
                     WEFDSESGLVCSYSRENTAKADSVERTEVIRDEQGRIVGLDSADGLVVYTYDAAGQLT
                     GSRSGDLEFEWVFEAGLMVSERTWRHSGGTGESEEPSRVLSGERSFAYNRLNQLTEII
                     AADHTAEHTFTTVTTYEYNAAGERTREIITDDRGVQQVREYAWGAYSGLASVTDTYVT
                     AHGGEAALRVRMVTDVTGELAQVAGVNGVSVPLLWDPDAAMPQILGAGGMPAPGSDGG
                     FSQVGIAGGFDPWAVPPMLGSAPDAQGMNIPGLPRTSSADDSGVWESILPAGFSFTGA
                     GSVRVAGLDVMGARVFDGVSKRFLSTDPLAQVPGTGFFADVYAFCGNNPVGLMDPWGL
                     KPMSPDEFQKYSQEQYDKFWQGVRNVGEWAAGAIMVAAGLALTVAAVATGPLGMVLLG
                     AASGALMSGGMSVITQKMEGKNVDWGAVGRDALIGGLAGGAGGVVGGIFAKGATVAKG
                     LATAEKAGKISRVVQMGVKASDKINAGIARIGNTKLVSAFRNSKFINGASNWVGNKLY
                     GKTFEGGVDELGAKVIGSGLQEGVKDGTSSSVKYAATTDNWNGTDQLSAFGMGFTGGF
                     VFGAVGGGANQGMTASSDLAKETGKTASKLNNPWTRNYANDWITSNGADAISIGLDQK
                     MSPEEKAQKMIHKVGVNSIKSGFTAGAKTYGGTIKNARGESEAPGATLQTGTSGTVAA
                     DEQ"
     repeat_region   707249..707512
     gene            complement(709319..712645)
                     /locus_tag="HMPREF0733_RS10725"
                     /old_locus_tag="HMPREF0733_10654"
     CDS             complement(709319..712645)
                     /locus_tag="HMPREF0733_RS10725"
                     /old_locus_tag="HMPREF0733_10654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004006371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775422.1"
                     /db_xref="GI:908631389"
                     /translation="MPHVRPEPIAPENSGSPSSLGGKPAPMPELKHVDPPQSSVDDNM
                     SIGTADKPRAMPDVQFDDGASDNLRNALNSAADTIETQQGGRDGLFDTARDKFEGKYA
                     HDFHMCHVQLANNSANVVTMLRYGAKLVDYIKECAHVENENRKKAREWENRNGLQQTW
                     DGVVLNKHRPDYAPNPSKPAEPGSAPQRDVNAGAPDASGGTSSAIPENLDGYNTACVS
                     YDNEAGLKHTDITNALNTYTSSCHHGSLDISETINSMAGWLQQSNQVNTWVSGVAQDF
                     RDAGSGTGNIKTVSNAYLDQRMQERGTGAPQVQKIEVHPAQVTGEIPTSGFANDPVNV
                     ATGNFIEPETDLSFPGTFARNLNLKRMYNSLAVTNSQDIPSGVFGIGWSSTLDQRLEF
                     DADKASWFTADGRILTFAREGEGFARASGEAWWLTKAELGSDAYARIEALQRETQRQL
                     KNSRGLDESAVQAFMQEPFYWIVMNNAHESFGFSASGDWVSATDGHPSNTVVAFRDAQ
                     GRVTDLVHPGSQRGIRVDYEELGQSTEAPEHRPISAYTYNTTGAEADTPLMAAEYSYE
                     GEYLTSVATNAGVRSYTHTDAGLIREVINANGIVEVTNTYDELGRVVHQLTEYGREVS
                     YTYTPSLVTIVADAETGDNSNLWTSDSKGRLIGITATDGSRQTMRYDSFGNRVGITER
                     DGSRTARVFDNRGRLKRERTPEGTDYTYGWDEHDRITGVSVRDARDPRNLGTPMTVSY
                     EYADSVNPNPSAVIDADGAQTLYDWDDRGLLTRVTEPTGVSTTFEYDAYGDLVLVTNG
                     AGNTTTLIRDDHGRVIGVIDPLGRRGTATYNSSGALASIENADGARWTFAYPEFAVES
                     LPSLVRNSTNTSGGCGNLPTSVTDPYGATIRFTYNAGGEIASVTNPLGHTTEGTFDTW
                     GNLVGLTTASGAVWNYVYDGLSQLVEATDPSGAATRYSYDLNGELSSVTDATGVEIKR
                     RVDRQRGIEEIADAFSSSFIHTDIFGRVTSEQKRARGGSSAKKADVESEFITYDVAGR
                     PVEILDAAGGLTRCERDGAGRVLRVISAEGRIETYDYDGAGRVISHAVGLDAPERYTD
                     EEGVSRVVEPSCLGDNSPGV"
     gene            713031..713447
                     /locus_tag="HMPREF0733_RS03105"
                     /old_locus_tag="HMPREF0733_10656"
     CDS             713031..713447
                     /locus_tag="HMPREF0733_RS03105"
                     /old_locus_tag="HMPREF0733_10656"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397929.1"
                     /db_xref="GI:503163268"
                     /translation="MGNYIYYSLIFSGIVICSYLSYRSEKKQKNYYQKITSAYAMGWG
                     ATPSSHRVPTSEKAGEDPLPKGGAAHENERSDALGETPESVPARDVEEFVESFTNIVQ
                     RRPLLFPIAGWAMMITIIFFVGYIILAFIARRPSEE"
     gene            713492..714136
                     /locus_tag="HMPREF0733_RS03110"
                     /old_locus_tag="HMPREF0733_10657"
     CDS             713492..714136
                     /locus_tag="HMPREF0733_RS03110"
                     /old_locus_tag="HMPREF0733_10657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397930.1"
                     /db_xref="GI:503163269"
                     /translation="MIQVLGVGSLALFGISCIFLLYAQRNWNYRNLKYPYRGTKDKFQ
                     GILANIILLLSSIPVIILSLIGIYIPEYPGTVIFLPAMNVGWYSGVYYYLSRKNFYLW
                     TTPEGFSWSNTWGKKYQATYRNIHKYRYYAREGDLTWMVLKTQHGTLRFDPKLTNAGL
                     LIPQLAFRLTTGYWAQHDHSDDQDKIQCFYDDLEETQDLVMSYSGLTFKSEERI"
     gene            714273..714890
                     /locus_tag="HMPREF0733_RS03115"
                     /old_locus_tag="HMPREF0733_10658"
     CDS             714273..714890
                     /locus_tag="HMPREF0733_RS03115"
                     /old_locus_tag="HMPREF0733_10658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397931.1"
                     /db_xref="GI:503163270"
                     /translation="MIPLVAAVLPSLGVLIASKFVTTKINYYKLEDVVTYRLKIVHKI
                     AAVISYIFFVFIVYIYITLYLYAGLEFVTVWPIWTPLVIYIMIIIHIFRNYRYSYITI
                     DDEGITYKVFMGRKKYIPYMNIAEYNLKPYQDRFILRSSTGQKVVVRPVGMSLQQLLF
                     YVSFRVTEGRWPRLDSSIDRKALEDSLGSNSGVLYLLEYPCEKIE"
     repeat_region   714921..715293
     gene            714938..715096
                     /locus_tag="HMPREF0733_RS03120"
                     /old_locus_tag="HMPREF0733_10659"
     CDS             714938..715096
                     /locus_tag="HMPREF0733_RS03120"
                     /old_locus_tag="HMPREF0733_10659"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-methionine (S)-S-oxide reductase"
                     /protein_id="WP_013397932.1"
                     /db_xref="GI:503163271"
                     /translation="MIHKVGVNSIKSGFTAGAKTYGGTIKNARGESEAPGATLQTGTS
                     GTVAADEQ"
     gene            715086..715901
                     /locus_tag="HMPREF0733_RS03125"
                     /old_locus_tag="HMPREF0733_10660"
     CDS             715086..715901
                     /locus_tag="HMPREF0733_RS03125"
                     /old_locus_tag="HMPREF0733_10660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004004727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397933.1"
                     /db_xref="GI:503163272"
                     /translation="MSSELIFGLFCLVFVVGTFWLSAVFEGRRREREQKTQQVVEETS
                     DPRAVVRVLASVRLQASWFIKMLLWALLILILLMQVSFFDRVLSGGSPEIPVIWINFT
                     FLVLGLPGAVWGLWVCRVSYREILPEKLMRVNNRGRKQVLHYWQIDSSYFTLLGDENG
                     LFELTDTAGVVYRFKPHIEPCRYLGSQVAFRLDYGYWADPNNTQDAEILVQYIREKLW
                     VQRLLEVPTVSGLAHDGVGQEYRPVGGPDFGPEFRIRQSVSGDFTWAKNFVLT"
     repeat_region   715419..715897
     gene            complement(715985..716071)
                     /locus_tag="HMPREF0733_RS03130"
                     /old_locus_tag="HMPREF0733_t10012"
     tRNA            complement(715985..716071)
                     /locus_tag="HMPREF0733_RS03130"
                     /old_locus_tag="HMPREF0733_t10012"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(716035..716037),aa:Ser,seq:cga)
     gene            complement(716297..716947)
                     /locus_tag="HMPREF0733_RS03135"
                     /old_locus_tag="HMPREF0733_10661"
     CDS             complement(716297..716947)
                     /locus_tag="HMPREF0733_RS03135"
                     /old_locus_tag="HMPREF0733_10661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_004005669.1"
                     /db_xref="GI:490103828"
                     /translation="MERTATATKGTIPMPDTPNPARRPGRTGKTQRKLFTATMEIMEH
                     RGSAHVSIEEVAQRAGVSKGTVYYNFGSKKTMIDRLLQYGTHLLVESMSEASVAQSDP
                     REGLRKSISTALTYLHEHRGFTRLWVSEVWKGLDAWTDSMVDNRQEILDFIESQVRAL
                     RSRYTIDTAQDTRALALSIFGATFMLAMDREIHGVQRSIEDSTRAVMLVFDGYIRH"
     gene            complement(716957..719521)
                     /locus_tag="HMPREF0733_RS03140"
                     /old_locus_tag="HMPREF0733_10662"
     CDS             complement(716957..719521)
                     /locus_tag="HMPREF0733_RS03140"
                     /old_locus_tag="HMPREF0733_10662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_013397934.1"
                     /db_xref="GI:503163273"
                     /translation="MSVFRVALVELKRLTSGVLPVLVLLAMSCIPLLYGSLYLYGNWD
                     AYGNVNGIVGALVVEDEGAKDASGNDLNTGADVKKSLLDAGTFDWKSVETRDKAVQGV
                     SDGTYDFALVIPKDFSARLVSTGSFKPDEKGNTGPINPQAAGLEIITNDANNYVLTNI
                     VTKAGTAVRDSVASKVGDKTANTLLASFTTIHGKMNEAADGADKINANTVKLSDAMTQ
                     LADGTGTLNDGAVKLADGSEQLVDGSSRLIEGQNKLADGSSQLADGAGTLNQGAGKVN
                     DGAIKLADGSSTLANGASDAHNGASQLADGSAALANGTGSLKKGANDLAQGAQQVADG
                     THSLKNALDQDGVRQLPGTLTAMCQNLNSIDTSAPSGDFGTDLSNTVVSKVAEDTRQK
                     LAPLVESGSISQETADAIVANINSEQTKSAVASANDQVLKNHLAQHGQAGSDVLAKLQ
                     TLKNDNCVATGESAAAQKLSTLIDGVDKLDSGATAVAQGAGTLRDGITKLDSGATTLA
                     DGSAKLADGTGKVADGASTLNNGAAQLADGTGELKNGTGNLHNGAQQLADGEKEALDG
                     QNKLHEGATTLQDGSSQLADGTGKLNSSTGQIADGTGQLKDGTGQLSTGLQNGTRQIP
                     NLNEEQQKDVASVMSSPVDLEHSSLANGRNYGEGMGPFFMCLALWIGGLMLVQTLRPL
                     NNRALASKAPTARIILGSWLPFGLIGIAQAVLMFAAVKFGLGFQMAHPWLAFLFLCFV
                     ATIFTLFIHGVVVFFGSPGKLIALIIMILQLITAGGTMPYETLPHAMRWMHDFFPMGY
                     AVTGMRRLSYGINESSLMPIMMYLLLWGAVGLVLGYLGTRRDRIWSLKKLIPEITV"
     gene            complement(719524..720447)
                     /locus_tag="HMPREF0733_RS03145"
                     /old_locus_tag="HMPREF0733_10663"
     CDS             complement(719524..720447)
                     /locus_tag="HMPREF0733_RS03145"
                     /old_locus_tag="HMPREF0733_10663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397935.1"
                     /db_xref="GI:503163274"
                     /translation="MLTADDIWARGRHKALFGRTSFTVERGEVILIQADSQIERTSLS
                     LALTGRLKLSGGTLSWDHRSPVSLHHLRSISDIIDSPEVTAPEVHMRVHDYVSEMLSY
                     SLPFFGRPRASHWLEQNDLGELDRLWTEQLTGEQNIRLMSALAAHTRSDLLVFDTPSR
                     HLDHTRMWLPYLQELAENEDDPRAVIAVVPHISESWDGKTAVVGDAHEDLEETPQDAR
                     ESIRLTVAREETESSLDDLLGGDYNDDHGDPNDRETLEGEDPDEKVQTVRSPQEDSAA
                     NASEVSEPLLEDHEEQLEELSNPKNPAEKEQ"
     gene            complement(720816..721346)
                     /locus_tag="HMPREF0733_RS03150"
                     /old_locus_tag="HMPREF0733_10664"
     CDS             complement(720816..721346)
                     /locus_tag="HMPREF0733_RS03150"
                     /old_locus_tag="HMPREF0733_10664"
                     /EC_number="3.5.4.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="WP_013397936.1"
                     /db_xref="GI:503163275"
                     /translation="MEYNNSGVHAGDGEALSTIATLAEHERWMRLALDEGKRAACAGE
                     IPIGAVVVNAEGEIIGSGHNSREHDHDPTGHAEIHAIRQAAQHLKTWRLEECTLVVTV
                     EPCLMCAGAILMARIPTVVMGAWEEKTGAVGSQYDVLRDRRLGLDVQVYAGVLREECA
                     ELMRTFFEVRRPQQGA"
     gene            complement(721401..723533)
                     /locus_tag="HMPREF0733_RS03155"
                     /old_locus_tag="HMPREF0733_10665"
     CDS             complement(721401..723533)
                     /locus_tag="HMPREF0733_RS03155"
                     /old_locus_tag="HMPREF0733_10665"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecQ"
                     /protein_id="WP_013397937.1"
                     /db_xref="GI:503163276"
                     /translation="MPTLHENAQALLRKLTASPNASFHPGQFEAIEALVTDRRRTLVV
                     QRTGWGKSAVYFISALLMRAQGSGVALIISPLLSLMRDQVQAAERAGVRAATVNSANV
                     TEWEAIRARLDANDLDVLLIGPERLNNPAFREEWMPYLQPRLGLLVVDEAHCISDWGH
                     DFRPDYRRIGALIRELDTNVPVLATTATANERVSRDIAEQLAAGANPEDVVVLRGSLT
                     RDSLRLGVLQLPDEAQRLGWLVEHLDTLPGSGIIYTLTVSAAEDTSRLLQTAGHKVLA
                     YTGKTDPDERREAEEALKTNRVKALVATSALGMGFDKPDLGFVVHLGAPSSAVSYYQQ
                     VGRAGRGTDHADVLLLPGREDRAIWEYFATASMPNEQNAYAVCEALADEPDGLSIPAL
                     EARVQLRRSTLELLLKVLDVEDAVRKIGSRWYSTGTPWSYDAPRYRAVAQARVREQEA
                     MLAYESTEGCRMVFLARELDDTTAAPCGKCDRCAGPWYPEQVSERAVQQAQGTLNAVG
                     VEIAPRGMWPTGLQELAGENAPKGKIPLSERAEPGYALARLSDVGWGSRVRELLATDE
                     SGEPLDTPVPQALGQACVRVLAAWDWGETGRPETVLTVPSPVRPTLARSLGEGLAHVG
                     KLVYLGEAELAAEPRFFGGNSVFRCADVMRSYQIPPEVIERLREHPGPVLLVSDIVDS
                     RWSITVLAQRLRVSGASAVYPFALGVTH"
     gene            723893..724552
                     /locus_tag="HMPREF0733_RS03160"
                     /old_locus_tag="HMPREF0733_10666"
     CDS             723893..724552
                     /locus_tag="HMPREF0733_RS03160"
                     /old_locus_tag="HMPREF0733_10666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_013397938.1"
                     /db_xref="GI:503163277"
                     /translation="MVFFIPVLLAHLPLGLLGFKLEDVLISTGPWVLVVSAIIVFIES
                     GVLFPVLPGDSLIFALGMLHDRMGLSLWLAFPVLIIAAVVGGEVGYQLGARYGRNLFK
                     DDAKILSTKNLHAAEEFFAKRGGFALVVGRFVPIVRTFVSLAAGISSYPRRRFNLWNI
                     LGAVLWIGSIGMAGVLLGGVEFIHNNIEMLAVIIVLVSVLPVTFEYLRGRSKGKSEAA
                     E"
     gene            complement(724657..725364)
                     /locus_tag="HMPREF0733_RS03165"
                     /old_locus_tag="HMPREF0733_10667"
     CDS             complement(724657..725364)
                     /locus_tag="HMPREF0733_RS03165"
                     /old_locus_tag="HMPREF0733_10667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397939.1"
                     /db_xref="GI:503163278"
                     /translation="MSQNPYYQDPQYQPSYAQQPQGPYGQPYQPGAYMPVPEKKPEPS
                     TVVKTGIYLIFGYALYTLVSSIYNSVTLRDRMNALLEQQKNQYSPYGNYSSVHLSDSV
                     ITTSIVVGILIAVIIVALTVVIGYFYAKGHTWARITALVLSSIGTAFGVIALIMILTG
                     AGTGSVSYSPYSTMNDPVSIGMTIFSTVLQGAIIVFMVLRDATQYTAQSRIWRMYQQN
                     QSGVNPYQQQGNQPYNY"
     gene            complement(725537..726304)
                     /locus_tag="HMPREF0733_RS03170"
                     /old_locus_tag="HMPREF0733_10668"
     CDS             complement(725537..726304)
                     /locus_tag="HMPREF0733_RS03170"
                     /old_locus_tag="HMPREF0733_10668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321589.1"
                     /db_xref="GI:752672880"
                     /translation="MSQDPYGQQPPYQPPHPNAPMHPAIQYAPVPTQKPEPTTVVKIG
                     TYLIYAVALYMIMRAIVGLDDFGFQTYHTENGKTTEVNSSTGLGYVISAIFAAFTILL
                     GFFYSKGHGWARITALVLGIIGTIRDLLYFLLTLLAQSLVQSVTSQMDGAQQVSISPA
                     VYIVLILGIILQIAVVVFMLRGDAARYTSDSRLWRSYRQDQGPQPVQQPTDSQPQQGF
                     GQAVQNPQAQNPQSWSNPAPQNPNDRYDGGSDGYRLN"
     gene            complement(726465..727403)
                     /locus_tag="HMPREF0733_RS03175"
                     /old_locus_tag="HMPREF0733_10669"
     CDS             complement(726465..727403)
                     /locus_tag="HMPREF0733_RS03175"
                     /old_locus_tag="HMPREF0733_10669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397941.1"
                     /db_xref="GI:503163280"
                     /translation="MLIIQPFNTVTENKGVPPMSEQHRPDPALPQNPQPSGGQGYPQQ
                     PAPAGQPMYGNAPAPAAELPEKPAYRGTVVAVLIVGIIAALVSLACLILELTVTSKFA
                     EFARATDLDPKKDNPFDFGVRAYIGAVISIVAFIYLSYKVKYGDRSNSATLTVVAIGA
                     SAFNLFIFLPRLDDARGVQDLLQTDLIPERFVGFLNSYVYVVYLGIASVAVFALLIIL
                     TWIPPTTKYMEKAKAYYDALHGKNQPVDASALAVPVSEGQAPAAQHNAQHVQNGQQGY
                     GYDPQAPQNPQAQQNNVPQNPQNPQDHQGNSGYNLN"
     gene            complement(727656..728189)
                     /locus_tag="HMPREF0733_RS03180"
                     /old_locus_tag="HMPREF0733_10670"
     CDS             complement(727656..728189)
                     /locus_tag="HMPREF0733_RS03180"
                     /old_locus_tag="HMPREF0733_10670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein MscS"
                     /protein_id="WP_041321591.1"
                     /db_xref="GI:752672882"
                     /translation="MSYDSAVRSEYSTTTLTSGYMGEENMVNYSPVPRASLERPYLPR
                     AVKIAACASMMIAILRTIYLTASWNFENFALGNALTIANVFLHIILGIFILRGYALAR
                     ALLVSLALLTLGTSLLTLSWLRPAVPDIPGSYLSVVVLSMAALTHLVLLGFLMFPASV
                     TLYMRESNAYRQACAHC"
     gene            complement(728535..729380)
                     /locus_tag="HMPREF0733_RS03185"
     CDS             complement(728535..729380)
                     /locus_tag="HMPREF0733_RS03185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321593.1"
                     /db_xref="GI:752672884"
                     /translation="MNEYPKPASPDPRPPQGPQTSGAYSNQPQNQYGQNHPVNPQISQ
                     PYMQNPAHQVAPSPSTPPESAAKPKMSILLLSVLILAILMPILRVIEYGVMASMVSSL
                     MEALRQSLGESAYQQFIAKPEFYELRDMQVGLVGRFVFGIFFSIIYIFFGIFIFLGYN
                     WARIVLTVFTVLNTLLVMLFLMDSIVGYNEFANFTDLVDLRSQAFGLVIIYISILVVG
                     LLPLILMWLPPANRYVRQRTSVRRARNQANSPYGMPQPYAYPAPAPHPGQAPGNQPPS
                     GGQQL"
     gene            complement(729475..730209)
                     /locus_tag="HMPREF0733_RS03190"
                     /old_locus_tag="HMPREF0733_10672"
     CDS             complement(729475..730209)
                     /locus_tag="HMPREF0733_RS03190"
                     /old_locus_tag="HMPREF0733_10672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041321595.1"
                     /db_xref="GI:752672886"
                     /translation="MTYSAAPMPEGTPSYQPHMAASNPGGLAAAFKEPKRPTFVFVFA
                     IFTATVCPILRFVEYVLTSSYLSEAFKWHQSRTYVPAYGDMSLEQMKSGMFAQAQLNS
                     TLTFHFLSVLTSALLYILFGLVVNSGKNWGRILLTILASLGVLMSGMSALGQAYTMSD
                     PEAPAFANAQGYLGALVTVYMLLFLANICLVVLVWMPPVNVYMRNTKAYWKAKEALEA
                     GSKSYADRFAAQTELASEEQTKGTNS"
     gene            complement(730375..731202)
                     /locus_tag="HMPREF0733_RS03195"
                     /old_locus_tag="HMPREF0733_10673"
     CDS             complement(730375..731202)
                     /locus_tag="HMPREF0733_RS03195"
                     /old_locus_tag="HMPREF0733_10673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321598.1"
                     /db_xref="GI:752672889"
                     /translation="MTNHPNPTSGDPSPQQPSNPYVQHLQQHMAVGQGQNPTVPLQAA
                     PQGTYDNNAVKIEKPVRTFVLTLVLVGALACIALRIIEYLVSASLMNEAARWVSSQQY
                     AENIDREAIAVPAFLLSGAQAAFLLVSVFVSSCLYLLFGCFAYVGRNWARIMLTIIAV
                     IGIIMSAFKCWAFNTAQTGIEGISQNPQVQGYMRVLVILYAALCAVNLLTIIVMWLRP
                     ANRYVRKLKAYRLARLMEQTQYQQVYAYHVVQPGYYAGQQPGGYNPNTGQQYPGQRS"
     gene            complement(731440..732051)
                     /locus_tag="HMPREF0733_RS03200"
                     /old_locus_tag="HMPREF0733_10675"
     CDS             complement(731440..732051)
                     /locus_tag="HMPREF0733_RS03200"
                     /old_locus_tag="HMPREF0733_10675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005686.1"
                     /db_xref="GI:490103845"
                     /translation="MENQPEHPHDDRATVLVSKISGKPIRPLQVSLAALIMTIFIGMW
                     AYILISYIVWVVTVPLQGVSLWESETFLTLKDQLPLVFFMMATFVLMALHVVVLFAYL
                     RGHRWAAYVLTASLLLGMLCTFIVLLLVGVIMAGLNGAPMEEVEFLLDSNSSPLYVPL
                     YVGMPYLVMSVIALGLIWSRAAREYMHARSLWRAEQREDSLMF"
     gene            complement(732190..733104)
                     /locus_tag="HMPREF0733_RS03205"
                     /old_locus_tag="HMPREF0733_10676"
     CDS             complement(732190..733104)
                     /locus_tag="HMPREF0733_RS03205"
                     /old_locus_tag="HMPREF0733_10676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="skin secretory protein xP2 (protein APEG)"
                     /protein_id="WP_013397947.1"
                     /db_xref="GI:503163286"
                     /translation="MNAEDSPRDEAPPAGQDAVPTRYTAPIRHAVPAAPPAYALEHAR
                     QNSGEPEPAPQPPQPKKQGAVRQALRAATKPKTAEPQAPQDAPAPRFIPAPTPTPPAP
                     SSSEVSAASKPAPSQTSQEVEQDVSPRRNSIPHQAYTPKNPDRAFSQMQAGLETINAR
                     RRSLNITIGVRLAVLALLGIFEGAIIARYTTNMGWGFWLIITIYAVVQVWPLARPPKD
                     ASDASVYSVWGIFSLICFIGVGLVLSPITFLLLVLNWDGISLGLDPMIVLCALGALWL
                     LEIALLSVTLYKFNTLRAILARPTLSIR"
     gene            complement(733255..734001)
                     /locus_tag="HMPREF0733_RS03210"
                     /old_locus_tag="HMPREF0733_10677"
     CDS             complement(733255..734001)
                     /locus_tag="HMPREF0733_RS03210"
                     /old_locus_tag="HMPREF0733_10677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321601.1"
                     /db_xref="GI:752672892"
                     /translation="MAHEPVENVSGNNSDVQPTGRGAEHHVAHPALSAGYPMQGQPGV
                     LAYAAPQNPYTVGSAAYGVPGTYGYSGALSTGPDNSEIRKYASIYLVRLGIVGALLAL
                     YAMGIISGINDTFDLCKEALDQDKCLSRERIVIVPGYILVTLIAAFPICNIFGWLAVK
                     NNRHYLRVRVINIIGIVLSALGAIGGALVLLPTVENVVTWGHTVDKGALVSLVATVAP
                     AVDLVFSIIFVVYASRMKRGIYSPKNPYQP"
     gene            complement(734060..735010)
                     /locus_tag="HMPREF0733_RS03215"
     CDS             complement(734060..735010)
                     /locus_tag="HMPREF0733_RS03215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321602.1"
                     /db_xref="GI:752672893"
                     /translation="MSTDPMKNDNSSRQSEEPRTAPQESSATSPVDEHSGDSTAHKTD
                     GTGGASQHEHSGHAAKSAPLSEDKQNPNNSGNTQNQQTPPSAPGYVGLQPGYPAPSPS
                     TPPNPYANPHVVPGYSGYAVPSPTAYPYTAYPANPHDEIVRKRSLMYLLRLCIVGALI
                     AIGIVATTFNLIGAIIELSDCGTGSYSWSEYSQRVCREDNTSAITGASIFLVILIAYP
                     ICHIFGLLAVRKNQHHVRVLVINIIGIVLSSLGIVLAGLMLLGGIAMITAFGSSGLLA
                     IFIIFLVAGAVPVAELIFSIIFVRHASWMNHKDYFTKPGV"
     gene            complement(735162..735800)
                     /locus_tag="HMPREF0733_RS03220"
     CDS             complement(735162..735800)
                     /locus_tag="HMPREF0733_RS03220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_041321604.1"
                     /db_xref="GI:752672895"
                     /translation="MLSRWRLRQCFTMPAADRVPMSEQYNPGFWDQACSTPPPVRRLY
                     LVRMLFLVVPALTLVYFFEAIGLDPIGAVPLMYLSLHGWFAVAYARNKSMGLVMVGNL
                     LSALAASVITGFFAYILVFIHGPRTLWKLLGGSYPILTIWIMASFVIEILCSLIFVFL
                     IFRRFPSRAEREAQETRDLSQESSPPEDQAVNDHTLTKAEAQSTHRTDSDIP"
     gene            complement(735904..736410)
                     /locus_tag="HMPREF0733_RS03225"
                     /old_locus_tag="HMPREF0733_10680"
     CDS             complement(735904..736410)
                     /locus_tag="HMPREF0733_RS03225"
                     /old_locus_tag="HMPREF0733_10680"
                     /EC_number="3.5.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-asparaginase"
                     /protein_id="WP_013397951.1"
                     /db_xref="GI:503163290"
                     /translation="MSTIKNPDVITILATGGTIDKFYSVAGTLDIGKPAAHDVLSRVL
                     TDIRFDIRALIGKDSLDMTDEDRAELVAALNAIEHDQVLITHGTDTMSESARYIAEHA
                     ELGSKVVVLTGAMQPAVMAHSDAGFNLGAAISALNLLEPGVYISMSGRIFPAHTVRKD
                     RTRGIFEG"
     gene            complement(736656..737909)
                     /locus_tag="HMPREF0733_RS03230"
                     /old_locus_tag="HMPREF0733_10681"
     CDS             complement(736656..737909)
                     /locus_tag="HMPREF0733_RS03230"
                     /old_locus_tag="HMPREF0733_10681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013397952.1"
                     /db_xref="GI:503163291"
                     /translation="MAGIFIRAIYEVYVFALFCVVISLCLVGIGFLILPFMLNWMKFN
                     AEAERNTARHRAGVEVIGGYKPVEGGKYSINPRKSLARLGDSLVLRDILWHFVNVFVG
                     TFLGILPILLFLSGVWGVALMMGQHYFAPLFDVDPGGPHYMFLDMTTPNAYWYAGIMG
                     IIQIPLAFIIARPLLKAYGYWVQPVLGRPSELVLRERISHLTDTRNDALDFQQDEISR
                     IERDLHDGVQAHLVSMGMTLNEVAALMKEDPERAQQMLSQAQNSSVTALQELRGLVRG
                     IRPPLLADRGLNEAVRSLCASTSVPTTFTSTLTGRLPEPLETALYFAAAELVTNAVKH
                     ANAQNITVSITQGKSLIMLEVQDDGTGGIPQDALGSKASGGLEGVRRRLATFDGEMFV
                     SSPAEGPTSVRTIVPYAAPTAEQNS"
     gene            738268..738915
                     /locus_tag="HMPREF0733_RS03235"
                     /old_locus_tag="HMPREF0733_10682"
     CDS             738268..738915
                     /locus_tag="HMPREF0733_RS03235"
                     /old_locus_tag="HMPREF0733_10682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013397953.1"
                     /db_xref="GI:503163292"
                     /translation="MRIVIAEDQFLLRQGLENLFTRHGFEVVAAVDDGPSLTDAVLTH
                     RPDVALIDIRMPPTFTDEGLRAAVQIRKQIPGQPVLILSQYVERLYVDELHMDGGLGT
                     GYLLKDRVFDDAGFVRSVKAVAAGGVVVDPETLKELMEHRAVQQRLERLTSRELEVLT
                     LMAEGLSNSDIAEKLFVAEKTVAKHINTLFAKLDLPDTNSNARRVQAVLHLLRNG"
     gene            739081..739548
                     /locus_tag="HMPREF0733_RS03240"
                     /old_locus_tag="HMPREF0733_10683"
     CDS             739081..739548
                     /locus_tag="HMPREF0733_RS03240"
                     /old_locus_tag="HMPREF0733_10683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkylhydroperoxidase"
                     /protein_id="WP_013397954.1"
                     /db_xref="GI:503163293"
                     /translation="MMRANYPELVPESYKAMMALEGTLTLETALKELVKLRVSQINGC
                     AFCTDMHAKEAKLNGERELRLYHVPVWRESNLFNEKERAALEWAEKLTRLDGGHVTDA
                     DYQEVRQYFDDKELAELTFVITAINAWNRLGVAYAAVPGSVDKMMGLDKAGLE"
     gene            complement(739876..740589)
                     /locus_tag="HMPREF0733_RS03245"
                     /old_locus_tag="HMPREF0733_10684"
     CDS             complement(739876..740589)
                     /locus_tag="HMPREF0733_RS03245"
                     /old_locus_tag="HMPREF0733_10684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397955.1"
                     /db_xref="GI:503163294"
                     /translation="MEFMMAFRYSRSAMTGAAIFTLAGVTVLPLAQANAAPASPQSEG
                     ASSASQNAQGQQQSTNGQGQQAQGGATQVASDGSSQSQQQGANASQNDSNSASQNGQR
                     QVSQPSAPVESIFVVIDSVDGFIDPQKTDNALNVRGVWYDNNPSFNYSLTVQELDEFG
                     NVVDDDVSTTVGGSSISSDGHFDLHVNVDGTKINPSHKYQVHLTAYDQGDMTTSEDSY
                     PVVVWNHTHIPVFPLLAAR"
     repeat_region   740467..740685
     gene            complement(740995..742059)
                     /locus_tag="HMPREF0733_RS03250"
                     /old_locus_tag="HMPREF0733_10685"
     CDS             complement(740995..742059)
                     /locus_tag="HMPREF0733_RS03250"
                     /old_locus_tag="HMPREF0733_10685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein argonaute-2"
                     /protein_id="WP_013397956.1"
                     /db_xref="GI:503163295"
                     /translation="MEFMMAFRYSRSAMTGAAIFTLAGVTVLPLAQANAAPASPQDEA
                     RSGSTQGQPNSAAQNGQDQGQQQGANANGQGQQGANADAQGQQGANASGQKQDGATQD
                     QQQSANAGGQGQQQTQGGATQDPSQAASGGEQQQGQPSASQDKQGTNASGQGQQAPQS
                     RGASSASQSGQGQQQGQPSASQDQQGANAGGQGQQAQGASASQSSSNSNSASQNNQSR
                     HSQPSAPAKQSSGYATITSVDGFIDPQKTNNSLSVGITGVDNTHRIISDLRVQELDEF
                     GNIVNDDVNTVGGASSNDSEGNLGISVVVDGTKINPNHQYRLYLDVFDQDTLTRSYAY
                     YPVVVWNRSYIPVVPLSAAQ"
     repeat_region   741597..741708
     repeat_region   741824..742246
     gene            complement(742729..744258)
                     /locus_tag="HMPREF0733_RS03255"
                     /old_locus_tag="HMPREF0733_10686"
     CDS             complement(742729..744258)
                     /locus_tag="HMPREF0733_RS03255"
                     /old_locus_tag="HMPREF0733_10686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005509380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397957.1"
                     /db_xref="GI:503163296"
                     /translation="MSNTVHSSEDLSVILKVESPETRVFNNIRRITGFVKVRGLIDLI
                     TVLNLDANPRSAKKSQVTTEIIETIRETPELYPFKSKGILIGASEYDDFNRNRFHLLF
                     HNLKLEGILDGGHNTLAIALYLLEEAILLSSNPEKIEKNQKELRKVKTWDQMKKFWKK
                     MERSINLLKNSESESHDALVPVEILVPGAKTEESIHDFLSSILLICAARNNNVQLKAE
                     TLANQDGIFDDLKNTLEQQVPDVYKNISWKTNQPGDIDLRFLISLVWITLGVALEELN
                     KSDVIKNIKPLPGTTAYSSKSEAVRRYKDLISSNGISHKETGGDTNTWVVDNPQVKSA
                     LKMVPKVLEVYDYVYENFQDSYNMNDGKFGRIEVVKNESKQRRNFKTPFGRKDIEGPE
                     KMVPPAGYMMPVIYGLRNLVKVNEEQGTLEWAFDPMEFYGEPSNLAKIIGSIMSNMRD
                     VGFDPQRIGKGDSPYIQIANTVKTMRLEREQKQSGREAEEKIARLKKLLEESGVDVDL
                     S"
     gene            complement(744640..744712)
                     /locus_tag="HMPREF0733_RS03260"
                     /old_locus_tag="HMPREF0733_t10013"
     tRNA            complement(744640..744712)
                     /locus_tag="HMPREF0733_RS03260"
                     /old_locus_tag="HMPREF0733_t10013"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(744677..744679),aa:Lys,seq:ttt)
     gene            744846..745541
                     /locus_tag="HMPREF0733_RS03265"
                     /old_locus_tag="HMPREF0733_10687"
     CDS             744846..745541
                     /locus_tag="HMPREF0733_RS03265"
                     /old_locus_tag="HMPREF0733_10687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone acetyltransferase"
                     /protein_id="WP_004005703.1"
                     /db_xref="GI:490103864"
                     /translation="MAHRAHHRPVSQPSEKFERRVGGEDPAARDEAAHTSARILLERG
                     RQNSDPEVAARLIDFTDEYGIEALAQLWSHSPARSLPGALWRMYSLRDMVRRYPKATA
                     QAFSTGMGADYRSHLLAGVPDPPGASEVVKTADKILAGLYSGDIDIALERFAAFARVV
                     ALGLRLNYERADISRLSGNPQGVHPPSHEVRREGIERMFRVPEQYRKLVKIAEDLEAT
                     AAHWRASGGLEAL"
     gene            745875..746492
                     /locus_tag="HMPREF0733_RS03270"
                     /old_locus_tag="HMPREF0733_10689"
     CDS             745875..746492
                     /locus_tag="HMPREF0733_RS03270"
                     /old_locus_tag="HMPREF0733_10689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transport regulator"
                     /protein_id="WP_004005702.1"
                     /db_xref="GI:490103863"
                     /translation="MLHRIFPQANSSLTSLAQISVQVAEAAALLSEMVGSSTSEYPEL
                     FDRMLVHEANSTDLFFMTLTTVRSSFATPVPREDLYTLARKLTNAVEKLTSAAHILYL
                     HKIDGFAPHITAILDIIQRQAVLTEAVIPKLADIKGLDNYWMDMLRISRQAVRTAEEY
                     DAELAERFPMERYRRYTKFIAQLVEAANAMRGVSSEIGRIIVQES"
     gene            746492..747493
                     /locus_tag="HMPREF0733_RS03275"
                     /old_locus_tag="HMPREF0733_10690"
     CDS             746492..747493
                     /locus_tag="HMPREF0733_RS03275"
                     /old_locus_tag="HMPREF0733_10690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transporter"
                     /protein_id="WP_013397959.1"
                     /db_xref="GI:503163298"
                     /translation="MVLLSILCVGAFLSAIFVTGMHDASNAIAVPVRTRTMGDTAALI
                     TAALFNGIGVFAAYLLITDMSVPWIAVPSGHLGLPGLTAALITAALWGVATWALRMPA
                     SSTHALIGALAGVAWYARVDGEGSRFIPAIFDATLLPLLYLPPLIFLLSWLLVIPFYR
                     LAIRSSPSSVNRHSREVLAVSASAISLLHGMQTGYLYLLVLHVLGAVFPLPTRDLLPW
                     HVLTIALALAAGTLTGGRRIGYTFAYRMVRLDPMRGAVAQGTTALMQALGYFLLQLPF
                     SSSHLATASALGAGVNQRFNSVKPKIVANIMLTWFVTLPACFLCAIALMMALDGIFG"
     gene            747583..748590
                     /locus_tag="HMPREF0733_RS03280"
                     /old_locus_tag="HMPREF0733_10691"
     CDS             747583..748590
                     /locus_tag="HMPREF0733_RS03280"
                     /old_locus_tag="HMPREF0733_10691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_013397960.1"
                     /db_xref="GI:503163299"
                     /translation="MPYAQALYIPWRALFSSVAVIVRTKDRPVFLARALQNIAEQRYT
                     QYTVYVVDDGGNQEESQQIIDRSPVAAQTVLLHAAGGNMEAASNLGVRSSESTYIAIH
                     DDDDLWDPQFLERTVATLDETGADMCVVRIIERFERQTEDGFIVLNECTFHEDLPAMG
                     LQFLFRTNRAVPIGVLYRRTLHEKVGYFDEELPVVGDWEFNMRAAMAGEVQLLDDPLA
                     YWCKRPDATGSAANSVSHEQQHRIFDAQVRANAIREDLAAGAHIGPYLYQAHLTNELD
                     GRLLETLEALQDVQERLERLENMQQEQCERLHRMERAMSWSGKLSRLRAIFSPKDSSS
                     K"
     gene            748599..750137
                     /locus_tag="HMPREF0733_RS03285"
                     /old_locus_tag="HMPREF0733_10692"
     CDS             748599..750137
                     /locus_tag="HMPREF0733_RS03285"
                     /old_locus_tag="HMPREF0733_10692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide pyruvyl transferase"
                     /protein_id="WP_013397961.1"
                     /db_xref="GI:503163300"
                     /translation="MTRVLVVGDIGQPVYHVGDEAMTISTAEYLADAGMQVILATRDA
                     DQSRRYLGARGSSAYEYMPFLLFPWAPAEREITLERLEEFLVSGVMPDLPDFCPSAQH
                     IRDFVEGIQSVDAVVISGGGNLNSRYGWLLYERAAIALVAQYAKIPVFVSGQSIGPVL
                     SPRDEEVLLRMLRSAALVAVRERSSYEWCREHDLKALAGVDDASDYRAHTPEMTLDYA
                     DARVEVPELPEHYVCVTVHEVSGNKIHELAALLDKIYSEYGLAAVFLGHMGDPASEGG
                     RTGDYKAHELVAASMTSPATVIPILHADATVRIHQGAALNITDRYHPAVFSLSAGIPA
                     VALVPDAFTEMRICGVMGHYGMQNFMTPLHMLGTDIPEKLIASALSLSRGQRQELRAR
                     HEVVTALLHAWRKYLAASVRGEKQAHMPESISAAAAIPALEPSLEAINNAVRELLLKT
                     SLAEGTEWALSDRMHSWEAHMRGEFERAEDELQALKRSRMVRAAHRTSRQVQAMRHIG
                     SRFR"
     gene            750287..751549
                     /locus_tag="HMPREF0733_RS03290"
                     /old_locus_tag="HMPREF0733_10693"
     CDS             750287..751549
                     /locus_tag="HMPREF0733_RS03290"
                     /old_locus_tag="HMPREF0733_10693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397962.1"
                     /db_xref="GI:503163301"
                     /translation="MAHASMKEQFLNYVRAGAHRVRAGFFQSIQITIASMGAYLFAER
                     VLGHEEPIFAAVAALVSLGYVSGSTHSRRILEVSFGVSLGILIGDLFLQMLGRGIWQA
                     TLALFISVLLARFLDNGIIFTIQLSFQACLVILLPPTSDLPFTRSLDGVIGGVAAFLM
                     MFLMPKDPRNGSRQRAEALMSAFSDVFFLAAKAIRRYNYDQAYQSLQDSRKLQPLYEA
                     SKNDLVTARGMAQLSWAGKKTRIELDRLAQTLGAIDLAIRNTRVFNRRMASTIAHVQL
                     RPKALETLSAALEELALATQSTGLGMYSSTEHEREHYMEVARERLISLAETLEPKHLG
                     VETFEGESLVLMLRLITVDMLEATGMDHEDAVATLVPLGEAVTEHAPRTSEIPIVQAD
                     VAGAQEEDLRTRTVNIMLRDEDLEEELG"
     gene            complement(751717..752361)
                     /locus_tag="HMPREF0733_RS03295"
                     /old_locus_tag="HMPREF0733_10694"
     CDS             complement(751717..752361)
                     /locus_tag="HMPREF0733_RS03295"
                     /old_locus_tag="HMPREF0733_10694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013397963.1"
                     /db_xref="GI:503163302"
                     /translation="MVDQESSTPKRLPAAERREQMLSAASIVFGERGYAGTTTDAIAK
                     EAGVSQAYIVRTFGSKESLFVEAATRSVDKTIEVFRAAARDNDDLTTLPRHLGHAYVE
                     LVADRGILLTMMHLFTMGHHERFGKLAREEFARIYRVLHHELGLTAQKTEKILARGML
                     INAILGMRLTDVIDTDPDVEELLSCTFADEAHIVADLISGYEPLPPAARGRTSS"
     gene            752432..753829
                     /locus_tag="HMPREF0733_RS03300"
                     /old_locus_tag="HMPREF0733_10695"
     CDS             752432..753829
                     /locus_tag="HMPREF0733_RS03300"
                     /old_locus_tag="HMPREF0733_10695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013397964.1"
                     /db_xref="GI:503163303"
                     /translation="MDQTSQRRPAWLVILALSFPMFMASLDNLVVTNALPVIGADLHA
                     SIEQLTWTVNAYTLTFASCILMSSALADRFGRRRIFLSGIFIFTAASAWCGVSSDINT
                     LIIARAIQGFGASAIVPLSLALISTSVPERMRAAAIGIWGGVSGLGIAVGPLIGGAVV
                     EGMNWHSIFWLNVPISVICMALIWYTIDESYGRPQPLDFLGLILAGVGLFGLTYSIVR
                     GNDAGWTSAEVLTGLIGGVALIAIFIWWESRAAAPLLPLRLFRNRSFSAANVVGVIFC
                     FGIFGVIFLLIQFLQVVQGASPLEAGLMTMPWTLAPLVISPITGIFTPKIGTRPIIVT
                     GLILTGLGLFWVGTLLNPDTPYIQLVAPFLVSGIGNGIVFAPLATATLQGMAAEDQAT
                     ASGTNATARQIGVALGVATLTAIFTSLGGTLTPSGFSDAATPTTFVGAAALVAAVIAG
                     LFLPKHVRTEEKVQS"
     gene            complement(753936..755363)
                     /locus_tag="HMPREF0733_RS03305"
                     /old_locus_tag="HMPREF0733_10696"
     CDS             complement(753936..755363)
                     /locus_tag="HMPREF0733_RS03305"
                     /old_locus_tag="HMPREF0733_10696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="WP_013397965.1"
                     /db_xref="GI:503163304"
                     /translation="MAARTKTTKGTPAYRCTECGWTTAKWVGRCGECQTWGSVEEAAG
                     GTVARTRAASSVQKPAQVIGEVDSTVAAYMSTGNPEFDRVLGGGLVPGAVILMAGEPG
                     VGKSTLLLDVAATFARGYTPRTPAAERARAKTRDVLYVTGEESAAQVKLRADRIHAVA
                     DTLYLTSETDLGTALAHIEQVDPAMLVIDSVQTLASADVEGSAGGVTQVREVAASLIA
                     AAKARNMCTLLVGHVTKEGTIAGPRLLEHLVDVVCQFEGDKHSNIRMLRAIKNRYGPT
                     DEVGCFDMHEDGIAPVLDPSGMFVSRTPHPVAGTCVTVTMEGRRPLLAEVQALLDQAV
                     APAPRRTVAGLDSARIQMLLAVLQRRAGLNVGKLDCYVSTVGGAKISEPAADLACVMA
                     LASAAQNKPLPRKLAVFGEVGLAGEVRAVPGIRQRIAEVGRLGFTHVLVPASPTGVGQ
                     VPDGVTVREVATLGEALNLLFPQDK"
     gene            755489..756553
                     /locus_tag="HMPREF0733_RS03310"
                     /old_locus_tag="HMPREF0733_10697"
     CDS             755489..756553
                     /locus_tag="HMPREF0733_RS03310"
                     /old_locus_tag="HMPREF0733_10697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005745.1"
                     /note="non-specific DNA-binding; scans chromosomes during
                     sporulation for DNA-damage; delays initiation of
                     sporulation; participates in a checkpoint signaling
                     cascade for cell-cycle progression and DNA repair; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_004005745.1"
                     /db_xref="GI:490103906"
                     /translation="MQTDYSELLLKTIAQIAPGTELREGLERILRGRTGALIVLGSDR
                     TVTGLSSGGFTIDTEFSATRLRELAKMDGAIICDRDATRLLMAAVQLMPDATIDTNES
                     GTRHRTAERMAIQTGFPVISVSASMSVISVYVDGTRYTVEDTQYLMARANQAIQTLES
                     YKKRLNKVLSTLSALEIESHVTLSDVAITLQRMEMVRRIISEVSHYVLELGVNGRLVA
                     LQLEELRSPDMAGIDVILHDYLPRPTAQSISIATRALRDLTDMDIVDLTMIAQAAGFG
                     DYELDTPLQPRGYRLLDGIATIPNTIAERLVERFGTLQALMAASLEDLRDVDGIGEHR
                     ARTVRESLSRMAESSLEKYL"
     gene            complement(756697..757476)
                     /locus_tag="HMPREF0733_RS03315"
                     /old_locus_tag="HMPREF0733_10698"
     CDS             complement(756697..757476)
                     /locus_tag="HMPREF0733_RS03315"
                     /old_locus_tag="HMPREF0733_10698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397966.1"
                     /db_xref="GI:503163305"
                     /translation="MHDTQKTVILNGMSELGPELPPEVYRRRRIVAVVVLILVLLVGI
                     VGITTLVNQINKGPQDDAAAEATATGEPFQNFSARPTPSTVAPSGSVSGSASGSPNAS
                     ATPSVSGTPAVSDSATPSGSASASATPAVALCNAKDLKVTVEPSKKQYAPGEMPSFHV
                     VYTNSSGKPCFIGGEKVAEGVEINITSGDTQVYSSAKCTPTPTKRTEIPAGKEAASDV
                     AWDRKLNTSGCNALKNTAKGTYWVTATVNGVTSQRVNFLLK"
     gene            757611..758546
                     /locus_tag="HMPREF0733_RS03320"
                     /old_locus_tag="HMPREF0733_10699"
     CDS             757611..758546
                     /locus_tag="HMPREF0733_RS03320"
                     /old_locus_tag="HMPREF0733_10699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(Fe-S)-cluster assembly protein"
                     /protein_id="WP_013397967.1"
                     /db_xref="GI:503163306"
                     /translation="MFNLKNSHELHHRINTWYQHHARDLPWRRADCTAWGVMVSEFML
                     QQTPVNRVLPVWEEWMRRWPTPASLAAEDSAEAVRAWGRLGYPRRAQRLHGAAVAITK
                     HHDGEVPADYDELLELPGVGAYTAAAITVFAFGRRATVIDTNIRRVHARAVMGKALPH
                     KHLNVAETTLAEELMPQNTAVSCVWNASVMELGALVCVAKNPRCEQCPLEDICAWVKA
                     GKPQAEYTPTGQSWHGTDRQLRGAMMAVLRAAHAPVPRELLTDFSTDITVPDALKVPV
                     QDLRKLDSSQEQIDRCYSGLLKDKLAKERKDRVSL"
     gene            758675..759442
                     /locus_tag="HMPREF0733_RS03325"
                     /old_locus_tag="HMPREF0733_10700"
     CDS             758675..759442
                     /locus_tag="HMPREF0733_RS03325"
                     /old_locus_tag="HMPREF0733_10700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="WP_004005748.1"
                     /db_xref="GI:490103909"
                     /translation="MKIAVIGATGTIGSKIAAELEKRGHEVVPISRSHGVDVSSLADL
                     SAALTGVDVVIDAINNMIMSSKKAQTAFISTSSNIAQAAADNDVKRIVCVSIAGVENP
                     AVSRGYGYYAGKAAQEKTYQDSAVDTVIIRSTQWFELLDPIVQQVTVGPVSVLPTMKM
                     APIPADAAAQLVCDVADGSEKVPGTGIVSIRGEEEGTTAEFVKRLLTARGEVGGKTPK
                     VVRQLPYFGSAIAKGGLIPDPADHTVSTTLEEWLASL"
     gene            complement(759519..760025)
                     /locus_tag="HMPREF0733_RS03330"
                     /old_locus_tag="HMPREF0733_10701"
     CDS             complement(759519..760025)
                     /locus_tag="HMPREF0733_RS03330"
                     /old_locus_tag="HMPREF0733_10701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013397969.1"
                     /db_xref="GI:503163308"
                     /translation="MPASSEKSQQSVNPPQPGQGQEAYLAETRSRIGSSIKRAEQAMM
                     AVKSKVLREYDLSVAQYAAMTSLYYVPGQSAAQLARAAAVTPQTMATILARLDAKSLI
                     TRVPSEIHSRVNIVTLTDAGEELVVQADEKVRAVERAMSAEFTSQEREQLQDLLDRLI
                     GFLEHKGA"
     gene            complement(760248..762800)
                     /locus_tag="HMPREF0733_RS03335"
                     /old_locus_tag="HMPREF0733_10703"
     CDS             complement(760248..762800)
                     /locus_tag="HMPREF0733_RS03335"
                     /old_locus_tag="HMPREF0733_10703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding protein"
                     /protein_id="WP_013397971.1"
                     /db_xref="GI:503163310"
                     /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHLLLGLIHEGEGI
                     GARALESLGVTLNAVREQVQSIVGPSPQAPSGHIPFTPRAKKVLELSMREAIQLNHGY
                     IGTEHILLGMVRASEGVANQVLSKVGVQGAEVRQAVMDLISGYPGNNENKETAGVGAG
                     NSREGTPAGSTILDQFGRNLTAAAREGQLDPVIGRHHEMERVMQVLSRRTKNNPVLIG
                     EPGVGKTAVVEGLAQAIVHGDVPETLKDKHLYTLDLGSLVAGSRYRGDFEERLKKVLK
                     EIRTRGDIILFIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKHI
                     EKDAALERRFQPIQVDEPSQELAVQILKGVRDKYEAHHRVTITDESIEAAVNLAARYI
                     SDRFLPDKAVDLIDEAGARLRIKRMTAPPEIKILDEKASKLRTQKEDAIKGQDYEKAA
                     ALRDQEQKVLAEKAEAEKAWRENGDAFGEVTPEVISEVLASSTGVPVYKITEEESSRL
                     IKMEDELHKRVIGQDNAIKALSRAIRRTRAGLKDPRRPGGSFIFAGPTGVGKTELAKA
                     LAEFLFGDEDALITLDMSEYQEKHTVSRLFGAPPGYVGYDEGGQLTEKVRRKPFSVVL
                     FDEVEKAHTDLFNSLLQILEDGRLTDSQGRVVDFKNTVIIMTTNLGSRDVNRRVPVGF
                     QAMDHGDADYERMQARVMENLKEHFRPEFLNRVDDIIVFPQLSENEILQIVDLFVGRL
                     AKRLADQEMSIELTDAAKVLMASKGYDPAMGARPLRREMQRNIEDALSEKILFGEIKP
                     GEKITVGVEGEGDDAKFVFSSQQMRDLPLETVNKMAESAVEEAEQITGGASD"
     gene            complement(763348..763707)
                     /locus_tag="HMPREF0733_RS03340"
                     /old_locus_tag="HMPREF0733_10704"
     CDS             complement(763348..763707)
                     /locus_tag="HMPREF0733_RS03340"
                     /old_locus_tag="HMPREF0733_10704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005751.1"
                     /db_xref="GI:490103912"
                     /translation="MAQKVRIILEDDLDGGPAEETVRFGLDGAHYEIDLSSANAARLR
                     DAIRPFASKGRRVQVGASQRGSRGGRGSSAPVKRNPETAAIRKWARENGHEVSDRGRI
                     HQEIQDAYYAAMKAEGK"
     gene            complement(763881..764096)
                     /locus_tag="HMPREF0733_RS03345"
                     /old_locus_tag="HMPREF0733_10705"
     CDS             complement(763881..764096)
                     /locus_tag="HMPREF0733_RS03345"
                     /old_locus_tag="HMPREF0733_10705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005752.1"
                     /db_xref="GI:490103913"
                     /translation="MEILIALLPPIFAGIALYFILRWINRADRAERSAQRDVEKDAQQ
                     WYEKVKGSQGTVNPFGTDKTGNKTERQ"
     gene            complement(764245..765789)
                     /locus_tag="HMPREF0733_RS03350"
                     /old_locus_tag="HMPREF0733_10706"
     CDS             complement(764245..765789)
                     /locus_tag="HMPREF0733_RS03350"
                     /old_locus_tag="HMPREF0733_10706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="WP_048778895.1"
                     /db_xref="GI:881061244"
                     /translation="MSEQMKIRLEKRAKFLETAGEAYPVGLLDAEGKRIEPDHIADIR
                     AQYDPKLESGELTAGDETDHVVHVPGRVVFVRNTGKLCFASLQAGTNGDRIQAMLSLN
                     EVGEQSLADWKSLVDLGDHVYVTGRVVVSRRGELSIMVREWRMAAKSIRPMPVLHKDL
                     NEETRVRRRYLDLMVRPEARDLVKKRALITRTVRRVLEDHGYIELETPVLQLVHGGAT
                     ARPFRTHLNAFDQPMTMRIATELPLKRAVVGGIERVYEIGRVFRNEGVDSTHSPEFTT
                     LECYEAYADQYVMAERMQEIIVACAQELGVTAIETEDGTIDLGGEWAWLSVYPGLSEA
                     VGVEITPDTPAETLREIAAKHEVEVDPAWDAEKLVIELFGEIVEPTLLNPTFVYNYPP
                     SAQPLARPNRDGSRTIEAWDLIIGGMERGTAFSELIDPVIQRERLTEQSHKAAAGDDE
                     AMELDEDFLRALEHGAPPMGGLGLGVDRLIMLLAGEQDPERPGTVVRQPGIRETILFP
                     LMKPES"
     gene            complement(765873..766820)
                     /locus_tag="HMPREF0733_RS03355"
                     /old_locus_tag="HMPREF0733_10707"
     CDS             complement(765873..766820)
                     /locus_tag="HMPREF0733_RS03355"
                     /old_locus_tag="HMPREF0733_10707"
                     /EC_number="6.3.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="WP_013397973.1"
                     /db_xref="GI:503163312"
                     /translation="MTETSMPRIVTTITELRSAIAEALAAAQERLNERARAEAAEQEG
                     EVQYRSATLGYVPTMGALHAGHATLLRRASEQNDVVVASIFVNPLQFGPNEDYDKYPR
                     ALETDAQVAADAGVDIIFAPSVDEMYPEGEPLIRISSGELGNKFEGITRPGHFDGVLT
                     VVNKLFNIVRPAAGSHEVNAYFGQKDAQQVLLVQRMIHDFNHDITLRPIAIVRDDDGL
                     ALSSRNEFLSEQEREAALVISRTLALMRENSLNRGFESIDLESARARINSTEGVRLDY
                     LELVDPSNFQPPTADSERVLALVAAYVGSTRLIDNMDLL"
     gene            complement(766817..767773)
                     /locus_tag="HMPREF0733_RS03360"
                     /old_locus_tag="HMPREF0733_10708"
     CDS             complement(766817..767773)
                     /locus_tag="HMPREF0733_RS03360"
                     /old_locus_tag="HMPREF0733_10708"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stilbene synthase"
                     /protein_id="WP_041321877.1"
                     /db_xref="GI:752673168"
                     /translation="MTTNHLKPARLGIGVISAGKVGAVLGAALRAAGHSLVGVHAVSE
                     ASQERADVLLPGVPLLEVEQIAERSELLLLAVPDDELAGLIEYLASSGSLTSGQLLVH
                     TSGRHGTDIFAPATTLGAIGLAIHPAMTFTGLSLDLQRLTGTSFAVTGPAPFIPIAQA
                     LVVEMGGEPVHVAEADRALYHAALAHASNHLVTLLGQSQQMLASIGIEDPARYLGPLV
                     RATVDNALASGEGALTGPVARGDAGTLDAHLNALIEYTDHENTQDIADSYAAMVRATA
                     SRAHNRNLLNDDQKARIESTLRTHTTGTRQSGAMPDDKEFSS"
     gene            complement(767863..769575)
                     /locus_tag="HMPREF0733_RS03365"
                     /old_locus_tag="HMPREF0733_10709"
     CDS             complement(767863..769575)
                     /locus_tag="HMPREF0733_RS03365"
                     /old_locus_tag="HMPREF0733_10709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397975.1"
                     /db_xref="GI:503163314"
                     /translation="MTQEPQNSNNQGVRSVESSNTLEHQITPSEAAETLTWWRTDVRT
                     FIMNIWVFVAFIIYLAWDYIKNSFNNNAENDYWNILRQLPEYLLNHVGHNPVMLYGYG
                     AAAVLIFGGSVLSWAFTRYSVSAHSVYRHSGIFFKKQRQIRLESVQSVDISRPLVARI
                     LGLSELRLEAADGAEEALHIKYLSHAKAQDLQERLLQRVSTLRAANTPESAGSVSVPP
                     EKDHEVTLAGEQQAEEGHKPERLLFKVPNLRVLAAIVLSALLWALPVAIIWVGGTIVG
                     WLVNPQKDLGQISQFIFPSLIPILGFLWQLWSSFDQGANFTVERIRQNTSDARGDSLR
                     ITYGFTGTHTQTLFPQRIQALKIEQPLLWKPFGWYRVVVNIAGVAVNTEGSSDDLFTR
                     NTALPVGTAREMQRLLHLLLPSASPHSLETVQAVMESSRYNPADSSELGVVKAPHRTR
                     WLNPLTFRRDGFARVNTERVEAEADLHHSGHAPTRDLLLLRGGCLLRFLSVVPERQVL
                     AVQWSQGPLNRILKTACISLGSVPGPVKPAVQNLEVHDAERIAAEIIARTDGTRPYYT
                     SPSA"
     gene            complement(769575..770150)
                     /locus_tag="HMPREF0733_RS03370"
                     /old_locus_tag="HMPREF0733_10710"
     CDS             complement(769575..770150)
                     /locus_tag="HMPREF0733_RS03370"
                     /old_locus_tag="HMPREF0733_10710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397976.1"
                     /db_xref="GI:503163315"
                     /translation="MSQLSHAEDASFLHEGESSVTATEGEWVRAHPSYTKIRLIQVVG
                     FFATLVGVFAALTVMFEMMRSSGVLPKTTWLPVLTGAIAAVLVVWGIWWMALLPRRTR
                     ALGYSLRPNHLMARQGVLFRHVTSIPYGRIQYVDVDSGPLERAHHLVRLTIRTAGVTA
                     SKVTLYGIPAERGQQLRELLIRRADERMAAL"
     gene            complement(770160..770693)
                     /locus_tag="HMPREF0733_RS03375"
                     /old_locus_tag="HMPREF0733_10711"
     CDS             complement(770160..770693)
                     /locus_tag="HMPREF0733_RS03375"
                     /old_locus_tag="HMPREF0733_10711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397977.1"
                     /db_xref="GI:503163316"
                     /translation="MKPIRISVIACAVALGLVAATILNNLVVNAGGGELAMSPVVALI
                     CVVIAGITLWFAFQVARFRNVETRRKAKSMNSLMAARTLACAQGAILTGALLAGWMLG
                     LIVYDVALASARGIPGFFWSTVVNLIGAVLLLAGGLWAQHLCRIPPDDPDGNSSSGGS
                     NSGKLAADGYSRTSDRR"
     gene            complement(770690..771292)
                     /locus_tag="HMPREF0733_RS03380"
                     /old_locus_tag="HMPREF0733_10712"
     CDS             complement(770690..771292)
                     /locus_tag="HMPREF0733_RS03380"
                     /old_locus_tag="HMPREF0733_10712"
                     /EC_number="2.7.6.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="WP_013397978.1"
                     /db_xref="GI:503163317"
                     /translation="MDALAHTAVLALGSNLGESETTLEQAAADLVHLSGGAVRLVRAS
                     GLYVTEPVGGPADQPDYINAVLEVRTSLDPYALLALCQQVEAHHHRVRLVRWGPRTLD
                     IDVITYDDLVSDDPVLTLPHPRAHERAFVLVPWKQANPQAVIPSRDAATGEQTRHLVA
                     DLARRVRAADERAGVNAVRFMRDMNLPKNLFDSGAESEGV"
     gene            complement(771330..771764)
                     /locus_tag="HMPREF0733_RS03385"
                     /old_locus_tag="HMPREF0733_10713"
     CDS             complement(771330..771764)
                     /locus_tag="HMPREF0733_RS03385"
                     /old_locus_tag="HMPREF0733_10713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="WP_037231372.1"
                     /db_xref="GI:739370356"
                     /translation="MPNPAHAYASCDRITLTGVAAVGFHGALDFEKREGQPFVVDTVL
                     YTDFTQAAATDDLAQTTNYAEVAEIIRTHIVGESLDLIETLAVRIAQNILDECAYVHA
                     LEVTVNKPKAPIEVTFGNVAVTVFREREGTQIQGGKGACARG"
     gene            complement(771802..772752)
                     /locus_tag="HMPREF0733_RS03390"
                     /old_locus_tag="HMPREF0733_10714"
     CDS             complement(771802..772752)
                     /locus_tag="HMPREF0733_RS03390"
                     /old_locus_tag="HMPREF0733_10714"
                     /EC_number="2.5.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="WP_013397980.1"
                     /db_xref="GI:503163319"
                     /translation="MHAMMSPQPPTHLPCDAAAAERTLVMGILNVTPDSFSDGGEHYT
                     ANDALAHAQRMIAQGADIIDVGGESTRPGAVRISVDEELRRILPVIEGLAETGITISV
                     DTMNAATARAAVAAGAHIINDVSGMSVSDEMIQTVAELGVPYILMHARGTSTTMDALA
                     AYPSGTVAEVLDELAALRDRLVAAGVHAENIILDPGLGFAKGGMQDWELLAALGQLHT
                     LGHRVLIAGSRKRFLANALKAADAARTKTQNPAASANAVPDQMPPARAPEDRDAASAA
                     LSALVAAQGVWGVRVHNVPPTVDAVTVANTLRTITRTKQT"
     gene            773012..773215
                     /locus_tag="HMPREF0733_RS03395"
                     /old_locus_tag="HMPREF0733_10715"
     CDS             773012..773215
                     /locus_tag="HMPREF0733_RS03395"
                     /old_locus_tag="HMPREF0733_10715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397981.1"
                     /db_xref="GI:503163320"
                     /translation="MNLKVGAWILGFIALAAFITVVLANGLTAVRWVAFGVATCAGFL
                     SLGMVVTLALGWDDPTGTKTESH"
     gene            773254..773850
                     /locus_tag="HMPREF0733_RS03400"
                     /old_locus_tag="HMPREF0733_10716"
     CDS             773254..773850
                     /locus_tag="HMPREF0733_RS03400"
                     /old_locus_tag="HMPREF0733_10716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone acetyltransferase"
                     /protein_id="WP_013397982.1"
                     /db_xref="GI:503163321"
                     /translation="MPDALTIRPATPNDAQSIARIRVQGWRFAYQGLISQDYLDSLSV
                     AEDTERMRGYLSQFPRNSPPSRSASVQGSGDGEKRSFMLAARGDAVLGFCGFSAVPDK
                     AYRPERAVPAGTMVGRLHSLYIDPDSLGQSIGHTLMNHALSTFAAWGCEHATLWVLEG
                     NSRAISFYERQGWRCTGATKVDQSFGPCLVEHEMTVQL"
     gene            complement(773933..774520)
                     /locus_tag="HMPREF0733_RS03405"
                     /old_locus_tag="HMPREF0733_10717"
     CDS             complement(773933..774520)
                     /locus_tag="HMPREF0733_RS03405"
                     /old_locus_tag="HMPREF0733_10717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase"
                     /protein_id="WP_041321610.1"
                     /db_xref="GI:752672901"
                     /translation="MSEDNGSGVDKPRIEAAVREILLAIGEDPDRDGLQNTPARVARA
                     YEEFFSGLHADPADVLGTTFDIAHSEMVLVKDIPFYSTCEHHLVPFHGVAHVGYIPGA
                     DGKVTGLSKLARVLEVYARRPQVQERLTTQVVEALEEHLNPRGAIVVIEAEHMCMSMR
                     GVRKPGAKTVTSAVRGQLKNAATRAEAMSLIFSKH"
     gene            complement(774507..776804)
                     /locus_tag="HMPREF0733_RS03410"
                     /old_locus_tag="HMPREF0733_10718"
     CDS             complement(774507..776804)
                     /locus_tag="HMPREF0733_RS03410"
                     /old_locus_tag="HMPREF0733_10718"
                     /EC_number="3.4.24.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_013397984.1"
                     /db_xref="GI:503163323"
                     /translation="MAQKSNNSPNGPDNFLGRLINGRWLWAIVIAIVVVAFSLSSLFA
                     QGARQVDTNVGLQLLNDHQVKSAKIYDGDQRVELQLKEDYKQGSNNYGSSVKFYYVQP
                     RAEEVVRAMNGAQLESYTDQPVENSFLGSLISLLLPVLLFGAIFWLLMGRMGGNSSVM
                     SFAKSRAKKFNKDNPTVRFSDVAGVDEALAELEEVREFLAEPEKFTRLGAKIPKGVLL
                     YGPPGTGKTLLAKAVAGEAGAPFYSISGSDFVEMFVGVGASRVRDLFKEAKSNPAAIV
                     FVDEIDAVGRRRGVGMGGGNDEREQTLNQLLVEMDGFDGNSNVIVIAATNRPDVLDPA
                     LLRPGRFDRQIGVDAPDMKGRQRILEVHAAGKPIDRRVDLGQVAKRTPGFTGADLANV
                     MNEAALLTARDNGNVIDDRAIDEAIDRVMAGPQRASRIMSEHERKVTAYHEGGHALVA
                     AALRNSAPVTKITILPRGRALGYTMVMPQDDKYSTTRHELLDQMAYAMGGRAAEEIVF
                     HDPSTGAANDIQKASDTARKMVADYGMSALLGSVKLGSDDTEPFMGGDPSAARNYSDK
                     TAYKIDIEVRKLLEEAHDEAFQILVENRDVLDRLAFALLEKETLLENEIAEIFKDVRK
                     RPEREHWYSKEGRERTDIPPVKAPSELAAEKNGLEGDSDPTVAMKAPTTASMPTAPEH
                     TAPGQNLPGQGGQPQQMPHPGTQDIEDTDPTVAMPPQQYPEQRQFPGQYPEQQYPGQQ
                     NEQQQNPYPYNNPNQNPYGGSDERG"
     gene            complement(<777007..777192)
                     /locus_tag="HMPREF0733_RS03415"
                     /old_locus_tag="HMPREF0733_10719"
                     /pseudo
     CDS             complement(<777007..777192)
                     /locus_tag="HMPREF0733_RS03415"
                     /old_locus_tag="HMPREF0733_10719"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397985.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein"
     gene            complement(777370..777921)
                     /locus_tag="HMPREF0733_RS03420"
                     /old_locus_tag="HMPREF0733_10720"
     CDS             complement(777370..777921)
                     /locus_tag="HMPREF0733_RS03420"
                     /old_locus_tag="HMPREF0733_10720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005504342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_004005768.1"
                     /db_xref="GI:490103930"
                     /translation="MQAQDVQDDLKNVLFTKEEINAKVAELAARIDEDYEGKDVLLVG
                     VLKGAIMVMADLSRALKGHYTMDWMAVSSYGSGTKSSGVVRILKDLDTDLTGRNVLIV
                     EDIIDSGLTLAWLQQNLKSRGAESVEICTLLRKPKVVKTDVQVKYVGWDIEPEFVVGY
                     GLDFAEKYRNLDCVATLHPHVYS"
     gene            complement(778099..778335)
                     /locus_tag="HMPREF0733_RS03425"
                     /old_locus_tag="HMPREF0733_10721"
     CDS             complement(778099..778335)
                     /locus_tag="HMPREF0733_RS03425"
                     /old_locus_tag="HMPREF0733_10721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397986.1"
                     /db_xref="GI:503163325"
                     /translation="MGLFGSDKNPRAELSVLFAKEDEPMEAAIDWARSVADKAGLDPA
                     KDEVQLIRELRRTELNLDLKTATYLAEQTAKAAW"
     gene            complement(778477..779673)
                     /locus_tag="HMPREF0733_RS03430"
                     /old_locus_tag="HMPREF0733_10722"
     CDS             complement(778477..779673)
                     /locus_tag="HMPREF0733_RS03430"
                     /old_locus_tag="HMPREF0733_10722"
                     /EC_number="6.3.4.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthetase"
                     /protein_id="WP_013397987.1"
                     /db_xref="GI:503163326"
                     /translation="MQHGRQGRLHPAVGTARRELARALTNLLGEGTIKGTGRARRESV
                     VSQQGAETEKPLVLVACSGGPDSLALACIAAHFARRSDVRVGAVVVDHGLQADSAEVA
                     ASTAETLTNLGLYPVRTECVQVPQGSMGPEMAARTARYSAFECAVHNTGARAVLLGHT
                     LDDQAETVLLGLGRGSGTRSLAGMPPARIENGVTYLRPFLALRRADMLNICEAEGATP
                     WNDPTNTDQTLMRARIRHTILPFLQEHLGGDVALSLARTAAVAGPDAEYLDALATAEY
                     TRLKLPAGVHLPDIPEADAVPGDHSTEVALEKPTPTVIALNRAETAALHPALRMRVLA
                     LATRAAQGENPGFERLQALDEFVAEYATAGPVQLPGHVSAYRRRRVQDPRTGTRVDAL
                     VLISQR"
     gene            complement(780037..781164)
                     /locus_tag="HMPREF0733_RS03435"
                     /old_locus_tag="HMPREF0733_10723"
     CDS             complement(780037..781164)
                     /locus_tag="HMPREF0733_RS03435"
                     /old_locus_tag="HMPREF0733_10723"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013397988.1"
                     /db_xref="GI:503163327"
                     /translation="MSENNTQNLLNVERIAKIVGSLAPAGPRMKPQEMAGVVASLRKA
                     AEESVDHVHRITGLDAAQDLRDSEVLVVDRSTWAKANAQAFSIMLVPFVKPAFEKIQQ
                     KKPHADLDKLKEGLAFEVGAVLSFLSTKVLGQYEPYAALAGYGQPGGRLMLLAPNVVS
                     VERELNVEPEDFRLWVCLHEQTHRVQFAAAPWLRDYFLAKITELGDSAASTFDLKDAF
                     RAAAQARAEEPGEGRAHPVKEATANARKIASELTAIMSLLEGHANVVMDAVDAQIVPT
                     VKTIRRRFNRRSSTQKFLTKLIYRLLGMNKKMAQYRDGQKFVQHVVDAVGMERFNVVW
                     ARPENLPTEREIHNPDAWIKRVLDEDAKVAVAGGRDEENTA"
     gene            complement(781326..781958)
                     /locus_tag="HMPREF0733_RS03440"
                     /old_locus_tag="HMPREF0733_10724"
     CDS             complement(781326..781958)
                     /locus_tag="HMPREF0733_RS03440"
                     /old_locus_tag="HMPREF0733_10724"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049775424.1"
                     /db_xref="GI:908631391"
                     /translation="MKSSQYTPDHPEYVTLSAALMGSFIWRLLEVFCVFLLILGAGAV
                     VSALGLSALSLSLYQATKTVLISYLIFPLVLALAQRPLVVRAQHPSPGGKLFAAYEIL
                     VPPPVYLVVALAVTQDIGRAVVVGVCALVFYLAYAAWFKPWKPRFTRTEVRSKIEQTK
                     QMTREMFGEAAQERAETMQKNAEVDDPAVKDLFLPDNRYRMPLDHNERRS"
     gene            complement(782000..783142)
                     /locus_tag="HMPREF0733_RS03445"
                     /old_locus_tag="HMPREF0733_10725"
     CDS             complement(782000..783142)
                     /locus_tag="HMPREF0733_RS03445"
                     /old_locus_tag="HMPREF0733_10725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321612.1"
                     /db_xref="GI:752672903"
                     /translation="MKGLVCDCRNAIRLTATAGVSVICAGADVAARATAPNVMRKVLD
                     IKNVSNTSHGTTGKTKPVVALRTRVSALTDTITEYSKAMGRSRKTKRLWNSASGLGNA
                     IRQRTLSMRSVKAPQIPGKQYSPLKELPQPVFQRLSSQLYMASLVWGSVSMLCGGRTK
                     ERQYTPDHPEYVALTSALKGGYFSGFLEAVCVFLVILCARVVGPASKLSALSLPRLQI
                     AGIVWNSYLIFPLVLVLVQRPLVVRAQHPSPGGLLFAAYDIFVPPLVYLVVTLGMFQE
                     VGKAATVGSCALVFYLAYAAWLKPWKPGLTRTQVRHKIQETKRMTRELVSDIAQEYAG
                     MMQERAEIMQKYADVDNPAIKNLFLPGNRYRMPLDYEKRGALPYTR"
     gene            complement(783529..784014)
                     /locus_tag="HMPREF0733_RS03450"
                     /old_locus_tag="HMPREF0733_10726"
     CDS             complement(783529..784014)
                     /locus_tag="HMPREF0733_RS03450"
                     /old_locus_tag="HMPREF0733_10726"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic pyrophosphatase"
                     /protein_id="WP_004005776.1"
                     /db_xref="GI:490103938"
                     /translation="MELDVTIEIPRGSRVKYEIDHETGRLYLDRVLFTSMQYPTAYGY
                     FENTLGEDGDPLDAMLVLDVDIVPGVIVEARPVAVFNMTDEAGGDAKVLCVPTDKRYD
                     HIKSLADVPEQLKAEIQHFFERYKDLEPGKWVKGEGWDDIAAAEKMVQEAIDRFAAEG
                     H"
     gene            784200..785882
                     /locus_tag="HMPREF0733_RS03455"
                     /old_locus_tag="HMPREF0733_10727"
     CDS             784200..785882
                     /locus_tag="HMPREF0733_RS03455"
                     /old_locus_tag="HMPREF0733_10727"
                     /EC_number="3.4.16.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="WP_013397991.1"
                     /db_xref="GI:503163330"
                     /translation="MRVTGSVFRGGIRYALKMRSPQPINTPFTRRALLGAAPALFLAA
                     CSNPSGGQSQSGTASVTPSVTPTPSPTPVLNTQQLQDLKIQLDKLFQERPYPAHSMLV
                     TALDGTRELYADAPDTPRLPASNMKILTYFALVQTAPERTFTTSVVQGKNGLFLVAGG
                     DTLLVEGATEPATADSPTMRAGLSTLAADTVQQMNERKVAHGTFPVYLDTTIYTGSAT
                     NPGWEPGDLESGQITPINPIALASHTVPGQSTPDKPARPQDAGIAALEAFVKVLNKAS
                     EEHAEVKAGYVFTVADRRPREADAEQIAQVQSASALDQAFVMMLESDNVLAEVLGRNM
                     AIAAGREGSASEAQKLVREKLQEAKISVTGLVQADVSGMSLQNRVTARTLAQTLGALA
                     AHPKHDELERRFPVAGVSGTLKDRFSGEANKYARGHVAAKTGTLFTAISLSGYATRPD
                     GTRLIFVSLLNDVGGAEALPGAKDTVDSAAAIVAVRTEPPANPTGTPAPSGSQVPGSS
                     SAPDATDSGSAPNSSQAPDGSSSASPAGGSAPQEDAPSQAVGQNPAEVPSSQ"
     gene            786016..788739
                     /locus_tag="HMPREF0733_RS03460"
                     /old_locus_tag="HMPREF0733_10728"
     CDS             786016..788739
                     /locus_tag="HMPREF0733_RS03460"
                     /old_locus_tag="HMPREF0733_10728"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_013397992.1"
                     /db_xref="GI:503163331"
                     /translation="MSSPSAASAPGDLPRVAVAELLRVHRCETALYADFSRHTAGTRE
                     DEYDTTANELSHVVHSDSGAPQLIPEVVALLEAAQASCGTGNSAAAEVEVRTAQGMER
                     YPLARLIPVLETLTERYEFLRASWREGVALADIPGLLSCGDCPACAARAEAEVGASET
                     LDEPELVPHSSDDSDEESWEDSSDSPAESTFEGIPAKAQHPYRVRPAAPADDDEEYAQ
                     LERLRERLAELEKQNQKNRGLSSENTRLAMLLSGVDFYRREKAPFWRDHLRRLHEPYE
                     NWANTRNCVIFESVETATDWERVRGAKMRTLRAVATLADSHTLKADDTGHYLLYSADD
                     APAKAYESIDSQVEAFRATNPQARVPDTLHRLGFFGAKIMSLEPYEEPGEPAEDATLA
                     TGGGQRVVMVVAERIRVNDEEHAAFPLGLTPGAPVTTKQLEASLVRVAVEAEDSIPNV
                     AATGTLDLIERRPPRLKTRESLPQETEFSHAELPTVEAVLAAVRDLDRSYVAVQGPPG
                     SGKTFLGSQVIARLVAAGAKVGVVAQSHAVVENMLTACLERNLFPADRVMRAKGKSQL
                     PDYPWVEVSDKDLTALLDKSSGLSSEKSGTGTSPGVLFGGTAWDFANPNRIPEGSLDL
                     LVIDEAGQFSLANTLAVGRAARNLLLLGDPQQLPQVAVGEHPYPLDTSALGWLSGGQS
                     VLPAAFGYFLQVTWRMHPQLCAPVSTLSYGGKLHSAAAASERILKVPEREESVLPADP
                     GLYMYGVHHEHCTVRSEVEAAAVARLACEFVGASWTPGANQPARELTGEDIVVVAAYN
                     AQVDTIAEHLRRAGLLDADGHGVRVGTVDKFQGQQAPVTIVSMASSNAGVSGRGAEFL
                     LSPNRLNVALSRGQWCSVLVASDSLHRFVPQSIPELLALGGYLGLVRSAAP"
     gene            788849..789535
                     /locus_tag="HMPREF0733_RS03465"
                     /old_locus_tag="HMPREF0733_10729"
     CDS             788849..789535
                     /locus_tag="HMPREF0733_RS03465"
                     /old_locus_tag="HMPREF0733_10729"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecJ"
                     /protein_id="WP_049775425.1"
                     /db_xref="GI:908631392"
                     /translation="MLAHGNPCRETLSKPEVLRHNGGVFVLTFIQRSPQVSLPALLDK
                     LSKLNPRVEFAQTYPDEIQGAFESSADALQAALYASREQGFWVGIGVGELRIPRFAGA
                     LGTVSTNDCTGDALEFSRLAVEAARTGAPARGIAVSAHDRAVADMASGLTRLLYRVCS
                     DRTEAEWRVVDLLVPGVRGQQRAVAQALGITTQAVSRTLMRSLWHEEQAARPAVLDLL
                     NRLDSASPTK"
     gene            complement(789608..789832)
                     /locus_tag="HMPREF0733_RS03470"
                     /old_locus_tag="HMPREF0733_10730"
     CDS             complement(789608..789832)
                     /locus_tag="HMPREF0733_RS03470"
                     /old_locus_tag="HMPREF0733_10730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="WP_013397994.1"
                     /db_xref="GI:503163333"
                     /translation="MSTHTAEGLYNSVMRNGKPARLRSDYKKVVDTEVGELRRSISQQ
                     VKERQQSKFQDSPQPWWTVVVNPIRNIFNR"
     gene            complement(789864..790349)
                     /locus_tag="HMPREF0733_RS03475"
                     /old_locus_tag="HMPREF0733_10731"
     CDS             complement(789864..790349)
                     /locus_tag="HMPREF0733_RS03475"
                     /old_locus_tag="HMPREF0733_10731"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397995.1"
                     /db_xref="GI:503163334"
                     /translation="MITFAWWILAVIFGFISPFEACQSIFKWVTAPDWEGWGNILRNT
                     AGWAALIAAIATVTVALKTNTTRAKEAASADFRDQMQWAADHLGEDVTPYQFVYALML
                     VERYAKLPPTLLSDEDKELAVRLQALIEESTDISEDTEQNEVSDENDEATSNSEPNTV
                     N"
     gene            complement(790547..790945)
                     /locus_tag="HMPREF0733_RS03480"
                     /old_locus_tag="HMPREF0733_10732"
     CDS             complement(790547..790945)
                     /locus_tag="HMPREF0733_RS03480"
                     /old_locus_tag="HMPREF0733_10732"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013397996.1"
                     /db_xref="GI:503163335"
                     /translation="MSVLLYDPDCGFCTASANLLRRLGPGARILPGTPENLVQYRVDA
                     RRFAHALPFINDSGQIIYGSDAIALTLRTFSDATLRGKFLRAAGVLLLNPPMRPVAHR
                     AYRLVAGHRAEISRLTSRLGCTSSCAVKPT"
     gene            791093..791809
                     /locus_tag="HMPREF0733_RS03485"
                     /old_locus_tag="HMPREF0733_10733"
     CDS             791093..791809
                     /locus_tag="HMPREF0733_RS03485"
                     /old_locus_tag="HMPREF0733_10733"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013397997.1"
                     /db_xref="GI:503163336"
                     /translation="MPLSELSVSTQNYLKAIWSLEEWTEAPATASALAERMGLRVSSV
                     SDGLKRLAAADLIDHQRYGAIELTPLGRTYAVAMIRRHRLIETFLVETLGYTWDRVHD
                     EAEVLEHAVSDFMIERIDAILDHPTRDPHGDPIPDASGRISFPQTVPLTQCEPGERVI
                     LERINDSDPKLLRYLQDHGFVPGARLLLEEGAPFSEAVNVRVLAHANNSDAPAAQNPN
                     SSAIPLGTAAAAGLFVSRSS"
     gene            complement(791930..792799)
                     /locus_tag="HMPREF0733_RS03490"
                     /old_locus_tag="HMPREF0733_10734"
     CDS             complement(791930..792799)
                     /locus_tag="HMPREF0733_RS03490"
                     /old_locus_tag="HMPREF0733_10734"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013397998.1"
                     /db_xref="GI:503163337"
                     /translation="MSILDYLVEPFTLPFMTRAMVVTVIAAVVCALLSCWLVMLGWSL
                     MGDAISHAVLPGVVLAYIAGIPFAVGAVIAALVAVTLIGAVQRSGRVREDAAIGIVFT
                     TLFALGLVLVSVTPSSTDLNHILFGNVLGVSWPDVWQVAILAVIVAGVLLIKRRDFIL
                     YAFDRGFAHAIGLRPRVLGALLLVMLALTSVVALQIVGVVLVVAMLVIPGSTARLLTD
                     RFTPMLAVSVGVSTLGTLVGLYSSYHLDISPGGAVVVTQGIIFLAVYIFAPRYGILGR
                     IRAARRPAEPVEA"
     gene            complement(792801..793577)
                     /locus_tag="HMPREF0733_RS03495"
                     /old_locus_tag="HMPREF0733_10735"
     CDS             complement(792801..793577)
                     /locus_tag="HMPREF0733_RS03495"
                     /old_locus_tag="HMPREF0733_10735"
                     /EC_number="3.6.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013397999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_013397999.1"
                     /db_xref="GI:503163338"
                     /translation="METLLRVENLGVHYGTVRALYETTFELGTGSICGLIGMNGSGKS
                     TLFKAIMGVIPAHTGTVEIAGKEPYLARKNGIVSYVPQSEEIDWSFPVSVREVVAMGR
                     YRGLGITRRLRATDKQAVEHALERVELTELAHRQIGALSGGQRKRAFVARAIAQGARL
                     LLLDEPFAGVDKRSESMLIQVLKQMRSEGSTVLVSTHDLASLRAFADDALLLRQTILM
                     HDTPQAVLAPENLVQAFGMQVQAGADSGASDEQTRREKGE"
     gene            complement(793709..794605)
                     /locus_tag="HMPREF0733_RS03500"
                     /old_locus_tag="HMPREF0733_10736"
     CDS             complement(793709..794605)
                     /locus_tag="HMPREF0733_RS03500"
                     /old_locus_tag="HMPREF0733_10736"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-binding protein"
                     /protein_id="WP_041321883.1"
                     /db_xref="GI:752673174"
                     /translation="MLGIALASILVLLLSACTSAGKQDEKKTVLTTFTVLADIAKNVA
                     GDHLNVESLTKPGTEIHEYEPTPSDIKKAHDADLVLDNGLNLESWFTKFVQDSNAPHA
                     TVSEGVQPINIAEDAYAGKPNPHSWMSPKNVQIYVDNMVREFSKLDPAHADDYRTNGE
                     NYKKQLQQVQDELVRDVSVLPENQRALVTCEGAFSYLAADASLKEKYIWAVNSEQQAT
                     PSQLSSTIDFVRENQVPAVFCESTVSDDPMRQVVDATGAKFGGVLYVDSLSEANGPVP
                     TYLDMIRHDARTIVAGLTGKQS"
     gene            complement(795016..795222)
                     /locus_tag="HMPREF0733_RS03505"
                     /old_locus_tag="HMPREF0733_10737"
     CDS             complement(795016..795222)
                     /locus_tag="HMPREF0733_RS03505"
                     /old_locus_tag="HMPREF0733_10737"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004005790.1"
                     /db_xref="GI:490103952"
                     /translation="MTTVFYRGERRDVKSFTPEEHQDYLDKKQHTINEAKEAIAGMKA
                     RIAELERIQAMNPIRRWFYQKFHI"
     gene            complement(795222..795641)
                     /locus_tag="HMPREF0733_RS03510"
                     /old_locus_tag="HMPREF0733_10738"
     CDS             complement(795222..795641)
                     /locus_tag="HMPREF0733_RS03510"
                     /old_locus_tag="HMPREF0733_10738"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013398001.1"
                     /db_xref="GI:503163340"
                     /translation="MISPETWGVLGDVARNTSGLLAVCAAYFTIRVAYRTNQARAREA
                     VRTHFRDRIQWAVEHVDSDKELERTLAQQVILKYYSDSELEIDDLKIATVVAEEFLRL
                     EQGNEEPSRAETPAHLENRVTHLDNENTLDVQEEGEE"
     gene            complement(795779..796654)
                     /locus_tag="HMPREF0733_RS03515"
                     /old_locus_tag="HMPREF0733_10739"
     CDS             complement(795779..796654)
                     /locus_tag="HMPREF0733_RS03515"
                     /old_locus_tag="HMPREF0733_10739"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013398002.1"
                     /db_xref="GI:503163341"
                     /translation="MSRNLTPEPVATGIVETRIGQLRWREYGGPREAAGGKTLLFVHG
                     LLTNSDVWGEVVQNLSQDFRCITLDIPLGSHTIPAREDAALTVAALAQAVNEAAEQLC
                     PHGFTLIGSDTGGVVSQLAAVQEPAGLKRLVLLSCDTEKNFLPLPLRYLQYVAYIPGT
                     MQALRAALHLEWVRRLPIAFGWLVKRELDAAEWSSIIAPLKDAGVRRDLAKVLKGIST
                     KYTVQSARDLERFEHPTLFLWADTTRLFPIKNARRLASRMPDARVVPVPESYAFSQLD
                     QPKFVANALREELAG"
     gene            complement(796684..797487)
                     /locus_tag="HMPREF0733_RS03520"
     CDS             complement(796684..797487)
                     /locus_tag="HMPREF0733_RS03520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease"
                     /protein_id="WP_037236646.1"
                     /db_xref="GI:739375709"
                     /translation="MKIATWNVNSIRARADRIEDWLDKTEVDVLALQETKTKDETFPF
                     ELFEFLGYEVAHYGLNQWNGVAIASRVGLDSVERTFPNQPAFGKPGDPAEIEARAIGA
                     TCNGVRIWSLYVPNGRGLTDPHMAYKMEWMRQLRTNVNGWLHADPAAQFALVGDWNVA
                     PEDTDVWDIDFFRENDLTHVSAPEREAFYALLNDEGLVDPVRPYTQGEYTYWDYQAGR
                     FSKNEGMRIDFQLCSPALAARVENAWIDREEREGDGASDHTPVVIELAD"
     gene            complement(797775..798761)
                     /locus_tag="HMPREF0733_RS03525"
                     /old_locus_tag="HMPREF0733_10741"
     CDS             complement(797775..798761)
                     /locus_tag="HMPREF0733_RS03525"
                     /old_locus_tag="HMPREF0733_10741"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013398004.1"
                     /db_xref="GI:503163343"
                     /translation="MLSKLTKKRPDALIVMLICAVIFAILIPARGTFADWFSTGTKFA
                     VALLFYLYGARLSTSEAIAGLKHWRLHALILTCTFVIFPLFGLALFPLRFVLGDGLYL
                     GILFLTLVPSTVQASIAFTSIAGGNVAGAIVSASLSSIVGVVATPLLAMLLMHSDHIE
                     ISGSVFLDIAIQLFLPFVLGQLTRRWVGEFAKKPTTKWLDKFSVMMIVYSAFSASVVQ
                     GIWTRVAWWQIVLLIVVTILMVALMLWLTDWLAARLKFNRADRITIQFCGSKKSLAAG
                     LPMAIIIFGSGSLGLLMLPLMVFHQVQLMMCTWLSARYAALDVVGKASVEQP"
     gene            complement(798860..800467)
                     /locus_tag="HMPREF0733_RS03530"
                     /old_locus_tag="HMPREF0733_10742"
     CDS             complement(798860..800467)
                     /locus_tag="HMPREF0733_RS03530"
                     /old_locus_tag="HMPREF0733_10742"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M48"
                     /protein_id="WP_013398005.1"
                     /db_xref="GI:503163344"
                     /translation="MSQHTPGAEPPLPNDVSQGWLPEDKRQTPQSPLPQPKFWGYQSL
                     IPHKMLNALRHPGEIPWLVAAYAVTLAVYLGLLIFFIETIVSRDRYNDLEWTSSSRYS
                     TMSYAERVFNDYAEQAITLLILAPLVILIARALFYAQQRVRGIRISPTQFPEAYAMVA
                     EAAYAAGLRRVPDAYVVSGNGVLNAFASGHGFRRFIAINSDLFEVGGQSRDPQALRFI
                     IGHEVGHIAAGHVGYFRLLFTQTFMRIPVVGQALSRAQEYTADNFGYRYCPEGGPGAI
                     KVLTAGKYLNQQVNFDEFADRAVNDQGFAIWLINLISTHPVLTWRAHALRNRHEPGRL
                     FWRPQFNPPSAPPSLIPSQEPPAQWPDPIQATGFMDEQKPAWEDYNLNTVKTYPAPQG
                     APKIQGTLFAGWEDAQARAARAAYAARWEQYAASQGVPGYVPGYGYPMQPAPGQPGYG
                     QPMPNQPPPWQSGSGQFEADQPAPDQANQGQPQPPQPEQQGHTEPPKDATEPGVALNQ
                     PIKPADDQHPEQKRSEQQDQQGNDTSD"
     repeat_region   801125..801491
     gene            complement(801126..801362)
                     /locus_tag="HMPREF0733_RS03535"
                     /old_locus_tag="HMPREF0733_10744"
     CDS             complement(801126..801362)
                     /locus_tag="HMPREF0733_RS03535"
                     /old_locus_tag="HMPREF0733_10744"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="WP_013398007.1"
                     /db_xref="GI:503163346"
                     /translation="MKTEKSKEIFWSIISILVGGVAWLTMQNISWGVVDPAKVGLVFA
                     VIGLISLIWALFNKNSDSSRAHETIRNANRSKED"
     gene            complement(802630..803763)
                     /locus_tag="HMPREF0733_RS03540"
                     /old_locus_tag="HMPREF0733_10746"
     CDS             complement(802630..803763)
                     /locus_tag="HMPREF0733_RS03540"
                     /old_locus_tag="HMPREF0733_10746"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetate kinase"
                     /protein_id="WP_041321884.1"
                     /db_xref="GI:752673175"
                     /translation="MLILVVNAGSSSLKYQVRDTSAPESEQMITSGLIENIGTDVPDH
                     EVALHMMAEKLEGVLHGRQLQAIGHRVVQGAEKFTHPVLLNEQVIDEIDALSPLAPLH
                     NPAHVKGMRAAFHTWPDLPQVAVFDTAFHSTMPEHAWRYAIPYDLADKYSIRRYGFHG
                     TSHEYVSHVAADMLGIARDEFNGVVAHLGNGASVTAVKGGKSVDTSMGYTPLAGLVMG
                     TRSGDIDPSALTTILTRDPEIDAERLDTILNKESGLLALAGSNDMRKVVESAQSGDER
                     AQLALDMTAYRLMKYIGGYNLVVGGAQALIFTAGIGENSGDFRKLVLDRLAPLGIRYN
                     EEENMKRSPEPRLISTEDSSIAVFVIPTNEEKAIAEATEELVA"
     gene            complement(803901..804992)
                     /locus_tag="HMPREF0733_RS03545"
                     /old_locus_tag="HMPREF0733_10747"
     CDS             complement(803901..804992)
                     /locus_tag="HMPREF0733_RS03545"
                     /old_locus_tag="HMPREF0733_10747"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_013398010.1"
                     /db_xref="GI:503163349"
                     /translation="MSLFRNLVGASAAAATLTAVARRVRKHAQRIVTPLGIWSTLPVA
                     QERHIGIVYNPSKSSTHAVVNILERTVVANGWKPALASTTRIDEPGTQAARDLIDRGV
                     DTLLAVGGDGTVRAVAAAIQEARSRGKDVTLGIIPLGTGNLLARNLRLPITDIAACIN
                     IALNGTRQMVDAIDMSAESAEGDVTNHMFYVMSGAGFDALVMNDANEDLKARIGWLAY
                     VHSGLNHIFGHSHKVRIQLDDDEPFEARARSVLIANCGRLQGGLQLTDITEVNDGNLE
                     VIIISPRTVLEWGQLAAKVVRRALPGSSRISLPVMRHYVGHRVSLDMLSGAQPIEVDG
                     DLVPSAIRLQARIVPSALSVNVHPDALTT"
     gene            complement(805469..806251)
                     /locus_tag="HMPREF0733_RS03550"
                     /old_locus_tag="HMPREF0733_10750"
     CDS             complement(805469..806251)
                     /locus_tag="HMPREF0733_RS03550"
                     /old_locus_tag="HMPREF0733_10750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013398013.1"
                     /db_xref="GI:503163352"
                     /translation="MPNNTSAQAASLPQVRPVWINSTVVLLELRRKFRNLRIFLLAIL
                     LPVMFFFMIAYPQRDSLEGSVNTGTYYMIGISAYAAIVSSSAVGAAIPIERVQGWSRA
                     LALTPFRPLGYVITKVLSSMLLGAIAVVVMMVLGLVTGMPLDAWQAAQSSLIIIAGSS
                     AFAAFGIFVGYFMSADSAQTLINLIISVFSVFGGLFLPLSHFPQALQDIVHWLPSYGL
                     GVLARLPVGVEWDPWALVNLVAWLVIFVAGAAWCLSKDTHRV"
     gene            complement(806241..807182)
                     /locus_tag="HMPREF0733_RS03555"
                     /old_locus_tag="HMPREF0733_10751"
     CDS             complement(806241..807182)
                     /locus_tag="HMPREF0733_RS03555"
                     /old_locus_tag="HMPREF0733_10751"
                     /EC_number="3.6.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013398014.1"
                     /db_xref="GI:503163353"
                     /translation="MMYSSPPVVMRDVVQKFGSTTVLHGLDLTVNPGEIVALLGPNGA
                     GKSTAVDIILGLTKPYAGSVEVFGTTPQHAVKAGHVAAVQQDGGLLPDLTVKETVQYM
                     ASLYGKLKNVSAVLAQAGLEGNAKTLVQKCSGGQKQRLRFAIALLTDPDFLILDEPTA
                     GMDVQGRRDFWASVTQSGDHQRAVLFATHYLAEVDEFADRVVVINQGHVVADGTPAEI
                     RSYARGSTLRATVNDAWTSEQIEERLAELRALDGVSAVSLHGIRLEISAADADAVASH
                     LLADGFAKNLEIASSSLDDAFVLLTETDSEGEHKNAK"
     gene            complement(808489..809793)
                     /locus_tag="HMPREF0733_RS03560"
                     /old_locus_tag="HMPREF0733_10754"
     CDS             complement(808489..809793)
                     /locus_tag="HMPREF0733_RS03560"
                     /old_locus_tag="HMPREF0733_10754"
                     /EC_number="6.1.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="seryl-tRNA synthetase"
                     /protein_id="WP_013398017.1"
                     /db_xref="GI:503163356"
                     /translation="MIDINLLRENPEIFRASQRARGKDEAHVDRILEADAARRASIGT
                     YENLRAEQNAFGKQVAKAPKEEKPALVAQAKELAAHVANAKAASEAKTAEYEELLSSI
                     ENLIIDGVPTGGEDDFVVLKEVGTPRDFAAEGFEPRDHLEIGELIGGIDMARGAKVSG
                     SRFYFLKGQVARLEQALMWMALDLATANGFTMMTTPTLVRPEIMNGTGFNVKHDDEIY
                     RLERDDLYLVGTSEVALAGYHMDEILDLSDGPKKYLGWSSCYRREAGAAGKDTRGIIR
                     VHQFNKAEMFVYCQVEQAEEIHEQMRALEEEMLQKCGLAYRVIDTAAGDLGTSAARKF
                     DCEAWVPTQGTYRELTSTSNCTTYQARRLNIRERTADTVDDVGNVRKGRTRAVATLNG
                     TLATTRWVVAILETHQQPDGSVRIPEALRPYMGGAEVIPVAS"
     gene            complement(809909..810874)
                     /locus_tag="HMPREF0733_RS03565"
                     /old_locus_tag="HMPREF0733_10755"
     CDS             complement(809909..810874)
                     /locus_tag="HMPREF0733_RS03565"
                     /old_locus_tag="HMPREF0733_10755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="WP_041321885.1"
                     /db_xref="GI:752673176"
                     /translation="MRYTYLGPSGTFTESALLSVPGVVGAERIPATSVPNALERLRSG
                     DVDAAMVPIENSVEGGVSATLDAIAASEGMRIIREVLVPIRFVLVAARPLALEDIKTV
                     STHSHAWAQVRQWVDETIPTAEYLPGSSTAAAAVGLLDPSCAYDAAICSPALLATHPD
                     LHVLAEDIGDNKNAVTRFVLISSTADIPEPTGADKTTLTIPLPENREGTPENRSGALL
                     ELLEQFASRGVNLSRIESRPTGRQMGSYMFSVDADGHIYEARMRDALRGLHRIAPGIK
                     YLGSYPRADRQPTVAPRIHSENSFDAAHAWVESLFPGGRPAHLKR"
     gene            811015..811944
                     /locus_tag="HMPREF0733_RS03570"
                     /old_locus_tag="HMPREF0733_10756"
     CDS             811015..811944
                     /locus_tag="HMPREF0733_RS03570"
                     /old_locus_tag="HMPREF0733_10756"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013398019.1"
                     /db_xref="GI:503163358"
                     /translation="MSPNFTLLDQLYTQERLLNSGYTRTTMRRKLRTKELISVLQGVY
                     IAASVWDSFTPSLQVLARHTALALRDSTCVFCLSSAAFLYGLPLLHVPQNLHVLAGYS
                     VRGAASDGVLEHTSNEASVQVTVLRPNFRVTELSQTLLDCARTLPVLEGCALVDAALH
                     RRMLAPEEILPRLQASQNSAATHIATHADARSSSLLESVARLQLVEMGLPAPVHRLDF
                     EAYLLRASDAHAPNRASDYVGVYRMLRTRQASFVWLEQRVGLAMVASDAVLPHADAPT
                     PEGWHMVQVRWEDFYPSSRVLREKLHPYFPQLR"
     gene            complement(812082..812945)
                     /locus_tag="HMPREF0733_RS03575"
                     /old_locus_tag="HMPREF0733_10757"
     CDS             complement(812082..812945)
                     /locus_tag="HMPREF0733_RS03575"
                     /old_locus_tag="HMPREF0733_10757"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine synthase"
                     /protein_id="WP_013398020.1"
                     /db_xref="GI:503163359"
                     /translation="MAKKKNRSAASRRAEHPNKTGAVAGVYPISTGEAELVPDGYHSD
                     GWLLLINGVQSSHVIVGQPRMLDFEYMRWIVAVLDSHIQTHLNPEKLRITHLGGGACS
                     LARYCADVYPNSRNTVVELDAKLAEHVRDWFDIPKSPRVKIRVGDAGTVTRSFAPASR
                     DVVIRDVFAVDKTPAELTGVDFVRTVDNSLGPGGLYILNCGDDRTLNAARAEAAALLE
                     VFEYVSIVADSAMLKGRRRGNIILAGSHVPLPQLGSAEAASISRVLMGGGVPAQYWDT
                     EKVRAFARKGA"
     gene            complement(813220..813540)
                     /locus_tag="HMPREF0733_RS03580"
                     /old_locus_tag="HMPREF0733_10758"
     CDS             complement(813220..813540)
                     /locus_tag="HMPREF0733_RS03580"
                     /old_locus_tag="HMPREF0733_10758"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013398021.1"
                     /db_xref="GI:503163360"
                     /translation="MLFAFSVAPTGGGSADGSVHDAVAEAVSIVRSSGLPHQTGPMFT
                     TIEGDWDECMDVIKRATEAVTKRAPRVSLVVKADIRPGHDHGEIEGKVQRLNAAIDQM
                     ESGK"
     gene            813937..816030
                     /locus_tag="HMPREF0733_RS03585"
                     /old_locus_tag="HMPREF0733_10759"
     CDS             813937..816030
                     /locus_tag="HMPREF0733_RS03585"
                     /old_locus_tag="HMPREF0733_10759"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate acetyltransferase"
                     /protein_id="WP_004005808.1"
                     /db_xref="GI:490103970"
                     /translation="MTTGIYLSAMTQDSGKSLIALGLADSLVKRADRVGFFRPIFKGE
                     TASDDPMIRLMKEHFNLSDEQVGGAVSLTEALEFIAEGNTEEISARAVSAYEEIAAHS
                     DVVIVDGIYLTAQNALAVEFDLNAQVSRDLGLPVIAIVGANEASLEEATNAVEVARSE
                     LKAAKVDLFSIIVNRADPELRESIEKNVKLGEHKFPVYVLPEIADLGKPTIAEVVSAL
                     KLDGSHLSQEDLGRDINEIKIAAMTVSNFLNQFADGDFVIVPGDRADVVAATLASALS
                     PTFPAPSGMLLTGGLNNLPGNNTAVGSLLESAPFPVLSTDRDTFKSARAVSRVHGSVI
                     NGQARKLASAFGGWDEYVNQEELLSRLELERPASMTPLRFLHNLIETARANRRSVVLP
                     EGYDVRILRAAEMIARRDFCDLILLGNPDKISEICQAEGINLPASIRIIDIANNEYSE
                     DFAATYAELRAHKGMTIEGARERMSDPSYFGTMLVYKGLADGMVSGAINTTANTIRPS
                     LEFIKTRPGTKIVSSVFLMLMEDRVLVYGDCAVNPNPNAEQLADIAKASAETARQFGV
                     DPKVAMLSYSTGTSGSGADVDVVREATEIVRASNPDFAVEGPIQYDAASNMSIASTKM
                     PDSQVAGQATVFIFPDLNTGNNTYKAVQQSSGAPAVGPVLQGLRKPVNDLSRGTTVED
                     IINTVAITAIQAQGM"
     gene            complement(816135..816488)
                     /locus_tag="HMPREF0733_RS03590"
                     /old_locus_tag="HMPREF0733_10760"
     CDS             complement(816135..816488)
                     /locus_tag="HMPREF0733_RS03590"
                     /old_locus_tag="HMPREF0733_10760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008054502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013398022.1"
                     /db_xref="GI:503163361"
                     /translation="MKVPDPYIIMALDAGRRVQRYTPESAEAFFESELIQDAICMRLQ
                     EMGENLSKIRQQFPDYYQAHHSESWHRLIGLRNVISHGYGDIDLNIVWRIASQHLSGV
                     MQELETLQASSLPDL"
     gene            complement(816485..816787)
                     /locus_tag="HMPREF0733_RS03595"
                     /old_locus_tag="HMPREF0733_10761"
     CDS             complement(816485..816787)
                     /locus_tag="HMPREF0733_RS03595"
                     /old_locus_tag="HMPREF0733_10761"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="WP_013398023.1"
                     /db_xref="GI:503163362"
                     /translation="MRAPHPQSVYTLPHEQTVLNTLRKYGVVKAHLFGSAARGELTPA
                     SDLDFLIEMKDSPDYGVLLRLSEELEQITGYPVDVLTSIKPVFRPYIEPDLTELPL"
     gene            816856..817179
                     /locus_tag="HMPREF0733_RS03600"
                     /old_locus_tag="HMPREF0733_10762"
     CDS             816856..817179
                     /locus_tag="HMPREF0733_RS03600"
                     /old_locus_tag="HMPREF0733_10762"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013398024.1"
                     /db_xref="GI:503163363"
                     /translation="MTNRDSSAQPHGYTPNKEAHLKRLRRIEGQVRGIARMVEEDKYC
                     IDVLTQVAAVSKALHAVSLNLLEEHMGHCVTNAAIESERTGDATIVDEKIKEATAAIS
                     RMMRS"
     gene            817237..817452
                     /locus_tag="HMPREF0733_RS03605"
                     /old_locus_tag="HMPREF0733_10763"
     CDS             817237..817452
                     /locus_tag="HMPREF0733_RS03605"
                     /old_locus_tag="HMPREF0733_10763"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal transporter"
                     /protein_id="WP_004005811.1"
                     /db_xref="GI:490103973"
                     /translation="MAITTVKATGLTCNHCAMSVSEEVGEVPGVTGVNVDVVKDGVST
                     VTIEHEGTLNTQAVADAIVEAGFTPAV"
     gene            817455..817892
                     /locus_tag="HMPREF0733_RS03610"
                     /old_locus_tag="HMPREF0733_10764"
     CDS             817455..817892
                     /locus_tag="HMPREF0733_RS03610"
                     /old_locus_tag="HMPREF0733_10764"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013398025.1"
                     /db_xref="GI:503163364"
                     /translation="MAYSPQYQAMAVGAVRALVGTENIHLTEAISRVARQMGLDSDLL
                     DAWVRDSTPYTAREDQRGLKRRGASRIYSSQDHAANTPADGTGDNLHPGVHGTAYDAL
                     AQRRTFRRAALTRVRGVNDRGSKLTGQRPRSNRADGLPDEGEV"
     gene            817967..820366
                     /locus_tag="HMPREF0733_RS03615"
                     /old_locus_tag="HMPREF0733_10765"
     CDS             817967..820366
                     /locus_tag="HMPREF0733_RS03615"
                     /old_locus_tag="HMPREF0733_10765"
                     /EC_number="3.6.3.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonate dehydratase"
                     /protein_id="WP_013398026.1"
                     /db_xref="GI:503163365"
                     /translation="MGNSTQTASTTAENDHSLFDSSANGGQTRIIHLDVQGMTCASCV
                     GRVERKLRKIPGVDPAVNLPLESARVIVPADITDEQIIETVNNAGYTASLKTEVRDAE
                     SEETTNARSGGLGWRIVVALLLGVPIFLISMFPTFQFPHWGWVLALITLPVAVYSAEP
                     FHRAALTNARHFSSTMDTLVSLGVIVAYLYSLAQLFMNPGLTEHVHPMQGGILGMFLS
                     GNHAPLYFDSASMVTLFLLIGRAVEHRTRTRSSEALRTLLSLGARTATLLRTDKRGTT
                     REVQIPVEDLLPGDEFLVRPGEKIATDGTVIAGSSAVDASLLTGESVPVEVSVGDAVT
                     GATLNTSGSLTVRATRVGSETTLAKMGELVAAAQETKAPIARLADRVSAIFVPTILVI
                     SLLTLIGWLAVSHDVPRAFNAAVSVLVIACPCALGLATPTALLAGTGRGSQLGILIRN
                     AQVLETTYAVNRIVLDKTGTVTEGTMRVARFGTFDDFTEVTDDNASSKSERSVSILSD
                     AAAVEALSEHPIAHAIARFATENYGAFLGTVENFEGVPGGVRGELVRTRGEGESRRLV
                     LVGTPEYLLQAGVPLTEKQHQMLEQTRSEGLTTVAVARAIGTKDPLPVGLIALADSPK
                     PESAQAIAELHELGLEPTLLTGDAPEVAQAIASSVGINPENVFAGVTPERKSEVIAKL
                     QDEGYRVAMVGDGVNDAPALARADLGMAMGSGTDVAVQASDIVLMRSDMRAIPTSLRL
                     SRATLHTIKSNLFWAFAYNTIAVPVAAAGLLNPMIAGAAMAFSSVFVVLNSMRLTRFE
                     R"
     gene            820538..821230
                     /locus_tag="HMPREF0733_RS03620"
                     /old_locus_tag="HMPREF0733_10766"
     CDS             820538..821230
                     /locus_tag="HMPREF0733_RS03620"
                     /old_locus_tag="HMPREF0733_10766"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_013398027.1"
                     /db_xref="GI:503163366"
                     /translation="MPKLTPQMFTFLNDPPVEDTLYDLYDATLKQGKRMFIHFLPKIH
                     QILGRGIDWETENEDFYTDKYIPITPQQGEFLYMQALASGARNIVEFGTSYGISTLYL
                     AAAAKRNGGRVITCEYVPHKAEAARKNFERAGLADYIELREGDALKTLQDLDFSPDFV
                     LLDGWPDLVLPVFQLLEPHLADRAVIAVDDVEGFGPSMEDYLDYVRTPANGYVSVTMH
                     PSKALEYTVKVA"
     gene            821303..821731
                     /locus_tag="HMPREF0733_RS03625"
                     /old_locus_tag="HMPREF0733_10767"
     CDS             821303..821731
                     /locus_tag="HMPREF0733_RS03625"
                     /old_locus_tag="HMPREF0733_10767"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013398028.1"
                     /db_xref="GI:503163367"
                     /translation="MKTLPIIWQHLVNAEKQTCSRCGTTGEELRKALQVLEAELLPQG
                     IQPHLEIRTMSEEEFLTHPEESNRIWIMGVPLEDLVGGIQGSSTCDDVCHGEQCRTVE
                     SQGKTYDAVPASLIVQAAHRALSLEKPAEDRRQFVQTICC"
     gene            821864..822523
                     /locus_tag="HMPREF0733_RS03630"
                     /old_locus_tag="HMPREF0733_10768"
     CDS             821864..822523
                     /locus_tag="HMPREF0733_RS03630"
                     /old_locus_tag="HMPREF0733_10768"
                     /EC_number="1.6.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H nitroreductase"
                     /protein_id="WP_013398029.1"
                     /db_xref="GI:503163368"
                     /translation="MILTREQAIEIFKRRVSTRSYDPARTISDKDFNTILEFGRLSPS
                     SVGSEPWKFLVIQNKELREKLKPIAWGMANTLDDASHVVIIVAKKNARYDSDFLLQAL
                     AKRNLPEDQMQMALDMYKNFQVHDMKIADDERALFEWTRKNTYIALGNMLTGAAMLGI
                     DSCPVEGMDYDAVTQLLTEEGLLDPEDYGVSVAATFGYRSREIDPKPRKPLDELVVWA
                     K"
     gene            complement(822807..823067)
                     /locus_tag="HMPREF0733_RS03635"
                     /old_locus_tag="HMPREF0733_10769"
     CDS             complement(822807..823067)
                     /locus_tag="HMPREF0733_RS03635"
                     /old_locus_tag="HMPREF0733_10769"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013398030.1"
                     /db_xref="GI:503163369"
                     /translation="MILLNILAHDTLNEQADAPGWILPVVLAVVVIAFVAIGAVILKG
                     IMRDSGDTSQRAAHKAERKIATKTGKKLGRTAHDKYREHRKE"
     gene            823262..823990
                     /locus_tag="HMPREF0733_RS03640"
                     /old_locus_tag="HMPREF0733_10771"
     CDS             823262..823990
                     /locus_tag="HMPREF0733_RS03640"
                     /old_locus_tag="HMPREF0733_10771"
                     /EC_number="1.6.6.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="WP_013398032.1"
                     /db_xref="GI:503163371"
                     /translation="MSLLDLLNRRRSVRHYDENQPIDADVVKECLRAAQLAPTSSNMQ
                     LYELYHVTDPATLNKLAAACMHQQAAKTAQQMVVFVTRQDLYRRRAKAALEFERGNVE
                     RNSPAEKQKDRIKNWEMYYTKAMPLLYARCFGLLGASRAAMANCAGLFVPMMREVSEH
                     DYRVVVHKSCGLVAQTFMLAMTEAGYDTCPMEGFDSHRVKKLLNLPRNVEINMVVACG
                     IRKPGHGIWGERFRLPFDEVYRRV"
     gene            824023..824595
                     /locus_tag="HMPREF0733_RS03645"
                     /old_locus_tag="HMPREF0733_10772"
     CDS             824023..824595
                     /locus_tag="HMPREF0733_RS03645"
                     /old_locus_tag="HMPREF0733_10772"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole biosynthesis protein ThiJ"
                     /protein_id="WP_013398033.1"
                     /db_xref="GI:503163372"
                     /translation="MKTLAVVILDKFADWEPALLAAGLQSIIGGYTVRWASVNREVKT
                     SMGGLRVEPDMTIPEIPSTADAVIVIGAEGSWRALPAEDSQKLASILRSFKDAGKPVG
                     GICDGAYFLASAGLLDGRRHTANSFEDIKDLPAYTNPHQYVNTTREAVRDKNLVTASG
                     LGFVDFTFEMLHALGDIPDAAIEQFNQMLR"
     gene            824650..824799
                     /locus_tag="HMPREF0733_RS03650"
                     /old_locus_tag="HMPREF0733_10773"
     CDS             824650..824799
                     /locus_tag="HMPREF0733_RS03650"
                     /old_locus_tag="HMPREF0733_10773"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase"
                     /protein_id="WP_013398034.1"
                     /db_xref="GI:503163373"
                     /translation="MKHSHDSAPDDWSWLDELGELDPSFIEAIQQLHAAPIYYQIPER
                     AHGDI"
     gene            824917..825351
                     /locus_tag="HMPREF0733_RS03655"
                     /old_locus_tag="HMPREF0733_10774"
     CDS             824917..825351
                     /locus_tag="HMPREF0733_RS03655"
                     /old_locus_tag="HMPREF0733_10774"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013398035.1"
                     /db_xref="GI:503163374"
                     /translation="MDFQFEVPPQLELGQPIGYYHERFNKDLYDSSFHGSERFMGRVT
                     LGNAERLVDLGLAEGKVVLFSLQILDGDTLNGVSLGLSPHEFHEKMRIEGHDSSIFSE
                     RLIFFEDFLTLGCEGKNIEFIEWWDRGYWDDYSFLEEAYPNT"
     gene            complement(825550..825888)
                     /locus_tag="HMPREF0733_RS03660"
                     /old_locus_tag="HMPREF0733_10775"
     CDS             complement(825550..825888)
                     /locus_tag="HMPREF0733_RS03660"
                     /old_locus_tag="HMPREF0733_10775"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321618.1"
                     /db_xref="GI:752672909"
                     /translation="MKKSFKRTLVAGVAGAVLAAGAAIPANAASSTSSLVPPRTEIDA
                     TVHGPGSSWWCHSVIYVFYTPINYQEPRYETVTACGNETVTKHLVSNHTQVAVAGEEY
                     HPAITASPRG"
     gene            826638..826895
                     /locus_tag="HMPREF0733_RS03665"
                     /old_locus_tag="HMPREF0733_10776"
     CDS             826638..826895
                     /locus_tag="HMPREF0733_RS03665"
                     /old_locus_tag="HMPREF0733_10776"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="WP_041321620.1"
                     /db_xref="GI:752672911"
                     /translation="MLGLIGMIIAGAIIGALARLIMRGHQNISALWTVILGAVGAFVG
                     GGIASFFGVADTAGIDWIRWILSIIAAIVAISIYLSVTKKN"
     gene            827263..827745
                     /locus_tag="HMPREF0733_RS03670"
                     /old_locus_tag="HMPREF0733_10777"
     CDS             827263..827745
                     /locus_tag="HMPREF0733_RS03670"
                     /old_locus_tag="HMPREF0733_10777"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline shock protein 23"
                     /protein_id="WP_004005822.1"
                     /db_xref="GI:490103984"
                     /translation="MSDNSIPQTGQQRERENNKETQQDKTPRGPLQTSHGVTTIEENV
                     VAKIAGMATREVPGVYDMGNAVRRAFSAVTDRIPNAQTNVAGGISVQKGETQAAVDVT
                     VVVEYGVSIVEVANAIRRNIIEQIEGTTGLEVVEVNIDVTDVHLPDDDSTSADSADLK
                     "
     gene            827950..828369
                     /locus_tag="HMPREF0733_RS03680"
                     /old_locus_tag="HMPREF0733_10779"
     CDS             827950..828369
                     /locus_tag="HMPREF0733_RS03680"
                     /old_locus_tag="HMPREF0733_10779"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041321622.1"
                     /db_xref="GI:752672913"
                     /translation="MTETNTQPAAVSVEDSQTESPWQEQRGVTVIPAQVVAQIAAQAA
                     YESANVGSNAGGLLGIGARRNFHSRPEAKCDLYGQVAVLHLDLGLTFPTALVSTLQQV
                     REHVSQRVEYFTGLRVEKINIEISWLNPNNQVRRALR"
     gene            828366..828914
                     /locus_tag="HMPREF0733_RS03685"
                     /old_locus_tag="HMPREF0733_10780"
     CDS             828366..828914
                     /locus_tag="HMPREF0733_RS03685"
                     /old_locus_tag="HMPREF0733_10780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="benzoate transporter"
                     /protein_id="WP_013398039.1"
                     /db_xref="GI:503163378"
                     /translation="MKAPVQNLIRRPSRSLPVIILALLFLIVGGLGIWALGNRLLNGA
                     WPNGTSSAVSGLGSTIIGSPAVLAAACFVIVCSLFMILLALWPGAPERTEVLADNIPG
                     QTAISRRDLARLVQAHVERVDGVHSARVRVRRTRVNVTVFSVLDDLEPVRQAAQKAAE
                     QAIQTLKPVGTAHSRVRIQHTS"
     gene            828928..829578
                     /locus_tag="HMPREF0733_RS03690"
                     /old_locus_tag="HMPREF0733_10781"
     CDS             828928..829578
                     /locus_tag="HMPREF0733_RS03690"
                     /old_locus_tag="HMPREF0733_10781"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006888529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013398040.1"
                     /db_xref="GI:503163379"
                     /translation="MRSVSGILNRIVLAVSGLLIAVIALWLIASGMGVGQSWPALNSV
                     LAKADTRVDTWVGPQAHWLLPAAVIGSVLLLAIGLVLLIKQVPRKAAASPLRLTGSDG
                     TLLATLSPDVISQALSERAEDVPGVQRCSVWVTGSPSNLWVQATVTVAENSEVAWTVS
                     ELRNRLDHDVSSSLGKHARQIDVLLRLEQASKPQSAAHTVAGQHSLESGGSDNHDR"
     gene            829568..830215
                     /locus_tag="HMPREF0733_RS03695"
                     /old_locus_tag="HMPREF0733_10782"
     CDS             829568..830215
                     /locus_tag="HMPREF0733_RS03695"
                     /old_locus_tag="HMPREF0733_10782"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase sigma-70 factor"
                     /protein_id="WP_013398041.1"
                     /db_xref="GI:503163380"
                     /translation="MTDEQRSNAGQSTGPPTEHVPHPNAASQGKDRYLVLRAQDGDID
                     AFGKLVERYQGRLFRTAYMIVRNRHDSEDIVQETLVQAWRSLHLLRDPDAFRGWLMRI
                     CTNKATSTIRQLQRRATDPYDSEGLESASVLPNTTSTATDDPAQSSEVNAQIEALAKL
                     LASAPEELRIVWVLREVDDMSYEEISQTLNLTESTVRGRLARARSLVMRHMKEWE"
     gene            830212..830748
                     /locus_tag="HMPREF0733_RS03700"
                     /old_locus_tag="HMPREF0733_10783"
     CDS             830212..830748
                     /locus_tag="HMPREF0733_RS03700"
                     /old_locus_tag="HMPREF0733_10783"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013398042.1"
                     /db_xref="GI:503163381"
                     /translation="MSSTTRIPHAEPRHTKSAQSYELDEASTREYLRLIASLHKTWDT
                     LEAQSSTSVMPQRHMMDAVLAETRHGAQVEMPPTDLGPYSMSEFSLRALVRRSVDSVP
                     GARALKSSFKHAPAPEGQRELGIPDTIFCRISAHVTTSSLPQLAQQVRDAVRQACFEN
                     LELSPTVNIHIEDLHDDD"
     gene            830738..831073
                     /locus_tag="HMPREF0733_RS03705"
                     /old_locus_tag="HMPREF0733_10784"
     CDS             830738..831073
                     /locus_tag="HMPREF0733_RS03705"
                     /old_locus_tag="HMPREF0733_10784"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013398043.1"
                     /db_xref="GI:503163382"
                     /translation="MTINLSAAELTHVVTAVPGVRGIEPGIGSTLKAIGNRMSGDPAT
                     ARFGIIIESGAQKVIIEIGIDDSRTVKEIVRDVQEAVLRSLSQASREGGASGSGSKPQ
                     VRVRIQSLL"
     gene            complement(831250..832752)
                     /locus_tag="HMPREF0733_RS03710"
                     /old_locus_tag="HMPREF0733_10785"
     CDS             complement(831250..832752)
                     /locus_tag="HMPREF0733_RS03710"
                     /old_locus_tag="HMPREF0733_10785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter MatE"
                     /protein_id="WP_013398044.1"
                     /db_xref="GI:503163383"
                     /translation="MSNKASEPNTSGAANTSDGTASTHEPQNLLDATPRTGSIPLHLG
                     EGGADSGKTQPEKSLNRRILALAVPAFGALIAEPLFVLADSALVGQLGTETLAGMSIA
                     ATLITTVVGLMNFLAYSVTPAVARAFGAHRLAHAYRIGVDGVWVALGLGLLIMGVGYI
                     FADPALRGMGANDATIGYARDYLHHSLWGIPPMMMILALMGTLRGLQDTVTPLKVAGV
                     GTVVNVALNWVLIYPVGWGVAGSATGTSLTQWGMALALGIFIHLKMRPQGVTWRPDIA
                     GMRGVLSLGSWLMLRTLSMRLALLSTVFVVARLGDEQTAAYQLGMSVFNLLLFALDSL
                     AIAAQALLGKELGERDLTAESGRAKVRELKNRLVRMSLVYGVVTGVVAPVIGFFGNWI
                     FTQDAPVATLFAWATLVIGVGQPIAAYVFVLDGILMGAQDVKYLAIGSFVMLVVYAPV
                     IFGIHWAVSGGLLSATVGYLGLWAAYILWYQGVRAFIFGRRAASDVWIKA"
     gene            complement(832944..833324)
                     /locus_tag="HMPREF0733_RS03715"
                     /old_locus_tag="HMPREF0733_10786"
     CDS             complement(832944..833324)
                     /locus_tag="HMPREF0733_RS03715"
                     /old_locus_tag="HMPREF0733_10786"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004005831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein S4"
                     /protein_id="WP_004005831.1"
                     /db_xref="GI:490103993"
                     /translation="MSEEITSARIDVWLWSVRIFKTRALAADECKGGHVRVNDASAKP
                     SQKLKRGDIVRVRYPGWERVFKVEKLITKRVGAPIAVTCYEDLSGPRPAHLSMPPVAK
                     RERGTGRPTKKERRALDELRGRKG"
     gene            complement(833417..834622)
                     /locus_tag="HMPREF0733_RS03720"
                     /old_locus_tag="HMPREF0733_10787"
     CDS             complement(833417..834622)
                     /locus_tag="HMPREF0733_RS03720"
                     /old_locus_tag="HMPREF0733_10787"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013398046.1"
                     /db_xref="GI:503163385"
                     /translation="MARTPEAITPSSWRKVIAIATLASVIVSIVILAFTWPTKAMETN
                     LPVSIAGPEAAVSQFEQGLKERGIETFEFKQASSREDAERQIKERETYGAIVFTEGAA
                     PEVMTAPAANASANQMLTGVAQQMNAQVQQQATAAKTQALQQAAQAGGQQGAIATQQL
                     EQLKTEQEKLQQAQVKTTAVVPLGDGDPNGMGLAVAAFPLVMGGIIGGVLSISLVKGT
                     VRRFATAGLYGILGGLFMTLILGTWFGFVPGDFGALWATFGMTVFATASFMIGMSALF
                     ADAVGIGLGAVISMFIGNPLSGANMPWQFIPAPWGAFGQLMVPGASNTLLRNIAYFPN
                     ASNSLQWAVLLGWAGFGLLAGAIGWAWKERRATHMSAEDDTASVGAKTEANADVPDNV
                     EIPWKTANT"
     gene            834791..835387
                     /locus_tag="HMPREF0733_RS03725"
                     /old_locus_tag="HMPREF0733_10788"
     CDS             834791..835387
                     /locus_tag="HMPREF0733_RS03725"
                     /old_locus_tag="HMPREF0733_10788"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013398047.1"
                     /db_xref="GI:503163386"
                     /translation="MPRLTEATKQARRRQIIDAAFTCFTAKGYTHTSMTDIIRESGLS
                     SGSIYSHFSGKGDILYATVQQRIDMIAAAYGELKDPSPRDIMRMIFATSTVEANFTSM
                     LRIRLESFTVPEVQESTNTLFTTLHDIVAQSLIPWGQRYLEAENKRKPSADELQAFVS
                     DTADALILTFQGFMVRSTLSPSTDREHLFQIALSLLPE"
     gene            complement(835512..836261)
                     /locus_tag="HMPREF0733_RS03730"
                     /old_locus_tag="HMPREF0733_10789"
     CDS             complement(835512..836261)
                     /locus_tag="HMPREF0733_RS03730"
                     /old_locus_tag="HMPREF0733_10789"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013398048.1"