GenomeNet

Database: RefSeq
Entry: NC_015675
LinkDB: NC_015675
Original site: NC_015675 
LOCUS       NC_015675            6884444 bp    DNA     circular CON 06-JUL-2013
DEFINITION  Mesorhizobium opportunistum WSM2075 chromosome, complete genome.
ACCESSION   NC_015675
VERSION     NC_015675.1  GI:337264537
DBLINK      Project: 40861
            BioProject: PRJNA40861
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Mesorhizobium opportunistum WSM2075
  ORGANISM  Mesorhizobium opportunistum WSM2075
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Phyllobacteriaceae; Mesorhizobium.
REFERENCE   1  (bases 1 to 6884444)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D.,
            Goodwin,L., Pitluck,S., Chertkov,O., Misra,M., Detter,J.C., Han,C.,
            Tapia,R., Land,M., Hauser,L., Kyrpides,N., Ovchinnikova,G.,
            Mavrommatis,K.M., Tiwari,R.P., Howieson,J.G., O'Hara,G.W.,
            Nandasena,K.G. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Mesorhizobium opportunistum WSM2075
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6884444)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JUN-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 6884444)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D.,
            Goodwin,L., Pitluck,S., Chertkov,O., Misra,M., Detter,J.C., Han,C.,
            Tapia,R., Land,M., Hauser,L., Kyrpides,N., Ovchinnikova,G.,
            Mavrommatis,K.M., Tiwari,R.P., Howieson,J.G., O'Hara,G.W.,
            Nandasena,K.G. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002279.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4086182
            Source DNA and organism available from Kemanthi G. Nandasena
            (K.Nandasena@murdoch.edu.au)
            Contacts: Kemanthi G. Nandasena (K.Nandasena@murdoch.edu.au)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##MIGS-Data-START##
            investigation_type     :: bacteria_archaea
            project_name           :: Mesorhizobium opportunistum WSM2075
            collection_date        :: August 2000
            lat_lon                :: -31.530408 116.947875
            depth                  :: Missing
            alt_elev               :: Missing
            country                :: Australia
            environment            :: Host, Rhizosphere, Root nodule
            num_replicons          :: Missing
            ref_biomaterial        :: LMG 24607
            biotic_relationship    :: Symbiotic
            trophic_level          :: Missing
            rel_to_oxygen          :: Aerobe
            isol_growth_condt      :: Missing
            sequencing_meth        :: WGS
            assembly               :: Newbler v. 2.3 (pre-release)
            finishing_strategy     :: Finished
            GOLD Stamp ID          :: Gi03279
            Type Strain            :: Yes
            Greengenes ID          :: 101371
            Isolation Site         :: Antonio's farm, Antonio Rd, Northam,
                                      Western Australia
            Source of Isolate      :: Nandasena
            Isolation Comments     :: has symbiosis island from WSM1271, but
                                      ineffective for N fixation
            Host Name              :: Biserrula pelecinus L
            Cell Shape             :: Rod-shaped
            Motility               :: Motile
            Temperature Range      :: Mesophile
            Gram Staining          :: Gram-
            Symbiotic Relationship :: Parasitic
            Diseases               :: None
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..6884444
                     /organism="Mesorhizobium opportunistum WSM2075"
                     /mol_type="genomic DNA"
                     /strain="WSM2075"
                     /isolation_source="Antonio's farm, Antonio Rd."
                     /db_xref="taxon:536019"
                     /country="Australia: Northam, Western Australia"
                     /lat_lon="31.530409 S 116.947876 E"
                     /collection_date="Aug-2000"
     gene            675..2219
                     /locus_tag="Mesop_0001"
                     /db_xref="GeneID:10830486"
     CDS             675..2219
                     /locus_tag="Mesop_0001"
                     /note="COGs: COG0593 ATPase involved in DNA replication
                     initiation;
                     InterProIPR018312:IPR013317:IPR013159:IPR020591:IPR
                     001957:IPR003593;
                     KEGG: mlo:mll5581 chromosomal replication initiation
                     protein;
                     PFAM: Chromosomal replication initiator DnaA; Chromosomal
                     replication initiator DnaA domain;
                     SMART: Chromosomal replication initiator DnaA domain; AAA
                     ATPase;
                     SPTR: Chromosomal replication initiator protein dnaA;
                     TIGRFAM: chromosomal replication initiator protein DnaA;
                     PFAM: domain; Bacterial dnaA protein;
                     TIGRFAM: chromosomal replication initiator protein DnaA"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="YP_004608593.1"
                     /db_xref="GI:337264538"
                     /db_xref="GeneID:10830486"
                     /translation="MQSGVERELTGDLPFPGTLIGANGMAVSSDAEQKFDRVKAQLKA
                     RLGAEVYSSWFGRMKVAEASKGIVRISVPTAFLRSWINGHYLDLISELWKQEDADLLK
                     IEIIVRTATRQGRSHAEPELAPVRKMTRQTQTALAAGTVSPGRIERSPVPRPGAAIES
                     EFRHNVLGSPLDPRYTFGSFIEGPSNRVAFAAAKAVAESQSSAVRFNPLFLHATVGLG
                     KTHLLQAIAAESLKQNPKSRVVYLTAEYFMWRFATAIRDNNALTLKEQLRDIDLLIID
                     DMQFLQGKSIQHEFCHLINMLLDSAKQVVVAADRPPSELESLEPRVRSRLNGGVALEM
                     SAPDFAMRLGMLKLRLATARVDDASLDISEEILNHVARTVTGSGRELEGAFNQLLFRQ
                     SFEPQITIDRIDEILGHIYRTGEPKRVRIEDIQRIVARHYNVSKTELLSNRRTRTIVK
                     PRQVAMYLSKVMTPRSLPEIGRRFGGRDHTTVLHAVRKIEDLSGNDNTLAQELELLRR
                     LINDQA"
     misc_feature    762..2210
                     /locus_tag="Mesop_0001"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    777..959
                     /locus_tag="Mesop_0001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    1287..1655
                     /locus_tag="Mesop_0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    1311..1334
                     /locus_tag="Mesop_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(1314..1337,1500..1502,1599..1601)
                     /locus_tag="Mesop_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    1488..1505
                     /locus_tag="Mesop_0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    1647..1649
                     /locus_tag="Mesop_0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1935..2204
                     /locus_tag="Mesop_0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(2004..2006,2028..2033,2052..2054,2070..2078,
                     2103..2117,2124..2126,2133..2138)
                     /locus_tag="Mesop_0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            2525..3643
                     /locus_tag="Mesop_0002"
                     /db_xref="GeneID:10823806"
     CDS             2525..3643
                     /locus_tag="Mesop_0002"
                     /EC_number="2.7.7.7"
                     /note="COGs: COG0592 DNA polymerase sliding clamp subunit
                     (PCNA homolog);
                     InterPro IPR001001;
                     KEGG: mlo:mll5580 DNA polymerase III subunit beta;
                     PFAM: DNA polymerase III beta chain;
                     PRIAM: DNA-directed DNA polymerase;
                     SMART: DNA polymerase III beta chain;
                     SPTR: DNA polymerase III beta subunit;
                     TIGRFAM: DNA polymerase III, beta subunit;
                     PFAM: DNA polymerase III beta subunit, C-terminal domain;
                     DNA polymerase III beta subunit, N-terminal domain; DNA
                     polymerase III beta subunit, central domain;
                     TIGRFAM: DNA polymerase III, beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_004608594.1"
                     /db_xref="GI:337264539"
                     /db_xref="GeneID:10823806"
                     /translation="MRVILERSNLLKSLNHVHRVVERRNTIPILSNVLLSAEGASLEM
                     KATDLDLEVTEATPAKVERGGATTVPAHLLYDIVRKLSDGAEVMLKTDEDGNAMTVTS
                     GRSSFRLQCLPQSDFPELSAGSFSHIFRLDSVALKGLIEKTQFAISTEETRYYLNGIY
                     LHTHEVGGKLKLRSVATDGHRLARAEIDAPAGSEGMPGIIIPRKTVSELQKLVDDPDV
                     AVTTELSDTKIRFTIGSVVLTSKLIDGTFPDYQRVIPTGNDKKLILDRQSFAAAVDRV
                     STISSERGRAVKLSISEGQVTLAVNNPDSGSATEELAADYSSDPIEIGFNAKYLLDVA
                     AQLTGTEAKFMLADAGSPTLIHDMADETALYVLMPMRV"
     misc_feature    2525..3640
                     /locus_tag="Mesop_0002"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    2525..3637
                     /locus_tag="Mesop_0002"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(2594..2596,2738..2740,2759..2761,3134..3136)
                     /locus_tag="Mesop_0002"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2741..2743,2750..2752,2834..2836,2840..2842,
                     3356..3358,3449..3454)
                     /locus_tag="Mesop_0002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(3053..3055,3059..3070,3500..3502,3626..3637)
                     /locus_tag="Mesop_0002"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(3053..3055,3059..3064,3281..3283,3386..3388,
                     3425..3430,3509..3511,3626..3637)
                     /locus_tag="Mesop_0002"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            3719..4852
                     /locus_tag="Mesop_0003"
                     /db_xref="GeneID:10823807"
     CDS             3719..4852
                     /locus_tag="Mesop_0003"
                     /note="COGs: COG1195 Recombinational DNA repair ATPase
                     (RecF pathway);
                     InterPro IPR018078:IPR003395:IPR003593:IPR001238;
                     KEGG: mlo:mll5578 recombination protein F;
                     PFAM: SMC domain protein;
                     SMART: AAA ATPase;
                     SPTR: DNA replication and repair protein recF;
                     TIGRFAM: DNA replication and repair protein RecF;
                     PFAM: RecF/RecN/SMC N terminal domain;
                     TIGRFAM: recF protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="YP_004608595.1"
                     /db_xref="GI:337264540"
                     /db_xref="GeneID:10823807"
                     /translation="MPGQTHISKLTLTNFRNYAALAIDLAPGAVVFSGDNGAGKTNLL
                     EAISFLTPGRGLRRAPYADVARAGGDGGFALHARLDGPDGQVEIGTGISGGDSEGGRR
                     VRINGATARSAEDMLEWLRVVWLTPAMDTLFTGPAADRRRFLDRLVLAIDPGHGQRAL
                     DYEKAMRGRNRLLTENSRDDRWFEAIEIQMAETGVAIAAARAEMVRLLAAMIDRLPDS
                     GPFPQADIGLAGDLEAEIAGTPAVDVEERFRRALADGRDRDRAAGRTLEGPHRSDLLV
                     RHRPKAMPAELCSTGEQKALLVGIVLSHARLTGEVSGMTPILLLDEIAAHLDGGRRAA
                     LFSILEELNCQAFMTGTDAALFSSLQGRAQFLTVDHGIVGPTV"
     sig_peptide     3719..3784
                     /locus_tag="Mesop_0003"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    3734..4837
                     /locus_tag="Mesop_0003"
                     /note="recombination protein F; Reviewed; Region: recF;
                     PRK00064"
                     /db_xref="CDD:234608"
     misc_feature    3737..4831
                     /locus_tag="Mesop_0003"
                     /note="ATP-binding cassette domain of RecF; Region:
                     ABC_RecF; cd03242"
                     /db_xref="CDD:213209"
     misc_feature    3818..3841
                     /locus_tag="Mesop_0003"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213209"
     misc_feature    order(3827..3832,3836..3844,4046..4048,4679..4684,
                     4769..4771)
                     /locus_tag="Mesop_0003"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213209"
     misc_feature    4037..4048
                     /locus_tag="Mesop_0003"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213209"
     misc_feature    4580..4609
                     /locus_tag="Mesop_0003"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213209"
     misc_feature    4667..4684
                     /locus_tag="Mesop_0003"
                     /note="Walker B; other site"
                     /db_xref="CDD:213209"
     misc_feature    4691..4702
                     /locus_tag="Mesop_0003"
                     /note="D-loop; other site"
                     /db_xref="CDD:213209"
     misc_feature    4757..4777
                     /locus_tag="Mesop_0003"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213209"
     gene            4864..5658
                     /locus_tag="Mesop_0004"
                     /db_xref="GeneID:10823808"
     CDS             4864..5658
                     /locus_tag="Mesop_0004"
                     /note="COGs: COG0476 Dinucleotide-utilizing protein
                     involved in molybdopterin and thiamine biosynthesis family
                     2;
                     InterPro IPR000594:IPR007901;
                     KEGG: mlo:mll5577 molybdopterin biosynthesis protein MoeB;
                     PFAM: UBA/THIF-type NAD/FAD binding protein; MoeZ/MoeB
                     domain protein;
                     SPTR: UBA/THIF-type NAD/FAD binding protein;
                     PFAM: MoeZ/MoeB domain; ThiF family"
                     /codon_start=1
                     /transl_table=11
                     /product="UBA/THIF-type NAD/FAD binding protein"
                     /protein_id="YP_004608596.1"
                     /db_xref="GI:337264541"
                     /db_xref="GeneID:10823808"
                     /translation="MDVVKVFDPLYGPDMTNALTADEIERYARHIVLPEVGGSGQQKL
                     KQARVLVIGAGGLGAPVLEYLAAAGVGTLGIVDDDTVSLSNLQRQVIHGTDTVGLLKT
                     HSAEAAIARINPNTNVETHTFRLTADNAPALVARYDMVVDGSDNFETRYVVADACASE
                     HKPLVHAAVGRFDGSVTVLKPFEDGKDGKPNPGYRDLFPEAPPPGLVPSCAEAGVLGA
                     LTGVVGTLQAMEAIKLITGIGEPLVGRLLLYDALAARFETIRYKRG"
     misc_feature    4906..5652
                     /locus_tag="Mesop_0004"
                     /note="molybdopterin biosynthesis protein MoeB;
                     Provisional; Region: PRK05690"
                     /db_xref="CDD:180204"
     misc_feature    4939..5643
                     /locus_tag="Mesop_0004"
                     /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved
                     in molybdopterin and thiamine biosynthesis family. The
                     common reaction mechanism catalyzed by MoeB and ThiF, like
                     other E1 enzymes, begins with a nucleophilic attack of the
                     C-terminal carboxylate of MoaD...; Region:
                     ThiF_MoeB_HesA_family; cd00757"
                     /db_xref="CDD:238386"
     misc_feature    order(5020..5022,5026..5028,5032..5034,5092..5094,
                     5098..5100,5125..5127,5164..5166,5290..5292,5308..5310)
                     /locus_tag="Mesop_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    order(5032..5034,5293..5301,5311..5313,5365..5370,
                     5380..5382,5386..5388,5599..5601,5611..5613,5632..5634,
                     5638..5643)
                     /locus_tag="Mesop_0004"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238386"
     gene            5661..6149
                     /locus_tag="Mesop_0005"
                     /db_xref="GeneID:10823809"
     CDS             5661..6149
                     /locus_tag="Mesop_0005"
                     /note="InterPro IPR000182;
                     KEGG: mlo:mll5576 hypothetical protein;
                     PFAM: GCN5-related N-acetyltransferase;
                     SPTR: GCN5-related N-acetyltransferase;
                     PFAM: Acetyltransferase (GNAT) family"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-like N-acetyltransferase"
                     /protein_id="YP_004608597.1"
                     /db_xref="GI:337264542"
                     /db_xref="GeneID:10823809"
                     /translation="MARTSAPSITRIPADFDRWDDVLALIMRAFAFMDGVIDPPSSAH
                     RLTVDSLRDKARLESGFVALDSDRIVGCVFAIERADDFYVGKLAVEPDCQGQGIGRRL
                     MRAVEILALDRGKAALELQTRIELTANHAAFARLGFHETERTAHEGYSRPTSITMRKA
                     LS"
     misc_feature    5715..6074
                     /locus_tag="Mesop_0005"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    5841..6020
                     /locus_tag="Mesop_0005"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(5919..5927,5955..5960)
                     /locus_tag="Mesop_0005"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(6170..7171)
                     /locus_tag="Mesop_0006"
                     /db_xref="GeneID:10823810"
     CDS             complement(6170..7171)
                     /locus_tag="Mesop_0006"
                     /EC_number="1.1.1.26"
                     /note="COGs: COG1052 Lactate dehydrogenase and related
                     dehydrogenase;
                     InterPro IPR006140:IPR006139;
                     KEGG: mlo:mlr5574 2-hydroxyacid dehydrogenase;
                     PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
                     catalytic region;
                     PRIAM: Glyoxylate reductase;
                     SPTR: D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding;
                     PFAM: D-isomer specific 2-hydroxyacid dehydrogenase, NAD
                     binding domain; D-isomer specific 2-hydroxyacid
                     dehydrogenase, catalytic domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxylate reductase"
                     /protein_id="YP_004608598.1"
                     /db_xref="GI:337264543"
                     /db_xref="GeneID:10823810"
                     /translation="MAGKKKPLVVITRKLPDPVETRMRELFDARLNVEDRPMTQPELV
                     AAVKEADVLVPTVTDQIDAALIAQAGDNLKLIANFGNGVDKIDVAAAAKKGITVTNTP
                     NVLTEDTADMTMALMLAVPRRLAEGANVLTGDKKWVGWSPTWMLGRRIWGKRLGIVGM
                     GRIGTAVARRAKAFGLSIHYHNRHRVLPAVEDGLEATYWESLDQMLARMDIISVNCPS
                     TPATFHLLSARRLALLQPTAYIVNTARGDIIDEEALVKLIQDGKIAGAGLDVYEHEPA
                     LNGKLLKLAARNKVVLLPHMGSATLEGRIDMGEKVIINIRAFVDGHRPPDRVLPLRT"
     misc_feature    complement(6182..7159)
                     /locus_tag="Mesop_0006"
                     /note="Lactate dehydrogenase and related dehydrogenases
                     [Energy production and conversion / Coenzyme metabolism /
                     General function prediction only]; Region: LdhA; COG1052"
                     /db_xref="CDD:223980"
     misc_feature    complement(6209..7153)
                     /locus_tag="Mesop_0006"
                     /note="D-glycerate dehydrogenase/hydroxypyruvate reductase
                     (GDH); Region: GDH; cd05301"
                     /db_xref="CDD:240626"
     misc_feature    complement(order(6260..6262,6266..6277,6281..6301,
                     6326..6328,6347..6352,6650..6655,6662..6667,6719..6733,
                     6737..6757,6761..6763,6767..6769,6776..6778,6800..6802,
                     6806..6808,6818..6820,6827..6832,6836..6841,6848..6853,
                     6935..6937,6998..7006,7124..7126,7130..7135))
                     /locus_tag="Mesop_0006"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240626"
     misc_feature    complement(order(6278..6280,6287..6289,6437..6439,
                     6857..6859,6926..6934,7001..7003))
                     /locus_tag="Mesop_0006"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240626"
     misc_feature    complement(order(6278..6283,6287..6289,6362..6367,
                     6437..6445,6506..6511,6521..6529,6614..6616,6623..6631,
                     6683..6697,6845..6847,6926..6931))
                     /locus_tag="Mesop_0006"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:240626"
     misc_feature    complement(order(6287..6289,6350..6352,6437..6439))
                     /locus_tag="Mesop_0006"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240626"
     gene            7320..7880
                     /locus_tag="Mesop_0007"
                     /db_xref="GeneID:10823811"
     CDS             7320..7880
                     /locus_tag="Mesop_0007"
                     /note="COGs: COG3807 conserved hypothetical protein;
                     InterPro IPR010466;
                     KEGG: mlo:mll5573 hypothetical protein;
                     PFAM: protein of unknown function DUF1058;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Bacterial SH3 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608599.1"
                     /db_xref="GI:337264544"
                     /db_xref="GeneID:10823811"
                     /translation="MSGFASLRLVLSAAFLGTLLYSPLAAAQGAAAPAQGAVTLGPSG
                     LPLPRFVSLKSGRVNSRVGPGANYSVDWMYMKAGLPMEIIQEFDTWRRVRDADGSEGW
                     INQSLLSGRRTAIIAPWQRGKGAQINLLNSPDKDARVIAIVEPGVMGMIKSCDGQWCE
                     MTLGGHTGWLAQSTVWGAYPGERVKD"
     sig_peptide     7320..7400
                     /locus_tag="Mesop_0007"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    7356..7874
                     /locus_tag="Mesop_0007"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3807"
                     /db_xref="CDD:226329"
     misc_feature    7479..7649
                     /locus_tag="Mesop_0007"
                     /note="Bacterial SH3 domain; Region: SH3_4; pfam06347"
                     /db_xref="CDD:115031"
     misc_feature    7686..7850
                     /locus_tag="Mesop_0007"
                     /note="Bacterial SH3 domain; Region: SH3_4; pfam06347"
                     /db_xref="CDD:115031"
     gene            complement(7870..8250)
                     /locus_tag="Mesop_0008"
                     /db_xref="GeneID:10823812"
     CDS             complement(7870..8250)
                     /locus_tag="Mesop_0008"
                     /note="KEGG: mlo:mlr5572 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608600.1"
                     /db_xref="GI:337264545"
                     /db_xref="GeneID:10823812"
                     /translation="MKPLDLIIRLEWVVVAVAAIVFYASSGISWWLFAVLILAPDLSM
                     LGYLGGPRLGAIAYNALHMLIAPVLLLLAGHLLGNAAAITVALIWIAHIAIDRSLGYG
                     LKLSTGFQDTHLGRIGRKPGAFSP"
     misc_feature    complement(7900..8241)
                     /locus_tag="Mesop_0008"
                     /note="Domain of unknown function (DUF4260); Region:
                     DUF4260; pfam14079"
                     /db_xref="CDD:206249"
     gene            complement(8273..8740)
                     /locus_tag="Mesop_0009"
                     /db_xref="GeneID:10823813"
     CDS             complement(8273..8740)
                     /locus_tag="Mesop_0009"
                     /note="COGs: COG0735 Fe2+/Zn2+ uptake regulation protein;
                     InterPro IPR002481;
                     KEGG: mlo:mlr5570 transcription regulator;
                     PFAM: ferric-uptake regulator;
                     SPTR: Ferric uptake regulator, Fur family;
                     PFAM: Ferric uptake regulator family"
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family ferric uptake regulator"
                     /protein_id="YP_004608601.1"
                     /db_xref="GI:337264546"
                     /db_xref="GeneID:10823813"
                     /translation="MDRGCRKENVAVDKRVREAGLRPTRQRIALADLLFAKGDRHLSA
                     EELHEEALAAGVPVSLATVYNALHQFTQAGLLRILAVEGAKTYFDTNTSDHHHFYIEG
                     ENRIFDIANGPVTVTNLPDPPEGMEIANVDIVVRLRPKRQESPAGPEQSAKPE"
     misc_feature    complement(8333..8668)
                     /locus_tag="Mesop_0009"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(8417..8419,8450..8452,8456..8458,
                     8474..8476,8618..8620))
                     /locus_tag="Mesop_0009"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(8522..8566)
                     /locus_tag="Mesop_0009"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(8348..8350,8453..8455,8459..8461))
                     /locus_tag="Mesop_0009"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(8333..8353,8357..8365,8390..8395,
                     8438..8446))
                     /locus_tag="Mesop_0009"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(8432..8434,8441..8443))
                     /locus_tag="Mesop_0009"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            8982..9497
                     /locus_tag="Mesop_0010"
                     /db_xref="GeneID:10823814"
     CDS             8982..9497
                     /locus_tag="Mesop_0010"
                     /EC_number="4.2.1.60"
                     /note="COGs: COG0764
                     3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier
                     protein) dehydratase;
                     InterPro IPR013114:IPR010083;
                     KEGG: mlo:mll5569 3-hydroxydecanoyl-(acyl carrier protein)
                     dehydratase;
                     PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
                     FabA/FabZ;
                     PRIAM: 3-hydroxydecanoyl-[acyl-carrier-protein]
                     dehydratase;
                     SPTR: Beta-hydroxyacyl-(Acyl-carrier-protein) dehydratase
                     FabA;
                     TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
                     dehydratase FabA;
                     PFAM: FabA-like domain;
                     TIGRFAM: beta-hydroxyacyl-[acyl carrier protein]
                     dehydratase FabA"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-ACP dehydratase"
                     /protein_id="YP_004608602.1"
                     /db_xref="GI:337264547"
                     /db_xref="GeneID:10823814"
                     /translation="MAGKPSYDYDELLACARGELFGEGNAQLPYPPMLMFDRITEISE
                     TGGAFDKGFIRAEFDIKPDLWFFACHFIGNPIMPGCLGLDALWQLTGFYLGWLGEPGK
                     GMALSTGEVKFKGMVTPSVKKVEYGVDFKRVMRGRLVLGIADGWMKADGEPIYAATDL
                     KVGLSKQSAVA"
     misc_feature    9057..9482
                     /locus_tag="Mesop_0010"
                     /note="FabA, beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase: Bacterial protein of the type II, fatty
                     acid synthase system that binds ACP and catalyzes both
                     dehydration and isomerization reactions, apparently in the
                     same active site. The FabA...; Region: FabA; cd01287"
                     /db_xref="CDD:238614"
     misc_feature    order(9057..9065,9231..9233,9240..9245,9252..9257,
                     9288..9299)
                     /locus_tag="Mesop_0010"
                     /note="active site 1 [active]"
                     /db_xref="CDD:238614"
     misc_feature    order(9060..9062,9066..9068,9219..9221,9231..9233,
                     9288..9314,9318..9320,9324..9329)
                     /locus_tag="Mesop_0010"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238614"
     misc_feature    order(9210..9218,9318..9329)
                     /locus_tag="Mesop_0010"
                     /note="active site 2 [active]"
                     /db_xref="CDD:238614"
     gene            9547..10767
                     /locus_tag="Mesop_0011"
                     /db_xref="GeneID:10823815"
     CDS             9547..10767
                     /locus_tag="Mesop_0011"
                     /note="COGs: COG0304 3-oxoacyl-(acyl-carrier-protein)
                     synthase;
                     InterPro IPR018201:IPR014030:IPR014031;
                     KEGG: mlo:mll5566 3-oxoacyl-(acyl carrier protein)
                     synthase I;
                     PFAM: Beta-ketoacyl synthase;
                     SPTR: Beta-ketoacyl synthase;
                     PFAM: Beta-ketoacyl synthase, N-terminal domain;
                     Beta-ketoacyl synthase, C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoacyl synthase"
                     /protein_id="YP_004608603.1"
                     /db_xref="GI:337264548"
                     /db_xref="GeneID:10823815"
                     /translation="MRRVVVTGIGIVSSIGNNANEVQTSLHDARSGISFSDSFAEHGF
                     RCQVWGAPTLDPSAMIDRRAMRFLSQGAAWNHVAMDQAIADAGLGEDDVTNERTGIVM
                     GSGGPSTRTIVEAAETTLKNGSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISS
                     ACSTSAHCIGNGYELIQWGKQDMVFAGGHEDLDWTMSDLFDAMGAMSSKFNDKASTAS
                     RAYDVNRDGFVIAGGAGVLVLEELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGA
                     IRCMRQAMSTISTPVDYINTHGTSTPVGDSKEMGAIREVFGEKMPFITSTKSLTGHSL
                     GAAGVQESIYSILMMQGGFIGESAHIETLDPEFEGMPIVRKRIDNAKIDTVLSNSFGF
                     GGTNATLVFQRYSA"
     misc_feature    9547..10764
                     /locus_tag="Mesop_0011"
                     /note="3-oxoacyl-(acyl carrier protein) synthase I;
                     Reviewed; Region: PRK07967"
                     /db_xref="CDD:181184"
     sig_peptide     9547..9603
                     /locus_tag="Mesop_0011"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    9550..10749
                     /locus_tag="Mesop_0011"
                     /note="Beta-ketoacyl-acyl carrier protein (ACP) synthase
                     (KAS), type I and II. KASs are responsible for the
                     elongation steps in fatty acid biosynthesis. KASIII
                     catalyses the initial condensation and KAS I and II
                     catalyze further elongation steps by Claisen...; Region:
                     KAS_I_II; cd00834"
                     /db_xref="CDD:238430"
     misc_feature    order(9859..9861,9880..9885,9895..9897,9904..9909,
                     9943..9945,9961..9963,9973..9975,9985..9987,10003..10005,
                     10009..10011,10015..10023,10057..10059,10066..10071,
                     10078..10080,10138..10143,10150..10155,10330..10344,
                     10378..10380,10723..10725,10729..10731)
                     /locus_tag="Mesop_0011"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238430"
     misc_feature    order(10030..10032,10435..10437,10540..10542)
                     /locus_tag="Mesop_0011"
                     /note="active site"
                     /db_xref="CDD:238430"
     gene            10819..11631
                     /locus_tag="Mesop_0012"
                     /db_xref="GeneID:10823816"
     CDS             10819..11631
                     /locus_tag="Mesop_0012"
                     /EC_number="1.3.1.9"
                     /note="COGs: COG0623 Enoyl-(acyl-carrier-protein);
                     InterPro IPR002198:IPR002347;
                     KEGG: mlo:mll5565 enoyl-(acyl carrier protein) reductase;
                     PFAM: short-chain dehydrogenase/reductase SDR;
                     SPTR: Short-chain dehydrogenase/reductase SDR;
                     PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004608604.1"
                     /db_xref="GI:337264549"
                     /db_xref="GeneID:10823816"
                     /translation="MNGLMKGKRGLVMGVANDHSIAWGIAKKLSEHGAELAFTYQGEA
                     FGRRVKPLADKLGAALVVPCDVEDSASVAATFETLNKEWGGLDFVVHAIGFSDKNELK
                     GLYADTSRDNFVRTMVISCYSFTEIARHAAALMNDGGSMITLTYAGSVRVMPNYNVMG
                     VAKAGLEASVRYLANDYGPRGIRVNGISAGPVRTLAGAGISDARHMFSYQQRNSPLRR
                     TVTIDEVGGSALYLLSDLSSGVTGEIHYVDSGYHIVSMPTLDELKQTDSTRD"
     misc_feature    10822..11598
                     /locus_tag="Mesop_0012"
                     /note="Enoyl-[acyl-carrier-protein]; Region: FabI;
                     COG0623"
                     /db_xref="CDD:223696"
     misc_feature    10837..11580
                     /locus_tag="Mesop_0012"
                     /note="Enoyl acyl carrier protein (ACP) reductase (ENR),
                     divergent SDR; Region: ENR_SDR; cd05372"
                     /db_xref="CDD:187630"
     misc_feature    order(10858..10866,10876..10881,10939..10941,11008..11016,
                     11092..11103,11173..11175,11248..11256,11284..11286,
                     11305..11307,11383..11394,11398..11409)
                     /locus_tag="Mesop_0012"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187630"
     misc_feature    order(10909..10911,11014..11025,11032..11034,11128..11148,
                     11155..11160,11167..11172,11179..11184,11191..11193,
                     11203..11205,11212..11214,11260..11265,11269..11280,
                     11284..11289,11296..11301,11308..11313,11320..11325,
                     11329..11346,11350..11355,11434..11436,11443..11445,
                     11461..11472,11488..11490,11497..11502,11509..11511,
                     11524..11526,11530..11568,11572..11580)
                     /locus_tag="Mesop_0012"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(11014..11025,11128..11148,11155..11160,11167..11172,
                     11179..11184,11191..11193,11200..11205,11212..11214,
                     11260..11265,11269..11277,11284..11289,11296..11301,
                     11308..11313,11320..11325,11329..11337,11341..11349)
                     /locus_tag="Mesop_0012"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(11098..11100,11104..11106,11254..11256,11284..11286,
                     11293..11295,11305..11307,11404..11409,11416..11418,
                     11425..11427)
                     /locus_tag="Mesop_0012"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(11176..11178,11254..11256,11293..11295,11305..11307)
                     /locus_tag="Mesop_0012"
                     /note="active site"
                     /db_xref="CDD:187630"
     gene            11768..13312
                     /locus_tag="Mesop_0013"
                     /db_xref="GeneID:10823817"
     CDS             11768..13312
                     /locus_tag="Mesop_0013"
                     /note="COGs: COG2200 FOG: EAL domain;
                     InterPro IPR000160:IPR001633;
                     KEGG: mlo:mll5564 hypothetical protein;
                     PFAM: EAL domain protein; GGDEF domain containing protein;
                     SMART: EAL domain protein; GGDEF domain containing
                     protein;
                     SPTR: Diguanylate cyclase/phosphodiesterase;
                     TIGRFAM: diguanylate cyclase;
                     PFAM: EAL domain; GGDEF domain;
                     TIGRFAM: diguanylate cyclase (GGDEF) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="YP_004608605.1"
                     /db_xref="GI:337264550"
                     /db_xref="GeneID:10823817"
                     /translation="MPAVSNPKRTPVFRLLTIASSGIGSFVLGIWGLKYGLGGGFAGI
                     SADMMVAIMAALCALAASVAAMSFFAGVDESADFVFNETHFDKLTGLLGRPAMVGKIA
                     EAACTTSRTGEPVFLIDIDIDRFKQINDAIGYTQGDELIRAFTKRLQSCVPARALIGR
                     IGAGEFAVLLPDHQIPGTMESMVERLIDEMMEPYELSSHQQSVSLSVGIVAMPKDGVD
                     PVLILRRSNLALQNARASGVGNWSVFDSEMGRVADYRQWVESELHTAFERGDFDLHYQ
                     PQLDLPTGRIVGYEALIRWNHPERGMIPPMEFIQIAEETGMINPIGEWVLRKACSDAR
                     HLPDDCFVAVNISPVQFMTKDFVGIVRDAMRATGIKPSRLELEVTETAMMQDRDRAAA
                     ILKELAEMGISVAVDDFGTGYSNLSYLIDFSFGKLKIDRSFVSRIDTDSSSGAVVSTI
                     VGLSRALGVSIIAEGVETESQATLLRAAGCEVVQGYLFGRPAPLKFSVTDAHATDEVR
                     RVANLH"
     misc_feature    12017..12478
                     /locus_tag="Mesop_0013"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(12128..12130,12257..12259)
                     /locus_tag="Mesop_0013"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(12143..12145,12152..12157,12167..12169,12179..12181,
                     12245..12247,12251..12262)
                     /locus_tag="Mesop_0013"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(12233..12235,12320..12322)
                     /locus_tag="Mesop_0013"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    12545..13249
                     /locus_tag="Mesop_0013"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(13323..14336)
                     /locus_tag="Mesop_0014"
                     /db_xref="GeneID:10823818"
     CDS             complement(13323..14336)
                     /locus_tag="Mesop_0014"
                     /note="COGs: COG2813 16S RNA G1207 methylase RsmC;
                     InterPro IPR002052:IPR007848;
                     KEGG: mlo:mlr5563 ribosomal RNA small subunit
                     methyltransferase C;
                     PFAM: methyltransferase small;
                     SPTR: Methyltransferase small;
                     PFAM: Methyltransferase small domain"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase small"
                     /protein_id="YP_004608606.1"
                     /db_xref="GI:337264551"
                     /db_xref="GeneID:10823818"
                     /translation="MSTEALKTLFHPFEVEALPLPRKDERMLFLGAEPGLRLPQGFEA
                     ALHVVQGFRPHFRALQAAKFTVTPQPEGDGFDAALVLAGRHRGQNELRIAEALERVVP
                     GGLIVVAGGKDDGIASLRKRIDELVPLDGHMPKYHGVAFWLRRPADPAAAQELRAANP
                     VLLVEGRFHTAPGMFSFDRIDAGSKLLVDNLPGDLRGNIADFCAGWGYVAAEVASRSP
                     GITALDLYEADFAALEAAKRNLGAAALVPGFFWLDLLAEPVERRYDAVVMNPPFHRAR
                     AAEPEIGAGMIHAAGKALKPGGRLFMVANRQLPYEPVLKAAFSSHAELARDGMFKVLS
                     ARR"
     misc_feature    complement(13326..14207)
                     /locus_tag="Mesop_0014"
                     /note="16S RNA G1207 methylase RsmC [Translation,
                     ribosomal structure and biogenesis]; Region: RsmC;
                     COG2813"
                     /db_xref="CDD:225370"
     misc_feature    complement(13428..13745)
                     /locus_tag="Mesop_0014"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(13530..13532,13584..13586,13662..13667,
                     13713..13733))
                     /locus_tag="Mesop_0014"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(14406..16553)
                     /locus_tag="Mesop_0015"
                     /db_xref="GeneID:10823819"
     CDS             complement(14406..16553)
                     /locus_tag="Mesop_0015"
                     /EC_number="2.7.7.8"
                     /note="COGs: COG1185 Polyribonucleotide
                     nucleotidyltransferase (polynucleotide phosphorylase);
                     InterProIPR012162:IPR001247:IPR015847:IPR015848:IPR
                     018111:IPR003029:IPR004087:IPR004088;
                     KEGG: mlo:mlr5562 polynucleotide
                     phosphorylase/polyadenylase;
                     PFAM: 3' exoribonuclease; Exoribonuclease, phosphorolytic
                     domain 2; Polynucleotide phosphorylase, phosphorolytic
                     RNA-binding; K Homology, type 1, subgroup; RNA binding S1
                     domain protein;
                     PRIAM: Polyribonucleotide nucleotidyltransferase;
                     SMART: KH domain protein;
                     SPTR: Polyribonucleotide nucleotidyltransferase;
                     TIGRFAM: polyribonucleotide nucleotidyltransferase;
                     PFAM: KH domain; S1 RNA binding domain; 3' exoribonuclease
                     family, domain 1; Polyribonucleotide
                     nucleotidyltransferase, RNA binding domain; 3'
                     exoribonuclease family, domain 2;
                     TIGRFAM: polyribonucleotide nucleotidyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="YP_004608607.1"
                     /db_xref="GI:337264552"
                     /db_xref="GeneID:10823819"
                     /translation="MFNHHKVEIEWGGRPLILETGKIARQADGAVLATYGETKVLATV
                     VSMKEPKPGLDFFPLTVNYQEKTYAAGKIPGGYFKREGRPSEKETLVSRLIDRPIRPL
                     FADGYKNDTQIVVTVVQHDLENDPDILSIVATSAALTLSGVPFMGPVGGARVGYINGE
                     YVLNPHIDEMQESKLDLVVAGTADAVLMVESEAKELGEELMLGAVMFGHRGFQPVIDA
                     IIKLAEVAAKEPRDFTAPDYSVLEAEMLKIVGDELSNAYKNVDKQKRYAAVDAVKAKV
                     KAAFAPAEGDEAKYTSEQIGSVFKELQAKVVRWNILDTGSRIDGRDLKTVRKIVSEVG
                     VLPRTHGSALFTRGETQALVVATLGTGEDEQYVDSLTGMYKEKFLLHYNFPPYSVGET
                     GRMGSPGRREIGHGKLAWRAIRPMLPSADQFPYTLRVVSEITESNGSSSMATVCGTSL
                     ALMDAGVPLAKPVAGIAMGLIKEGERFAVLSDILGDEDHLGDMDFKVAGTTSGITSLQ
                     MDIKIEGITEEIMKIALDQAKDGRQHILGEMAHALTGARPELGEFAPRIEVMHIPTDK
                     IRDVIGSGGKVIREIVEKTGAKINIEDDGTVKIASSNAKEIEAAKKWIHTIVAEPEVG
                     EIYEGTVVKTADFGAFVNFFGPRDGLVHISQLANERVAKTSDVVKEGDKVWVKLMGFD
                     ERGKVRLSMKVVDQASGKEIVRDKKSEGEEDAA"
     misc_feature    complement(14469..16553)
                     /locus_tag="Mesop_0015"
                     /note="polynucleotide phosphorylase/polyadenylase;
                     Provisional; Region: PRK11824"
                     /db_xref="CDD:236995"
     misc_feature    complement(15855..16541)
                     /locus_tag="Mesop_0015"
                     /note="Polyribonucleotide nucleotidyltransferase, repeat
                     1; Region: RNase_PH_PNPase_1; cd11363"
                     /db_xref="CDD:206768"
     misc_feature    complement(order(16437..16439,16446..16448,16452..16454,
                     16458..16460,16488..16490,16497..16499,16503..16505,
                     16530..16532,16536..16538))
                     /locus_tag="Mesop_0015"
                     /note="RNase E interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206768"
     misc_feature    complement(order(16188..16202,16212..16214,16218..16220,
                     16224..16226,16299..16301,16311..16325,16332..16343,
                     16347..16358,16362..16364,16368..16370,16413..16415,
                     16419..16421,16425..16427,16431..16433,16458..16460,
                     16473..16490))
                     /locus_tag="Mesop_0015"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206768"
     misc_feature    complement(15588..15833)
                     /locus_tag="Mesop_0015"
                     /note="Polyribonucleotide nucleotidyltransferase, RNA
                     binding domain; Region: PNPase; pfam03726"
                     /db_xref="CDD:252128"
     misc_feature    complement(14925..15581)
                     /locus_tag="Mesop_0015"
                     /note="Polyribonucleotide nucleotidyltransferase, repeat
                     2; Region: RNase_PH_PNPase_2; cd11364"
                     /db_xref="CDD:206769"
     misc_feature    complement(order(14925..14930,14940..14942,14952..14954,
                     14964..14966,15543..15545,15552..15581))
                     /locus_tag="Mesop_0015"
                     /note="RNase E interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206769"
     misc_feature    complement(order(15246..15254,15258..15260,15264..15266,
                     15270..15272,15360..15362,15366..15368,15375..15383,
                     15387..15398,15405..15407,15411..15413,15459..15467,
                     15477..15485,15489..15491,15495..15497,15507..15512,
                     15534..15548,15558..15560,15564..15566))
                     /locus_tag="Mesop_0015"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206769"
     misc_feature    complement(order(15024..15026,15030..15032,15066..15068,
                     15072..15074,15090..15092,15231..15239,15339..15341,
                     15351..15353,15402..15404,15408..15410))
                     /locus_tag="Mesop_0015"
                     /note="active site"
                     /db_xref="CDD:206769"
     misc_feature    complement(14712..14891)
                     /locus_tag="Mesop_0015"
                     /note="Polynucleotide phosphorylase (PNPase) K homology
                     RNA-binding domain (KH). PNPase is a polyribonucleotide
                     nucleotidyl transferase that degrades mRNA in prokaryotes
                     and plant chloroplasts. The C-terminal region of PNPase
                     contains domains homologous to...; Region: PNPase_KH;
                     cd02393"
                     /db_xref="CDD:239086"
     misc_feature    complement(order(14781..14792,14805..14810,14817..14822,
                     14829..14843,14847..14855,14859..14861))
                     /locus_tag="Mesop_0015"
                     /note="putative nucleic acid binding region [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239086"
     misc_feature    complement(14829..14840)
                     /locus_tag="Mesop_0015"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239086"
     misc_feature    complement(14481..14684)
                     /locus_tag="Mesop_0015"
                     /note="S1_PNPase: Polynucleotide phosphorylase (PNPase),
                     ), S1-like RNA-binding domain. PNPase  is a
                     polyribonucleotide nucleotidyl transferase that degrades
                     mRNA. It is a trimeric multidomain protein. The C-terminus
                     contains the S1 domain which binds ssRNA; Region:
                     S1_PNPase; cd04472"
                     /db_xref="CDD:239918"
     misc_feature    complement(order(14598..14600,14604..14606,14634..14636,
                     14658..14660))
                     /locus_tag="Mesop_0015"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239918"
     misc_feature    complement(14538..14543)
                     /locus_tag="Mesop_0015"
                     /note="domain interface; other site"
                     /db_xref="CDD:239918"
     gene            complement(16831..17100)
                     /locus_tag="Mesop_0016"
                     /db_xref="GeneID:10823820"
     CDS             complement(16831..17100)
                     /locus_tag="Mesop_0016"
                     /note="COGs: COG0184 Ribosomal protein S15P/S13E;
                     InterPro IPR000589:IPR005290;
                     KEGG: mlo:msr5561 30S ribosomal protein S15;
                     PFAM: ribosomal protein S15;
                     SPTR: 30S ribosomal protein S15;
                     TIGRFAM: ribosomal protein S15;
                     PFAM: Ribosomal protein S15;
                     TIGRFAM: ribosomal protein S15, bacterial/organelle"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="YP_004608608.1"
                     /db_xref="GI:337264553"
                     /db_xref="GeneID:10823820"
                     /translation="MSITAERKQELMGEFATAKGDTGSPEVQVAILSERIKNLTDHFK
                     DHKKDNHSRRGLLALVSQRRSLLDYLKRKDDARYQTLIEKLGLRR"
     misc_feature    complement(16843..17082)
                     /locus_tag="Mesop_0016"
                     /note="Ribosomal protein S15 (prokaryotic)_S13
                     (eukaryotic) binds the central domain of 16S rRNA and is
                     required for assembly of the small ribosomal subunit and
                     for intersubunit association, thus representing a key
                     element in the assembly of the whole ribosome; Region:
                     Ribosomal_S15p_S13e; cd00353"
                     /db_xref="CDD:238213"
     misc_feature    complement(order(16894..16896,16906..16908,16945..16950,
                     16954..16959,16963..16965,16975..16977,16984..16986,
                     16996..16998,17017..17019,17026..17028,17077..17079))
                     /locus_tag="Mesop_0016"
                     /note="16S/18S rRNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238213"
     misc_feature    complement(order(16849..16851,16861..16863,16981..16983,
                     16990..16992,16999..17004,17011..17013))
                     /locus_tag="Mesop_0016"
                     /note="S13e-L30e interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:238213"
     misc_feature    complement(order(16843..16848,16909..16911,16921..16923))
                     /locus_tag="Mesop_0016"
                     /note="25S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238213"
     gene            complement(17282..18376)
                     /locus_tag="Mesop_0017"
                     /db_xref="GeneID:10823821"
     CDS             complement(17282..18376)
                     /locus_tag="Mesop_0017"
                     /note="COGs: COG0598 Mg2+ and Co2+ transporter;
                     InterPro IPR002523:IPR004488;
                     KEGG: mlo:mlr5559 divalent cation transport-related
                     protein;
                     PFAM: Mg2 transporter protein CorA family protein;
                     SPTR: Magnesium and cobalt transport protein CorA;
                     TIGRFAM: magnesium and cobalt transport protein CorA;
                     PFAM: CorA-like Mg2+ transporter protein;
                     TIGRFAM: magnesium Mg(2+) and cobalt Co(2+) transport
                     protein (corA)"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium and cobalt transport protein CorA"
                     /protein_id="YP_004608609.1"
                     /db_xref="GI:337264554"
                     /db_xref="GeneID:10823821"
                     /translation="MAKAEAVKKRTPVKTRRPPVGASPGTLIADPAARRSELRLTMIS
                     PQKYKTIENASIDDVEANCHKWPVIWLDCTGLANIQLIEEIGRIFNLHPLALEDVVNT
                     GQRPKVDFFEDHAFVVVRMIDDVTSHRYEQIGLFVGENFVVTFQEREGDPFDPVRKRI
                     ESSAPNRLRARGADYLAYALIDAIVDSYFPPIEAAGDLVDSIEDEMLHSPHKHQMRQL
                     HELRRDANVLKGVLWPMRDALATLIRNDVPYVKAETKVFLNDTLDHSLRLIELVETQR
                     DMLTGLIEMHLSLSQARTNDVISYLTIVSVIFMPLTFLVGVWGMNFDPESSPWNMPEL
                     KSYYGYPVSLLFMAVVAVGLIAFFKWKKWL"
     misc_feature    complement(17285..18175)
                     /locus_tag="Mesop_0017"
                     /note="Thermotoga maritima CorA_like subfamily; Region:
                     TmCorA-like_1; cd12828"
                     /db_xref="CDD:213362"
     misc_feature    complement(17297..18175)
                     /locus_tag="Mesop_0017"
                     /note="CorA-like Mg2+ transporter protein; Region: CorA;
                     pfam01544"
                     /db_xref="CDD:250695"
     misc_feature    complement(order(17294..17296,17303..17305,17336..17338,
                     17345..17350,17357..17362,17411..17434,17438..17455,
                     17459..17467,17471..17509,17513..17536,17543..17551,
                     17555..17560,17564..17569,17576..17581,17585..17590,
                     17597..17602,17606..17611,17621..17623,17687..17689,
                     17699..17701,17708..17713,17720..17722,17729..17734,
                     17753..17758,17768..17770,17777..17782,17798..17800,
                     17810..17812,17819..17821,17843..17845,17852..17854,
                     17879..17881,17900..17902,17912..17914,18050..18052,
                     18056..18058,18062..18067,18083..18088,18095..18097))
                     /locus_tag="Mesop_0017"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213362"
     misc_feature    complement(order(17597..17599,17831..17833,18086..18088))
                     /locus_tag="Mesop_0017"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213362"
     misc_feature    complement(order(17597..17599,18083..18085))
                     /locus_tag="Mesop_0017"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213362"
     misc_feature    complement(order(17852..17854,17900..17902))
                     /locus_tag="Mesop_0017"
                     /note="Cl binding site [ion binding]; other site"
                     /db_xref="CDD:213362"
     misc_feature    complement(17525..17527)
                     /locus_tag="Mesop_0017"
                     /note="aspartate ring; other site"
                     /db_xref="CDD:213362"
     misc_feature    complement(order(17291..17302,17480..17482,17498..17500))
                     /locus_tag="Mesop_0017"
                     /note="basic sphincter; other site"
                     /db_xref="CDD:213362"
     misc_feature    complement(order(17474..17476,17483..17485))
                     /locus_tag="Mesop_0017"
                     /note="putative hydrophobic gate; other site"
                     /db_xref="CDD:213362"
     misc_feature    complement(order(17420..17425,17429..17431))
                     /locus_tag="Mesop_0017"
                     /note="periplasmic entrance; other site"
                     /db_xref="CDD:213362"
     gene            complement(18421..19428)
                     /locus_tag="Mesop_0018"
                     /db_xref="GeneID:10823822"
     CDS             complement(18421..19428)
                     /locus_tag="Mesop_0018"
                     /note="COGs: COG0130 Pseudouridine synthase;
                     InterPro IPR002501:IPR014780;
                     KEGG: mlo:mlr5558 tRNA pseudouridine synthase B;
                     PFAM: pseudouridylate synthase TruB domain protein;
                     SPTR: tRNA pseudouridine synthase B;
                     TIGRFAM: tRNA pseudouridine synthase B;
                     PFAM: Pseudouridine synthase II TruB, C-terminal; TruB
                     family pseudouridylate synthase (N terminal domain);
                     TIGRFAM: tRNA pseudouridine 55 synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="YP_004608610.1"
                     /db_xref="GI:337264555"
                     /db_xref="GeneID:10823822"
                     /translation="MARRGKKKGRPVSGWVVLDKPVGMGSTEAVSKIKWLFQAEKAGH
                     AGTLDPLASGMLPIALGEATKTVPYVQDGAKVYRFTVAWGQERSTDDLEGPVTKEADQ
                     RPSEAEVRALLPKYTGVIMQTPPQFSAIKIAGERAYDLAREGETVDIPAREIEIGRLD
                     IVEHGTDQTVFEVECGKGTYVRSLARDMGRDLGCFGHISELRRVEVEPFTPEDFVTVA
                     ELEAARFGAPGEDVVGEDIEGEGKSEAADAVDVVEAPVDFGAIDALLVDTSAALDCLP
                     QIAISDDAATKIRLGNPVIIRGRDAPVEAEEACATARGKLVAIGAIEQGMFKPKRVFA
                     G"
     misc_feature    complement(18427..19428)
                     /locus_tag="Mesop_0018"
                     /note="tRNA pseudouridine synthase B; Provisional; Region:
                     truB; PRK05389"
                     /db_xref="CDD:235442"
     misc_feature    complement(18760..19389)
                     /locus_tag="Mesop_0018"
                     /note="Pseudouridine synthase, Escherichia coli TruB like;
                     Region: PseudoU_synth_EcTruB; cd02573"
                     /db_xref="CDD:211339"
     misc_feature    complement(order(18820..18822,18883..18900,18973..18975,
                     19036..19050,19198..19200,19204..19206,19216..19218,
                     19225..19230,19237..19239,19279..19293,19297..19305,
                     19339..19341,19348..19350,19354..19356))
                     /locus_tag="Mesop_0018"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:211339"
     misc_feature    complement(order(18883..18885,19282..19293))
                     /locus_tag="Mesop_0018"
                     /note="active site"
                     /db_xref="CDD:211339"
     misc_feature    complement(18430..18603)
                     /locus_tag="Mesop_0018"
                     /note="Pseudouridine synthase II TruB, C-terminal; Region:
                     TruB-C_2; pfam09157"
                     /db_xref="CDD:255208"
     gene            complement(19428..19898)
                     /locus_tag="Mesop_0019"
                     /db_xref="GeneID:10823823"
     CDS             complement(19428..19898)
                     /locus_tag="Mesop_0019"
                     /note="COGs: COG0858 Ribosome-binding factor A;
                     InterPro IPR020053:IPR000238;
                     KEGG: mlo:mlr5557 ribosome-binding factor A;
                     PFAM: ribosome-binding factor A;
                     SPTR: Ribosome-binding factor A;
                     TIGRFAM: ribosome-binding factor A;
                     PFAM: Ribosome-binding factor A;
                     TIGRFAM: ribosome-binding factor A"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="YP_004608611.1"
                     /db_xref="GI:337264556"
                     /db_xref="GeneID:10823823"
                     /translation="MPRSTTSGPSQRMLRVGEQVRHALSETLQRGDIIDPLIENSVVS
                     VSEVRMSPDLKIATAFVSPLGAKDAEAVIEALNKHAKFVRGRVSGALRQMKYMPEFRF
                     RLDTSFDNFARINDLLKSPEVARDLDADDDKAQEDKAQEDRAKDDKAKEGKDSE"
     misc_feature    complement(19515..19880)
                     /locus_tag="Mesop_0019"
                     /note="ribosome-binding factor A; Validated; Region: rbfA;
                     PRK00521"
                     /db_xref="CDD:234787"
     gene            complement(20038..22620)
                     /locus_tag="Mesop_0020"
                     /db_xref="GeneID:10823824"
     CDS             complement(20038..22620)
                     /locus_tag="Mesop_0020"
                     /note="COGs: COG0532 Translation initiation factor 2
                     (IF-2; GTPase);
                     InterProIPR000178:IPR013575:IPR006847:IPR000795:IPR
                     004161:IPR005225;
                     KEGG: mlo:mlr5554 translation initiation factor IF-2;
                     PFAM: protein synthesis factor GTP-binding; translation
                     initiation factor IF-2 domain protein; Initiation factor 2
                     associated domain protein ; elongation factor Tu domain 2
                     protein;
                     SPTR: Translation initiation factor IF-2;
                     TIGRFAM: translation initiation factor IF-2; small
                     GTP-binding protein;
                     PFAM: Elongation factor Tu domain 2;
                     Translation-initiation factor 2; Translation initiation
                     factor IF-2, N-terminal region; Elongation factor Tu GTP
                     binding domain; Bacterial translation initiation factor
                     IF-2 associated region;
                     TIGRFAM: small GTP-binding protein domain; translation
                     initiation factor IF-2"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="YP_004608612.1"
                     /db_xref="GI:337264557"
                     /db_xref="GeneID:10823824"
                     /translation="MSDTKSGDDKTLSVTPKKTLTLKRPGMEQGTVRQNFSHGRTKSV
                     VVETKKRKFSLPGDKPEPVAAAPAPVFTPKPAAVVAAPPVVQEAPKAPPPPPPPVERS
                     GMVLNELSRSEMEARRRALEGSKVREVEDRQRAAEEAKRRAEDEERRKREREESARRQ
                     AEEEARLQTEAESRRRAEEEARRRAPLAAELATADEEEEVKPKRTGAGAPVRRPVTPE
                     VARPAKPTKGEEDRRRGKLTLNSALTDEDARARSLSSMRRRQEKFKRAMHNEPREKVM
                     REVILPETITIQELAQRMSERAVDVVKFFMKQGQILKPGDVIDADTAELVATEFGHTV
                     RRVAESDIEEGLFNIADNAEDLVSRPPVVTIMGHVDHGKTSLLDAIRNANVVSGEAGG
                     ITQHIGAYQVEKNGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIE
                     SISHAKAAGVPIIVAINKIDKHDADPQKVRSELLRHEVFVESMGGEVLDVEVSATKGT
                     NLDKLLEAILLQAEILDLKANPDRTAEGVVIEAQLDKGRGPVATVLVQTGTLMPGDIL
                     VAGNEWGRVRALVNDRGEQIKEAPPAMPVEVLGLQGTPQAGDRFAVVNNEARAREITE
                     YRQRLAREKAVARHAGQRGSLEQMMSQLQTSGLKEFPLVIKGDVQGSIEAINAALDKL
                     GTDEVRARIVHAGAGAITESDVSLAETSGAAIIGFNVRANVQARAAAAAAGIEIRYYS
                     IIYNLVDDVKAALSGLLSPERRETFIGNAEILEIFDITKVGKIAGCRVTEGKVERGAG
                     VRLIRDNVVIHEGTLKTLKRFKDEVSEVPGGQECGMAFQNYEDMRVGDVIECFRVEMV
                     TRTL"
     misc_feature    complement(22447..22575)
                     /locus_tag="Mesop_0020"
                     /note="Bacterial translation initiation factor IF-2
                     associated region; Region: IF2_assoc; pfam08364"
                     /db_xref="CDD:254758"
     misc_feature    complement(20044..22236)
                     /locus_tag="Mesop_0020"
                     /note="translation initiation factor IF-2; Validated;
                     Region: infB; PRK05306"
                     /db_xref="CDD:235401"
     misc_feature    complement(21622..21777)
                     /locus_tag="Mesop_0020"
                     /note="Translation initiation factor IF-2, N-terminal
                     region; Region: IF2_N; pfam04760"
                     /db_xref="CDD:252785"
     misc_feature    complement(21049..21540)
                     /locus_tag="Mesop_0020"
                     /note="Initiation Factor 2 (IF2)/ eukaryotic Initiation
                     Factor 5B (eIF5B) family; Region: IF2_eIF5B; cd01887"
                     /db_xref="CDD:206674"
     misc_feature    complement(21499..21522)
                     /locus_tag="Mesop_0020"
                     /note="G1 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    complement(order(21178..21180,21190..21192,21295..21300,
                     21367..21372,21424..21429,21475..21480,21487..21489,
                     21496..21501,21511..21513,21517..21519))
                     /locus_tag="Mesop_0020"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206674"
     misc_feature    complement(order(21106..21114,21208..21213,21217..21222,
                     21367..21369,21496..21516))
                     /locus_tag="Mesop_0020"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206674"
     misc_feature    complement(21427..21447)
                     /locus_tag="Mesop_0020"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206674"
     misc_feature    complement(21439..21441)
                     /locus_tag="Mesop_0020"
                     /note="G2 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    complement(21373..21384)
                     /locus_tag="Mesop_0020"
                     /note="G3 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    complement(21322..21378)
                     /locus_tag="Mesop_0020"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206674"
     misc_feature    complement(21211..21222)
                     /locus_tag="Mesop_0020"
                     /note="G4 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    complement(21106..21114)
                     /locus_tag="Mesop_0020"
                     /note="G5 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    complement(20737..21021)
                     /locus_tag="Mesop_0020"
                     /note="This family represents the domain II of bacterial
                     Initiation Factor 2 (IF2) and its eukaryotic mitochondrial
                     homologue mtIF2. IF2, the largest initiation factor is an
                     essential GTP binding protein. In E. coli three natural
                     forms of IF2 exist in the cell; Region: IF2_mtIF2_II;
                     cd03702"
                     /db_xref="CDD:239673"
     misc_feature    complement(20368..20691)
                     /locus_tag="Mesop_0020"
                     /note="Translation-initiation factor 2; Region: IF-2;
                     pfam11987"
                     /db_xref="CDD:256778"
     misc_feature    complement(20071..20322)
                     /locus_tag="Mesop_0020"
                     /note="mtIF2_IVc: this family represents the C2 subdomain
                     of domain IV of mitochondrial translation initiation
                     factor 2 (mtIF2) which adopts a beta-barrel fold
                     displaying a high degree of structural similarity with
                     domain II of the translation elongation factor...; Region:
                     mtIF2_IVc; cd03692"
                     /db_xref="CDD:239663"
     gene            complement(22617..23267)
                     /locus_tag="Mesop_0021"
                     /db_xref="GeneID:10823825"
     CDS             complement(22617..23267)
                     /locus_tag="Mesop_0021"
                     /note="COGs: COG2740 nucleic-acid-binding protein
                     implicated in transcription termination;
                     InterPro IPR007393;
                     KEGG: mlo:mlr5553 hypothetical protein;
                     PFAM: protein of unknown function DUF448;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF448)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608613.1"
                     /db_xref="GI:337264558"
                     /db_xref="GeneID:10823825"
                     /translation="MNDRTCIVTRKQAEPDELIRFVVGPDSAVVPDLKRNLPGRGCWV
                     SADRLHIEKAAAKNLFARAFKAQVVVPPDLGGMVDGLLSRSALGMLGLARKAGAISLG
                     ATKVESAVRGGLALFVLHATEASDDGVRKISQARRATVHIGGPSILAYKLFSEAELSL
                     ALGGTNVIHAAVLAGDAGKAVQKRMVALDRYRGGTPDDLAMLAAVADEDDAAEDME"
     misc_feature    complement(22665..23267)
                     /locus_tag="Mesop_0021"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09190"
                     /db_xref="CDD:236401"
     misc_feature    complement(23034..23264)
                     /locus_tag="Mesop_0021"
                     /note="Ylxr homologs; group of conserved hypothetical
                     bacterial proteins of unknown function; structure revealed
                     putative RNA binding cleft; proteins are encoded by an
                     operon that includes other proteins involved in
                     transcription and/or translation; Region: YlxR; cd00279"
                     /db_xref="CDD:238173"
     misc_feature    complement(order(23139..23141,23208..23210,23256..23258))
                     /locus_tag="Mesop_0021"
                     /note="putative RNA binding cleft [nucleotide binding];
                     other site"
                     /db_xref="CDD:238173"
     misc_feature    complement(22731..23003)
                     /locus_tag="Mesop_0021"
                     /note="Ribosomal protein L7Ae/L30e/S12e/Gadd45 family;
                     Region: Ribosomal_L7Ae; cl00600"
                     /db_xref="CDD:260522"
     gene            complement(23306..24901)
                     /locus_tag="Mesop_0022"
                     /db_xref="GeneID:10823826"
     CDS             complement(23306..24901)
                     /locus_tag="Mesop_0022"
                     /note="COGs: COG0195 Transcription elongation factor;
                     InterProIPR013735:IPR003029:IPR018111:IPR004087:IPR
                     004088:IPR010213:IPR010214;
                     KEGG: mlo:mlr5551 transcription elongation factor NusA;
                     PFAM: NusA domain protein; RNA binding S1 domain protein;
                     K Homology, type 1, subgroup;
                     SPTR: NusA antitermination factor;
                     TIGRFAM: transcription termination factor NusA;
                     PFAM: NusA N-terminal domain; S1 RNA binding domain;
                     TIGRFAM: transcription termination factor NusA;
                     transcription termination factor NusA, C-terminal
                     duplication"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor NusA"
                     /protein_id="YP_004608614.1"
                     /db_xref="GI:337264559"
                     /db_xref="GeneID:10823826"
                     /translation="MVVSANRLELLQIADAVAREKSIDKSIVIAAMADAIQKAARSRY
                     GQETNIRADINPNTGEMKLQRLMEVVEKVDDYATQIAISSARERNPDAQLGDFIAEQL
                     PPMDFGRIAAQSAKQVIVQKVREAERDRQYDEYKDRIGEIVNGTVKRVEYGNVIVDLG
                     RGEAIIRRDELIPRENYKYGDRVRAYVYDVRREQRGPQIFLSRTHPQFMAKLFTMEVP
                     EIYDGIIEIKSVARDPGSRAKIAVISRDSSIDPVGACVGMRGSRVQAVVGELQGEKID
                     IIPWSPSAASFIVNALQPAEVAKVVLDEDAERIEVVVPDDQLSLAIGRRGQNVRLASQ
                     LTGWDIDILTEAEESERRQKEFVERSALFMEALDVDEMVGQVLASEGFTSVEEVAYVD
                     AGEIASIDGFDEDTASEIQTRAREYLEKIEAEHDDKRKALGVSDELREIPGITTAMMV
                     TLGEDGVKTIEDFAGYAADDLTGWKERKDGETKVYPGVLANHGVSRADAEQMVLNARL
                     KAGWITEDELAAEEAPADEAVGA"
     misc_feature    complement(23465..24886)
                     /locus_tag="Mesop_0022"
                     /note="transcription elongation factor NusA; Validated;
                     Region: nusA; PRK09202"
                     /db_xref="CDD:236410"
     misc_feature    complement(24512..24877)
                     /locus_tag="Mesop_0022"
                     /note="NusA N-terminal domain; Region: NusA_N; pfam08529"
                     /db_xref="CDD:254856"
     misc_feature    complement(24293..24493)
                     /locus_tag="Mesop_0022"
                     /note="S1_NusA: N-utilizing substance A protein (NusA),
                     S1-like RNA-binding domain. S1-like RNA-binding domains
                     are found in a wide variety of RNA-associated proteins.
                     NusA is a transcription elongation factor containing an
                     N-terminal catalytic domain and three...; Region: S1_NusA;
                     cd04455"
                     /db_xref="CDD:239902"
     misc_feature    complement(order(24401..24403,24407..24409,24434..24436,
                     24458..24460))
                     /locus_tag="Mesop_0022"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239902"
     misc_feature    complement(order(24308..24310,24407..24409,24413..24415,
                     24440..24442,24452..24454))
                     /locus_tag="Mesop_0022"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239902"
     misc_feature    complement(24068..24289)
                     /locus_tag="Mesop_0022"
                     /note="NusA_K homology RNA-binding domain (KH). NusA is an
                     essential multifunctional transcription elongation factor
                     that is universally conserved among prokaryotes and
                     archaea. NusA anti-termination function plays an important
                     role in the expression of...; Region: NusA_KH; cd02134"
                     /db_xref="CDD:239049"
     misc_feature    complement(24122..24133)
                     /locus_tag="Mesop_0022"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239049"
     misc_feature    complement(23873..24043)
                     /locus_tag="Mesop_0022"
                     /note="NusA_K homology RNA-binding domain (KH). NusA is an
                     essential multifunctional transcription elongation factor
                     that is universally conserved among prokaryotes and
                     archaea. NusA anti-termination function plays an important
                     role in the expression of...; Region: NusA_KH; cd02134"
                     /db_xref="CDD:239049"
     misc_feature    complement(23924..23935)
                     /locus_tag="Mesop_0022"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239049"
     misc_feature    complement(23648..23797)
                     /locus_tag="Mesop_0022"
                     /note="transcription termination factor NusA, C-terminal
                     duplication; Region: nusA_Cterm_rpt; TIGR01954"
                     /db_xref="CDD:131009"
     misc_feature    complement(23381..23608)
                     /locus_tag="Mesop_0022"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     gene            complement(24951..25598)
                     /locus_tag="Mesop_0023"
                     /db_xref="GeneID:10823827"
     CDS             complement(24951..25598)
                     /locus_tag="Mesop_0023"
                     /note="InterPro IPR003728:IPR020790;
                     KEGG: mlo:mlr5550 hypothetical protein;
                     PFAM: protein of unknown function DUF150;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Uncharacterised BCR, YhbC family COG0779"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608615.1"
                     /db_xref="GI:337264560"
                     /db_xref="GeneID:10823827"
                     /translation="MTAMTSEGDDRIIRESGIDARIALIIQPVLRGIGFRLVRVHLSG
                     QNGLTLQIMAEREDGTMTVEDCEEVSRAVSPALDVDDPIEKAYHLEVSSPGIDRPLVR
                     KSDFVTWTGHLVKMETSVVVADRKRFKGKIAEAGENDVLIERDKAAYGEEPTVRVPYD
                     AISETRLILTDDLIRDALSKDNRARKEAKKRRGEPDDDVPEGTEADATEEHEQES"
     misc_feature    complement(<25203..25547)
                     /locus_tag="Mesop_0023"
                     /note="Sm and related proteins; Region: Sm_like; cl00259"
                     /db_xref="CDD:260307"
     misc_feature    complement(25086..25316)
                     /locus_tag="Mesop_0023"
                     /note="Bacillus subtilis YxlS-like, C-terminal domain;
                     Region: YlxS_C; cd01734"
                     /db_xref="CDD:212481"
     misc_feature    complement(order(25101..25118,25122..25127,25131..25139,
                     25176..25178,25197..25199,25215..25217,25221..25223,
                     25242..25244,25248..25250))
                     /locus_tag="Mesop_0023"
                     /note="putative oligomer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212481"
     misc_feature    complement(order(25125..25127,25185..25187,25191..25193))
                     /locus_tag="Mesop_0023"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:212481"
     gene            25959..26123
                     /locus_tag="Mesop_0024"
                     /db_xref="GeneID:10823828"
     CDS             25959..26123
                     /locus_tag="Mesop_0024"
                     /note="KEGG: mlo:msl5548 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608616.1"
                     /db_xref="GI:337264561"
                     /db_xref="GeneID:10823828"
                     /translation="MGNRRLLSALGDLFTAFGGAVAASRAVEAGRKPRADDLRKVDMD
                     PAIFNRIGRF"
     sig_peptide     25959..26024
                     /locus_tag="Mesop_0024"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            complement(26153..26854)
                     /locus_tag="Mesop_0025"
                     /db_xref="GeneID:10823829"
     CDS             complement(26153..26854)
                     /locus_tag="Mesop_0025"
                     /note="COGs: COG0220 S-adenosylmethionine-dependent
                     methyltransferase;
                     InterPro IPR003358;
                     KEGG: mlo:mlr5547 tRNA (guanine-N(7)-)-methyltransferase;
                     PFAM: putative methyltransferase;
                     SPTR: tRNA (Guanine-N(7)-)-methyltransferase;
                     PFAM: Putative methyltransferase;
                     TIGRFAM: tRNA (guanine-N(7)-)-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methyltransferase"
                     /protein_id="YP_004608617.1"
                     /db_xref="GI:337264562"
                     /db_xref="GeneID:10823829"
                     /translation="MSPDDRPSRATEAFFGRRRGKPVRPQQAAALESGLGTYRLDLTA
                     EAPSELRTLFEADVSAVRLEIGFGGGEHLLHRAIEAPTTGFVGVEPFVNGMAKMMMAV
                     RQRPLANLRVFDDDATRLLDWLPPASLDGIDLLYPDPWPKKKHWKRRFVSAVNLDRFA
                     RVLKPGSKFRFASDIDTYVNWTLLHCRAHGAFAWQAADAGDWNSPYAGWPGTRYEAKA
                     IREGRRPAYLTFVRT"
     misc_feature    complement(26159..26827)
                     /locus_tag="Mesop_0025"
                     /note="Predicted S-adenosylmethionine-dependent
                     methyltransferase [General function prediction only];
                     Region: COG0220"
                     /db_xref="CDD:223298"
     gene            complement(26881..28146)
                     /locus_tag="Mesop_0026"
                     /db_xref="GeneID:10823830"
     CDS             complement(26881..28146)
                     /locus_tag="Mesop_0026"
                     /EC_number="2.5.1.6"
                     /note="COGs: COG0192 S-adenosylmethionine synthetase;
                     InterPro IPR002133;
                     KEGG: mlo:mlr5545 S-adenosylmethionine synthetase;
                     PFAM: S-adenosylmethionine synthetase;
                     PRIAM: Methionine adenosyltransferase;
                     SPTR: S-adenosylmethionine synthetase;
                     TIGRFAM: S-adenosylmethionine synthetase;
                     PFAM: S-adenosylmethionine synthetase, C-terminal domain;
                     S-adenosylmethionine synthetase, N-terminal domain;
                     S-adenosylmethionine synthetase, central domain;
                     TIGRFAM: S-adenosylmethionine synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="YP_004608618.1"
                     /db_xref="GI:337264563"
                     /db_xref="GeneID:10823830"
                     /translation="MTRQNYFFTSESVAEGHPDKVCDRISDEIVDLVYREAKKTGMDP
                     WKVRVACETLATTNRVVIAGEVRVPETLLKKDKAGNVLMDAAGHPVVNPAKFKSVARK
                     AIREIGYEQAGFHWKTAKIEVLLHGQSPDIGQGVDNAADRQGEEGAGDQGIMFGYACR
                     ETPDLMPAPIYYSHKILELLAAARHQNNGEAGKLGPDAKSQVTVRYVDGKAAEATQIV
                     LSTQHLDSSWDSKKVRKVVEPYIREALGDLKIADDCMWYINPTGKFVIGGPDGDAGLT
                     GRKIIVDTYGGAAPHGGGAFSGKDTTKVDRSAAYAARYLAKNVVAAKLADRCTIQLSY
                     AIGVAQPLSVYVDLHGTGKVDEAKLEDALRTVMDLSPSGIRRHLDLNKPIYAKTSSYG
                     HFGRKAGRDGSFSWEKTDLAKALKDAVAA"
     misc_feature    complement(27757..28137)
                     /locus_tag="Mesop_0026"
                     /note="S-adenosylmethionine synthetase, N-terminal domain;
                     Region: S-AdoMet_synt_N; pfam00438"
                     /db_xref="CDD:249858"
     misc_feature    complement(26884..28134)
                     /locus_tag="Mesop_0026"
                     /note="S-adenosylmethionine synthetase; Validated; Region:
                     PRK05250"
                     /db_xref="CDD:235374"
     misc_feature    complement(27355..27717)
                     /locus_tag="Mesop_0026"
                     /note="S-adenosylmethionine synthetase, central domain;
                     Region: S-AdoMet_synt_M; pfam02772"
                     /db_xref="CDD:251520"
     misc_feature    complement(26923..27351)
                     /locus_tag="Mesop_0026"
                     /note="S-adenosylmethionine synthetase, C-terminal domain;
                     Region: S-AdoMet_synt_C; pfam02773"
                     /db_xref="CDD:111646"
     gene            complement(28316..28735)
                     /locus_tag="Mesop_0027"
                     /db_xref="GeneID:10823831"
     CDS             complement(28316..28735)
                     /locus_tag="Mesop_0027"
                     /note="InterPro IPR001387;
                     KEGG: mlo:mlr5544 transcriptional regulator;
                     PFAM: helix-turn-helix domain protein;
                     SMART: helix-turn-helix domain protein;
                     SPTR: Transcriptional regulator, XRE family;
                     PFAM: Helix-turn-helix"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_004608619.1"
                     /db_xref="GI:337264564"
                     /db_xref="GeneID:10823831"
                     /translation="MTEENKKKPNPIDIHVGSRIRLRRNMLGMSQEKLGENLGITFQQ
                     IQKYEKGTNRVGASRLQAIASILGVPVAFFFEDAPGQESSANRGFAEDASMAFAVEFC
                     GSPEGLQLNRAFVKIADVKVRRRIIDLVKSLAADDLD"
     misc_feature    complement(28343..28693)
                     /locus_tag="Mesop_0027"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(28514..28687)
                     /locus_tag="Mesop_0027"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(28586..28588,28661..28663,28673..28675))
                     /locus_tag="Mesop_0027"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(28589..28591,28664..28666))
                     /locus_tag="Mesop_0027"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(28583..28588,28598..28600,28607..28609,
                     28640..28645))
                     /locus_tag="Mesop_0027"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(28349..>28633)
                     /locus_tag="Mesop_0027"
                     /note="Isoprenoid Biosynthesis enzymes, Class 1; Region:
                     Isoprenoid_Biosyn_C1; cl00210"
                     /db_xref="CDD:260263"
     gene            complement(28874..30466)
                     /locus_tag="Mesop_0028"
                     /db_xref="GeneID:10823832"
     CDS             complement(28874..30466)
                     /locus_tag="Mesop_0028"
                     /note="COGs: COG0815 Apolipoprotein N-acyltransferase;
                     InterPro IPR003010:IPR004563;
                     KEGG: mlo:mlr5543 apolipoprotein N-acyltransferase;
                     PFAM: Nitrilase/cyanide hydratase and apolipoprotein
                     N-acyltransferase;
                     SPTR: Apolipoprotein N-acyltransferase;
                     TIGRFAM: apolipoprotein N-acyltransferase;
                     PFAM: Carbon-nitrogen hydrolase;
                     TIGRFAM: apolipoprotein N-acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="YP_004608620.1"
                     /db_xref="GI:337264565"
                     /db_xref="GeneID:10823832"
                     /translation="MVRLAGRIILLWGWRRALVAFLAGALAVLGQAPYDFFAACFISF
                     PVLVWLLDGATGEASGSLFRRLRPAFAVGWWFGFGYFLAGLWWIGSALLVEADSFAWA
                     LPFAVIGIPFALAFFYGFATVIARLLWSSDIGRIAALAFGFALAEWLRGFLFTGFPWN
                     AIGYAAMPVPLLMQSVSVTGMVGMNALAVFLFALPALLAARRHLRLGAALFVVLAAAH
                     VGFGYVRLAAPEKPAERSLNVRIVQPAVDLSEKWDASVRDRIFATLLGLSAKAPDPSH
                     DRPQLILWPETSVPFLFTERPDALTALGDMLGDGQMLIAGVVREEGGSAAGADSRYYN
                     SVVAIDDKGEIADAVDKVHLVPFGEYLPFADLLSRFGIEQLVAGPMTFTAGNERHAIT
                     LPGGLRALPFICYEVIFPDLVAVDATSAQLIVNVTNDAWFGDTPGPYQHFRQAQIRAV
                     ENGLPLLRAANNGISAVVDPRGRIVDALAIDARGAIDVKVPIAEQAVVSEGQRRINGM
                     LIMLLFALGGALLNVRQRLRVN"
     sig_peptide     complement(30377..30466)
                     /locus_tag="Mesop_0028"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(28994..30442)
                     /locus_tag="Mesop_0028"
                     /note="apolipoprotein N-acyltransferase; Reviewed; Region:
                     lnt; PRK00302"
                     /db_xref="CDD:234721"
     misc_feature    complement(28994..29758)
                     /locus_tag="Mesop_0028"
                     /note="Apolipoprotein N-acyl transferase (class 9
                     nitrilases); Region: ALP_N-acyl_transferase; cd07571"
                     /db_xref="CDD:143595"
     misc_feature    complement(order(29183..29185,29243..29248,29252..29257,
                     29390..29392,29402..29404,29414..29416,29609..29611))
                     /locus_tag="Mesop_0028"
                     /note="putative active site [active]"
                     /db_xref="CDD:143595"
     misc_feature    complement(order(29255..29257,29414..29416,29609..29611))
                     /locus_tag="Mesop_0028"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143595"
     misc_feature    complement(order(29075..29080,29114..29119,29123..29131,
                     29135..29140,29222..29227,29234..29248,29252..29254,
                     29366..29374,29393..29395,29402..29413))
                     /locus_tag="Mesop_0028"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143595"
     gene            complement(30566..31036)
                     /locus_tag="Mesop_0029"
                     /db_xref="GeneID:10823833"
     CDS             complement(30566..31036)
                     /locus_tag="Mesop_0029"
                     /note="COGs: COG2764 conserved hypothetical protein;
                     InterPro IPR004360;
                     KEGG: mlo:mlr5539 hypothetical protein;
                     PFAM: Glyoxalase/bleomycin resistance protein/dioxygenase;
                     SPTR: Glyoxalase/bleomycin resistance protein/dioxygenase;
                     PFAM: Glyoxalase/Bleomycin resistance protein/Dioxygenase
                     superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004608621.1"
                     /db_xref="GI:337264566"
                     /db_xref="GeneID:10823833"
                     /translation="MTIDDPFKHASLGSGVFYRDPRAALDWLEAAFGFERSMVVSDAE
                     GKLVHAEMRFGDCTIIVDSEWSDYVASPASVSGKNTQSVYVRLKDGLDGHCEQARAAG
                     AVIIQEPADQFYGERQYRARDPEGHVWTFSQTIRVVSREEAERLGGMRIEGWHR"
     misc_feature    complement(30638..31003)
                     /locus_tag="Mesop_0029"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_14; cd08355"
                     /db_xref="CDD:176703"
     gene            complement(31053..32147)
                     /locus_tag="Mesop_0030"
                     /db_xref="GeneID:10823834"
     CDS             complement(31053..32147)
                     /locus_tag="Mesop_0030"
                     /note="COGs: COG1253 Hemolysins and related protein
                     containing CBS domains;
                     InterPro IPR000644:IPR005170;
                     KEGG: mlo:mlr5537 hemolysin;
                     PFAM: transporter-associated region; CBS domain containing
                     protein;
                     SPTR: Transporter-associated protein;
                     PFAM: CBS domain; Transporter associated domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter-associated region"
                     /protein_id="YP_004608622.1"
                     /db_xref="GI:337264567"
                     /db_xref="GeneID:10823834"
                     /translation="MNDKPETAARPDAGSAPKASDTSEEGSSPSTVTPGATSTGSVAS
                     ETSPAGPSLFERVLGLFRQRNGTSLREEIAGALAETASDAGAFSPGERAMLNNILRLR
                     EVRVEDVMVPRADIQGVEITTTLGDLLGTFEQSGHSRMPVYSETLDDPRGMVHIRDVL
                     AHITKLARVKKGRTTRKTPVATQLDLAQVDLSRTIGELNLIRQVLFVPPSMLASDLMG
                     RMQTTRTQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDDEPMITQAGDGVFVVD
                     GKAEIDEVAKMIGEGFAAGEHGEYVDTIGGMIFNTLGRVPARGEVVQAIPGFEFHVLD
                     ADPRRVKRVRIVQSQKGERRRRATARTEQA"
     misc_feature    complement(31110..>31991)
                     /locus_tag="Mesop_0030"
                     /note="Hemolysins and related proteins containing CBS
                     domains [General function prediction only]; Region: TlyC;
                     COG1253"
                     /db_xref="CDD:224173"
     misc_feature    complement(31404..31808)
                     /locus_tag="Mesop_0030"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     misc_feature    complement(31110..31352)
                     /locus_tag="Mesop_0030"
                     /note="Transporter associated domain; Region: CorC_HlyC;
                     smart01091"
                     /db_xref="CDD:215020"
     gene            complement(32176..32676)
                     /locus_tag="Mesop_0031"
                     /db_xref="GeneID:10823835"
     CDS             complement(32176..32676)
                     /locus_tag="Mesop_0031"
                     /note="COGs: COG0319 metal-dependent hydrolase;
                     InterPro IPR020549:IPR002036;
                     KEGG: mlo:mlr5536 hypothetical protein;
                     PFAM: protein of unknown function UPF0054;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Uncharacterized protein family UPF0054;
                     TIGRFAM: metalloprotein, YbeY/UPF0054 family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608623.1"
                     /db_xref="GI:337264568"
                     /db_xref="GeneID:10823835"
                     /translation="MPEDSTSVDGSLPVEIDISIEAGDWPAEASLARLVDRAVAVAFA
                     ETGAAGQSELSIVFSDDAHIRTLNADWRGKDKPTNVLSFPAFPHVKDGPLPPMLGDIV
                     LAAETVAREAALEDKPLENHITHLVIHGLLHLMGYDHETDTEAEAMEAVERAALARLA
                     IPDPYA"
     misc_feature    complement(32179..32637)
                     /locus_tag="Mesop_0031"
                     /note="Predicted metal-dependent hydrolase [General
                     function prediction only]; Region: COG0319"
                     /db_xref="CDD:223396"
     gene            complement(32694..33743)
                     /locus_tag="Mesop_0032"
                     /db_xref="GeneID:10823836"
     CDS             complement(32694..33743)
                     /locus_tag="Mesop_0032"
                     /note="COGs: COG1702 Phosphate starvation-inducible
                     protein PhoH predicted ATPase;
                     InterPro IPR003714;
                     KEGG: mlo:mlr5535 phosphate starvation-induced protein
                     PhoH;
                     PFAM: PhoH family protein;
                     SPTR: Phosphate starvation-induced protein; PhoH;
                     PFAM: PhoH-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PhoH family protein"
                     /protein_id="YP_004608624.1"
                     /db_xref="GI:337264569"
                     /db_xref="GeneID:10823836"
                     /translation="MSAAELKNLPPVPASGASDMAHIVLTFDNNKLASALYGQFDENL
                     ARLEQKLGVDIRSRGNQLTIKGSASAAEQARRALDNLYGILQKGVDIGQSDVDGAVRM
                     AVAADDQLTLPTLERKGKVSAAQIATRKKTIYARSLNQDAYMRALERSELVFGIGPAG
                     TGKTYLAVAHAAMLLERGMVERIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDAL
                     YDMMPADKVERAIAAEVIEIAPLAFMRGRTLAHAAVILDEAQNTTPMQMKMFLTRLGE
                     NSRMIVTGDPTQIDLPPSTKSGLVEALRVLDGVAGAVTVRFNDIDVVRHPLVAEIVRA
                     YDRDAKLARGLGAEN"
     misc_feature    complement(32700..33722)
                     /locus_tag="Mesop_0032"
                     /note="Phosphate starvation-inducible protein PhoH,
                     predicted ATPase [Signal transduction mechanisms]; Region:
                     PhoH; COG1702"
                     /db_xref="CDD:224616"
     misc_feature    complement(32736..33350)
                     /locus_tag="Mesop_0032"
                     /note="PhoH-like protein; Region: PhoH; pfam02562"
                     /db_xref="CDD:251376"
     gene            complement(33770..35191)
                     /locus_tag="Mesop_0033"
                     /db_xref="GeneID:10823837"
     CDS             complement(33770..35191)
                     /locus_tag="Mesop_0033"
                     /note="COGs: COG0621 2-methylthioadenine synthetase;
                     InterProIPR013848:IPR007197:IPR002792:IPR006463:IPR
                     006638:IPR005839;
                     KEGG: mlo:mlr5534 hypothetical protein;
                     PFAM: Protein of unknown function UPF0004 ; Radical SAM
                     domain protein; deoxyribonuclease/rho motif-related TRAM;
                     SMART: Elongator protein 3/MiaB/NifB;
                     SPTR: RNA modification enzyme, MiaB family;
                     TIGRFAM: RNA modification enzyme, MiaB family;
                     tRNA-i(6)A37 thiotransferase enzyme MiaB;
                     PFAM: TRAM domain; Radical SAM superfamily;
                     Uncharacterized protein family UPF0004;
                     TIGRFAM: tRNA-N(6)-(isopentenyl)adenosine-37
                     thiotransferase enzyme MiaB; RNA modification enzyme, MiaB
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="MiaB family RNA modification protein"
                     /protein_id="YP_004608625.1"
                     /db_xref="GI:337264570"
                     /db_xref="GeneID:10823837"
                     /translation="MDLNTIESDDIGTLAGHPAVHAVAAKKVFIKTYGCQMNVYDSQR
                     MADALAADGYTATGAIGEADLVLLNTCHIREKAAEKVYSELGRIRDMKAERASVGREL
                     LIGVAGCVAQAEGAEIIRRSPAVDLVIGPQTYHRLPDVLARVRGGEKIVETDYAIEDK
                     FEHLPQPKRAEVIKRGVTAFLTVQEGCDKFCTFCVVPYTRGSEVSRPVAQIVAEAERL
                     AEAGVREVTLLGQNVNAWHGQGDTKGGRTEEWGLGRLLHRLAQIPGLARLRYTTSHPR
                     DMDDELIAAHRDLPSLMPYLHLPVQSGSDRILKAMNRRHTARDYLALLDRIRAARPDI
                     ALSGDFIVGFPGETEADFEATMELVRQVNYASAFSFKYSPRPGTPGAEMADHVPETVK
                     DERLQRLQALLLKQQQDFGLSLIGSTIDTLIEKPGRQSGQKVGRSPWLQPVIVDEKAG
                     EIGDIIQVRITKTGYNSLFAELA"
     misc_feature    complement(33773..35125)
                     /locus_tag="Mesop_0033"
                     /note="(dimethylallyl)adenosine tRNA
                     methylthiotransferase; Provisional; Region: PRK14325"
                     /db_xref="CDD:237673"
     misc_feature    complement(34802..35113)
                     /locus_tag="Mesop_0033"
                     /note="Uncharacterized protein family UPF0004; Region:
                     UPF0004; pfam00919"
                     /db_xref="CDD:250224"
     misc_feature    complement(34025..34636)
                     /locus_tag="Mesop_0033"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(34076..34078,34169..34171,34301..34303,
                     34373..34381,34457..34462,34505..34507,34607..34615,
                     34619..34621,34625..34627,34631..34633))
                     /locus_tag="Mesop_0033"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(33776..33955)
                     /locus_tag="Mesop_0033"
                     /note="TRAM domain; Region: TRAM; cl01282"
                     /db_xref="CDD:242412"
     gene            complement(35267..36067)
                     /locus_tag="Mesop_0034"
                     /db_xref="GeneID:10823838"
     CDS             complement(35267..36067)
                     /locus_tag="Mesop_0034"
                     /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
                     acyltransferase;
                     InterPro IPR002123;
                     KEGG: mlo:mlr5533 hypothetical protein;
                     PFAM: phospholipid/glycerol acyltransferase;
                     SMART: phospholipid/glycerol acyltransferase;
                     SPTR: Phospholipid/glycerol acyltransferase;
                     PFAM: Acyltransferase;
                     TIGRFAM: 1-acyl-sn-glycerol-3-phosphate acyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid/glycerol acyltransferase"
                     /protein_id="YP_004608626.1"
                     /db_xref="GI:337264571"
                     /db_xref="GeneID:10823838"
                     /translation="MIKKIRIFLALGLVVAGSLILVPLQMLSMKTGWWPETFILKIWH
                     RLILRALGMRVHVKGTLSDKRPLLVASNHISWTDIMVLGSFADVKFIARADMEGWPLI
                     GMLSKLQRTVFIERERKRSSGDQASEIANRMAKGDAMVLFAEGSTGDGNAILPFKSTL
                     FGAASMAISEGAAEQVFIQPVAIAYTRLHGVPLGRRHRPISAWIGDEDLMPHLKVLMA
                     EGALDVEVHFGDPIAFSKGSNRKETAKLMESQVRDMMMAALADPRPSR"
     misc_feature    complement(<35822..36067)
                     /locus_tag="Mesop_0034"
                     /note="Lysophospholipid acyltransferases (LPLATs) of
                     glycerophospholipid biosynthesis; Region: LPLAT; cl17185"
                     /db_xref="CDD:266537"
     sig_peptide     complement(36005..36067)
                     /locus_tag="Mesop_0034"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(35312..35935)
                     /locus_tag="Mesop_0034"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    complement(order(35627..35635,35783..35794,35834..35836,
                     35840..35842,35849..35851))
                     /locus_tag="Mesop_0034"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     gene            complement(36088..36582)
                     /locus_tag="Mesop_0035"
                     /db_xref="GeneID:10823839"
     CDS             complement(36088..36582)
                     /locus_tag="Mesop_0035"
                     /note="COGs: COG0456 Acetyltransferase;
                     InterPro IPR000182;
                     KEGG: mlo:mlr5531 peptide N-acetyltransferase;
                     PFAM: GCN5-related N-acetyltransferase;
                     SPTR: GCN5-related N-acetyltransferase;
                     PFAM: Acetyltransferase (GNAT) family"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-like N-acetyltransferase"
                     /protein_id="YP_004608627.1"
                     /db_xref="GI:337264572"
                     /db_xref="GeneID:10823839"
                     /translation="MRIPFLQPRRRDYALEPLRITDSPAVSLLHREDFVRPWTDGEFA
                     ALLEQDTVFGYAARETGQGAKPPVGVVLARLAAGEGEILTVAVGRSHRRQGLGWQLMD
                     AVLRELHAQRAEALFLEVDETNVAAIALYRRLGFREVGKRPDYYKSPDRGPTGALVMR
                     RDLR"
     misc_feature    complement(36091..36558)
                     /locus_tag="Mesop_0035"
                     /note="Acetyltransferases [General function prediction
                     only]; Region: RimI; COG0456"
                     /db_xref="CDD:223532"
     misc_feature    complement(36226..36420)
                     /locus_tag="Mesop_0035"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(36289..36294,36322..36330))
                     /locus_tag="Mesop_0035"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(36582..37319)
                     /locus_tag="Mesop_0036"
                     /db_xref="GeneID:10823840"
     CDS             complement(36582..37319)
                     /locus_tag="Mesop_0036"
                     /note="COGs: COG1214 Inactive homolog of metal-dependent
                     protease putative molecular chaperone;
                     InterPro IPR000905:IPR017861;
                     KEGG: mlo:mlr5530 hypothetical protein;
                     PFAM: peptidase M22 glycoprotease;
                     SPTR: Peptidase M22 glycoprotease;
                     PFAM: Glycoprotease family;
                     TIGRFAM: universal bacterial protein YeaZ"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M22 glycoprotease"
                     /protein_id="YP_004608628.1"
                     /db_xref="GI:337264573"
                     /db_xref="GeneID:10823840"
                     /translation="MLAVARLGGHREVFLGTGCFMKVLAIDCAASLCAACVYDAAVGL
                     ELGRSVLDLGKGHAEHLMAVIAEALKAGATDYAGLGAIAVSVGPGSFTGLRVGVSTAR
                     GLALALKIPAIGVTTLEALAAEAAAAFPGRAVLAALDAGREEIHAALYDQMSVLTYGP
                     AVATLAEATGMAIESSAVLAGTAAAQIAASAGRGFDIGPRTATADILTYARLAAVKGA
                     GERPKPLYLRGADAKPQAGFILSRQQN"
     misc_feature    complement(36615..37259)
                     /locus_tag="Mesop_0036"
                     /note="Inactive homolog of metal-dependent proteases,
                     putative molecular chaperone [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     COG1214"
                     /db_xref="CDD:224135"
     misc_feature    complement(<36852..37157)
                     /locus_tag="Mesop_0036"
                     /note="Glycoprotease family; Region: Peptidase_M22;
                     pfam00814"
                     /db_xref="CDD:250152"
     gene            complement(37353..38459)
                     /locus_tag="Mesop_0037"
                     /db_xref="GeneID:10823841"
     CDS             complement(37353..38459)
                     /locus_tag="Mesop_0037"
                     /note="COGs: COG3490 conserved hypothetical protein;
                     InterPro IPR008311:IPR000169:IPR017909:IPR006311;
                     KEGG: mlo:mlr5529 hypothetical protein;
                     PFAM: conserved hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF1513)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608629.1"
                     /db_xref="GI:337264574"
                     /db_xref="GeneID:10823841"
                     /translation="MKTPLIDRRDFLRAAGIGFAAAMAPSAWAMTLAADAVFATAFVK
                     RDGSFGAAVLSEAGKVLHTIDLPDRGHDVTFDPMSKRSVVFARQPGTFAVVFDHTGRD
                     APLTIASIPGRHFFGHGVFSPDGALLYATENDFDNAAGVVGVYDARAKFSRVGEFPTY
                     GMGPHELLLLGDGRTIAVANGGIETHPDYGRAELNIATMKPSYVLVDRVTGDLIEKHE
                     LPAPLHQLSIRHMDTDQAGTVWFGCQYRGPGTDRPLLVGRAARGKDLQLLDMQGDVLA
                     GFRNYIGSVAANPGSGTVAVSSPEGNSLVVIDAASGQVLSNSALVEVCGVAPDGTGFM
                     ATTGAGEIIEGSGAMRSEPDYVWDNHMLRIEQVA"
     misc_feature    complement(37365..38459)
                     /locus_tag="Mesop_0037"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3490"
                     /db_xref="CDD:226021"
     sig_peptide     complement(38373..38459)
                     /locus_tag="Mesop_0037"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            complement(38463..39536)
                     /locus_tag="Mesop_0038"
                     /db_xref="GeneID:10823842"
     CDS             complement(38463..39536)
                     /locus_tag="Mesop_0038"
                     /note="COGs: COG3489 periplasmic lipoprotein;
                     InterPro IPR018976;
                     KEGG: mlo:mlr5528 hypothetical protein;
                     PFAM: Peptidase M75, Imelysin;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Imelysin"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M75, Imelysin"
                     /protein_id="YP_004608630.1"
                     /db_xref="GI:337264575"
                     /db_xref="GeneID:10823842"
                     /translation="MLKRSALFLVLPLALLGALPASAAVKASDVIQRAIDGFVRPAYA
                     GLHEHTQALAKAMHELCEAPSPGELDAARTEFSATVYAWSSAEIIGLGPIKENNRLER
                     MLFWPDRKSIGLKQVQAALSAKDPTATDPAQLAGKSVAMQGALEFVLFGDGADALAGK
                     DDPYRCAYGAAVAGNIGTMAKDVNDAWNKPDGFAALWANPGPQNPLYRDGNEAVTELV
                     GVFINELEMVRDVRLKGFLGGKPEADKPKQAIYWRSQNTGNSLAGNLDGIDRLFQVSK
                     LGNALPEDARWMAESIHIQLVNGVATAKSVQGPIDKALADQALRGKLEHFALITSSLS
                     TLIGTRLTAEFGLTAGFSSLDGD"
     sig_peptide     complement(39468..39536)
                     /locus_tag="Mesop_0038"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(38466..39464)
                     /locus_tag="Mesop_0038"
                     /note="Predicted periplasmic lipoprotein [General function
                     prediction only]; Region: COG3489"
                     /db_xref="CDD:226020"
     gene            complement(39536..41134)
                     /locus_tag="Mesop_0039"
                     /db_xref="GeneID:10823843"
     CDS             complement(39536..41134)
                     /locus_tag="Mesop_0039"
                     /note="COGs: COG3488 thiol oxidoreductase;
                     InterPro IPR010538:IPR009056;
                     KEGG: mlo:mlr5527 hypothetical protein;
                     PFAM: protein of unknown function DUF1111;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF1111)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608631.1"
                     /db_xref="GI:337264576"
                     /db_xref="GeneID:10823843"
                     /translation="MRRPLEFLRRLRRAESSPPLRKPAGSTGRRCAILVLALTSSALA
                     GDLQPAGLATTRTDLDAKDQARVTAITRPTADFSKPERFELMQGGAGTSEKDVNRDAF
                     SQSSANITFEEEGTFKLGNALFRKNWVSSPSSTQASDGLGPLFNERACQNCHLKDGRG
                     RPPQGDLGSTSMFLRLARDASSAEEKAALADHQVLNFPDPVYGTQLQELAVPGLRGEG
                     RMHVDYQERKVELTDGTVVSLRKPSYSVTDPAYGPLDPRTTLSPRLTPPMIGLGLIEQ
                     IAPADILAHADPQDHDGDGISGRPNIVRDGQGGELTLGRFGWKAQTASIRQQAADAFA
                     GDIGISTPEESKHWGDCTIAQAKCLAMPNGVQQRLGSAEAPPPVMDLVTFYSRNLAVP
                     ARRDRDAPDVLAGKKVFYDIGCVSCHAPKFVTRRDAPDKAQAFQLIWPYSDFLLHDMG
                     PDLADGQAVGEATGNEWRTPPLWGIGLTGTVNGNSFFLHDGRARSLTEAILWHGGEGQ
                     KARDRFAAANAAERSALLEFLESL"
     sig_peptide     complement(41003..41134)
                     /locus_tag="Mesop_0039"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(39539..40981)
                     /locus_tag="Mesop_0039"
                     /note="Predicted thiol oxidoreductase [Energy production
                     and conversion]; Region: COG3488"
                     /db_xref="CDD:226019"
     misc_feature    complement(39539..40873)
                     /locus_tag="Mesop_0039"
                     /note="Protein of unknown function (DUF1111); Region:
                     DUF1111; pfam06537"
                     /db_xref="CDD:253788"
     gene            complement(41147..41632)
                     /locus_tag="Mesop_0040"
                     /db_xref="GeneID:10823844"
     CDS             complement(41147..41632)
                     /locus_tag="Mesop_0040"
                     /note="COGs: COG2193 Bacterioferritin (cytochrome b1);
                     InterPro IPR002024:IPR008331:IPR009040;
                     KEGG: mlo:mlr5526 bacterioferritin;
                     PFAM: Ferritin Dps family protein;
                     SPTR: Bacterioferritin;
                     TIGRFAM: bacterioferritin;
                     PFAM: Ferritin-like domain;
                     TIGRFAM: bacterioferritin"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="YP_004608632.1"
                     /db_xref="GI:337264577"
                     /db_xref="GeneID:10823844"
                     /translation="MKGEPQVIERLNEALFLELGAVNQYWVHFRLLEDWGYAKLAKKE
                     RAESIEEMHHADKLVARIIFLEGHPNLQSVAPLRIGQNVKEVLESDLAGEYDARTAYK
                     RSREICNEAGDYVSMKLFEQLLADEEGHIDFLETQLDLLASIGEEKYGQLNAASADDA
                     E"
     misc_feature    complement(41171..41629)
                     /locus_tag="Mesop_0040"
                     /note="Bacterioferritin, ferritin-like diiron-binding
                     domain; Region: Bacterioferritin; cd00907"
                     /db_xref="CDD:153099"
     misc_feature    complement(41201..41611)
                     /locus_tag="Mesop_0040"
                     /note="Ferritin-like domain; Region: Ferritin; pfam00210"
                     /db_xref="CDD:249681"
     misc_feature    complement(order(41465..41467,41477..41479,41498..41500,
                     41543..41545,41564..41566,41588..41590))
                     /locus_tag="Mesop_0040"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:153099"
     misc_feature    complement(order(41252..41257,41330..41332,41342..41344,
                     41351..41356,41471..41473,41480..41482,41558..41560,
                     41570..41575,41579..41584))
                     /locus_tag="Mesop_0040"
                     /note="ferroxidase pore; other site"
                     /db_xref="CDD:153099"
     misc_feature    complement(order(41243..41245,41252..41254,41330..41332,
                     41351..41353,41471..41473,41480..41482,41558..41560,
                     41579..41581))
                     /locus_tag="Mesop_0040"
                     /note="ferroxidase diiron center [ion binding]; other
                     site"
                     /db_xref="CDD:153099"
     gene            complement(41598..41909)
                     /locus_tag="Mesop_0041"
                     /db_xref="GeneID:10823845"
     CDS             complement(41598..41909)
                     /locus_tag="Mesop_0041"
                     /note="KEGG: mlo:msr5525 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: BFD-like [2Fe-2S] binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608633.1"
                     /db_xref="GI:337264578"
                     /db_xref="GeneID:10823845"
                     /translation="MLICHCNIITEKEIEQTIIDLLDQDPWQLIVPAKVYHTMQKRGR
                     CCGCFPNVVETIIRVTENYHTRSEASGVDIVSHLDRVRGLRVQYGSRIHERRTAGHRA
                     A"
     misc_feature    complement(41748..41909)
                     /locus_tag="Mesop_0041"
                     /note="BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD;
                     pfam04324"
                     /db_xref="CDD:252526"
     gene            complement(42019..43308)
                     /locus_tag="Mesop_0042"
                     /db_xref="GeneID:10823846"
     CDS             complement(42019..43308)
                     /locus_tag="Mesop_0042"
                     /note="COGs: COG3487 Uncharacterized iron-regulated
                     protein;
                     InterPro IPR018976;
                     KEGG: mlo:mlr5523 hypothetical protein;
                     PFAM: Peptidase M75, Imelysin;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Imelysin"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M75, Imelysin"
                     /protein_id="YP_004608634.1"
                     /db_xref="GI:337264579"
                     /db_xref="GeneID:10823846"
                     /translation="MTARYGGRLAAMGATALLTAAVFVLPAKAQTDAKAVVTTYSDIA
                     LAKYEDSLTTAQALDKAVDALLANPSADTLNAARDAWKASRVPYQQTEVYRFGNKIVD
                     DWEGKVNSWPLDEGLIDYVAKSYGTESDANSLYTANVIANKEIEINGKKVDASKLSPE
                     FLSGTLQEAGGVEANVATGYHAIEFLLWGQDLHGTGPGAGERPYTDYDLKNCTGGNCD
                     RRAEYLKSASTLLVSDLQEMVDDWKADGAARKALADGEPNTAISTIFTGMGSLSYGEL
                     AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIRAAYLASYTRLDGTVVSGPSVH
                     EMVKTADPAIDKELSDKLDVTVAKMEAIKARAEAGEAYDQQIAEGNTEGNATVQAAID
                     ALIDQTKSIERAVGSLKLNAIAFEGSDSLDAPDKVFK"
     misc_feature    complement(42022..43308)
                     /locus_tag="Mesop_0042"
                     /note="Uncharacterized iron-regulated protein [Inorganic
                     ion transport and metabolism]; Region: IrpA; COG3487"
                     /db_xref="CDD:226018"
     sig_peptide     complement(43222..43308)
                     /locus_tag="Mesop_0042"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            43753..45006
                     /locus_tag="Mesop_0043"
                     /db_xref="GeneID:10823847"
     CDS             43753..45006
                     /locus_tag="Mesop_0043"
                     /note="COGs: COG0446 NAD(FAD)-dependent dehydrogenase;
                     InterPro IPR013027;
                     KEGG: mlo:mll5522 rubredoxin reductase;
                     PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     SPTR: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     PFAM: Pyridine nucleotide-disulphide oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_004608635.1"
                     /db_xref="GI:337264580"
                     /db_xref="GeneID:10823847"
                     /translation="MKNGVVIVGAGHAGVQAAASLREDSYDGPVILIGDENELPYHKP
                     PLSKTFIKDAEAKPQPLRGEAFYTGNAIDYRPGIRIERIDAGRRSLEISGGGALAFDH
                     LILATGSRPRLLPLPGADLSGVLSLRSLSDARLIRELSARSDDVVILGGGFIGLEIAA
                     TLRAAGRTVTVVEAVDRLLGRAVAPVVASHVRQRLEATGVRILTGTSIAKLEGENGHV
                     AAAITLSGERLPARMVIVGIGAVPNVELAQDAGLAIANGIRVDHQMRSSVPEILAIGD
                     AASYRHWFTGGDVRLESVQNATDQARLAARTITGHADAYCAVPWFWSDIGDMKLQMVG
                     LTAGGNSHVLLGDLPDNKFSIYHYAGDRLLGIESVNRPGDHMLGRKMLGAGFSPTPET
                     VAAGPDGLKAALAAFQAVEPAKAVG"
     misc_feature    43753..44907
                     /locus_tag="Mesop_0043"
                     /note="phenylpropionate dioxygenase ferredoxin reductase
                     subunit; Provisional; Region: PRK09754"
                     /db_xref="CDD:170080"
     misc_feature    43768..44208
                     /locus_tag="Mesop_0043"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    44188..44397
                     /locus_tag="Mesop_0043"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    <44239..>44607
                     /locus_tag="Mesop_0043"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    44710..44964
                     /locus_tag="Mesop_0043"
                     /note="Reductase C-terminal; Region: Reductase_C;
                     pfam14759"
                     /db_xref="CDD:258896"
     gene            complement(45383..46660)
                     /locus_tag="Mesop_0044"
                     /db_xref="GeneID:10823848"
     CDS             complement(45383..46660)
                     /locus_tag="Mesop_0044"
                     /EC_number="2.6.1.19"
                     /note="COGs: COG0160 4-aminobutyrate aminotransferase and
                     related aminotransferase;
                     InterPro IPR005814:IPR004632;
                     KEGG: mlo:mlr5521 4-aminobutyrate aminotransferase;
                     PFAM: aminotransferase class-III;
                     PRIAM: 4-aminobutyrate transaminase;
                     SPTR: 4-aminobutyrate aminotransferase;
                     TIGRFAM: 4-aminobutyrate aminotransferase;
                     PFAM: Aminotransferase class-III;
                     TIGRFAM: 4-aminobutyrate aminotransferase, prokaryotic
                     type"
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="YP_004608636.1"
                     /db_xref="GI:337264581"
                     /db_xref="GeneID:10823848"
                     /translation="MKNSAISERKNQSISRGVGMTTQIYADRAENSEIWDVEGRRYID
                     FSSGIAVVNTGHRHPRVIEAVKAQLDRFTHTCHQVVPYESYVRLAERLNAMLPGKFEK
                     KTIFVTTGAEAVENAIKIARNATGRPAVIAFSGGFHGRTFMGMALTGKVVPYKVGFGA
                     MPGDVYHAPFPVPLHGVSTADSLAALDRLFKADVDPARVAAIIVEPVQGEGGFYEAPR
                     EFLTALRKLCDQHGMLLIADEVQTGFARTGKMFAMDHHEVAADITTMAKSLAGGFPLS
                     AVTGRAEIMDAPGPGGLGGTYGGSPIGVAAAHAVLDVIEDEKLCDRANTLGARLKQRL
                     QSIRDDVPEIVDIRGLGFMNAVEFNDVKKGLPSAEIANAIRLKALDKGLILLTCGVYG
                     NVIRFLAPITIQDEVMNEALDILESSIREVCAA"
     misc_feature    complement(45404..46645)
                     /locus_tag="Mesop_0044"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    complement(45395..46579)
                     /locus_tag="Mesop_0044"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    complement(order(45860..45862,45938..45943,45947..45949,
                     46046..46048,46241..46243,46247..46252,46328..46336))
                     /locus_tag="Mesop_0044"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(45860..45862,45938..45940,45947..45949,
                     46046..46048,46247..46252,46328..46333))
                     /locus_tag="Mesop_0044"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    complement(45860..45862)
                     /locus_tag="Mesop_0044"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            46898..48037
                     /locus_tag="Mesop_0045"
                     /db_xref="GeneID:10823849"
     CDS             46898..48037
                     /locus_tag="Mesop_0045"
                     /note="COGs: COG0845 Membrane-fusion protein;
                     InterPro IPR006143;
                     KEGG: mlo:mll5520 RND efflux membrane fusion protein;
                     PFAM: secretion protein HlyD family protein;
                     SPTR: Efflux transporter, RND family, MFP subunit;
                     TIGRFAM: efflux transporter, RND family, MFP subunit;
                     PFAM: HlyD family secretion protein;
                     TIGRFAM: RND family efflux transporter, MFP subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="YP_004608637.1"
                     /db_xref="GI:337264582"
                     /db_xref="GeneID:10823849"
                     /translation="MSRNATSSVSPPSAQAPRLLSFTAASTIFACTTVLLLAGCQKQE
                     AAAKKLPIMVRTETVAMADYAPRTSLTGVIAARTLNNLSFRVGGRVAERLVDVGQHVD
                     QGTVLARIDPQEQESDLRSAQADLDAAQAQLTQSAAAFERQKTLLAQGFTTRRDYDAA
                     DQAQKVAQGSVDAARSAFANAQQNLSFTELKAGAAGVITARQVETGQVVQAAQTVFTV
                     AEDGDRDAVFNVQETLVARTPASPAVTITLLSDPQVRATGKVREISPAVDPASGSIRV
                     KVGIPDTPAGMPLGAAVIGSVGAKQAKAILLPWQALTSSAGKPAVWIVDPSTKAVTMA
                     PVEVLAFGSGTVAIAKGLNEGQSVVTAGGQLLSPGQTVEISGAGQ"
     sig_peptide     46898..46987
                     /locus_tag="Mesop_0045"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    47057..48019
                     /locus_tag="Mesop_0045"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    47138..47257
                     /locus_tag="Mesop_0045"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    47462..47767
                     /locus_tag="Mesop_0045"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            48034..49110
                     /locus_tag="Mesop_0046"
                     /db_xref="GeneID:10823850"
     CDS             48034..49110
                     /locus_tag="Mesop_0046"
                     /note="COGs: COG0845 Membrane-fusion protein;
                     InterPro IPR006143;
                     KEGG: mlo:mll5519 RND efflux membrane fusion protein;
                     PFAM: secretion protein HlyD family protein;
                     SPTR: Efflux transporter, RND family, MFP subunit;
                     TIGRFAM: efflux transporter, RND family, MFP subunit;
                     PFAM: HlyD family secretion protein;
                     TIGRFAM: RND family efflux transporter, MFP subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="YP_004608638.1"
                     /db_xref="GI:337264583"
                     /db_xref="GeneID:10823850"
                     /translation="MSRLPSILLGLFMLGALASCSKSDEKPPEIIRPVLSVVVEPRTT
                     QIFGFAGSVEPQVSADLAFRLLGRVVSRDVKVGDIVSKGTTIATLDPTALELAVQAAK
                     AELSNAEAQFANAAASEERQRQLLAAANTTQAVFDAAQQARKAAEANVERAKASLAKS
                     QEQLGYARLFSDFDGVVTAVGAEVGQTVSPGQTVVTVARSDLREAVVDIPDQLTGDLA
                     AGTPFQVILQSLPTIQTEAKLREIAPQSEGSTRTRRVKLTLTDPPQAFRLGSTVTATR
                     MTKVTPTIELPLSALLEKDGADKVWIVDPQTSSVSAKEIKLAAKGAATFIVAEGLEAG
                     MRVVTAGVHSLSEGQKVKVPEGGV"
     sig_peptide     48034..48102
                     /locus_tag="Mesop_0046"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    48133..49095
                     /locus_tag="Mesop_0046"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    48187..48348
                     /locus_tag="Mesop_0046"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    48535..48840
                     /locus_tag="Mesop_0046"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            49110..52208
                     /locus_tag="Mesop_0047"
                     /db_xref="GeneID:10823851"
     CDS             49110..52208
                     /locus_tag="Mesop_0047"
                     /note="COGs: COG0841 Cation/multidrug efflux pump;
                     InterPro IPR001036;
                     KEGG: mlo:mll5518 RND efflux transporter;
                     PFAM: acriflavin resistance protein;
                     SPTR: Acriflavin resistance protein;
                     PFAM: AcrB/AcrD/AcrF family"
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="YP_004608639.1"
                     /db_xref="GI:337264584"
                     /db_xref="GeneID:10823851"
                     /translation="MKGFNLSDWALSHRSMVWYFMLVFVVAGIFSYLHLGREEDPNFT
                     IKTMIIQANWPGASVKETVQQVTDRIEKKLEELDSLDYTKSVTTAGQTVIFVNLKDTT
                     KARDVVPNWIQVRNMVNDIAAQFPQGVQGPFFNDRFGDVYGNIYAFTSDGLTPRQLRD
                     YVEDARTKILTVPNAGKVDLVGAQDEAIYLEFSTRQIAALGLNQQAIVASLQAQNAIT
                     PSGVIQSGPERISVRVGGQFTSEDSLRAINLRVNDRFFRLSDVATITRGYADPPTALF
                     RFNGQDAIGLAIGMKPNANLLEFGEALHKEMNKVLADLPVGVGVHLVADQPVIVEEAV
                     SGFTRALFEAVAIVLAVSFISLGMRAGFVVALSIPLVLAITFTVMAYLGISLQRISLG
                     ALIIALGLLVDDAMIAVEMMVARLEVGDNLRKAATYVYTSTAFPMLTGTLVTVAGFIP
                     IGLNNSAAGEYTFTLFVVIAVSLLVSWIVAVLFAPLLGVTILPATMKTKHHDQPGRFT
                     SLFRRVLVGSVRHHWLTIIATVLLFAGSIAGFGLVQQQFFPPSDRPELIVDWNLPQNS
                     SIADTRDQMERFEQRALVGNPDIDHFSSYIGQGAVRFVLAYDVQPANPYFGQTVIVTK
                     SIEARNRVKPALEKLLREEFVGTDAFVKLLELGPPVGRPVQYRVGGPDIQTVRELAQQ
                     FAGVISANPKLAASTFDWNEPQRVLRVDVLQDKARQLGITSSDIASALNSTVGGATIT
                     QVRDATYLINVVARSRDAERGSIGTLQNMQLPTSSGEAIPLAAVANFRYDLEQPTVWR
                     RDRIPTITVRAGLVGDVLPATVVNELKPSVDAFIAKLPPGYSVETAGSVEESAKSQGP
                     IAAVVPLMLFVMATILMVQLQSFQRLFLVVAVAPLGLIGVVAALVPSGAPLGFVAILG
                     VLALIGILIRNSVILIVQIEDLVREGKDRWAAVIEATEHRMRPIALTAAAASLALIPI
                     AREVFWGPMAYAMMGGIIAGTAITLLFLPALYVTWFRIKEPKARDEPPVPDIGEPVQT
                     PA"
     misc_feature    49122..52139
                     /locus_tag="Mesop_0047"
                     /note="Cation/multidrug efflux pump [Defense mechanisms];
                     Region: AcrB; COG0841"
                     /db_xref="CDD:223911"
     misc_feature    <50151..50576
                     /locus_tag="Mesop_0047"
                     /note="Fucose 4-O-acetylase and related acetyltransferases
                     [Carbohydrate transport and metabolism]; Region: NolL;
                     COG3594"
                     /db_xref="CDD:226122"
     gene            complement(52221..52541)
                     /locus_tag="Mesop_0048"
                     /db_xref="GeneID:10823852"
     CDS             complement(52221..52541)
                     /locus_tag="Mesop_0048"
                     /note="KEGG: aba:Acid345_2425 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608640.1"
                     /db_xref="GI:337264585"
                     /db_xref="GeneID:10823852"
                     /translation="MEQWRFEDPPNVAVLSDRGIFKSGDWIAYVVHEADDDDSYSDEG
                     GSWQFHNSETGPVDEGDIMIVRRDESILELADLPKGWHAWRSSKSSPWQRAKSLPVPS
                     NDNE"
     gene            complement(52584..53333)
                     /locus_tag="Mesop_0049"
                     /db_xref="GeneID:10823853"
     CDS             complement(52584..53333)
                     /locus_tag="Mesop_0049"
                     /note="COGs: COG1124 ABC-type
                     dipeptide/oligopeptide/nickel transport system ATPase
                     component;
                     InterPro IPR017871:IPR003439:IPR003593;
                     KEGG: mlo:mlr5517 ABC transporter, ATP-binding protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608641.1"
                     /db_xref="GI:337264586"
                     /db_xref="GeneID:10823853"
                     /translation="MTSAIAVDGLEVIFDRFRALKGVSLDVQPGESFGLVGESGSGKS
                     TLLRAIAGLAPVASGSIAVNGKTLGTRRDKAFYREVQMVFQDPYGSLHPRQTVDRLLQ
                     EPLAIHGFSDGEKRIQRALDEVGLGNGFRFRYSHQLSGGQRQRVAIARALILEPSILL
                     LDEPTSALDASVQAEVLNLLEEVRRRRKLTFLMVSHDLAIITHMCERLMVMQSGEAVE
                     NLTASDLVERHVTKDYTRNLLRASEGFVRTV"
     misc_feature    complement(52593..53330)
                     /locus_tag="Mesop_0049"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    complement(52680..53321)
                     /locus_tag="Mesop_0049"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(53202..53225)
                     /locus_tag="Mesop_0049"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(52746..52748,52845..52850,53079..53081,
                     53199..53207,53211..53216))
                     /locus_tag="Mesop_0049"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(53079..53090)
                     /locus_tag="Mesop_0049"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(52893..52922)
                     /locus_tag="Mesop_0049"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(52845..52862)
                     /locus_tag="Mesop_0049"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(52827..52838)
                     /locus_tag="Mesop_0049"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(52740..52760)
                     /locus_tag="Mesop_0049"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     gene            complement(53330..54175)
                     /locus_tag="Mesop_0050"
                     /db_xref="GeneID:10823854"
     CDS             complement(53330..54175)
                     /locus_tag="Mesop_0050"
                     /note="COGs: COG0444 ABC-type
                     dipeptide/oligopeptide/nickel transport system ATPase
                     component;
                     InterPro IPR003439:IPR013563:IPR003593;
                     KEGG: mlo:mlr5516 oligopeptide ABC transporter,
                     ATP-binding protein;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
                     C-terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608642.1"
                     /db_xref="GI:337264587"
                     /db_xref="GeneID:10823854"
                     /translation="MSRETKTLLEVDDLRVTFPTRTGLIEAVRGVSFSLGRERLGIVG
                     ESGSGKSQTGRAIMGLTPPQARISANKLAFDGIDLLDISPRQRRALRGNRIAMILQDP
                     KYSLDPVMSIGRQIVETLRTHEKVSKAEARERALAMLEAVQIRDPKRVFDLHPHEVSG
                     GMGQRAMIAMMLIAGPEMMIADEPTSALDVTVQLDVLGILDRLVSERGMGLIFISHDL
                     RLVSSFCDRVIVMYAGKVVEQLKASELGRAQHPYTRGLLNCMPKIGADRHPLPVLDRK
                     PEWAA"
     misc_feature    complement(53387..54160)
                     /locus_tag="Mesop_0050"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    complement(53459..54154)
                     /locus_tag="Mesop_0050"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(54023..54046)
                     /locus_tag="Mesop_0050"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(53528..53530,53627..53632,53876..53878,
                     54020..54028,54032..54037))
                     /locus_tag="Mesop_0050"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(53876..53887)
                     /locus_tag="Mesop_0050"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(53675..53704)
                     /locus_tag="Mesop_0050"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(53627..53644)
                     /locus_tag="Mesop_0050"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(53609..53620)
                     /locus_tag="Mesop_0050"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(53522..53542)
                     /locus_tag="Mesop_0050"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<53336..53467)
                     /locus_tag="Mesop_0050"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(54200..55126)
                     /locus_tag="Mesop_0051"
                     /db_xref="GeneID:10823855"
     CDS             complement(54200..55126)
                     /locus_tag="Mesop_0051"
                     /note="COGs: COG1173 ABC-type
                     dipeptide/oligopeptide/nickel transport systems permease
                     components;
                     InterPro IPR000515;
                     KEGG: mlo:mlr5515 ABC transporter, permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608643.1"
                     /db_xref="GI:337264588"
                     /db_xref="GeneID:10823855"
                     /translation="MTASDVRPLSRRDWLLSERPASRMQARLGRAYVAWRRFSANRLA
                     FVGLLIIIALLVIAALAGVLAPYSPTFGDLKNARLLAPSAEHWFGTDDLGRDILSRIL
                     YGSRWTLYVVILVAIIAAPIGLLVGTVAGYAGGWTDAILMRITDIFLAFPKLVLALAF
                     VAALGPGIENAVLAIAITSWPPYARIARAETLTVRNSDYIKAVQLMGASPFRIVLRHI
                     MPLCISSLIVRVTLDMAGIILTAAGLGFLGLGAQPPLPEWGTMIASGRRFILDQWWVA
                     GAPGFAILIVSLGFNLLGDGLRDALDPRSGDQ"
     misc_feature    complement(54212..55051)
                     /locus_tag="Mesop_0051"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(54269..54811)
                     /locus_tag="Mesop_0051"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(54272..54277,54284..54289,54293..54298,
                     54305..54310,54344..54349,54389..54394,54401..54412,
                     54431..54433,54440..54445,54485..54487,54536..54538,
                     54545..54550,54560..54562,54566..54571,54578..54580,
                     54584..54586,54590..54595,54644..54646,54650..54655,
                     54662..54691,54695..54706,54734..54736,54749..54754,
                     54761..54766))
                     /locus_tag="Mesop_0051"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(54395..54412,54644..54688))
                     /locus_tag="Mesop_0051"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(54308..54310,54344..54346,54353..54355,
                     54392..54394,54608..54610,54644..54646))
                     /locus_tag="Mesop_0051"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(54464..54466,54476..54481,54497..54535))
                     /locus_tag="Mesop_0051"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(55323..56384)
                     /locus_tag="Mesop_0052"
                     /db_xref="GeneID:10823856"
     CDS             complement(55323..56384)
                     /locus_tag="Mesop_0052"
                     /note="COGs: COG0601 ABC-type
                     dipeptide/oligopeptide/nickel transport systems permease
                     components;
                     InterPro IPR000515;
                     KEGG: mlo:mlr5514 ABC transporter, permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608644.1"
                     /db_xref="GI:337264589"
                     /db_xref="GeneID:10823856"
                     /translation="MSAVENEGGRGGARAYALASSLGRFLVIAVTTYLGLLAVTFFIG
                     RVIPIDPVLAVLGDRAPANVVERTRREMGLDLPLIEQFYIYVKHALSGDFGTSVLTTN
                     PVMTDIRRALPATTELATLGTLIGALLGVPLGVLAAVRRGSLIDQIVRVIGLIGYSVP
                     IFWLGLLGLVLFYAKLQWVAFPARLDVVYEYTFTPITGFYLLDSAMQGQWDVFYDAFR
                     HIILPASLLGYFSLAYISRMTRSFMLNELAQEYIVAARAKGLSETRIIWGHALRNAAV
                     PMVTVIALSYAGLLEGSVLTETVFSWPGIGLYITNSLQNADMNAVLGGTIVIGSVFIA
                     INLLSDLLYRVLDPRTKVQ"
     misc_feature    complement(55326..56321)
                     /locus_tag="Mesop_0052"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(55362..56051)
                     /locus_tag="Mesop_0052"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(55362..55367,55374..55379,55386..55391,
                     55395..55400,55407..55412,55449..55454,55491..55496,
                     55503..55514,55533..55535,55542..55547,55587..55589,
                     55638..55640,55647..55652,55662..55664,55668..55673,
                     55680..55682,55686..55688,55692..55697,55878..55880,
                     55884..55889,55896..55925,55929..55940,55971..55973,
                     55986..55991,55998..56003))
                     /locus_tag="Mesop_0052"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(55497..55514,55878..55922))
                     /locus_tag="Mesop_0052"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(55410..55412,55449..55451,55458..55460,
                     55494..55496,55710..55712,55878..55880))
                     /locus_tag="Mesop_0052"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(55566..55568,55578..55583,55599..55637))
                     /locus_tag="Mesop_0052"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(56403..58169)
                     /locus_tag="Mesop_0053"
                     /db_xref="GeneID:10823857"
     CDS             complement(56403..58169)
                     /locus_tag="Mesop_0053"
                     /note="COGs: COG0747 ABC-type dipeptide transport system
                     periplasmic component;
                     InterPro IPR000914;
                     KEGG: mlo:mlr5513 ABC transporter, periplasmic
                     oligopeptide-binding protein;
                     PFAM: extracellular solute-binding protein family 5;
                     SPTR: Extracellular solute-binding protein family 5;
                     PFAM: Bacterial extracellular solute-binding proteins,
                     family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="family 5 extracellular solute-binding protein"
                     /protein_id="YP_004608645.1"
                     /db_xref="GI:337264590"
                     /db_xref="GeneID:10823857"
                     /translation="MVLTNWTKTTTVSGQRAMAGPEKNTATLSRELRSTKQGTITMMM
                     EKFALRSRILLAGAAMSALLLAGAPAGAVTPADTLVEGFAIDDIISMDPGEAFELSTA
                     EVTGNTYDLLVRLDLSDTSKVKPDLAESWTVSDDGLTYTFKLKPGLKFASGNPITAAD
                     VAYSFERAVKLDKSPAFIIDQFGISGDNVTEKAKAVDDTTFQFTVDKAYAPSFVLNCL
                     SATVASVVDAKLVKEHVAAVTPSADYKWDNDFGNAWLKTGYAGSGAYKLREWRANEAV
                     VMERNDNYYGEKAKLARVIYRNMKESSAQRLALEAGDIDVARNLEPNDLDAIAKNADL
                     TTTSAPKGTVYYISLNQKNPNLAKPEVRQAFKYLVDYDALSSTILKGIGEIHQTFLPK
                     GVLGELDENPFKLDVAKAKELLAKAGLPDGFSVTMDVRTGQPTTGMAESIQQTLGQAG
                     IKLEIIPGDGKQTLTKYRARNHDIYIGQWGQDYFDPNSNAQTFASNPDNSDAGKSKTL
                     AWRNAWDIPDLTKQTEAALLEKDSGKRADMYKDLEKKILDTSPFVVIHQQLEVAGLRK
                     NLKGFALGPSFDTNFVGPVSKE"
     misc_feature    complement(56406..58052)
                     /locus_tag="Mesop_0053"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(56457..57947)
                     /locus_tag="Mesop_0053"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_7; cd08512"
                     /db_xref="CDD:173877"
     gene            complement(58300..59577)
                     /locus_tag="Mesop_0054"
                     /db_xref="GeneID:10823858"
     CDS             complement(58300..59577)
                     /locus_tag="Mesop_0054"
                     /note="COGs: COG2951 Membrane-bound lytic murein
                     transglycosylase B;
                     InterPro IPR002477:IPR011970;
                     KEGG: mlo:mlr5511 transglycolase;
                     PFAM: Peptidoglycan-binding domain 1 protein;
                     SPTR: Lytic murein transglycosylase;
                     TIGRFAM: lytic murein transglycosylase;
                     PFAM: Putative peptidoglycan binding domain;
                     TIGRFAM: lytic murein transglycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="lytic murein transglycosylase"
                     /protein_id="YP_004608646.1"
                     /db_xref="GI:337264591"
                     /db_xref="GeneID:10823858"
                     /translation="MAGRPEGGATERGLRQFCLAFFLAALAFLVFSTPASAAKIDDQF
                     RAWLQNDLWPQAKAQGISKSTFDAAFDGIKPNLKLPDLVMPGEKPKTPQKQHQAEFGS
                     PGAYFAEKTIGAVTAGGRARETANAKTIAAIEKRYGVPGEILLAIWGRETGFGAAKMP
                     YDAFEVLGTKAFMSTKKDFFRTELLAALEIVERGLAPVGAMKSSWAGALGQPQFMPTS
                     FLKHAVDFDGDGRVDIWNSTPDVLASIANYLVHYGWVKGRGWGFEVTVPETVSCSLEG
                     PDQGKKISQWVALGIKRVGEKPFPASELKAEGFLLMPAGRSGPAFIATPNFYVLKEYN
                     TSDLYALFIGHGADRIAHGDSNFSGAWGPVGDLHRSDIAALQRTLEAKGYDVGSADGL
                     PGFKTRRSIGKWQAKNGQASTCFPDAGLVTALK"
     sig_peptide     complement(59467..59577)
                     /locus_tag="Mesop_0054"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(58522..59451)
                     /locus_tag="Mesop_0054"
                     /note="lytic murein transglycosylase; Region: MltB_2;
                     TIGR02283"
                     /db_xref="CDD:233810"
     misc_feature    complement(58534..59451)
                     /locus_tag="Mesop_0054"
                     /note="Transglycosylase SLT domain; Region: SLT_2;
                     pfam13406"
                     /db_xref="CDD:257731"
     misc_feature    complement(<58792..59031)
                     /locus_tag="Mesop_0054"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    complement(order(58834..58836,58933..58935,59002..59004))
                     /locus_tag="Mesop_0054"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(59002..59004)
                     /locus_tag="Mesop_0054"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     misc_feature    complement(58306..58476)
                     /locus_tag="Mesop_0054"
                     /note="Putative peptidoglycan binding domain; Region:
                     PG_binding_1; pfam01471"
                     /db_xref="CDD:250643"
     gene            complement(59744..60349)
                     /locus_tag="Mesop_0055"
                     /db_xref="GeneID:10823859"
     CDS             complement(59744..60349)
                     /locus_tag="Mesop_0055"
                     /note="COGs: COG0353 Recombinational DNA repair protein
                     (RecF pathway);
                     InterPro IPR015967:IPR006171:IPR006154:IPR000093;
                     KEGG: mlo:mlr5510 recombination protein RecR;
                     PFAM: TOPRIM domain protein; Zinc finger C4-type, RecR;
                     SMART: Toprim sub domain protein;
                     SPTR: Recombination protein RecR;
                     TIGRFAM: recombination protein RecR;
                     PFAM: Toprim domain; RecR protein;
                     TIGRFAM: recombination protein RecR"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein RecR"
                     /protein_id="YP_004608647.1"
                     /db_xref="GI:337264592"
                     /db_xref="GeneID:10823859"
                     /translation="MSKRIAGPEIERLIQLLAKVPGLGPRSARRAALHLIKKKEQLLS
                     PLAAAMGEAADKVRICSTCGNVDTSDPCMICTDPRRDATTLIVVEDVSDLWALERAAA
                     MNVRYHVLGGTLSPLDGVGPDQLNIRSLIDRVAGGEVKEIILAVNATVEGQTTAHYLT
                     DQLSGFDIKVTRLAHGVPVGGELDYLDEGTLAAALRSRTAF"
     misc_feature    complement(59747..60334)
                     /locus_tag="Mesop_0055"
                     /note="recombination protein RecR; Reviewed; Region: recR;
                     PRK00076"
                     /db_xref="CDD:234616"
     misc_feature    complement(60107..60229)
                     /locus_tag="Mesop_0055"
                     /note="RecR protein; Region: RecR; pfam02132"
                     /db_xref="CDD:251108"
     misc_feature    complement(59768..60103)
                     /locus_tag="Mesop_0055"
                     /note="TOPRIM_recR: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in Escherichia coli RecR.  RecR participates in the RecFOR
                     pathway of homologous recombinational repair in
                     prokaryotes. This pathway provides a...; Region:
                     TOPRIM_recR; cd01025"
                     /db_xref="CDD:173775"
     misc_feature    complement(order(59897..59899,59903..59905,59909..59911,
                     60071..60073,60080..60085))
                     /locus_tag="Mesop_0055"
                     /note="putative active site [active]"
                     /db_xref="CDD:173775"
     misc_feature    complement(order(59909..59911,60083..60085))
                     /locus_tag="Mesop_0055"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173775"
     misc_feature    complement(order(59768..59776,59780..59782,59786..59788,
                     59801..59803,59807..59842,59870..59872,59906..59908,
                     59915..59917,59921..59923,59927..59929,60050..60055,
                     60059..60067))
                     /locus_tag="Mesop_0055"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173775"
     gene            complement(60431..61447)
                     /locus_tag="Mesop_0056"
                     /db_xref="GeneID:10823860"
     CDS             complement(60431..61447)
                     /locus_tag="Mesop_0056"
                     /note="COGs: COG3773 Cell wall hydrolyses involved in
                     spore germination;
                     InterPro IPR011105;
                     KEGG: mlo:mlr5508 hypothetical protein;
                     PFAM: cell wall hydrolase SleB;
                     SPTR: Cell wall hydrolase SleB;
                     PFAM: Cell Wall Hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall hydrolase SleB"
                     /protein_id="YP_004608648.1"
                     /db_xref="GI:337264593"
                     /db_xref="GeneID:10823860"
                     /translation="MIVTRWKAPLLLGVVTSPLFLAACSQTTSHGMSVASLTDAITPS
                     FLSSRAYSHTPKDRECLERAMFFESNRSSRDGMIAVGTVVMNRLRSGNHGSTICQVVG
                     EPGQFAPGVMTRPMNSRAMPDVEEAADAVLKGERKAKLKNTMYFHTAGLRFPYKNMHY
                     TMVAGGNAFYEKRGRNWQPLPDEPMVASVETEKPAVPVTMVASAEPVRSDRKLVRNAP
                     AQQQAPTQQAPTQQAYVTAAVEPARPFKMATAPAQQTYVTAAAAPSAKSARVASKPVA
                     VAMQEPMEEPDAARFGGTLNKKIISSVQGEPQEASMGFQSTPENTDAIGAMIVSQGRP
                     LETN"
     sig_peptide     complement(61379..61447)
                     /locus_tag="Mesop_0056"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(60434..61255)
                     /locus_tag="Mesop_0056"
                     /note="Cell wall hydrolyses involved in spore germination
                     [Cell envelope biogenesis, outer membrane]; Region: SleB;
                     COG3773"
                     /db_xref="CDD:226296"
     misc_feature    complement(60935..61240)
                     /locus_tag="Mesop_0056"
                     /note="Cell Wall Hydrolase; Region: Hydrolase_2;
                     pfam07486"
                     /db_xref="CDD:254227"
     gene            complement(61683..62090)
                     /locus_tag="Mesop_0057"
                     /db_xref="GeneID:10823861"
     CDS             complement(61683..62090)
                     /locus_tag="Mesop_0057"
                     /note="KEGG: mlo:mlr5505 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608649.1"
                     /db_xref="GI:337264594"
                     /db_xref="GeneID:10823861"
                     /translation="MTDEPSERLIEQRIRNRIYEILEILADCDAGVDLVGIKGYFYLF
                     EDFVHRPSIEAGTSALSREERAVVLEIAEFLEAASETNPDFTKAEFIHSDWPGRIAPA
                     ARNARRLFLARGLFSEKVEELEPGQPAVAAAGR"
     gene            complement(62110..62433)
                     /locus_tag="Mesop_0058"
                     /db_xref="GeneID:10823862"
     CDS             complement(62110..62433)
                     /locus_tag="Mesop_0058"
                     /note="COGs: COG0718 conserved hypothetical protein;
                     InterPro IPR004401;
                     KEGG: mlo:mlr5504 hypothetical protein;
                     PFAM: conserved hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Uncharacterised BCR, YbaB family COG0718;
                     TIGRFAM: DNA-binding protein, YbaB/EbfC family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608650.1"
                     /db_xref="GI:337264595"
                     /db_xref="GeneID:10823862"
                     /translation="MKDLLGLMGKAKEMQAKFQAMQDEIATVEAAGQSGGGLVSVTLT
                     GKFEMKSLKIDPSLFKEDDVEVLEDLLLAAHNDARVKVEQIMQEKTKALTAGLPIPPG
                     MKLPF"
     misc_feature    complement(62125..62433)
                     /locus_tag="Mesop_0058"
                     /note="hypothetical protein; Validated; Region: PRK00153"
                     /db_xref="CDD:234669"
     gene            complement(62475..64268)
                     /locus_tag="Mesop_0059"
                     /db_xref="GeneID:10823863"
     CDS             complement(62475..64268)
                     /locus_tag="Mesop_0059"
                     /note="COGs: COG2812 DNA polymerase III gamma/tau
                     subunits;
                     InterPro IPR003959:IPR003593:IPR012763;
                     KEGG: mlo:mlr5503 DNA polymerase III subunits gamma and
                     tau;
                     PFAM: AAA ATPase central domain protein;
                     SMART: AAA ATPase;
                     SPTR: DNA polymerase III, subunits gamma and tau;
                     TIGRFAM: DNA polymerase III, subunits gamma and tau;
                     PFAM: ATPase family associated with various cellular
                     activities (AAA); DNA polymerase III gamma and tau
                     subunits C terminal; DNA polymerase III subunits gamma and
                     tau domain III;
                     TIGRFAM: DNA polymerase III, subunit gamma and tau"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunits gamma and tau"
                     /protein_id="YP_004608651.1"
                     /db_xref="GI:337264596"
                     /db_xref="GeneID:10823863"
                     /translation="MSEAGNEKAAAYRVLARKYRPSNFSELVGQEPMVRTLTNAFATG
                     RIAQAWMLTGVRGVGKTTTARILARALNYKTATVDQPSVDLAVLGEHCQAIMEGRHVD
                     VIEMDAASHTGIDDIRDIIERVRYAPVSARYKVYIIDEVHMLSTQAFNGLLKTLEEPP
                     PHVKFIFATTEIRKVPITVLSRCQRFDLRRIDAGALVAHLSSIAGKEGISVDDDALAM
                     IARAAEGSARDSLSILDQAIAHGAGSVSAEAVRAMLGLADRARIVDLFEHVMKGDVAA
                     VLAEFRAQYDTGADPAAVLTDLAEFNHLVTRLRFVPTAMDDASLSQDERQRGADFARA
                     LSVRVLSRTWQMLLKGIPEVQSSNRPVSAAEMVLIRLAHAADLPTLDEALRSLEGASP
                     VQNGAPRPNGVPAGPGNGGGASAVAQTRMPSGQGGAQTMRLVEATPAPVAFVAPPPPA
                     PEAQPVPLKSLADIVALADAQRDIAFKVLVKRCIRLVRIEPGRIDVSLTDDAPKMLLN
                     DLTMKLRAWTGRNWLVSLSKEEGGQTLAEMESTRRENAFLDAKSDPAVAAILARFPGA
                     KIIDVRIPDAPEADADQAEVPVEPPADDDDA"
     misc_feature    complement(62481..64250)
                     /locus_tag="Mesop_0059"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK09111"
                     /db_xref="CDD:236382"
     misc_feature    complement(63714..64187)
                     /locus_tag="Mesop_0059"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(64086..64109)
                     /locus_tag="Mesop_0059"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(63759..63761,63852..63854,64083..64106))
                     /locus_tag="Mesop_0059"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(63849..63866)
                     /locus_tag="Mesop_0059"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(63723..63725)
                     /locus_tag="Mesop_0059"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(63108..63536)
                     /locus_tag="Mesop_0059"
                     /note="DNA polymerase III subunits gamma and tau domain
                     III; Region: DNA_pol3_gamma3; pfam12169"
                     /db_xref="CDD:256887"
     misc_feature    complement(62553..62897)
                     /locus_tag="Mesop_0059"
                     /note="DNA polymerase III gamma and tau subunits C
                     terminal; Region: DUF3646; pfam12362"
                     /db_xref="CDD:257007"
     gene            complement(64369..64471)
                     /locus_tag="Mesop_R0001"
                     /db_xref="GeneID:10823864"
     ncRNA           complement(64369..64471)
                     /locus_tag="Mesop_R0001"
                     /ncRNA_class="SRP_RNA"
                     /product="RNA component of signal recognition particle"
                     /db_xref="GeneID:10823864"
     gene            64619..65038
                     /locus_tag="Mesop_0060"
                     /db_xref="GeneID:10823865"
     CDS             64619..65038
                     /locus_tag="Mesop_0060"
                     /note="COGs: COG0537 Diadenosine tetraphosphate (Ap4A)
                     hydrolase and other HIT family hydrolase;
                     InterPro IPR001310;
                     KEGG: mlo:mll5502 hypothetical protein;
                     PFAM: histidine triad (HIT) protein;
                     SPTR: Histidine triad (HIT) protein;
                     PFAM: HIT domain"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad (HIT) protein"
                     /protein_id="YP_004608652.1"
                     /db_xref="GI:337264597"
                     /db_xref="GeneID:10823865"
                     /translation="MLPGLKAGFTLDARLEADSEQLMWLGLCELRVMNDRRWPWLLLV
                     PQRPGAEEIHDMTPLDQAMLTFETNMVAQALKKVTGCTKINTGALGNIVRQLHIHIVA
                     RSEGDAGWPGPVWGHGLREPYQRSELRRFAETIRAAL"
     misc_feature    64658..64936
                     /locus_tag="Mesop_0060"
                     /note="HIT domain; Region: HIT; pfam01230"
                     /db_xref="CDD:250462"
     misc_feature    order(64742..64744,64895..64897,64907..64909,64913..64915)
                     /locus_tag="Mesop_0060"
                     /note="nucleotide binding site/active site [active]"
                     /db_xref="CDD:238263"
     misc_feature    order(64901..64903,64907..64909,64913..64921)
                     /locus_tag="Mesop_0060"
                     /note="HIT family signature motif; other site"
                     /db_xref="CDD:238263"
     misc_feature    64907..64909
                     /locus_tag="Mesop_0060"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238263"
     gene            65092..66036
                     /locus_tag="Mesop_0061"
                     /db_xref="GeneID:10823866"
     CDS             65092..66036
                     /locus_tag="Mesop_0061"
                     /note="COGs: COG2816 NTP pyrophosphohydrolase containing a
                     Zn-finger probably nucleic-acid-binding;
                     InterPro IPR020084:IPR015375:IPR015376:IPR000086;
                     KEGG: mlo:mll5500 hypothetical protein;
                     PFAM: NUDIX hydrolase; NADH pyrophosphatase-like ; Zinc
                     ribbon NADH pyrophosphatase;
                     SPTR: NUDIX hydrolase;
                     PFAM: NADH pyrophosphatase zinc ribbon domain; NUDIX
                     domain; NADH pyrophosphatase-like rudimentary NUDIX
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="YP_004608653.1"
                     /db_xref="GI:337264598"
                     /db_xref="GeneID:10823866"
                     /translation="MSFSLFDAPLREPSQFVGFAGNTIDRQSENRADDSVDKALADPT
                     TRLLLMNGGRLHLKLREGGSLDPWFGLTESEPFKPAFDRGVLLGFSEQGPVVAVLAGV
                     DPEQLPETVKAIDYRSVYMQGLIDEAAAGAMAQGAALLAWHASHRFCSKCGTQSEMRA
                     GGYKRHCPNCGTEHFPRTDPVAIMLTATREKCLLGRGAHFAPGMYSALAGFIEPGETI
                     EAAVRRETLEEAGIRLGRVVYHASQPWPFPYSLMIGCFGEPLNEDIQADLNELEDCRW
                     FGRDEVRLMLAREHPGNLVTPPKGAIAHHLIRAWVDSE"
     misc_feature    65161..66027
                     /locus_tag="Mesop_0061"
                     /note="NTP pyrophosphohydrolases containing a Zn-finger,
                     probably nucleic-acid-binding [DNA replication,
                     recombination, and repair]; Region: NPY1; COG2816"
                     /db_xref="CDD:225373"
     misc_feature    65221..>65457
                     /locus_tag="Mesop_0061"
                     /note="NADH pyrophosphatase-like rudimentary NUDIX domain;
                     Region: NUDIX-like; pfam09296"
                     /db_xref="CDD:255270"
     misc_feature    65521..65616
                     /locus_tag="Mesop_0061"
                     /note="NADH pyrophosphatase zinc ribbon domain; Region:
                     zf-NADH-PPase; pfam09297"
                     /db_xref="CDD:255271"
     misc_feature    65629..66027
                     /locus_tag="Mesop_0061"
                     /note="NADH pyrophosphatase, a member of the Nudix
                     hydrolase superfamily, catalyzes the cleavage of NADH into
                     reduced nicotinamide mononucleotide (NMNH) and AMP. Like
                     other members of the Nudix family, it requires a divalent
                     cation, such as Mg2+ or Mn2+, for...; Region:
                     NADH_pyrophosphatase; cd03429"
                     /db_xref="CDD:239521"
     misc_feature    order(65632..65634,65716..65724,65824..65826,65833..65835,
                     65839..65841,65845..65847)
                     /locus_tag="Mesop_0061"
                     /note="putative NADH binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239521"
     misc_feature    order(65719..65724,65728..65730,65764..65766,65773..65778,
                     65824..65826,65833..65835,65839..65841,65845..65847)
                     /locus_tag="Mesop_0061"
                     /note="putative active site [active]"
                     /db_xref="CDD:239521"
     misc_feature    65719..65787
                     /locus_tag="Mesop_0061"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239521"
     misc_feature    order(65764..65766,65773..65778,65899..65901)
                     /locus_tag="Mesop_0061"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239521"
     gene            66068..66367
                     /locus_tag="Mesop_0062"
                     /db_xref="GeneID:10823867"
     CDS             66068..66367
                     /locus_tag="Mesop_0062"
                     /note="InterPro IPR013097;
                     KEGG: mlo:mll5499 hypothetical protein;
                     PFAM: Stress responsive alpha-beta barrel domain protein;
                     SPTR: Stress responsive alpha-beta barrel domain protein;
                     PFAM: Stress responsive A/B Barrel Domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Stress responsive alpha-beta barrel
                     domain-containing protein"
                     /protein_id="YP_004608654.1"
                     /db_xref="GI:337264599"
                     /db_xref="GeneID:10823867"
                     /translation="MIRHTVVFTLKHQPHSLEEKRFLVDARKILTAIRGVTHFEQLRQ
                     VSPKNDYQFGFSMEFADQAAYTRYNDHPDHVAFVRDRWVPEVEKFLEIDYVPLGW"
     misc_feature    66071..66355
                     /locus_tag="Mesop_0062"
                     /note="Stress responsive A/B Barrel Domain; Region: Dabb;
                     pfam07876"
                     /db_xref="CDD:254481"
     gene            complement(66369..67232)
                     /locus_tag="Mesop_0063"
                     /db_xref="GeneID:10823868"
     CDS             complement(66369..67232)
                     /locus_tag="Mesop_0063"
                     /EC_number="4.2.1.51"
                     /note="COGs: COG0077 Prephenate dehydratase;
                     InterPro IPR018528:IPR001086:IPR002912;
                     KEGG: mlo:mlr5498 prephenate dehydratase;
                     PFAM: prephenate dehydratase; amino acid-binding ACT
                     domain protein;
                     PRIAM: Prephenate dehydratase;
                     SPTR: Prephenate dehydratase;
                     PFAM: Prephenate dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="Prephenate dehydratase"
                     /protein_id="YP_004608655.1"
                     /db_xref="GI:337264600"
                     /db_xref="GeneID:10823868"
                     /translation="MPEKTNRISFQGEPGANSDTACRNVFPSMEPLPCPTFEDAFNAV
                     ETGKADLAMIPIENTIAGRVADIHHLLPESKLHIVGEYFLPIHFQLMVLPGVKRDEIK
                     TVHSHIHALGQCRKYVRKNGWKAIVAGDTAGAAKMVSEVKDRTMAALSPALAATLYGL
                     DLIEENVEDTDSNVTRFVVLTKNKQWAERPSPDVKMMTTFIFRVRNVPAALYKAMGGF
                     ATNGINMTKLESYQLGAFTATLFYADIEGHPDDPLVKLALEELRFFSREVRILGVYPA
                     SESREQWKVAD"
     misc_feature    complement(66390..67229)
                     /locus_tag="Mesop_0063"
                     /note="prephenate dehydratase; Provisional; Region:
                     PRK11899"
                     /db_xref="CDD:237014"
     misc_feature    complement(66681..67211)
                     /locus_tag="Mesop_0063"
                     /note="Prephenate dehydratase; Region: PDT; pfam00800"
                     /db_xref="CDD:250142"
     misc_feature    complement(66408..66644)
                     /locus_tag="Mesop_0063"
                     /note="C-terminal ACT domain of the bifunctional
                     chorismate mutase-prephenate dehydratase (CM-PDT) enzyme
                     and the prephenate dehydratase (PDT) enzyme; Region:
                     ACT_CM-PDT; cd04905"
                     /db_xref="CDD:153177"
     misc_feature    complement(order(66537..66548,66597..66608))
                     /locus_tag="Mesop_0063"
                     /note="putative L-Phe binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153177"
     gene            complement(67296..68024)
                     /locus_tag="Mesop_0064"
                     /db_xref="GeneID:10823869"
     CDS             complement(67296..68024)
                     /locus_tag="Mesop_0064"
                     /EC_number="2.7.7.38"
                     /note="COGs: COG1212 CMP-2-keto-3-deoxyoctulosonic acid
                     synthetase;
                     InterPro IPR003329:IPR004528;
                     KEGG: mlo:mlr5497 3-deoxy-manno-octulosonate
                     cytidylyltransferase;
                     PFAM: acylneuraminate cytidylyltransferase;
                     PRIAM: 3-deoxy-manno-octulosonate cytidylyltransferase;
                     SPTR: 3-deoxy-D-manno-octulosonate cytidylyltransferase;
                     TIGRFAM: 3-deoxy-D-manno-octulosonate
                     cytidylyltransferase;
                     PFAM: Cytidylyltransferase;
                     TIGRFAM: 3-deoxy-D-manno-octulosonate
                     cytidylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-
                     octulosonatecytidylyltransferase"
                     /protein_id="YP_004608656.1"
                     /db_xref="GI:337264601"
                     /db_xref="GeneID:10823869"
                     /translation="MSTLILIPARMASTRLPGKPLADIAGAPMIVHVARRAAEAGLGR
                     VVVATDTQSVAEAVRAHGFEAVMTRIDHESGSDRIHEALVALDPGRKVETIVNVQGDL
                     PTIDPGIIAASLRPFEDRAVDIATLGVEIVRDEEKTNPNVVKIVGSPLSATRLRALYF
                     TRATAPWGEGALYHHVGLYAYRRAALERFVALKPSPLERRERLEQLRALEAGMRIDAE
                     IVQSLPLGVDTPEDLERARTILVN"
     misc_feature    complement(67308..68021)
                     /locus_tag="Mesop_0064"
                     /note="CMP-KDO synthetase catalyzes the activation of KDO
                     which is an essential component of the lipopolysaccharide;
                     Region: CMP-KDO-Synthetase; cd02517"
                     /db_xref="CDD:133010"
     misc_feature    complement(order(67722..67724,67728..67730,67800..67802,
                     67881..67883,67995..68003))
                     /locus_tag="Mesop_0064"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133010"
     misc_feature    complement(order(67389..67400,67419..67427,67434..67439,
                     67524..67544,67548..67553,67569..67574,67587..67589,
                     67605..67607,67656..67658))
                     /locus_tag="Mesop_0064"
                     /note="oligomer interface; other site"
                     /db_xref="CDD:133010"
     gene            68218..68898
                     /locus_tag="Mesop_0065"
                     /db_xref="GeneID:10823870"
     CDS             68218..68898
                     /locus_tag="Mesop_0065"
                     /note="COGs: COG3474 Cytochrome c2;
                     InterPro IPR003088:IPR002327:IPR009056;
                     KEGG: mlo:mll5495 cytochrome c;
                     PFAM: cytochrome c class I;
                     SPTR: Cytochrome c class I;
                     PFAM: Cytochrome c"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c class I"
                     /protein_id="YP_004608657.1"
                     /db_xref="GI:337264602"
                     /db_xref="GeneID:10823870"
                     /translation="MDSNEVNKLLAGLLGTVFVVFSVGIVSDALFASPAPEKPGFAIE
                     AAEPAEGGPAAPAAAAKPIADLLATANVEQGAAVFKKCQACHSGEKGGPNKVGPDLWD
                     LVDRPVAEHEGFAYSAGMKEFSKGGTEKWTYDNINHFITSPKKFVKGTAMGFAGLPKD
                     EDRANVIAYLRTLSDNPKPLPAPGAAADAGAPAKPADGAAPAKPADGAAPAKPAAPAA
                     PAPAAPAK"
     misc_feature    68326..68745
                     /locus_tag="Mesop_0065"
                     /note="Cytochrome c2 [Energy production and conversion];
                     Region: COG3474"
                     /db_xref="CDD:226005"
     gene            69102..70979
                     /locus_tag="Mesop_0066"
                     /db_xref="GeneID:10823871"
     CDS             69102..70979
                     /locus_tag="Mesop_0066"
                     /note="COGs: COG4166 ABC-type oligopeptide transport
                     system periplasmic component;
                     InterPro IPR000914;
                     KEGG: mlo:mll5494 peptide ABC transporter, periplasmic
                     peptide-binding protein;
                     PFAM: extracellular solute-binding protein family 5;
                     SPTR: Extracellular solute-binding protein family 5;
                     PFAM: Bacterial extracellular solute-binding proteins,
                     family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="family 5 extracellular solute-binding protein"
                     /protein_id="YP_004608658.1"
                     /db_xref="GI:337264603"
                     /db_xref="GeneID:10823871"
                     /translation="MTVGRTLLKSLLAAALLTAGLQTTRADEWRTTSSLIGQSKYGDN
                     FQHYDYVNPNAPKGGTLNSVVLGTFDSFNPYIVQGSPAAGLVGFGGGLLYDTLMEQAT
                     DEGSVSHPLIADAYKYPDDYSSATYRLDPRAKWHDGQPITVDDVIWSFQVLKANSPQY
                     SRYFENVTDAVAISDREVEFHFSQKGNRELPKILGDLAVLPKHWWEGTDANGKKRDVT
                     KPTLEIPLGSAAYKIVSFKPGSEIVWQRVPDYWAAKLPVKIGRENFDTQRFTYILDDN
                     AAWQAFTKGGLDDIKPENSSKRWKTFYDFPAIKAGDVIKKEFKTTSPEPMQAFMLNQR
                     RPLFADRLVRAALTYPFDFETMNRTLFYGFNTRTSSYFQGTELASSGLPQGKELEILE
                     KYRDKLPPELFTQEFKLPVYDSPQAERKYLKQAVDLFAKAGWVIKGGKMVNAKTGEPF
                     KFEILGWNDTDQVIASPYIANLRKIGVDATLRLIDQTQYINRVNNFDYDVIIGQLGQS
                     ESPGNEQRDFWSSKAADRRGSRNYAGIKNPVVDALVDRIIFATDRDDLVAATHALDRV
                     LLWNYYVVPQYYRAVVWLAYWNKFGIPAKQPSYIGADQNSWWIDLDKEKALAAKYRSG
                     N"
     sig_peptide     69102..69179
                     /locus_tag="Mesop_0066"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    69192..70946
                     /locus_tag="Mesop_0066"
                     /note="ABC-type oligopeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     OppA; COG4166"
                     /db_xref="CDD:226636"
     misc_feature    69231..70880
                     /locus_tag="Mesop_0066"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_14; cd08497"
                     /db_xref="CDD:173862"
     gene            70979..72847
                     /locus_tag="Mesop_0067"
                     /db_xref="GeneID:10823872"
     CDS             70979..72847
                     /locus_tag="Mesop_0067"
                     /note="COGs: COG4166 ABC-type oligopeptide transport
                     system periplasmic component;
                     InterPro IPR000914:IPR017909:IPR006311;
                     KEGG: mlo:mll5493 ABC transporter, solute-binding protein;
                     PFAM: extracellular solute-binding protein family 5;
                     SPTR: Extracellular solute-binding protein family 5;
                     PFAM: Bacterial extracellular solute-binding proteins,
                     family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="family 5 extracellular solute-binding protein"
                     /protein_id="YP_004608659.1"
                     /db_xref="GI:337264604"
                     /db_xref="GeneID:10823872"
                     /translation="MAVLPRRDFLALGTAAAAAAMLPGKAFADIATGVKLHGLSAFGD
                     LKYKPDFTHFDYVNPDAPKGGQMNFAPPNATLNQSFLTFNTLNSLVLRGDSPPRTELC
                     FDALMASALDEPDAVYGLLAESVTLSQDRNGFRFNLRPQARFNDGSPLTAEDVAFALK
                     LYKEQGHPNLSKALRHMTEAVAIDPVTLDLNFNGEQSAQNILAIVAMPIVSKAFYADN
                     VFDASTMTPPLGSGPYKIGRVAAGQTVEYERVADYWGRDLPVNRGLYNFDRIRIDFYL
                     DRQAAFEAFKKGDTHFREEFTARVWATGYDFPALKDGKVVKREFPGEKAPDMQGAALN
                     QRRPQFRDERVRRAIARCFDFEWMKRALFYGSYDRSQSNFERSDYKAEGLPSPGELAL
                     LEPFRAELPPEVFGEAVTQPLSDGSGHDRKLLGEASRLLAQAGWKRADNFVVNDKGER
                     LRVEMLAEDDGIVRIFTPWSENMKAIGIDASIRQIDSAQYEQRHSDFDFDLTVLHWSI
                     GATPTDDSLEMLYDSRMAKTPGQRNYPGTESKAIDALIVAAGKAHSRSELVTALRALD
                     RVLRARLDWIPTYYLANHRVAYWDMFGFVEQKPDFGFPAETLWWFDKGKAAKIGKG"
     sig_peptide     70979..71062
                     /locus_tag="Mesop_0067"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    71087..72829
                     /locus_tag="Mesop_0067"
                     /note="ABC-type oligopeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     OppA; COG4166"
                     /db_xref="CDD:226636"
     misc_feature    71126..72760
                     /locus_tag="Mesop_0067"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_14; cd08497"
                     /db_xref="CDD:173862"
     gene            73127..74221
                     /locus_tag="Mesop_0068"
                     /db_xref="GeneID:10823873"
     CDS             73127..74221
                     /locus_tag="Mesop_0068"
                     /note="COGs: COG4174 ABC-type uncharacterized transport
                     system permease component;
                     InterPro IPR000515;
                     KEGG: mlo:mll5491 peptide ABC transporter, permease
                     protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608660.1"
                     /db_xref="GI:337264605"
                     /db_xref="GeneID:10823873"
                     /translation="MGAYILRRILLMIPTLFGIMAISFAVIQFAPGGPVEQVIAKLTN
                     QGGSDRLGGGGGDAGGSNLDVAGDVSSKYRGAQGLDPEFIKKLEKQFGFDKPPLERFG
                     MMLWNYARFDFGNSYFRDISVLDLILEKMPVSISIGLWITLLSYLISIPLGIRKAVKD
                     GTPFDIWTSGVVIVGYAIPGFLFGIMLMVLFAGGSFWDWFPLRGLTSDNWDQLSWWGK
                     IVDYFWHMTLPLTALVLSAFATTTLLTKNSFLEEIRKQYVVTARAKGLSERQVLYGHV
                     FRNAMLIVIAGFPGAFISAFFTGSLLIENIFSLDGLGLLGFRSVVERDYPVVFANLYI
                     FSLLGLFIGLLSDLIYTWVDPRIDFERRDV"
     misc_feature    73127..74215
                     /locus_tag="Mesop_0068"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG4174"
                     /db_xref="CDD:226642"
     sig_peptide     73127..73201
                     /locus_tag="Mesop_0068"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    73517..74161
                     /locus_tag="Mesop_0068"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(73565..73570,73577..73582,73595..73597,73628..73639,
                     73643..73672,73679..73684,73688..73690,73832..73837,
                     73841..73843,73847..73849,73856..73861,73865..73867,
                     73877..73882,73889..73891,73940..73942,73982..73987,
                     73994..73996,74018..74029,74036..74041,74078..74083,
                     74111..74116,74123..74128,74132..74137,74144..74149,
                     74156..74161)
                     /locus_tag="Mesop_0068"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(73646..73690,74018..74035)
                     /locus_tag="Mesop_0068"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(73688..73690,73817..73819,74036..74038,74072..74074,
                     74081..74083,74111..74113)
                     /locus_tag="Mesop_0068"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(73892..73930,73946..73951,73961..73963)
                     /locus_tag="Mesop_0068"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            74221..75366
                     /locus_tag="Mesop_0069"
                     /db_xref="GeneID:10823874"
     CDS             74221..75366
                     /locus_tag="Mesop_0069"
                     /note="COGs: COG4239 ABC-type uncharacterized transport
                     system permease component;
                     InterPro IPR000515;
                     KEGG: mlo:mll5492 peptide ABC transporter, permease
                     protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608661.1"
                     /db_xref="GI:337264606"
                     /db_xref="GeneID:10823874"
                     /translation="MSEASVTAGVVPERMPRPFLSPLNKRRLQNFKANKRGYWSLWIF
                     LVLFVLSLFAEFIANDKPIIASYKGEILFPVLVAYPEEKFGGFYAVTDYRDPVIQDEI
                     NAHGWMIWPPVRYSYQTVNNAIPEAAPAKPSWEYDAKTRCNQYPQGAADPACNVGNWN
                     WLGTDDQARDVLARVIYGFRISVLFGLILTAGSALIGVGAGALQGYFGGWTDLLFQRF
                     IEIWSAIPVLYLLLIVAAILPPGFFILLGLMLLFSWVALVGVVRAEFLRARNFEYVNA
                     ARALGVPNRTIMFRHLLPNAMVATLTFLPFLLSGSISTLTSLDYLGFGLPPGSASLGE
                     LLKQAQRNLNAPWLGISGFVVISLMLSLLVFVGEATRDAFDPRKTFR"
     misc_feature    74269..75360
                     /locus_tag="Mesop_0069"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG4239"
                     /db_xref="CDD:226690"
     misc_feature    74755..75309
                     /locus_tag="Mesop_0069"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(74803..74808,74815..74820,74833..74835,74863..74874,
                     74878..74907,74914..74919,74923..74925,74974..74979,
                     74983..74985,74989..74991,74998..75003,75007..75009,
                     75019..75024,75031..75033,75082..75084,75124..75129,
                     75136..75138,75157..75168,75175..75180,75226..75231,
                     75259..75264,75271..75276,75280..75285,75292..75297,
                     75304..75309)
                     /locus_tag="Mesop_0069"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(74881..74925,75157..75174)
                     /locus_tag="Mesop_0069"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(74923..74925,74959..74961,75175..75177,75220..75222,
                     75229..75231,75259..75261)
                     /locus_tag="Mesop_0069"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(75034..75072,75088..75093,75103..75105)
                     /locus_tag="Mesop_0069"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            75363..76994
                     /locus_tag="Mesop_0070"
                     /db_xref="GeneID:10823875"
     CDS             75363..76994
                     /locus_tag="Mesop_0070"
                     /note="COGs: COG4172 ABC-type uncharacterized transport
                     system duplicated ATPase component;
                     InterPro IPR017871:IPR003439:IPR013563:IPR003593;
                     KEGG: mlo:mll5490 peptide ABC transporter, ATP-binding
                     protein;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
                     C-terminal region;
                     TIGRFAM: phosphonate C-P lyase system protein PhnK"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608662.1"
                     /db_xref="GI:337264607"
                     /db_xref="GeneID:10823875"
                     /translation="MSEAPLLRVQDLSVAFSQGGGQSVAVDHISFDIAKGETVALVGE
                     SGSGKSVSALSVLKLLPYPSASHPSGKILFQGTDLLAMNEKQLRQVRGNKITMIFQEP
                     MTSLNPLHTIEQQIVEILKLHQGMADRPAKARTLALLNEVGIRDPQKRLDAYPHQLSG
                     GQRQRVMIAMALANEPELLIADEPTTALDVTVQAQILELLAGLKSRKGMSMLFITHDL
                     GIVRKIADRVCVMTKGKIVETGPTKDIFANPQHPYTRHLLAAEPKGKPPAANADAKPV
                     MTGKDIKVWFPIKQGFFRRTVDHVKAVDGIDVTVRAGQTLGVVGESGSGKTTLGLALA
                     RMISSTGTIQFNGRDINQLTFNAMRPLRRELQIVFQDPFGSLSPRMSIAEIIEEGLKI
                     HEPKLSPDERDDKVAAVLKEVGLDPATRNRYPHEFSGGQRQRVAIARAMVLNPRFVML
                     DEPTSALDMSVQAQVVDLLRSLQAKHDLAYLFISHDLKVIRALANDVIVMRNGQIVEA
                     GPSEQIFGNPQTDYTRALIAAAFKIETAPVGIVSQ"
     misc_feature    75363..76964
                     /locus_tag="Mesop_0070"
                     /note="ABC-type uncharacterized transport system,
                     duplicated ATPase component [General function prediction
                     only]; Region: COG4172"
                     /db_xref="CDD:226641"
     misc_feature    75378..76082
                     /locus_tag="Mesop_0070"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    75489..75512
                     /locus_tag="Mesop_0070"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(75498..75503,75507..75515,75660..75662,75906..75911,
                     76008..76010)
                     /locus_tag="Mesop_0070"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    75651..75662
                     /locus_tag="Mesop_0070"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    75834..75863
                     /locus_tag="Mesop_0070"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    75894..75911
                     /locus_tag="Mesop_0070"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    75918..75929
                     /locus_tag="Mesop_0070"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    75996..76016
                     /locus_tag="Mesop_0070"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    76071..>76163
                     /locus_tag="Mesop_0070"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; pfam08352"
                     /db_xref="CDD:254752"
     misc_feature    76200..76889
                     /locus_tag="Mesop_0070"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    76320..76343
                     /locus_tag="Mesop_0070"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(76329..76334,76338..76346,76470..76472,76713..76718,
                     76815..76817)
                     /locus_tag="Mesop_0070"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    76461..76472
                     /locus_tag="Mesop_0070"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    76641..76670
                     /locus_tag="Mesop_0070"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    76701..76718
                     /locus_tag="Mesop_0070"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    76725..76736
                     /locus_tag="Mesop_0070"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    76803..76823
                     /locus_tag="Mesop_0070"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    76878..>76964
                     /locus_tag="Mesop_0070"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            77023..77964
                     /locus_tag="Mesop_0071"
                     /db_xref="GeneID:10823876"
     CDS             77023..77964
                     /locus_tag="Mesop_0071"
                     /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
                     related dehydrogenase;
                     InterPro IPR006140;
                     KEGG: mlo:mll5489 putative 2-hydroxyacid dehydrogenase;
                     PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding;
                     SPTR: D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding;
                     PFAM: D-isomer specific 2-hydroxyacid dehydrogenase, NAD
                     binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding protein"
                     /protein_id="YP_004608663.1"
                     /db_xref="GI:337264608"
                     /db_xref="GeneID:10823876"
                     /translation="MEKGRILLAVTGFHPQRWRDLLSAEREVVLEPDGAKDPSITYAV
                     VWKQRPNLLSSLPNLRAIFSIGAGVDHVFADPGLPDVPVVRVVADNLTQHMTEYVVWR
                     VLDHHRQGMLYRSQQQKKIWHEPQQRAASDISVGIMGLGNLGRAAASVLLSLGFAVNG
                     WSRTDRPMAGVATYCGEAGLIPFLKATDILVVLLPLTPDTQGIINYGVLKELRKRNGL
                     GGSVLINAGRGRLQKDADIARALDDGTLKEASLDVFEVEPLPKTSPLWKHPKVFVTPH
                     AAATSDPVHLAPIMLRQMDAFERGEKLDNLVDRKAGY"
     misc_feature    77035..77961
                     /locus_tag="Mesop_0071"
                     /note="Phosphoglycerate dehydrogenase and related
                     dehydrogenases [Amino acid transport and metabolism];
                     Region: SerA; COG0111"
                     /db_xref="CDD:223189"
     misc_feature    77035..77955
                     /locus_tag="Mesop_0071"
                     /note="Putative glycerate dehydrogenase and related
                     proteins of the D-specific 2-hydroxy dehydrogenase family;
                     Region: GDH_like_2; cd12164"
                     /db_xref="CDD:240641"
     misc_feature    order(77161..77163,77218..77226,77293..77295,77704..77706,
                     77848..77850)
                     /locus_tag="Mesop_0071"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240641"
     misc_feature    order(77221..77226,77275..77277,77293..77295,77305..77307,
                     77437..77451,77503..77514,77518..77520,77599..77607,
                     77617..77622,77698..77706,77776..77781,77848..77850,
                     77854..77859,77953..77955)
                     /locus_tag="Mesop_0071"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240641"
     misc_feature    order(77302..77304,77308..77316,77320..77325,77332..77337,
                     77344..77346,77350..77352,77359..77364,77368..77373,
                     77383..77388,77392..77394,77401..77403,77410..77412,
                     77482..77484,77770..77772,77782..77784,77791..77799,
                     77803..77805,77815..77820,77824..77826,77833..77835,
                     77839..77847,77851..77856,77866..77868)
                     /locus_tag="Mesop_0071"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240641"
     misc_feature    order(77704..77706,77791..77793,77848..77850)
                     /locus_tag="Mesop_0071"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240641"
     gene            complement(77978..78505)
                     /locus_tag="Mesop_0072"
                     /db_xref="GeneID:10823877"
     CDS             complement(77978..78505)
                     /locus_tag="Mesop_0072"
                     /note="COGs: COG0563 Adenylate kinase and related kinase;
                     KEGG: mlo:mlr5488 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608664.1"
                     /db_xref="GI:337264609"
                     /db_xref="GeneID:10823877"
                     /translation="MKLSDLGDRICVLGPSNSGKSTLADAIARKRGLEPVHLDLLHHL
                     PDTDWEPRPKAEFIALHDAAIAGERWVMDGNYSICMPQRFQRATGLILLDISTPASLL
                     RYFRRTLFEKERRGALQGGRDSVKWDMIRHIAVTTPKNRERYQALFEQADLPKLQLSS
                     IKAIKQCFRKWDLAR"
     misc_feature    complement(77981..78481)
                     /locus_tag="Mesop_0072"
                     /note="Adenylate kinase and related kinases [Nucleotide
                     transport and metabolism]; Region: Adk; COG0563"
                     /db_xref="CDD:223637"
     misc_feature    complement(<78179..78481)
                     /locus_tag="Mesop_0072"
                     /note="AAA domain; Region: AAA_17; cl19128"
                     /db_xref="CDD:267481"
     gene            complement(78546..78905)
                     /locus_tag="Mesop_0073"
                     /db_xref="GeneID:10823878"
     CDS             complement(78546..78905)
                     /locus_tag="Mesop_0073"
                     /note="KEGG: mlo:mlr5487 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608665.1"
                     /db_xref="GI:337264610"
                     /db_xref="GeneID:10823878"
                     /translation="MRWNMMILASCLATAGCVGNSMSERQDANIESSLQYDSVPCDQL
                     LARRNGLAQQYNLPTTAKPTFYNPAMGFGPFTPDMRSKAKRDSDKASGEIDAMNRSIE
                     RRDCGKPDKQKKFALPS"
     sig_peptide     complement(78837..78905)
                     /locus_tag="Mesop_0073"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            complement(79031..79948)
                     /locus_tag="Mesop_0074"
                     /db_xref="GeneID:10823879"
     CDS             complement(79031..79948)
                     /locus_tag="Mesop_0074"
                     /note="COGs: COG4976 methyltransferase (contains TPR
                     repeat);
                     InterPro IPR013217:IPR019734:IPR013026;
                     KEGG: mlo:mlr5485 hypothetical protein;
                     PFAM: Methyltransferase type 12;
                     SPTR: Methyltransferase type 12;
                     PFAM: Methyltransferase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="type 12 methyltransferase"
                     /protein_id="YP_004608666.1"
                     /db_xref="GI:337264611"
                     /db_xref="GeneID:10823879"
                     /translation="MKPLQTSSGDLNADRRADYAEMLFASGDHAQAAELLLGALELAP
                     RWAMGWFRLGEMQQTSGRADLAAQAWATSLKLDPADRQGASLKLQLIGKGPAAPAPPS
                     AFVETLFDHYAETFDTALVDRLGYRLPEFLDRQIRKARPGRFRLALDLGCGTGLMGER
                     VRPIVDRLEGFDISAAMLRKARAKGIYDALVKADLQGFSYSGDKADLVTSADVLIYVG
                     RLEALVETVAGLLAGGGLFAFSVETMAEAGDFALQTSRRYAHSQAYVRRTLEANGLSV
                     LALEPTTIRLDRHEPVKGLAVVAGKAYAA"
     misc_feature    complement(79046..79894)
                     /locus_tag="Mesop_0074"
                     /note="Predicted methyltransferase (contains TPR repeat)
                     [General function prediction only]; Region: COG4976"
                     /db_xref="CDD:227310"
     misc_feature    complement(79217..79507)
                     /locus_tag="Mesop_0074"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(79316..79318,79364..79372,79430..79435,
                     79481..79501))
                     /locus_tag="Mesop_0074"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            80098..81105
                     /locus_tag="Mesop_0075"
                     /db_xref="GeneID:10823880"
     CDS             80098..81105
                     /locus_tag="Mesop_0075"
                     /note="COGs: COG1236 exonuclease of the beta-lactamase
                     fold involved in RNA processing;
                     KEGG: mlo:mll5484 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Metallo-beta-lactamase superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608667.1"
                     /db_xref="GI:337264612"
                     /db_xref="GeneID:10823880"
                     /translation="MRASDLLHPRPEGLYCPPGDFFIDPVRPVNRALITHGHSDHARS
                     GHRSVLATRQTLDIMGLRYGEDFAGTTQAARVGETIVLNGVDVSFHPAGHVLGSAQIC
                     VDHQGTRIVASGDYKRQKDATCAPFEPIRCDVFITEATFGLPVFRHPPDTEEIARLLK
                     SAAQFPERTHLVGAYALGKAQRVMRLLRDAGYDKPLYIHGALAKLSDYYQSQGIELGM
                     LEPATVEDGKGDFAGAIVVGPPAAFADRWARRFPDPISCFASGWMRIRQRAKQGGVEL
                     PLIISDHADWDELTATIKETGAGEIWVTHGREEALVRWCELEGIAARPLHLVGYEDEG
                     D"
     misc_feature    80113..81096
                     /locus_tag="Mesop_0075"
                     /note="putative exonuclease, DNA ligase-associated;
                     Region: Xnuc_lig_assoc; TIGR04122"
                     /db_xref="CDD:200373"
     misc_feature    80173..>80442
                     /locus_tag="Mesop_0075"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            81142..81341
                     /locus_tag="Mesop_0076"
                     /pseudo
                     /db_xref="GeneID:10823881"
     gene            81338..82939
                     /locus_tag="Mesop_0077"
                     /db_xref="GeneID:10823882"
     CDS             81338..82939
                     /locus_tag="Mesop_0077"
                     /note="COGs: COG1793 ATP-dependent DNA ligase;
                     InterPro IPR016059:IPR012310:IPR012309;
                     KEGG: mlo:mll5481 ATP-dependent DNA ligase;
                     PFAM: ATP dependent DNA ligase; ATP dependent DNA ligase
                     domain protein;
                     SPTR: ATP dependent DNA ligase;
                     PFAM: ATP dependent DNA ligase domain; DNA ligase N
                     terminus; ATP dependent DNA ligase C terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP dependent DNA ligase"
                     /protein_id="YP_004608668.1"
                     /db_xref="GI:337264613"
                     /db_xref="GeneID:10823882"
                     /translation="MNRFAELLDRLVLTPSRNGKLTLLTDYFRSVEDPDRGLALAAIT
                     GDLNIAAIKPAMLRTLVTERMDPVLFGYSYDYVGDLAETVSLVWPQTSGHIPNREPTL
                     GEVVAKLQAASRSDGPKILAGLLDSAGISSRFAIIKLVTGGLRIGVSARLAKQALADF
                     GKVDVAEIEELWHGLSPPYTALFAWLEGKADKPHNTALALFRPVMLSNPIGDGDLEKL
                     DPADYAAEWKWDGIRVQAVAEGGVRRLYSRTGDDVSGAFPDLADAMNFSATLDGELLV
                     GDPREATGTFSDLQQRLNRKTVTPKMQQQYPAFMRCYDLLQIGGEDLRGLSFRERRTR
                     LEAFMGTLDPSRFDLSPFVDFTDWQALEDLRRAPPHPIIEGVMLKRWDSAYVAGRPKG
                     PWFKWKRDPHTVDAVLMYAQRGHGKRSSFYSDYTFGVWSGAEGEEELVPVGKAYFGFT
                     DEELRQIDKYVRDNTVERFGPVRSVRADRDNGLVLEVAFEGLNRSTRHKSGVAMRFPR
                     ISRLRWDKPANEADRIETLQALLDR"
     misc_feature    81338..82936
                     /locus_tag="Mesop_0077"
                     /note="ATP-dependent DNA ligase; Validated; Region:
                     PRK09247"
                     /db_xref="CDD:236428"
     misc_feature    81347..81811
                     /locus_tag="Mesop_0077"
                     /note="DNA ligase N terminus; Region: DNA_ligase_A_N;
                     pfam04675"
                     /db_xref="CDD:252736"
     misc_feature    81932..82543
                     /locus_tag="Mesop_0077"
                     /note="Adenylation domain of putative bacterial
                     ATP-dependent DNA ligases; Region:
                     Adenylation_DNA_ligase_Bac1; cd07897"
                     /db_xref="CDD:185708"
     misc_feature    order(82013..82024,82028..82036,82076..82084,82088..82090,
                     82094..82096,82154..82156,82181..82186,82193..82201,
                     82274..82276,82457..82459,82466..82468,82472..82474,
                     82517..82519,82523..82525,82529..82531)
                     /locus_tag="Mesop_0077"
                     /note="active site"
                     /db_xref="CDD:185708"
     misc_feature    order(82019..82021,82028..82036,82076..82084,82088..82090,
                     82094..82096,82181..82186,82193..82201,82457..82459,
                     82523..82525,82529..82531)
                     /locus_tag="Mesop_0077"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:185708"
     misc_feature    82541..82924
                     /locus_tag="Mesop_0077"
                     /note="The Oligonucleotide/oligosaccharide binding
                     (OB)-fold domain of archaeal and bacterial ATP-dependent
                     DNA ligases is a DNA-binding module that is part of the
                     catalytic core unit; Region: OBF_DNA_ligase_Arch_LigB;
                     cd07972"
                     /db_xref="CDD:153441"
     misc_feature    order(82577..82591,82604..82606,82664..82669,82673..82690,
                     82814..82816,82820..82825,82829..82831,82844..82855,
                     82859..82861)
                     /locus_tag="Mesop_0077"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:153441"
     gene            complement(82965..84110)
                     /locus_tag="Mesop_0078"
                     /db_xref="GeneID:10823883"
     CDS             complement(82965..84110)
                     /locus_tag="Mesop_0078"
                     /note="KEGG: mlo:mlr5480 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608669.1"
                     /db_xref="GI:337264614"
                     /db_xref="GeneID:10823883"
                     /translation="MDAIEKAIRNALEKGNAEDRAFRERVYRSAFAALDRALQANPGV
                     TVEMAIKRRKSIQATITEIESEFLPAVPDVGLEVDAPAAEPAPGAAPAIEIGDKSPSP
                     AAAVDSPAQPASDAPRSRVLPVVPDIMPDATLPGAPAIDMSAPATSGAATEVAPDRDE
                     RRIRGRRLPLTAIFLTVTVLAAVGIGLFFAMQTGVFKTAAQLDTAPPEAPPTVEDDDF
                     TPADGANAPAKPGSADQSRDWINVFSPTDPTHVAAPSDAKAEVMKDDSGPFLRIQSGA
                     SGSAVAFDVGQGVLEKLAGKHAVFDILARAEDGKDTQISVDCNFGELGDCGRKRYAVG
                     QQRNEYLFDVKFPDKRPGSAGTIAINSDFDKQGKAVDIYEIRVSIEP"
     gene            84399..84474
                     /locus_tag="Mesop_R0002"
                     /db_xref="GeneID:10823884"
     tRNA            84399..84474
                     /locus_tag="Mesop_R0002"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:10823884"
     gene            84628..84816
                     /locus_tag="Mesop_0079"
                     /db_xref="GeneID:10823885"
     CDS             84628..84816
                     /locus_tag="Mesop_0079"
                     /note="COGs: COG5475 Uncharacterized small protein;
                     InterPro IPR019226;
                     KEGG: mlo:mll5459 hypothetical protein;
                     PFAM: Protein of unknown function DUF2158;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Uncharacterized small protein (DUF2158)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608670.1"
                     /db_xref="GI:337264615"
                     /db_xref="GeneID:10823885"
                     /translation="MPNTFKTGDVVKLKSGGPKMTVSDGAASGVYLCHWFNKEGDVWT
                     PQHAGFKSDQLVAADQST"
     misc_feature    84628..84795
                     /locus_tag="Mesop_0079"
                     /note="Uncharacterized small protein (DUF2158); Region:
                     DUF2158; cl02293"
                     /db_xref="CDD:261236"
     gene            85002..85460
                     /locus_tag="Mesop_0080"
                     /db_xref="GeneID:10823886"
     CDS             85002..85460
                     /locus_tag="Mesop_0080"
                     /note="InterPro IPR018247:IPR002048:IPR018249;
                     KEGG: mlo:mll5457 acid shock protein;
                     SPTR: Putative signal transduction protein with EFhand
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative signal transduction protein with EFhand
                     domain"
                     /protein_id="YP_004608671.1"
                     /db_xref="GI:337264616"
                     /db_xref="GeneID:10823886"
                     /translation="MIRSSILVAALSLLTVAAFAQTATQPPADAPPTTTPPAATPPAA
                     APAAPKAKPDLTLAKFQKRREKAIMAADTDGDGKISQPEWGAFQAKHNGKGDPAKSFA
                     RIDSNHDGFIDRAELDAFFAKRFAKLDKNGDGVLTADERPGHKSAPKPEQ"
     sig_peptide     85002..85061
                     /locus_tag="Mesop_0080"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    85209..85364
                     /locus_tag="Mesop_0080"
                     /note="EF-hand domain pair; Region: EF-hand_7; pfam13499"
                     /db_xref="CDD:257819"
     misc_feature    85296..85421
                     /locus_tag="Mesop_0080"
                     /note="EF-hand, calcium binding motif; A diverse
                     superfamily of calcium sensors and calcium signal
                     modulators; most examples in this alignment model have 2
                     active canonical EF hands. Ca2+ binding induces a
                     conformational change in the EF-hand motif, leading to...;
                     Region: EFh; cd00051"
                     /db_xref="CDD:238008"
     misc_feature    order(85314..85316,85320..85322,85326..85328,85347..85349,
                     85386..85388,85392..85394,85398..85400,85419..85421)
                     /locus_tag="Mesop_0080"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238008"
     gene            85506..86048
                     /locus_tag="Mesop_0081"
                     /db_xref="GeneID:10823887"
     CDS             85506..86048
                     /locus_tag="Mesop_0081"
                     /note="COGs: COG1595 DNA-directed RNA polymerase
                     specialized sigma subunit sigma24 homolog;
                     InterPro IPR000838:IPR007627:IPR013249:IPR014284;
                     KEGG: mlo:mll5456 RNA polymerase sigma factor;
                     PFAM: sigma-70 region 2 domain protein; Sigma-70 region 4
                     type 2;
                     SPTR: RNA polymerase sigma factor;
                     TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
                     PFAM: Sigma-70, region 4; Sigma-70 region 2;
                     TIGRFAM: RNA polymerase sigma factor, sigma-70 family"
                     /codon_start=1
                     /transl_table=11
                     /product="ECF subfamily RNA polymerase sigma-24 subunit"
                     /protein_id="YP_004608672.1"
                     /db_xref="GI:337264617"
                     /db_xref="GeneID:10823887"
                     /translation="MSADPDEELVRRVGAGDPAAVQTLVARKLPRILSLAARMLGDAA
                     EAEDVAQETFVRIWRHASSWRRGNARFDTWIHRVTLNLCYDRLRRRREWVTDDVPDVA
                     DPAPLPDAHPREDAFRVEQALQAIAPRQREAIVLVYYQEMSNMEAAATLEISVDALES
                     LLSRGRRALQMILARDGVHD"
     misc_feature    85506..86045
                     /locus_tag="Mesop_0081"
                     /note="RNA polymerase sigma factor; Reviewed; Region:
                     PRK05602"
                     /db_xref="CDD:235530"
     misc_feature    85575..85778
                     /locus_tag="Mesop_0081"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    85857..86015
                     /locus_tag="Mesop_0081"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(85884..85886,85914..85916,85932..85937,85965..85967,
                     85971..85976,85980..85988,85992..85997,86001..86003)
                     /locus_tag="Mesop_0081"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            86041..86181
                     /locus_tag="Mesop_0082"
                     /db_xref="GeneID:10823888"
     CDS             86041..86181
                     /locus_tag="Mesop_0082"
                     /note="SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608673.1"
                     /db_xref="GI:337264618"
                     /db_xref="GeneID:10823888"
                     /translation="MTEKGMTEKGITKTRTTTNARLLSQLAGRAPVSIGARGTFGQGE
                     NR"
     gene            86178..86621
                     /locus_tag="Mesop_0083"
                     /db_xref="GeneID:10823889"
     CDS             86178..86621
                     /locus_tag="Mesop_0083"
                     /note="KEGG: mlo:mll5455 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608674.1"
                     /db_xref="GI:337264619"
                     /db_xref="GeneID:10823889"
                     /translation="MTEENSRAMDAKRFAALAAAYGSDLRRWPQTEREAATAFASSEA
                     GQAISGHAGRLDALLDRYSVPHPGKALHDAILRTAGQHLTRRRRQRFWWVGMGLAGIG
                     LAGAVAGLALVTVVTPEVQPDHYVLDANATAFGDAGPDDTIEEDL"
     misc_feature    86430..>86513
                     /locus_tag="Mesop_0083"
                     /note="CcmE; Region: CcmE; cl00994"
                     /db_xref="CDD:260735"
     gene            86618..87073
                     /locus_tag="Mesop_0084"
                     /db_xref="GeneID:10823890"
     CDS             86618..87073
                     /locus_tag="Mesop_0084"
                     /note="COGs: COG5612 integral membrane protein;
                     KEGG: mlo:mll5454 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608675.1"
                     /db_xref="GI:337264620"
                     /db_xref="GeneID:10823890"
                     /translation="MSTGRNFLIASVVLNVFLAGALAGGAVWIRSGKPAQGYSLEAAG
                     GRLPDQERMLFRKALREVRRESRDIILDGQQARREAADLLRQPVLDTAALSAALERAR
                     NADITVRTRLEQRIIEFAAAGSADERSVLAEGLTRRAGQQPSATPKKSP"
     misc_feature    86618..87061
                     /locus_tag="Mesop_0084"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG5612"
                     /db_xref="CDD:227899"
     sig_peptide     86618..86686
                     /locus_tag="Mesop_0084"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            87184..87465
                     /locus_tag="Mesop_0085"
                     /db_xref="GeneID:10823891"
     CDS             87184..87465
                     /locus_tag="Mesop_0085"
                     /note="KEGG: mch:Mchl_3263 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608676.1"
                     /db_xref="GI:337264621"
                     /db_xref="GeneID:10823891"
                     /translation="MNQLRKYAITAALAVTGTVATVAASSAMPIVSLAQPAALVEHVA
                     WGCGPGWHPNPWGRCVPNRVVVYPRYRYWHGPAYYGWHPHRHWHRWHRW"
     misc_feature    87184..>87384
                     /locus_tag="Mesop_0085"
                     /note="Type VI secretion lipoprotein; Region: T6SS-SciN;
                     cl01405"
                     /db_xref="CDD:260922"
     sig_peptide     87184..87285
                     /locus_tag="Mesop_0085"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            87571..89091
                     /locus_tag="Mesop_0086"
                     /db_xref="GeneID:10823892"
     CDS             87571..89091
                     /locus_tag="Mesop_0086"
                     /note="COGs: COG5267 conserved hypothetical protein;
                     InterPro IPR014917;
                     KEGG: mlo:mll5453 hypothetical protein;
                     PFAM: Protein of unknown function DUF1800;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF1800)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608677.1"
                     /db_xref="GI:337264622"
                     /db_xref="GeneID:10823892"
                     /translation="MAIPASNSPPDPVPDPVLVVFNRFGLGARPGDRDRIAGDPRGYL
                     KAELRQPDIAMISLDDPAYPNLPGSTSAIQASMAANFQRKLDRERMAAAVGQPATANA
                     QNMPAQNMRAQTTPAPIMPAPPVPPPAAPTKPVPPVEATLFRAEAQARFDKALRAQGG
                     FVERLVYFWSNHFCVSVAKDNIVRASAGAFEREAIRPFVLGRFADMLMAVERHPAMLF
                     YLDNQQSIGPDSRAGKNRKRGLNENLARETLELHTLGVGSGYTQADVTSFARILTGWT
                     MAGREGRLGEPGSSVFNANAHEPGDAVLLGKTYPAGGMGQAEAALDDIARHPATARHI
                     ATKFARHFISDDPPAAAVARLAKVFAKSDGNLRALAAALIDMPEAWSTPLAKMRSPVD
                     YVAAIRRAAGPGPNDPGQSLAWLNALGEPLWQPPGPNGFSDLTASWASAEGMKVRLDI
                     AWQAARQARDIGNPSDMLDAVIGPSASPETRQAVARAESKQQGLALLMMASEFQRR"
     misc_feature    87571..89088
                     /locus_tag="Mesop_0086"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5267"
                     /db_xref="CDD:227592"
     gene            89141..90379
                     /locus_tag="Mesop_0087"
                     /db_xref="GeneID:10823893"
     CDS             89141..90379
                     /locus_tag="Mesop_0087"
                     /note="COGs: COG4102 conserved hypothetical protein;
                     InterPro IPR010869;
                     KEGG: mlo:mll5452 hypothetical protein;
                     PFAM: protein of unknown function DUF1501;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF1501)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608678.1"
                     /db_xref="GI:337264623"
                     /db_xref="GeneID:10823893"
                     /translation="MSLLCEVPNPSRRAMLMTGGALFAWAYLPRFARAADNRDPRLIV
                     IVLRGALDGLSAVGPVGDPDYAGLHGDIALSLAGPHAALPLDGFFAVNPAMPVFARLF
                     KDGQAAVVHAAATGYRERSHFDGQDVLESGFAGPGHVATGWLNRALESLPAGDRVATL
                     GGLAVGPSTPLVIRGAAPVLGWAPQSLPAPAGDLAARVLDLYQHRDPVLAVALRNGLD
                     TDKMALDDQMGAKAMKPKGGLDSAAGMRQAAQGSARLIAADDGPRVAALAFDGWDTHV
                     NEGGATGRLATLLGGLDGAFEEFEKGLGERWKDTAIVAITEFGRTAQINGTVGTDHGT
                     GTVVLLAGGAIKGGRVIADWPGLKPAQLFEQRDLAPTSDVRAVLKGLLADQFGLSAAI
                     LGDKVFPESAAVKPMRDLIA"
     sig_peptide     89141..89242
                     /locus_tag="Mesop_0087"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    89150..90376
                     /locus_tag="Mesop_0087"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4102"
                     /db_xref="CDD:226587"
     gene            90494..92242
                     /locus_tag="Mesop_0088"
                     /db_xref="GeneID:10823894"
     CDS             90494..92242
                     /locus_tag="Mesop_0088"
                     /note="COGs: COG1368 Phosphoglycerol transferase and
                     related protein alkaline phosphatase superfamily;
                     InterPro IPR000917;
                     KEGG: bra:BRADO5553 putative sulfatase family protein;
                     PFAM: sulfatase;
                     SPTR: Sulfatase;
                     PFAM: Sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_004608679.1"
                     /db_xref="GI:337264624"
                     /db_xref="GeneID:10823894"
                     /translation="MGKSVVQLQRLVRLFCHPLALVLVSLAGIFAAGRAEHEWLSVPF
                     SLALVAALAGLLLLACGRLAFSVYLAWMSVAFITAVSAIKFRMKGFSLHFYDAVFVSR
                     DAEVYRFLLGSYLHLIVPVVIALALGIAAAIVLFRFDRKIGWPVSVRVLIMAALVVLV
                     PLTFPAEASKDRYFYYMQGRHMSAFFVSLLDLRNLVAEPAFEKRLQAVAPQTPFADTV
                     DCGDRAHLPDVFFVLSESQSDPGNFPQVGNGAGFLQRFAPGAGTPHPMQVETFGGGTW
                     ITNLSLMTGLSATDFGWRSPYLTITLQDKVAGALPEVLARCGYRTAVMTPMDFTFVNE
                     GPFLKSIGFETVLDIKAIAAPFYHLRDNFYYHAAEAFIARHRKEDGRPLFLEIQTMFP
                     HSPYEGRLEPELKVAGEPFSDDVQVSEYLRRMAVARGDFQDFLAGREADVGERGAVVL
                     EFGDHQSSATKPFVDAIAGGDALARPDSIAYRTFYTLTTFNHPLKRPMPGMAPLDVGF
                     LGASLLDAAGLPMSPVMADLVRLRDHCGGSFHGCSDRAAVDAHLRRRVDSGLLHLFPQ
                     AAPLHSLVPLQSAEAR"
     misc_feature    91172..>91858
                     /locus_tag="Mesop_0088"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     gene            complement(92279..95674)
                     /locus_tag="Mesop_0089"
                     /db_xref="GeneID:10823895"
     CDS             complement(92279..95674)
                     /locus_tag="Mesop_0089"
                     /note="COGs: COG0318 Acyl-CoA synthetase
                     (AMP-forming)/AMP-acid ligase II;
                     InterPro IPR020845:IPR011701:IPR002123:IPR000873;
                     KEGG: mlo:mlr5451 acylglycerophosphoethanolamine
                     acyltransferase;
                     PFAM: AMP-dependent synthetase and ligase;
                     phospholipid/glycerol acyltransferase; major facilitator
                     superfamily MFS_1;
                     SMART: phospholipid/glycerol acyltransferase;
                     SPTR: AMP-dependent synthetase and ligase;
                     PFAM: Acyltransferase; AMP-binding enzyme; Major
                     Facilitator Superfamily;
                     TIGRFAM: 1-acyl-sn-glycerol-3-phosphate acyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="YP_004608680.1"
                     /db_xref="GI:337264625"
                     /db_xref="GeneID:10823895"
                     /translation="MNTHLMLSRRFAPLFWTQFLSAFNDNFLKNTLVFLILFTLAADQ
                     AASLVTLAGAVFMAPFLLLSALGGEIADRFDKALIARRLKFAEIAAAGVSVAGIALSS
                     IPVLMTALLMFGIISALFGPIKYGILPDHLERKELPKANAWIESATFAAILGGTIAGG
                     VVSADGIGVMVFGPIMMALAVGCWFVSRYIPATGSAAPDLVIDKNIFRSTWRQVSELR
                     TDKRIWRAGLMTSWFWLIGAIVLSILPTLIKDSLGGNEIAVTAYLAVFAVSIAIGSAI
                     AAWMSQGRIVLLPAPVGTALLALFGLHLAWTIWSMQPSPKAETLSAFFAGPNTIRVAI
                     DLAGMAIASAFLVVPTFAAVQAWSPEARRARVVAAVSIVNAGFMTVGGVVVALIQTKV
                     STGGILFGLAAANAVAAWLMLKYLPTNAFRDFVSILFRAFLRLEIEGMENLKAAGKAP
                     ILALNHVSFLDGPLALTLTDEEPVFAIDYTIAQAWWMKPFMKLARALPLNPAKPMSTR
                     TLIKIVQGGDPLVIFPEGRITVTGGLMKVYDGAAMVADKTGSMVVPIRIDGLEKSPFS
                     RLTSQHVRRRLFPKVKVTILEPVKLEVAPELRGRQRRAAAGAALYQVMSDLVFRTQDI
                     DKTVLEKVILTANERGMKRLAVQDPVTGSLSYGKLLTAAAVLGEKFETLYAGQQTLGI
                     MLPNANGSCATLLGVMSAGKVPAMINFTAGAANILSACKAADVRTVLTSRAFVEQAKL
                     GAVVEEMRSVDIVWLDDLRATIGLKDKLLGLLRKSTPRVARKATDPAVILFTSGSEGT
                     PKGVVLTHRNILANAAQAASRIDFHSGDKVFNVLPIFHSFGLTAGTVLPLISGVPVFF
                     YPSPLHYRIVPELIYASNATIIFGTDTFLSGYARSAHPYDFRSIRYCFAGAEPVKPST
                     RMTYMEKFGVRILEGYGVTETAPVISINTPMYNRSGSVGKIMPGMEYRLDPVPGVDDG
                     GRLHVRGPNVMAGYLRAEKPGVLEPLPDGWHDTGDVVSVDEGFITICGRAKRFAKIGG
                     EMISLAAVEALAGELWKGSLSAVAAVADARKGEKLILITEAPGATRADLLAFAKANGA
                     MDLMVPAEVRVVPKVPVLGSGKLDFAGVTRLVQGEPVAKVEAA"
     misc_feature    complement(92285..95674)
                     /locus_tag="Mesop_0089"
                     /note="acylglycerophosphoethanolamine acyltransferase;
                     Provisional; Region: PRK06814"
                     /db_xref="CDD:235865"
     sig_peptide     complement(95540..95674)
                     /locus_tag="Mesop_0089"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(94472..95644)
                     /locus_tag="Mesop_0089"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(94541..94543,94550..94555,94562..94567,
                     94574..94579,94616..94618,94625..94630,94640..94642,
                     94649..94654,94661..94663,94853..94855,94865..94867,
                     94874..94876,94886..94888,94898..94900,94940..94942,
                     94949..94954,94961..94966,94973..94975,95222..95224,
                     95237..95242,95249..95254,95288..95290,95297..95302,
                     95309..95314,95321..95326,95471..95476,95480..95485,
                     95495..95497,95504..95509,95525..95527,95576..95581,
                     95585..95593,95600..95602))
                     /locus_tag="Mesop_0089"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    complement(93899..94396)
                     /locus_tag="Mesop_0089"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    complement(order(94091..94099,94235..94246,94292..94294,
                     94298..94300,94307..94309))
                     /locus_tag="Mesop_0089"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     misc_feature    complement(92315..93736)
                     /locus_tag="Mesop_0089"
                     /note="C-terminal domain of the acyl-acyl carrier protein
                     synthetase (also called 2-acylglycerophosphoethanolamine
                     acyltransferase, Aas); Region: AAS_C; cd05909"
                     /db_xref="CDD:213277"
     misc_feature    complement(order(93275..93280,93284..93301,93308..93310))
                     /locus_tag="Mesop_0089"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213277"
     misc_feature    complement(order(92345..92347,92579..92581,92612..92614,
                     92621..92623,92654..92656,92876..92893,92954..92959,
                     93299..93301))
                     /locus_tag="Mesop_0089"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213277"
     gene            complement(95920..97509)
                     /locus_tag="Mesop_0090"
                     /db_xref="GeneID:10823896"
     CDS             complement(95920..97509)
                     /locus_tag="Mesop_0090"
                     /note="COGs: COG1014 Pyruvate:ferredoxin oxidoreductase
                     and related 2-oxoacid:ferredoxin oxidoreductase gamma
                     subunit;
                     KEGG: mlo:mlr5450 putative indolepyruvate oxidoreductase
                     subunit B;
                     SPTR: Putative indolepyruvate oxidoreductase subunit B;
                     PFAM: Pyruvate ferredoxin/flavodoxin oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative indolepyruvate oxidoreductase subunit
                     B"
                     /protein_id="YP_004608681.1"
                     /db_xref="GI:337264626"
                     /db_xref="GeneID:10823896"
                     /translation="MLDAVPPFRARPGAQDDERVIKLAVLAVGGQGGGVLADWITDVA
                     ERNGYVAQSTSVAGVAQRTGATIYYVEMARDTGRLPVFALSPSQGDVDILIAAELMEA
                     GRAIIRGFVTPERTTLIASSHRIAAVSEKIEPGDGRASSSKVHGTAEAASKRFIAFDM
                     EKIAADNGSMISASLLGALAGSDALPFTRETYEQAIGAGGRGVKASLAAFGAAFDRAR
                     GAAAPAPKPSEPAIVESALGAGRVSGPQSLLQGWQALAARIDLMPVAMRDMALRGLRK
                     VVDYQDIAYGREYLDRLDKAIALDGAGHGHALSIAAAKHLANAMCYDDMIRVADLKTR
                     STRDKRVRREVGVKDGSILQVTEYFHPRIEEFCGTLPAGLGSYIENRPKLAAFLDRRI
                     NHGRRIRTDSFAGFAALWFIGGLRRWRRRLLRHQVELAHLERWYALALSHVPADYALA
                     VEILNCRRLIKGYSDTHARAQSKFDRVLSALDLLKGRHDAADWIRRLREVALKDEKGD
                     MLDGALKTVATLGPDPAPGTP"
     misc_feature    complement(95950..97479)
                     /locus_tag="Mesop_0090"
                     /note="putative indolepyruvate oxidoreductase subunit B;
                     Reviewed; Region: PRK08312"
                     /db_xref="CDD:236234"
     gene            complement(97502..99655)
                     /locus_tag="Mesop_0091"
                     /db_xref="GeneID:10823897"
     CDS             complement(97502..99655)
                     /locus_tag="Mesop_0091"
                     /EC_number="1.2.7.8"
                     /note="COGs: COG4231 Indolepyruvate ferredoxin
                     oxidoreductase alpha and beta subunits;
                     InterPro IPR011766:IPR017896;
                     KEGG: mlo:mlr5448 indolepyruvate ferredoxin oxidoreductase
                     alpha subunit;
                     PFAM: thiamine pyrophosphate protein domain protein
                     TPP-binding;
                     PRIAM: Indolepyruvate ferredoxin oxidoreductase;
                     SPTR: Indolepyruvate ferredoxin oxidoreductase;
                     PFAM: Thiamine pyrophosphate enzyme, C-terminal TPP
                     binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Indolepyruvate ferredoxin oxidoreductase"
                     /protein_id="YP_004608682.1"
                     /db_xref="GI:337264627"
                     /db_xref="GeneID:10823897"
                     /translation="MAERSFAKEVEKLRLGAGEEFAGEGILAITKALLQCGVGYVGGY
                     QGAPISHLMDVLADAQDILGELGVHFEASASEATATAMLAASVHYPIRGAATFKSTVG
                     TNVASDALANLASGGVTGGALIIVGEDYGEGSSIMQERSHAFAMKSQVWLLDPRPNLP
                     SIVKAVEDGFELSEISNTPVMLQVRIRCCHVHGHFIAKDNKRPPMTVADALEAPRRDT
                     GRIVLPPASFLHEKEKIAKRWPAAVDFIARNRINEFFGSDHGSVGIVMQGGMYNSVIR
                     ALQRLGLSDTYGDADVPLYVLNAVYPLIDDEFLSFCEGKQAVLVVEEGQPNYIEQAFA
                     AMLHKAGRGTRLVGKEHLPMAGEYTGQVMLDGIGAFLRAEAPHLLPGEVRAPNKVGDG
                     VDTADLINVVPGRPPGFCIGCPERPIFAATKLVEQELGKHHIASDIGCHLFSIMPPFE
                     LGATTMGYGLGPASASAFNSPDAKRRSISFVGDGGFWHNGLTSSIGNAVFNKNDGVIV
                     IVDNFYSAATGGQDILSSRAGNKTKSTKHPITEAVKGMGVKWLRHVDRTYDVGKMQDT
                     LREALTTEEKGPKVIVASSECMLNRQRREKPLVDKAIKGGERVIKPKFGVDEDICTGD
                     HACMRLSGCPSLSVKSLDDPLRDDPVASIDQNCVGCGNCGEVADAAVLCPSFYRADVV
                     HNPSRWDRFLEASRRATIGLLQRRRESRRLTFADA"
     misc_feature    complement(97592..99634)
                     /locus_tag="Mesop_0091"
                     /note="Indolepyruvate ferredoxin oxidoreductase, alpha and
                     beta subunits [Energy production and conversion]; Region:
                     COG4231"
                     /db_xref="CDD:226684"
     misc_feature    complement(99110..99514)
                     /locus_tag="Mesop_0091"
                     /note="Pyrimidine (PYR) binding domain of thiamine
                     pyrophosphate (TPP)-dependent enzymes; Region:
                     TPP_enzyme_PYR; cl11410"
                     /db_xref="CDD:264357"
     misc_feature    complement(order(99224..99226,99230..99232,99335..99337,
                     99341..99346,99431..99433,99440..99445,99494..99496))
                     /locus_tag="Mesop_0091"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    complement(order(99320..99322,99329..99334,99389..99391,
                     99398..99406,99410..99415,99422..99424,99431..99433,
                     99440..99445,99494..99496))
                     /locus_tag="Mesop_0091"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    complement(order(99341..99343,99428..99430))
                     /locus_tag="Mesop_0091"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    complement(97895..98446)
                     /locus_tag="Mesop_0091"
                     /note="Thiamine pyrophosphate (TPP) family, IOR-alpha
                     subfamily, TPP-binding module; composed of proteins
                     similar to indolepyruvate ferredoxin oxidoreductase (IOR)
                     alpha subunit. IOR catalyzes the oxidative decarboxylation
                     of arylpyruvates, such as...; Region: TPP_IOR_alpha;
                     cd02008"
                     /db_xref="CDD:238966"
     misc_feature    complement(order(98114..98116,98120..98122,98201..98212,
                     98288..98290))
                     /locus_tag="Mesop_0091"
                     /note="TPP-binding site; other site"
                     /db_xref="CDD:238966"
     gene            complement(99758..100240)
                     /locus_tag="Mesop_0092"
                     /db_xref="GeneID:10823898"
     CDS             complement(99758..100240)
                     /locus_tag="Mesop_0092"
                     /note="COGs: COG1846 Transcriptional regulators;
                     InterPro IPR000835;
                     KEGG: mlo:mlr5447 transcriptional regulator;
                     PFAM: regulatory protein MarR;
                     SMART: regulatory protein MarR;
                     SPTR: Transcriptional regulator, MarR family;
                     PFAM: MarR family"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_004608683.1"
                     /db_xref="GI:337264628"
                     /db_xref="GeneID:10823898"
                     /translation="MEQKVAEKRQRISTLGQIGLQQFAPYLMNRIMGRYNATLRDDFR
                     KQGLTIPQVRTLAVLSVTDGITVNDLSVYTVIEQSTLSRTLDTLEGQGLVRREQGVTD
                     SRIRHVFLTDEGRAEFARAWPAMHDAFEAMFDDVDDAEYAALIATLQKMLKNIRKHDI
                     "
     misc_feature    complement(99770..100138)
                     /locus_tag="Mesop_0092"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(99821..100117)
                     /locus_tag="Mesop_0092"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     misc_feature    complement(order(99896..99898,100034..100036,
                     100043..100045))
                     /locus_tag="Mesop_0092"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(99917..99925,99947..99955,99971..99976,
                     99980..99985,99992..99997,100001..100012,100037..100045))
                     /locus_tag="Mesop_0092"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     gene            complement(100240..101811)
                     /locus_tag="Mesop_0093"
                     /db_xref="GeneID:10823899"
     CDS             complement(100240..101811)
                     /locus_tag="Mesop_0093"
                     /note="COGs: COG1233 Phytoene dehydrogenase and related
                     protein;
                     InterPro IPR006076;
                     KEGG: mlo:mlr5446 hypothetical protein;
                     PFAM: FAD dependent oxidoreductase;
                     SPTR: FAD dependent oxidoreductase;
                     PFAM: Flavin containing amine oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_004608684.1"
                     /db_xref="GI:337264629"
                     /db_xref="GeneID:10823899"
                     /translation="MKAPDHIIVGSGINALVCAAMLGGKGAKVLVLERNDRIGGCMRT
                     EEITAPGFVHDVMATTFVLFITSPAFAALGADLARHGLEFCSTGTPTGVLRPDGSHAV
                     LGTDRAANVAALNAIAAGDGDRHADDVGGIERNAGLLFGLLGGSLWSYPTAKLLAGDA
                     WRRGPRGLGAFLGEALVPARGWLESTYQSETIRALWAPWVLHAGLGPEDAFSGQIAKV
                     IAFALEAAGAPIVKGGAKNLLSAFEALITERGGVISTEADVASIILAGGRATGVRLAS
                     GETVHASKSVICSVTPTQLYGRLLGAEAPKVDIEATQKYRYGKGNFQIHYALDKPPAW
                     RGNGLDKVALLHLTPGLDGVSKACNEAARGMLPEVPTICVGQPHALDPSRCPEGKAIL
                     WLQLPEAPRFIKGDAAGKLQAPADGQWTDALREAYADRAEAILASHIDGFKDSIIARR
                     AYSPADLEAMNINLVGGDPYGGSSALDQSFLWRPFKTSRNHQTGIKNLYHIGASTHPG
                     AGLGGGSGFLLAGRL"
     misc_feature    complement(100291..101811)
                     /locus_tag="Mesop_0093"
                     /note="Phytoene dehydrogenase and related proteins
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG1233"
                     /db_xref="CDD:224154"
     misc_feature    complement(101593..101790)
                     /locus_tag="Mesop_0093"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    complement(100291..>101118)
                     /locus_tag="Mesop_0093"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(101855..102060)
                     /locus_tag="Mesop_0094"
                     /pseudo
                     /db_xref="GeneID:10823900"
     gene            complement(102123..102914)
                     /locus_tag="Mesop_0095"
                     /db_xref="GeneID:10823901"
     CDS             complement(102123..102914)
                     /locus_tag="Mesop_0095"
                     /note="COGs: COG1878 metal-dependent hydrolase;
                     InterPro IPR007325;
                     KEGG: mlo:mlr5444 hypothetical protein;
                     PFAM: cyclase family protein;
                     SPTR: Cyclase family protein;
                     PFAM: Putative cyclase"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclase family protein"
                     /protein_id="YP_004608685.1"
                     /db_xref="GI:337264630"
                     /db_xref="GeneID:10823901"
                     /translation="MDTQKLLGEVAGQLLSGAIRVVDLSAPLGPDTPLIKLPPELAVD
                     TPKIEIHNISRYDKNGPWWAWNWLKLGEHSGTHFDAPQHWISGKDYPDGATDTIPAQN
                     FVGPVNVIDCSKEAAADHDFLLTVDHIKAWEAEHGAINAGEWVVMRTDWYKRNGSEAE
                     FLNANETGPHTPGPTAEAIQFLIGKNIKGWGSETIGTDAGKAGGMETPFPAHTLMHKA
                     NRYGLASLCNLDQLPPKGAILIAAPLKIEHGTGSPIRALALVSGK"
     misc_feature    complement(102129..102866)
                     /locus_tag="Mesop_0095"
                     /note="Kynurenine formamidase [Amino acid transport and
                     metabolism]; Region: COG1878"
                     /db_xref="CDD:224790"
     gene            103033..104607
                     /locus_tag="Mesop_0096"
                     /db_xref="GeneID:10823902"
     CDS             103033..104607
                     /locus_tag="Mesop_0096"
                     /note="COGs: COG1233 Phytoene dehydrogenase and related
                     protein;
                     KEGG: mlo:mll5443 dehydrogenase;
                     SPTR: Dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_004608686.1"
                     /db_xref="GI:337264631"
                     /db_xref="GeneID:10823902"
                     /translation="MSEFDAIFVGAGHNSLACAAHLALKGWKTGIFERSAAIGGAVQT
                     REYTLPGFRHDFGAMNLSLFAGSAFHRKYANELKAQRLEFAPVADCFASAFPDGRWFG
                     VSNDLEKTASRMAAFSAADAAAWRRLVAAFPAEAEHLFRLLGSPMSARALAGTAWTLW
                     RKKGIAGALDTGRLLLSSPRAWLEENFESPHVRATLATWGMHLDFAPDIAGGAVFPYL
                     ESMANQSFGMVLGKGGADTIIRALSGMVTSAGGRIVTGAEVAEITVSAGKATGVRLAS
                     GETHAATKAVIAGVAPKALTGKLLANGSGDSGFDTAMQKFRHAPGTMMIHLALDDLPD
                     WRAGSELRQFAYVHLSPSLDAMSRTYQQAMAGMLPDEPVLVVGQPTAIDSSRAPQGKH
                     VLWVQVRMLPAEILGDAAGKIAPAHWDQIKDVYADRVLDIIETYAPGLRSKILGRAVF
                     SPIDLERENPNLVGGDQVCGSHHLAQNFLFRPAHGYAGWNTPVANLHLTGAATWPGAG
                     TGAASGFMLAQQLGGR"
     misc_feature    103033..104595
                     /locus_tag="Mesop_0096"
                     /note="Phytoene dehydrogenase and related proteins
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG1233"
                     /db_xref="CDD:224154"
     misc_feature    103042..104598
                     /locus_tag="Mesop_0096"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            104719..106248
                     /locus_tag="Mesop_0097"
                     /db_xref="GeneID:10823903"
     CDS             104719..106248
                     /locus_tag="Mesop_0097"
                     /note="COGs: COG0747 ABC-type dipeptide transport system
                     periplasmic component;
                     InterPro IPR000914:IPR017909:IPR006311;
                     KEGG: mlo:mll5441 ABC transporter, periplasmic
                     peptide-binding protein;
                     PFAM: extracellular solute-binding protein family 5;
                     SPTR: Extracellular solute-binding protein family 5;
                     PFAM: Bacterial extracellular solute-binding proteins,
                     family 5 Middle;
                     TIGRFAM: Tat (twin-arginine translocation) pathway signal
                     sequence"
                     /codon_start=1
                     /transl_table=11
                     /product="family 5 extracellular solute-binding protein"
                     /protein_id="YP_004608687.1"
                     /db_xref="GI:337264632"
                     /db_xref="GeneID:10823903"
                     /translation="MTINRRELLGYSAAALGVAAVGLPQIAKAAAGELTIAYNVNLPS
                     WDPTTGPSAVNPTIQGLYQSVFDQFIPQKPDLSFAPGLLTEWGWNDDRTKVMMTVREG
                     VKWHDGSPFTPEDVVWSLQRAGDEKTGNPIQFVWKNVNNFKIDGNKITGDVVQFDPVY
                     FKWMSFLTGYILPKAYYEKVGAEGFEKAPIGTGPYMVEKFERNAFLRLKANPTYWGGK
                     PAFENVTIKFVADAASRVAEIESGSSQVTLEIPYEEYDRLIAKEGLAGSCKPVSDIGM
                     IFFNDIEAMLDKNVRQAAVMAVDKELLVKRLLRGYGQPIATLETPEYTAFDASIKVEH
                     NSEKAKELLAASGYSPEKPVKFTIQTTKGFKPKDYEMIQAIVGMWRKVGIEATIEVYE
                     IAKHYELRAADKLAPAAFYNWGNAIGDPTTSTGFAMYGPSPHSVWDSQDLIDMINPLW
                     GEKDEAKRIAGWKAVDKYIAEQAYVLPLMQYAQPIVHAKGVNVVQHVSGALLPALMTP
                     A"
     sig_peptide     104719..104805
                     /locus_tag="Mesop_0097"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    104812..106194
                     /locus_tag="Mesop_0097"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_10; cd08515"
                     /db_xref="CDD:173880"
     misc_feature    104851..106224
                     /locus_tag="Mesop_0097"
                     /note="ABC-type oligopeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     OppA; COG4166"
                     /db_xref="CDD:226636"
     gene            106461..107468
                     /locus_tag="Mesop_0098"
                     /db_xref="GeneID:10823904"
     CDS             106461..107468
                     /locus_tag="Mesop_0098"
                     /note="COGs: COG0601 ABC-type
                     dipeptide/oligopeptide/nickel transport systems permease
                     components;
                     InterPro IPR000515;
                     KEGG: mlo:mll5440 ABC transporter, permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608688.1"
                     /db_xref="GI:337264633"
                     /db_xref="GeneID:10823904"
                     /translation="MLLQRFLIRLLTMLITLFGVAVVVFVVIRVAPGDPIAMMLPPGA
                     TDADIARLRALYGLDKTIVQQFFIWLSGVARGDFGTSISLRQDVLGLVFNRLPATLEL
                     AIVALVMAVALGGTTAVLGARERGTAVEAGIDIASGAALSIPDFLWGLVLILLFGVLV
                     PIFDISGRVSPQLDLPFVTQFYLFESILRLRFDLTWDLLKHMLMPAVALALPLAAIIS
                     QLLKQSLKEVLDLDYVVLARVKGFSETQVILREALKNAALPTLTLVGVQFTFLIGGTV
                     IVERLFSYEGLGNMAIDAVINRDLPLIQGIVLVFALLFVLINLSVDMMYALLNPRLRH
                     G"
     sig_peptide     106461..106538
                     /locus_tag="Mesop_0098"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    106473..107465
                     /locus_tag="Mesop_0098"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    106746..107408
                     /locus_tag="Mesop_0098"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(106794..106799,106806..106811,106824..106826,
                     106857..106868,106872..106901,106908..106913,
                     106917..106919,107094..107099,107103..107105,
                     107109..107111,107118..107123,107127..107129,
                     107139..107144,107151..107153,107202..107204,
                     107244..107249,107256..107258,107277..107288,
                     107295..107300,107325..107330,107358..107363,
                     107370..107375,107379..107384,107391..107396,
                     107403..107408)
                     /locus_tag="Mesop_0098"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(106875..106919,107277..107294)
                     /locus_tag="Mesop_0098"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(106917..106919,107079..107081,107295..107297,
                     107319..107321,107328..107330,107358..107360)
                     /locus_tag="Mesop_0098"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(107154..107192,107208..107213,107223..107225)
                     /locus_tag="Mesop_0098"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            107461..108309
                     /locus_tag="Mesop_0099"
                     /db_xref="GeneID:10823905"
     CDS             107461..108309
                     /locus_tag="Mesop_0099"
                     /note="COGs: COG1173 ABC-type
                     dipeptide/oligopeptide/nickel transport systems permease
                     components;
                     InterPro IPR006650:IPR000515;
                     KEGG: mlo:mll5439 ABC transporter, permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608689.1"
                     /db_xref="GI:337264634"
                     /db_xref="GeneID:10823905"
                     /translation="MDEARTSRRGLSPRLWLAGGWLLLALLAAILAPLVAPQDPLAQD
                     LMLERLPPFWIDGAEPGYWLGTDSLGRDLLSRLIFGGRIAFIVAFAAAIAACLVGSTL
                     GLIAGYFGGWADRIISRIVDVWMAFPPVLFAILLVAVLGTGLSSVIIAIAVIDWTRFC
                     RVIRAETMGQSRMDYVENARIAGYGRIGIMLREVLPNVVPSIVALLSLEMGIAVIVEA
                     ILSFVNLSISTDDPTWGGIIAEGRLSIHQAWWVLVFPLITLILTVLSFSQFGEALKTR
                     FDPVLR"
     sig_peptide     107461..107565
                     /locus_tag="Mesop_0099"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    107569..108294
                     /locus_tag="Mesop_0099"
                     /note="nickel ABC transporter, permease subunit NikC;
                     Region: nickel_nikC; TIGR02790"
                     /db_xref="CDD:131837"
     misc_feature    107746..108249
                     /locus_tag="Mesop_0099"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(107749..107754,107761..107766,107779..107781,
                     107809..107820,107824..107853,107860..107865,
                     107869..107871,107920..107925,107929..107931,
                     107935..107937,107944..107949,107953..107955,
                     107965..107970,107977..107979,108028..108030,
                     108070..108075,108082..108084,108103..108114,
                     108121..108126,108166..108171,108199..108204,
                     108211..108216,108220..108225,108232..108237,
                     108244..108249)
                     /locus_tag="Mesop_0099"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(107827..107871,108103..108120)
                     /locus_tag="Mesop_0099"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(107869..107871,107905..107907,108121..108123,
                     108160..108162,108169..108171,108199..108201)
                     /locus_tag="Mesop_0099"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(107980..108018,108034..108039,108049..108051)
                     /locus_tag="Mesop_0099"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            108306..109184
                     /locus_tag="Mesop_0100"
                     /db_xref="GeneID:10823906"
     CDS             108306..109184
                     /locus_tag="Mesop_0100"
                     /note="COGs: COG0444 ABC-type
                     dipeptide/oligopeptide/nickel transport system ATPase
                     component;
                     InterPro IPR017871:IPR003439:IPR013563:IPR003593;
                     KEGG: mlo:mll5437 ABC transporter ATP-binding protein;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
                     C-terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608690.1"
                     /db_xref="GI:337264635"
                     /db_xref="GeneID:10823906"
                     /translation="MSACLDIANLSALLPNGQRVLRSVSLSVQPGEVRALVGESGAGK
                     TMIGKAVLGVLPSSVRIVEGDMRLEGEDLGKLAPKARRTLIGARTALIPQDPLTALNP
                     SRRIGSQMTDRLVRILGWSAEKADTRIRQLLDEVQIRDPDRVLRSYPHELSGGMRQRV
                     LIAAAFAAEPRLIVADEPTTALDVTVQKQILRLIAELQREHGTAILFVTHDLGVVAKI
                     SQKVSVLYAGKVVEEAETADLFASPRHPYTRALMAATPLYTDPLASLKPVDETVLAGL
                     AAEIAAADQAWRRPHG"
     misc_feature    108318..109007
                     /locus_tag="Mesop_0100"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    108375..109067
                     /locus_tag="Mesop_0100"
                     /note="nickel import ATP-binding protein NikD; Region:
                     nickel_nikD; TIGR02770"
                     /db_xref="CDD:131817"
     misc_feature    108417..108440
                     /locus_tag="Mesop_0100"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(108426..108431,108435..108443,108585..108587,
                     108831..108836,108933..108935)
                     /locus_tag="Mesop_0100"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    108576..108587
                     /locus_tag="Mesop_0100"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    108759..108788
                     /locus_tag="Mesop_0100"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    108819..108836
                     /locus_tag="Mesop_0100"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    108843..108854
                     /locus_tag="Mesop_0100"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    108921..108941
                     /locus_tag="Mesop_0100"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    108996..>109073
                     /locus_tag="Mesop_0100"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            109177..110013
                     /locus_tag="Mesop_0101"
                     /db_xref="GeneID:10823907"
     CDS             109177..110013
                     /locus_tag="Mesop_0101"
                     /note="COGs: COG1123 ATPase components of various ABC-type
                     transport systems contain duplicated ATPase;
                     InterPro IPR017871:IPR003439:IPR003593;
                     KEGG: mlo:mll5436 ABC transporter ATP-binding protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
                     C-terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608691.1"
                     /db_xref="GI:337264636"
                     /db_xref="GeneID:10823907"
                     /translation="MAEPLFCVRGLKVALPDMTRKPLIGRAPLAQILKGLDFDLPRGS
                     VTGIVGESGSGKSTLGRALVRLSEPSAGSIRFDGRDITHLPETELRPLRRDLQMIFQD
                     PMSSLNPRRTIASIIAAPLKQNGLGDNLKSRVAEALQRVGLPQSFASRYRHELSGGQR
                     QRVGIARALALSPKFVLADEIVSGLDVSTQAQILTLLEKLAAEMGLTVAFISHDLSVI
                     RRLCQQVIVMREGVIVEASATDALFDKPRQAYTRDLIAAIPLPEIDAGWLDIPSAAKA
                     PT"
     misc_feature    109267..109881
                     /locus_tag="Mesop_0101"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    109270..109962
                     /locus_tag="Mesop_0101"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    109324..109347
                     /locus_tag="Mesop_0101"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(109333..109338,109342..109350,109477..109479,
                     109711..109716,109813..109815)
                     /locus_tag="Mesop_0101"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    109468..109479
                     /locus_tag="Mesop_0101"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    109639..109668
                     /locus_tag="Mesop_0101"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    109699..109716
                     /locus_tag="Mesop_0101"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    109723..109734
                     /locus_tag="Mesop_0101"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    109801..109821
                     /locus_tag="Mesop_0101"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    109876..>110007
                     /locus_tag="Mesop_0101"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            110090..110689
                     /locus_tag="Mesop_0102"
                     /db_xref="GeneID:10823908"
     CDS             110090..110689
                     /locus_tag="Mesop_0102"
                     /note="InterPro IPR004360;
                     KEGG: mlo:mll5435 hypothetical protein;
                     PFAM: Glyoxalase/bleomycin resistance protein/dioxygenase;
                     SPTR: Glyoxalase/bleomycin resistance protein/dioxygenase;
                     PFAM: Glyoxalase/Bleomycin resistance protein/Dioxygenase
                     superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004608692.1"
                     /db_xref="GI:337264637"
                     /db_xref="GeneID:10823908"
                     /translation="MKTTITIATLAAAMLGSAGMATAGSIPGMRGHDHTGITVPDMKQ
                     AVDFFTEVVGCKKAMSFGPFADDKGTFMQDLLGVDPKAVIEQVTMVRCGYGSNIELFK
                     YTAPDQKDLTPKNSDIGGFHIAFYVDDVAAAKAYLDGKGVKTRLGPLPVKEGPAAGQT
                     ILYFQAPWGLQLEAISYPEGMAYEKGAETVLWSPKNPEK"
     sig_peptide     110090..110158
                     /locus_tag="Mesop_0102"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    110189..110608
                     /locus_tag="Mesop_0102"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    order(110189..110191,110201..110203,110348..110350,
                     110384..110386,110390..110392,110453..110455,
                     110576..110578,110600..110602,110606..110608)
                     /locus_tag="Mesop_0102"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(110189..110191,110453..110455,110606..110608)
                     /locus_tag="Mesop_0102"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            110833..113127
                     /locus_tag="Mesop_0103"
                     /db_xref="GeneID:10823909"
     CDS             110833..113127
                     /locus_tag="Mesop_0103"
                     /note="COGs: COG1902 NADH:flavin oxidoreductase Old Yellow
                     Enzyme family;
                     InterPro IPR004792:IPR001155;
                     KEGG: mlo:mll5434 hypothetical protein;
                     PFAM: NADH:flavin oxidoreductase/NADH oxidase; HI0933
                     family protein;
                     SPTR: NADH:flavin oxidoreductase/NADH oxidase;
                     PFAM: NADH:flavin oxidoreductase / NADH oxidase family"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavin oxidoreductase/NADH oxidase"
                     /protein_id="YP_004608693.1"
                     /db_xref="GI:337264638"
                     /db_xref="GeneID:10823909"
                     /translation="MKVAVLGGGPAGLYFAISMKLRDAAHDVTVYERNRADDTFGWGV
                     VLSAETLDNLSKNDPVSAVWIKKHFAYWDDIAVIHDGVRTVSSGHGFCGIGRKRLLIL
                     LQRRARELGVKLMFESDIADPKAYMETHDLVVAADGLNSRARNSFVDVFKPDIDTRKC
                     KFVWLGTNQKFDDAFTFIFEKTEHGWVWAHAYQFDSDTATFIVECSEQTWADFGFGAM
                     TQQESIAVCEKIFAKHLGGHSLMTNANHIRGSAWINFPRVLCERWSYKNLALMGDAAA
                     SAHFSIGSGTKLALESAVALAEYVETEPDLDAAFRKYEDARRTEVLKLQSAARNSLEW
                     FEEVERYLGLDPVQFNYSLLTRSQRISHENLRLRDAEWLGGAEEWFQRQAGAGGNSLR
                     RAPMFAPFKLRDMQLSNRVVVSPMAQYKAVDGCPTDWHFTHYAERAKGGAGLIYIEMT
                     CVSPEGRITPGCPGFYAPEHEVAWKRLVDFVHTETEAKICAQIGHSGAKGSTRLGWEG
                     TDVPLTSGNWPVMAASAVAWSPQNQVPKAMDRPDMDRVRDQFVASAEMADRCGFDMLE
                     IHAAHGYLLSSFITPVTNRRTDQYGGSLENRMRYPLEIFRAVRAAWPAGKPISMRISA
                     NDWVGIEGVTPADAVEIARLLHEAGVDICDVSAGQTSVLAKPVYGRMFQTPFSDRIRN
                     EVGMATMAVGNIYEPDHVNSILMAGRADLVALARPHLADPYWTLHAAVTLGDRGVKWP
                     DPYLPGRDQLYRLAERDAAAGLKV"
     misc_feature    110833..113121
                     /locus_tag="Mesop_0103"
                     /note="salicylyl-CoA 5-hydroxylase; Reviewed; Region:
                     PRK08255"
                     /db_xref="CDD:236203"
     misc_feature    110833..111786
                     /locus_tag="Mesop_0103"
                     /note="hypothetical protein; Provisional; Region:
                     PRK07236"
                     /db_xref="CDD:235980"
     misc_feature    112018..113019
                     /locus_tag="Mesop_0103"
                     /note="Old yellow enzyme (OYE) YqjM-like FMN binding
                     domain. YqjM is involved in the oxidative stress response
                     of Bacillus subtilis.  Like the other OYE members, each
                     monomer of YqjM contains FMN as a non-covalently bound
                     cofactor and uses NADPH as a reducing...; Region:
                     OYE_YqiM_FMN; cd02932"
                     /db_xref="CDD:239242"
     misc_feature    order(112072..112077,112081..112083,112087..112089,
                     112177..112179,112306..112308,112534..112536,
                     112543..112545,112549..112551,112693..112695,
                     112798..112800,112849..112851,112906..112911,
                     112969..112971,112975..112983,112990..112992)
                     /locus_tag="Mesop_0103"
                     /note="active site"
                     /db_xref="CDD:239242"
     misc_feature    order(112072..112077,112081..112083,112177..112179,
                     112306..112308,112534..112536,112543..112545,
                     112693..112695,112798..112800,112849..112851,
                     112906..112911,112969..112971,112975..112983,
                     112990..112992)
                     /locus_tag="Mesop_0103"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239242"
     misc_feature    order(112081..112083,112087..112089,112534..112536,
                     112543..112545,112549..112551)
                     /locus_tag="Mesop_0103"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239242"
     misc_feature    order(112084..112086,112114..112119,112123..112128,
                     112135..112137,112147..112149,112846..112848,
                     112852..112854,112909..112911,112927..112929,
                     112996..113001)
                     /locus_tag="Mesop_0103"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239242"
     misc_feature    112549..112551
                     /locus_tag="Mesop_0103"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:239242"
     gene            113124..113897
                     /locus_tag="Mesop_0104"
                     /db_xref="GeneID:10823910"
     CDS             113124..113897
                     /locus_tag="Mesop_0104"
                     /note="COGs: COG1028 Dehydrogenase with different
                     specificities (related to short-chain alcohol
                     dehydrogenase);
                     InterPro IPR002198:IPR002347;
                     KEGG: mlo:mll5433 granaticin polyketide ketoreductase;
                     PFAM: short-chain dehydrogenase/reductase SDR;
                     SPTR: Short-chain dehydrogenase/reductase SDR;
                     PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004608694.1"
                     /db_xref="GI:337264639"
                     /db_xref="GeneID:10823910"
                     /translation="MTAPATIAGKHALVTGGGSGVGRAIALALAGAGIDVTICGRREA
                     ELAKVAGESDRIFGIVADVTDENSIASLYKTAEAARGAFDIVVANAGMAGSTPAHKTT
                     LADWQRTLDVNLTGAFLTVKPALAGMAARKAGRVVFIASTAGLKGYAYVAPYVAAKHG
                     VVGLMRALAAETAKSGVTVNAVCPGFVETDMLEQSIQRIIQKTGRSAGEARASLASTN
                     PQGRFIQPQEVAAAVLWLCGDAAQSITGQAISISGGETW"
     misc_feature    113145..113885
                     /locus_tag="Mesop_0104"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    113157..113876
                     /locus_tag="Mesop_0104"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(113169..113171,113175..113186,113241..113249,
                     113304..113312,113388..113396,113457..113459,
                     113538..113546,113583..113585,113595..113597,
                     113673..113684,113688..113693)
                     /locus_tag="Mesop_0104"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(113460..113462,113544..113546,113583..113585,
                     113595..113597)
                     /locus_tag="Mesop_0104"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            113891..114361
                     /locus_tag="Mesop_0105"
                     /db_xref="GeneID:10823911"
     CDS             113891..114361
                     /locus_tag="Mesop_0105"
                     /note="COGs: COG1846 Transcriptional regulators;
                     InterPro IPR000835;
                     KEGG: mlo:mll5432 transcriptional regulator;
                     PFAM: regulatory protein MarR;
                     SMART: regulatory protein MarR;
                     SPTR: Transcriptional regulator, MarR family;
                     PFAM: MarR family"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_004608695.1"
                     /db_xref="GI:337264640"
                     /db_xref="GeneID:10823911"
                     /translation="MVAGPLPAPSGPGKDRLRLWIRLLRASRTIEAELRERLKKDFNT
                     TLPRFDVMAALYRAPEGMLMSDLSRFLLVSNGNVTGIVDRLVSEGLVARARRNGDRRT
                     SMVRLTDEGTKSFATIAAAHEGWIGELLGKVSEDDARRLTGMLTSFRSNWEGRE"
     misc_feature    113966..114313
                     /locus_tag="Mesop_0105"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    114008..114301
                     /locus_tag="Mesop_0105"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     gene            114358..115170
                     /locus_tag="Mesop_0106"
                     /db_xref="GeneID:10823912"
     CDS             114358..115170
                     /locus_tag="Mesop_0106"
                     /note="COGs: COG1024 Enoyl-CoA hydratase/carnithine
                     racemase;
                     InterPro IPR018376:IPR001753;
                     KEGG: mlo:mll5431 enoyl-CoA hydratase;
                     PFAM: Enoyl-CoA hydratase/isomerase;
                     SPTR: Enoyl-CoA hydratase/isomerase;
                     PFAM: Enoyl-CoA hydratase/isomerase family"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase/isomerase"
                     /protein_id="YP_004608696.1"
                     /db_xref="GI:337264641"
                     /db_xref="GeneID:10823912"
                     /translation="MTGMAGLKPKHFLWEVEGRIAKVRLDRPERKNPLTFDSYAELRD
                     TFRDLVYADDVDAVVFLSNGGNFCSGGDVHDIIGPLVKMDMKELLAFTRMTGDFVKAM
                     LNCGKPIIAAVDGVAVGAGAIIAMSSDIRIATPEAKTAFLFTRVGLAGCDMGACAILP
                     RIIGQGRAAELLYTGRTMTAAEGERWGFYNRLVDAAALEADALDMAARIVSGPTFAHG
                     ITKTQLNQEWSMGLDQAIEAEAQAQAICMQTRDFERAYKAFVAKEKPVFEGD"
     misc_feature    114367..115167
                     /locus_tag="Mesop_0106"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK08258"
                     /db_xref="CDD:181329"
     misc_feature    114391..114984
                     /locus_tag="Mesop_0106"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(114448..114450,114454..114456,114550..114552,
                     114562..114576,114703..114705,114709..114717,
                     114781..114786,114793..114795)
                     /locus_tag="Mesop_0106"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(114568..114570,114715..114717)
                     /locus_tag="Mesop_0106"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(114655..114657,114679..114681,114742..114753,
                     114787..114798,114817..114819,114823..114831,
                     114835..114840,114853..114858,114862..114867,
                     114871..114876,114883..114885,114916..114918,
                     114925..114927,114970..114972,114979..114984)
                     /locus_tag="Mesop_0106"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            115249..116397
                     /locus_tag="Mesop_0107"
                     /db_xref="GeneID:10823913"
     CDS             115249..116397
                     /locus_tag="Mesop_0107"
                     /note="COGs: COG1960 Acyl-CoA dehydrogenase;
                     InterPro IPR006092:IPR006091:IPR006090;
                     KEGG: mlo:mll5430 acyl-CoA dehydrogenase;
                     PFAM: acyl-CoA dehydrogenase domain protein;
                     SPTR: Acyl-CoA dehydrogenase domain protein;
                     PFAM: Acyl-CoA dehydrogenase, C-terminal domain; Acyl-CoA
                     dehydrogenase, middle domain; Acyl-CoA dehydrogenase,
                     N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase domain-containing
                     protein"
                     /protein_id="YP_004608697.1"
                     /db_xref="GI:337264642"
                     /db_xref="GeneID:10823913"
                     /translation="MPDRSFLNWPFFEDRHRELAENLESWCQQNLPVDHHDVDAACRE
                     LVTKLGRDGWLKPTALDTDNPGPLDVRTLCITRETLARHDGLADFAFAMQGLGTGALS
                     LFGTPEQQQWLSKTRAGKAISAFALSEPRSGSDVANTEMTATRDGDGYVLTGEKTWIS
                     NGGIADLYVVFARTGEAPGAKGLSAFLVPGDAKGLGIAERLEVIAPHPLARLSFDQVR
                     LPASALIGKPGDGFRIAMSVLDVFRSTVGAAALGFARRALDESIKRVAERKLFGAPMG
                     ELQMVQGHIADMALDVDAAALLIYRAAWTKDMGAARVTREAAMAKLFATDKAQEVIDK
                     AVQLHGGNGVRKGHIVESLYREIRALRIYEGASDVQKVVIARQVMGAA"
     misc_feature    115282..116388
                     /locus_tag="Mesop_0107"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    115375..116388
                     /locus_tag="Mesop_0107"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(115534..115536,115621..115623,115627..115629,
                     115720..115722,115726..115728,116332..116340,
                     116344..116346,116350..116352)
                     /locus_tag="Mesop_0107"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            116454..116849
                     /locus_tag="Mesop_0108"
                     /db_xref="GeneID:10823914"
     CDS             116454..116849
                     /locus_tag="Mesop_0108"
                     /note="COGs: COG0251 Putative translation initiation
                     inhibitor yjgF family;
                     InterPro IPR006175;
                     KEGG: mlo:mll5429 hypothetical protein;
                     PFAM: Endoribonuclease L-PSP;
                     SPTR: Endoribonuclease L-PSP;
                     PFAM: Endoribonuclease L-PSP"
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="YP_004608698.1"
                     /db_xref="GI:337264643"
                     /db_xref="GeneID:10823914"
                     /translation="MHEILQPAGWAKPVGYANGVAARGRLVFVGGQVGWNGQCQFETD
                     DFVGQVKQTLANIVAVLAEAGATPQHITSMTWYFTDKAEYLANLRGIGEAYREVIGRH
                     FPAMAAMQVMALVEDRAKVEIQATAVIPE"
     misc_feature    116499..116834
                     /locus_tag="Mesop_0108"
                     /note="YjgF, YER057c, and UK114 belong to a large family
                     of proteins present in bacteria, archaea, and eukaryotes
                     with no definitive function. The conserved domain is
                     similar in structure to chorismate mutase but there is no
                     sequence similarity and no...; Region:
                     YjgF_YER057c_UK114_family; cd00448"
                     /db_xref="CDD:100004"
     misc_feature    order(116499..116504,116511..116513,116517..116519,
                     116529..116531,116535..116537,116541..116546,
                     116661..116663,116667..116672,116676..116678,
                     116682..116684,116727..116729,116736..116738,
                     116763..116786,116817..116819,116823..116825,
                     116829..116831)
                     /locus_tag="Mesop_0108"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100004"
     misc_feature    order(116499..116501,116703..116705,116727..116729,
                     116769..116771,116817..116819)
                     /locus_tag="Mesop_0108"
                     /note="putative active site [active]"
                     /db_xref="CDD:100004"
     gene            complement(116851..117939)
                     /locus_tag="Mesop_0109"
                     /db_xref="GeneID:10823915"
     CDS             complement(116851..117939)
                     /locus_tag="Mesop_0109"
                     /note="COGs: COG2141 Coenzyme F420-dependent N5
                     N10-methylene tetrahydromethanopterin reductase;
                     InterPro IPR016048;
                     KEGG: mlo:mlr5427 hypothetical protein;
                     PFAM: Luciferase-like, subgroup;
                     SPTR: Luciferase-like monooxygenase;
                     PFAM: Luciferase-like monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="luciferase-like protein"
                     /protein_id="YP_004608699.1"
                     /db_xref="GI:337264644"
                     /db_xref="GeneID:10823915"
                     /translation="MKPHPLHGPNKLKLGVFSTNADGGLAITDVPERWTASWQDNLTA
                     AQIADRAGLEFMLPIARWRGFGGRNNVREWSFETFTWAAALAMATDRIGLFMTVHVPL
                     VHPLYAAKALATVDHISQGRAGLNIVCGWDPREFGMFGTPLVEKGYDQAAEWIEILER
                     LYASGEPLDYEGTYYRLKEAVSRPASLQVPRPVTMNAAFGGPGRDFAAARCDYLFTTF
                     SEMGDAGKHVADISERADRVGRNVGVYTVAHVVCRPTMEEAQAYYTRYAVDMADHDAV
                     DAHMAGKKEFSQSHDPHAYDRYRQRFAGGAGTYPLIGTPETIAADMAAIAGHGYQGIA
                     LSFVNYTQELPYFCDHVLPILRKAGLRA"
     misc_feature    complement(117145..117906)
                     /locus_tag="Mesop_0109"
                     /note="Alkanesulfonate monoxygenase is the monoxygenase of
                     a two-component system that catalyzes the conversion of
                     alkanesulfonates to the corresponding aldehyde and
                     sulfite. Alkanesulfonate monoxygenase (SsuD) has an
                     absolute requirement for reduced flavin...; Region:
                     Alkanesulfonate_monoxygenase; cd01094"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(117193..117195,117199..117201,
                     117295..117297,117337..117342,117499..117501,
                     117556..117558,117748..117750,117877..117879,
                     117889..117891))
                     /locus_tag="Mesop_0109"
                     /note="active site"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(117388..117393,117397..117408,
                     117412..117414,117526..117531,117538..117540,
                     117589..117591,117598..117600,117607..117612,
                     117619..117624,117628..117630,117679..117681,
                     117688..117693,117700..117702,117709..117711,
                     117745..117759))
                     /locus_tag="Mesop_0109"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(117646..117651)
                     /locus_tag="Mesop_0109"
                     /note="non-prolyl cis peptide bond; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(117145..117162,117181..117192,
                     117373..117414,117502..117510,117526..117552))
                     /locus_tag="Mesop_0109"
                     /note="insertion regions; other site"
                     /db_xref="CDD:238527"
     gene            118061..118822
                     /locus_tag="Mesop_0110"
                     /db_xref="GeneID:10823916"
     CDS             118061..118822
                     /locus_tag="Mesop_0110"
                     /EC_number="4.1.3.39"
                     /note="COGs: COG3836 2 4-dihydroxyhept-2-ene-1 7-dioic
                     acid aldolase;
                     InterPro IPR005000;
                     KEGG: mlo:mll5426 4-hydroxy-2-oxovalerate aldolase;
                     PFAM: HpcH/HpaI aldolase;
                     PRIAM: 4-hydroxy-2-oxovalerate aldolase;
                     SPTR: HpcH/HpaI aldolase;
                     PFAM: HpcH/HpaI aldolase/citrate lyase family"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-2-oxovalerate aldolase"
                     /protein_id="YP_004608700.1"
                     /db_xref="GI:337264645"
                     /db_xref="GeneID:10823916"
                     /translation="MSEFRQKCIGRTNLVGSFAAIPHPVAVEVMAQSGLDFLCIDWEH
                     AQISRDMIETMVRAADVHRVPAMVRVPGHAPEAIQAALDSGAQGVLVPRVSTAAQAQA
                     AVKASRYPPKGERGVGPGRAAGYGYRIPEYLAGANDRIVVAVQVETAEGLANIEAITA
                     VDGVDVVFVGPGDLSVSIDAVGPNGAGRLADAIRTIIGATVAHGRTSGIFCASPQNVG
                     RWAAIGASFFVLASDTMFLGAGTAANCAAARDELA"
     misc_feature    118061..118774
                     /locus_tag="Mesop_0110"
                     /note="HpcH/HpaI aldolase/citrate lyase family; Region:
                     HpcH_HpaI; cl17231"
                     /db_xref="CDD:266573"
     gene            119223..120020
                     /locus_tag="Mesop_0111"
                     /db_xref="GeneID:10823917"
     CDS             119223..120020
                     /locus_tag="Mesop_0111"
                     /note="COGs: COG0834 ABC-type amino acid transport/signal
                     transduction systems periplasmic component/domain;
                     InterPro IPR018313:IPR001638:IPR001320:IPR006311;
                     KEGG: mlo:mll5423 hypothetical protein;
                     PFAM: extracellular solute-binding protein family 3;
                     SMART: extracellular solute-binding protein family 3;
                     ionotropic glutamate receptor;
                     SPTR: Extracellular solute-binding protein family 3;
                     PFAM: Bacterial extracellular solute-binding proteins,
                     family 3"
                     /codon_start=1
                     /transl_table=11
                     /product="family 3 extracellular solute-binding protein"
                     /protein_id="YP_004608701.1"
                     /db_xref="GI:337264646"
                     /db_xref="GeneID:10823917"
                     /translation="MKLTRRNLILLAATIGIAAGPATAYAADVLNVGAYPTNPPFEYK
                     NESGTFEGFEVDIVNEAAKRAGMTTDIADLGFQALFAATTSKRIDVAISSITITPERL
                     KSQSFTQPYYDSDMGIATKTDSAVNTEADLKGKIVGVLSGSTGETWVKGHQEADGFSD
                     VKGYDTQQNLLLDLSAGRVDAAVSDIPGMEYSFTKMKDLKVKQRIKTGEQYGLMMTKD
                     HPLLGKLNDALTAMKKDGTLAAIHKKWFGSDAPADSSTVKEMPLPKA"
     sig_peptide     119223..119300
                     /locus_tag="Mesop_0111"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    119310..119960
                     /locus_tag="Mesop_0111"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    119310..119960
                     /locus_tag="Mesop_0111"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    order(119334..119336,119448..119450,119523..119525,
                     119652..119654,119775..119777)
                     /locus_tag="Mesop_0111"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(119724..119726,119736..119738,119754..119756)
                     /locus_tag="Mesop_0111"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    119841..119858
                     /locus_tag="Mesop_0111"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            120165..120839
                     /locus_tag="Mesop_0112"
                     /db_xref="GeneID:10823918"
     CDS             120165..120839
                     /locus_tag="Mesop_0112"
                     /note="COGs: COG0765 ABC-type amino acid transport system
                     permease component;
                     InterPro IPR000515:IPR010065;
                     KEGG: mlo:mll5422 ABC transporter permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Polar amino acid ABC transporter, inner membrane
                     subunit;
                     TIGRFAM: polar amino acid ABC transporter, inner membrane
                     subunit;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component;
                     TIGRFAM: amine acid ABC transporter, permease protein,
                     3-TM region, His/Glu/Gln/Arg/opine family"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter permease"
                     /protein_id="YP_004608702.1"
                     /db_xref="GI:337264647"
                     /db_xref="GeneID:10823918"
                     /translation="MSLIDTFFNADVIASSLPALLRGFLNTLLLGILSIGIGIPIGLV
                     ISLLRLYAPKPLRWLAVGYTDIFRALPVLVVLILIYYALPFLGIRLSSWASAVTAFAI
                     IMSAYSAEVFRSGIESIPRGQFEASQALGLPFLLTLRKVVLPQAIRVVIPPMTSNCVS
                     MFKDTSLASTVALPELLKEATNAQSLYANPSPLIGAALVYLIFLWPMVRLVSLLEDRF
                     KTEKTR"
     misc_feature    120201..120821
                     /locus_tag="Mesop_0112"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    120234..120776
                     /locus_tag="Mesop_0112"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(120282..120287,120294..120299,120312..120314,
                     120342..120353,120357..120386,120393..120398,
                     120402..120404,120468..120473,120477..120479,
                     120483..120485,120492..120497,120501..120503,
                     120513..120518,120525..120527,120576..120578,
                     120618..120623,120630..120632,120651..120662,
                     120669..120674,120711..120716,120741..120746,
                     120753..120758,120762..120767,120774..120776)
                     /locus_tag="Mesop_0112"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(120360..120404,120651..120668)
                     /locus_tag="Mesop_0112"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(120402..120404,120453..120455,120669..120671,
                     120705..120707,120714..120716,120741..120743)
                     /locus_tag="Mesop_0112"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(120528..120566,120582..120587,120597..120599)
                     /locus_tag="Mesop_0112"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            120889..122178
                     /locus_tag="Mesop_0113"
                     /db_xref="GeneID:10823919"
     CDS             120889..122178
                     /locus_tag="Mesop_0113"
                     /EC_number="2.8.1.7"
                     /note="COGs: COG0520 Selenocysteine lyase;
                     InterPro IPR000192:IPR011340;
                     KEGG: mlo:mll5421 aminotransferase NifS;
                     PFAM: aminotransferase class V;
                     PRIAM: Cysteine desulfurase;
                     SPTR: Cysteine desulfurase family protein;
                     TIGRFAM: cysteine desulfurase family protein;
                     PFAM: Aminotransferase class-V;
                     TIGRFAM: cysteine desulfurase family protein, VC1184
                     subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase family protein"
                     /protein_id="YP_004608703.1"
                     /db_xref="GI:337264648"
                     /db_xref="GeneID:10823919"
                     /translation="MNKHQTDNASAAAFPVDAIRAMFPALQRAGDFIFLDNAAGAQIP
                     QSVLDAVTNHLVSHNVQRGGRYGRSVTVDQSVADARESVALLINAYSPAEICFGMNAT
                     SFIRLVSLGIGQMLARDTEGERDEIVITDMDHDANIATWLALEPAGAKFKWWRMREDG
                     NLHVDDLRPLVSERTRLVACTVTAHSIGSIVNVASVAKIAHAAGAEVFLDCVHYGPHG
                     LIDVQAWDCDYLVCSGYKNFSPHMGFLWGRFETLKRLPTFREDFIPDEPPYKVEAGTF
                     IYENVSGMDAAVQYLELIGRNLAPSNNRSRRENIVAGMGAIRDYELVLAREMLAVLKG
                     CGATIYGVADEARIHERVPTFCFNIGKLSPQRIVEEMAEMQIGIRDGHMYAPRLMKRL
                     NLSMDSGAIRASLVHYNTVEEIHRFGEALRAIVAKLS"
     sig_peptide     120889..120975
                     /locus_tag="Mesop_0113"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    120928..122151
                     /locus_tag="Mesop_0113"
                     /note="cysteine desulfurase family protein, VC1184
                     subfamily; Region: am_tr_V_VC1184; TIGR01976"
                     /db_xref="CDD:233664"
     misc_feature    order(121189..121194,121201..121203,121432..121434,
                     121516..121518,121525..121527,121585..121587,
                     121594..121596)
                     /locus_tag="Mesop_0113"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    121594..121596
                     /locus_tag="Mesop_0113"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(122294..123124)
                     /locus_tag="Mesop_0114"
                     /db_xref="GeneID:10823920"
     CDS             complement(122294..123124)
                     /locus_tag="Mesop_0114"
                     /note="COGs: COG1123 ATPase components of various ABC-type
                     transport systems contain duplicated ATPase;
                     InterPro IPR017871:IPR003439:IPR013563:IPR003593;
                     KEGG: mlo:mlr5420 ABC transporter ATP-binding component;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
                     C-terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608704.1"
                     /db_xref="GI:337264649"
                     /db_xref="GeneID:10823920"
                     /translation="MSTTVLEGKNIVRDYHIGGGLFTGPRTVHAVKGVSFTVDKGKTL
                     AIVGESGCGKSTLARIITLIDPATSGDLFIDGNKVDIARGGLTREMRRKVQIVFQNPY
                     GSLNPRQKIGDVLGEPLLINTDKPAAERRDLAMKMLKKVGLGHEHYNRYPHMFSGGQR
                     QRIAIARALMLNPSLLVLDEPVSALDLSVQAQVLNLLADLQDEFQLTYVFISHDLSVV
                     RYIADDVMVMYFGEAVEYGSRDEVFSDPKHSYTKTLFAATPRADVASIKARLAKKKAA
                     "
     misc_feature    complement(122339..123118)
                     /locus_tag="Mesop_0114"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    complement(122414..123112)
                     /locus_tag="Mesop_0114"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(122960..122983)
                     /locus_tag="Mesop_0114"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(122486..122488,122585..122590,
                     122828..122830,122957..122965,122969..122974))
                     /locus_tag="Mesop_0114"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(122828..122839)
                     /locus_tag="Mesop_0114"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(122633..122662)
                     /locus_tag="Mesop_0114"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(122585..122602)
                     /locus_tag="Mesop_0114"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(122567..122578)
                     /locus_tag="Mesop_0114"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(122480..122500)
                     /locus_tag="Mesop_0114"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<122339..122425)
                     /locus_tag="Mesop_0114"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(123121..123978)
                     /locus_tag="Mesop_0115"
                     /db_xref="GeneID:10823921"
     CDS             complement(123121..123978)
                     /locus_tag="Mesop_0115"
                     /note="COGs: COG0444 ABC-type
                     dipeptide/oligopeptide/nickel transport system ATPase
                     component;
                     InterPro IPR017871:IPR003439:IPR013563:IPR003593;
                     KEGG: mlo:mlr5419 ABC transporter ATP-binding component;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
                     C-terminal region"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608705.1"
                     /db_xref="GI:337264650"
                     /db_xref="GeneID:10823921"
                     /translation="MSLLEIKNLTVSFDTAAGPFMAVQGIDLSIEPREVLAIVGESGS
                     GKSVSMLAVMGLLPNTATVKADRMAFDGVDLLKLSPSERRKIVGKDISMIFQEPIASL
                     NPCFTVGFQIEEVLRFHMGMDRAQRRARAIELMKLVGIADPEERLSSFPHQMSGGQCQ
                     RVMIAIAIACNPKLLIADEPTTALDVTIQKQILDLLVSLQAKYGMGLIMITHNMGVVA
                     ETADRVIVQYKGRKMEEADVLSLFESPKSNYTRALLSALPENAVGDRLPTVSDMLFEP
                     APSAAGASA"
     misc_feature    complement(123205..123978)
                     /locus_tag="Mesop_0115"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    complement(123271..123972)
                     /locus_tag="Mesop_0115"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(123838..123861)
                     /locus_tag="Mesop_0115"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(123343..123345,123442..123447,
                     123691..123693,123835..123843,123847..123852))
                     /locus_tag="Mesop_0115"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(123691..123702)
                     /locus_tag="Mesop_0115"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(123490..123519)
                     /locus_tag="Mesop_0115"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(123442..123459)
                     /locus_tag="Mesop_0115"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(123424..123435)
                     /locus_tag="Mesop_0115"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(123337..123357)
                     /locus_tag="Mesop_0115"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<123175..123282)
                     /locus_tag="Mesop_0115"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(123981..124904)
                     /locus_tag="Mesop_0116"
                     /db_xref="GeneID:10823922"
     CDS             complement(123981..124904)
                     /locus_tag="Mesop_0116"
                     /note="COGs: COG1173 ABC-type
                     dipeptide/oligopeptide/nickel transport systems permease
                     components;
                     InterPro IPR000515;
                     KEGG: mlo:mlr5418 ABC transporter permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608706.1"
                     /db_xref="GI:337264651"
                     /db_xref="GeneID:10823922"
                     /translation="MTNEGPATIEAATVVKPQDARLQMFAEFWHYFSVNKGAVIGLFV
                     FALLILIAIFAPLLAPHSPDDQFRDFFLTPPAWQAGGNAQFLLGTDAVGRDMLSRLIY
                     GSRFSLAIGFVVVTTALISGVILGLLAGYCRGWVDTLIMRIMDIILAFPSLLLALVLV
                     AVLGPGLVNAMIAIAFVLQPHFARLTRAAVMAEKNREYVISAKVAGASHLRLMLVTIL
                     PNCIAPLIVQATLSFSNAILEAAALGFLGMGAQPPTPEWGTMLAEAREFILRAWWVVT
                     FPGLAILITVFAINLIGDGLRDALDPKLKRS"
     misc_feature    complement(124680..124835)
                     /locus_tag="Mesop_0116"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    complement(123987..124832)
                     /locus_tag="Mesop_0116"
                     /note="dipeptide transporter; Provisional; Region:
                     PRK10913"
                     /db_xref="CDD:182833"
     misc_feature    complement(124017..124592)
                     /locus_tag="Mesop_0116"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(124017..124022,124029..124034,
                     124041..124046,124050..124055,124062..124067,
                     124125..124130,124170..124175,124182..124193,
                     124212..124214,124221..124226,124266..124268,
                     124317..124319,124326..124331,124341..124343,
                     124347..124352,124359..124361,124365..124367,
                     124371..124376,124449..124472,124476..124487,
                     124515..124517,124530..124535,124542..124547))
                     /locus_tag="Mesop_0116"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(124176..124193,124449..124469))
                     /locus_tag="Mesop_0116"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(124065..124067,124125..124127,
                     124134..124136,124173..124175,124389..124391))
                     /locus_tag="Mesop_0116"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(124245..124247,124257..124262,
                     124278..124316))
                     /locus_tag="Mesop_0116"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(124906..125913)
                     /locus_tag="Mesop_0117"
                     /db_xref="GeneID:10823923"
     CDS             complement(124906..125913)
                     /locus_tag="Mesop_0117"
                     /note="COGs: COG0601 ABC-type
                     dipeptide/oligopeptide/nickel transport systems permease
                     components;
                     InterPro IPR000515;
                     KEGG: mlo:mlr5417 ABC transporter permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Nickel-transporting ATPase;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608707.1"
                     /db_xref="GI:337264652"
                     /db_xref="GeneID:10823923"
                     /translation="MLRYILGKLALIIPTFIGITILAFGFVRILPGDPVLVLAGERGL
                     SPERHTALMHQFGFDLPIWQQYLTYLTNILSGDFGTSFSTKTPVLKDFLVRFPATVEL
                     AIFAMIFAVVLGVAAGIFAAIRRGSWFDQLTMGTALAGYSMPIFWWGLLLIIVFSGTL
                     HWTPVSGRIDLLYFFKPVTGFMTIDSLISGQKGAFRSALSHLVLPTIVLGTIPLAVIA
                     RQTRSAMLEVLGEDYVRTARAKGLAPRRVIGLHAFRNALIPVVTTIGLQVGTLLTGAI
                     LTESIFSWPGIGKWMIDAISKRDYFTVQGGLLLIALIVMSVNLIVDVLYAVINPRIRA
                     N"
     misc_feature    complement(124915..125913)
                     /locus_tag="Mesop_0117"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(124969..125628)
                     /locus_tag="Mesop_0117"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(124969..124971,124978..124983,
                     124990..124995,124999..125004,125011..125016,
                     125044..125049,125074..125079,125086..125097,
                     125116..125118,125125..125130,125170..125172,
                     125221..125223,125230..125235,125245..125247,
                     125251..125256,125263..125265,125269..125271,
                     125275..125280,125455..125457,125461..125466,
                     125473..125502,125506..125517,125548..125550,
                     125563..125568,125575..125580))
                     /locus_tag="Mesop_0117"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(125080..125097,125455..125499))
                     /locus_tag="Mesop_0117"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(125014..125016,125044..125046,
                     125053..125055,125077..125079,125293..125295,
                     125455..125457))
                     /locus_tag="Mesop_0117"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(125149..125151,125161..125166,
                     125182..125220))
                     /locus_tag="Mesop_0117"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(125965..127557)
                     /locus_tag="Mesop_0118"
                     /db_xref="GeneID:10823924"
     CDS             complement(125965..127557)
                     /locus_tag="Mesop_0118"
                     /note="COGs: COG0747 ABC-type dipeptide transport system
                     periplasmic component;
                     InterPro IPR000276:IPR000914;
                     KEGG: bmr:BMI_I1599 dipeptide ABC transporter,
                     extracellular solute-binding protein family 5;
                     PFAM: extracellular solute-binding protein family 5;
                     SPTR: Extracellular solute-binding protein family 5;
                     PFAM: Bacterial extracellular solute-binding proteins,
                     family 5 Middle"
                     /codon_start=1
                     /transl_table=11
                     /product="family 5 extracellular solute-binding protein"
                     /protein_id="YP_004608708.1"
                     /db_xref="GI:337264653"
                     /db_xref="GeneID:10823924"
                     /translation="MKKKLTFAAALLAASVLGGVANAKTLVYCAEASPEGFDPAPYTA
                     GQTFDASSRTVFNRLVEFDHGKTTTSPGLAESWTISDDGKEYTFKLRKGVKFAATDYF
                     TPTRDFNADDVVFSFQRQVDKTGPWFQYIPGIAYQYYNDQFGDNITKVEKVDDLTVKF
                     TLKEPAITFIPTLGMDFASVVSKEYADKLQADKTPELFNQKPIGTGPFIFVDYQTDAA
                     IRYKANPDYWGGKQKIDDLVFAITTDPAVRAQKLKAGECNIMSYPAPADIAGLQADAN
                     LKVDEQEGLNVGALMYNTQQKPFDDVRVRKALNMAINKKAIIDAVFQGAGQVAVNPIP
                     PTMWSYNKDVKDDPYDPDAAKKLLEEAGVKDLKMNVWAMPVSRPYMPNARRTAELIQA
                     DFAKVGVTVNIVSYDWGEYLKRASAVDHDGAVIVGWTGDNGDPDNFLGVLLSCASVGS
                     NNRAEWCNKDFDALINKAKTVSDQAERTKLYEQAQVIFKEQAPWATLAHSKVFMPMQK
                     TVSGFAMDPLGIHRFDGVDIAE"
     sig_peptide     complement(127489..127557)
                     /locus_tag="Mesop_0118"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(125968..127497)
                     /locus_tag="Mesop_0118"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(126019..127485)
                     /locus_tag="Mesop_0118"
                     /note="The substrate-binding component of an ABC-type
                     dipeptide import system contains the type 2 periplasmic
                     binding fold; Region: PBP2_DppA_like; cd08493"
                     /db_xref="CDD:173858"
     misc_feature    complement(order(126265..126267,126271..126282,
                     126322..126324,126334..126336))
                     /locus_tag="Mesop_0118"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173858"
     gene            128053..130107
                     /locus_tag="Mesop_0119"
                     /db_xref="GeneID:10823925"
     CDS             128053..130107
                     /locus_tag="Mesop_0119"
                     /note="COGs: COG0318 Acyl-CoA synthetase
                     (AMP-forming)/AMP-acid ligase II;
                     InterPro IPR020845:IPR000873;
                     KEGG: mlo:mll5415 acyl-CoA synthetase;
                     PFAM: AMP-dependent synthetase and ligase;
                     SPTR: AMP-dependent synthetase and ligase;
                     PFAM: AMP-binding enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="YP_004608709.1"
                     /db_xref="GI:337264654"
                     /db_xref="GeneID:10823925"
                     /translation="MAKASKTPVKASAKAVSKPAAGTDGKGKATAKTAAAKTAAKPAV
                     KAPAAKAAAATKSVTNPAAKAAPAKTSPTKAPAAKISPAKASPAKTGANKTGAAKAAL
                     PAKAVPAPKPAPAKRLPKALTELTAGLPEKLWLKSYPKNMPAEIGALPYNSIGDFLVG
                     ACKQFAGQPAFTCMGKSITYAELERLSAAFGAYLQSTGLQKGSRVALMMPNVLQYPVA
                     MMAVVRAGYTVVNINPLYTPRELEHQLKDSGAQAIVILENFANTLQAIVARTSVKHVV
                     VAAMGDMLGGLKGTIVNLVVRRVKKMVPTWSLPGHVKFNAALKAGGGMNFKPATVAAN
                     DVAFLQYTGGTTGISKGATLLHSNVLANVAQNSLWVEDAYTIKPKPAHLNLICALPLY
                     HIFALTVNALMGMQMGGQNILIPNPRDIPGFVKELGKYPIHIFPGLNTLFNALLNNED
                     FRKLDFKPLVLTLGGGMAVQKGVAERWKALTGCPVSEGYGLSETSPVATANKFSSGDF
                     TGTIGLPLPSTEIAIRDDDGNNVPLGEVGEICIRGPQVMAGYWNRPDETAKVMTKDGF
                     FKSGDMGFMDERGYTKIVDRKKDMILVSGFNVYPTELEEVVAMHPGVLEVAAIGVPDE
                     HSGEVPKLFIVKKDPALTVETITAFCRENLTGYKRPRYIEFRTELPKTPVGKILRRAL
                     RE"
     misc_feature    128440..130101
                     /locus_tag="Mesop_0119"
                     /note="Long-chain-fatty-acid--CoA ligase; Validated;
                     Region: PRK07059"
                     /db_xref="CDD:235923"
     misc_feature    128512..130101
                     /locus_tag="Mesop_0119"
                     /note="Prokaryotic long-chain fatty acid CoA synthetases
                     similar to Escherichia coli FadD; Region:
                     FC-FACS_FadD_like; cd05936"
                     /db_xref="CDD:213302"
     misc_feature    order(129067..129069,129076..129093,129097..129102)
                     /locus_tag="Mesop_0119"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213302"
     misc_feature    order(129076..129078,129445..129450,129511..129528,
                     129763..129765,129799..129801,129808..129810,
                     129841..129843,130078..130080)
                     /locus_tag="Mesop_0119"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213302"
     misc_feature    order(129076..129078,129217..129222,129364..129366,
                     129370..129375,129382..129384,129445..129450,
                     129511..129528,129763..129765,129799..129801,
                     129808..129810,129832..129843,130021..130023)
                     /locus_tag="Mesop_0119"
                     /note="putative active site [active]"
                     /db_xref="CDD:213302"
     misc_feature    order(129217..129219,129370..129375,129382..129384,
                     129445..129447,129832..129840,130003..130005,
                     130021..130023)
                     /locus_tag="Mesop_0119"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213302"
     gene            130116..130868
                     /locus_tag="Mesop_0120"
                     /db_xref="GeneID:10823926"
     CDS             130116..130868
                     /locus_tag="Mesop_0120"
                     /note="COGs: COG3897 methyltransferase;
                     InterPro IPR007848;
                     KEGG: mlo:mll5414 hypothetical protein;
                     PFAM: methyltransferase small;
                     SPTR: Putative uncharacterized protein;
                     manually curated;
                     PFAM: Ribosomal protein L11 methyltransferase (PrmA)"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase small"
                     /protein_id="YP_004608710.1"
                     /db_xref="GI:337264655"
                     /db_xref="GeneID:10823926"
                     /translation="MDSDRAGDGGPDHGLRLDPAEFIKANMRLVPVPALPEIRFYTAH
                     PGSGLRRLVDPENEGDADDDGPEPQPPYWAYAWAGGAVLARYILDNPSTVTGRRVLDL
                     GAGSGIVGIAAAKAGARTVIAAEIDRNGVAALTLNAAANGVAITVVGDDVTKGAPPAV
                     DMVLAGDVFYGQDVARRVMPFLDRCLAAGIEVLVGDPGRAYLPRSRLRLVAEYKVPDF
                     GDAKGAATRPSSVFRFEGRRSLALGSQPNHSE"
     misc_feature    130344..>130463
                     /locus_tag="Mesop_0120"
                     /note="Putative methyltransferase; Region:
                     Methyltransf_16; pfam10294"
                     /db_xref="CDD:255884"
     misc_feature    130407..130673
                     /locus_tag="Mesop_0120"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(130419..130439,130488..130493,130563..130571,
                     130611..130613)
                     /locus_tag="Mesop_0120"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(130907..131839)
                     /locus_tag="Mesop_0121"
                     /db_xref="GeneID:10823927"
     CDS             complement(130907..131839)
                     /locus_tag="Mesop_0121"
                     /note="COGs: COG0583 Transcriptional regulator;
                     InterPro IPR000847:IPR005119;
                     KEGG: atc:AGR_pAT_467 hypothetical protein;
                     PFAM: LysR substrate-binding; regulatory protein LysR;
                     SPTR: Transcriptional regulator, LysR family;
                     PFAM: Bacterial regulatory helix-turn-helix protein, lysR
                     family; LysR substrate binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004608711.1"
                     /db_xref="GI:337264656"
                     /db_xref="GeneID:10823927"
                     /translation="MVEHIALDRLTGIIAFARAGSLGSYTAAARALSISPSAVSKSIQ
                     RLERHLGLSLFTRTTRSLTFTPEGRDLHERALRLLREAEEIEQAAMTARSEPSGTLRV
                     AASLPIGLHLIAPALPAFRRLHPNLVVDLRLGDQTVDMIEEGIDVAIRIGDLADTRLL
                     SRKLAPHRLCCFASPAYLEERGTPTHPDDLVGHDTVNLRYQSTGQTFRWPFRIGDHEI
                     EIVPNAGVVADASDAVLIMLAAGGGIGIGASFMAAPYVKRGDLVPVLSTFAVERNNVT
                     VLWPASRRANPAVRAFLTMLDAAFMRRMAVSSID"
     misc_feature    complement(130925..131797)
                     /locus_tag="Mesop_0121"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(131633..131797)
                     /locus_tag="Mesop_0121"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(130952..131548)
                     /locus_tag="Mesop_0121"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(131015..131017,131096..131098,
                     131147..131149,131339..131341,131345..131347,
                     131387..131389,131504..131506,131516..131518))
                     /locus_tag="Mesop_0121"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(131120..131122,131129..131134,
                     131153..131167,131258..131260,131441..131461,
                     131465..131467,131477..131479,131486..131491,
                     131495..131500,131510..131515))
                     /locus_tag="Mesop_0121"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            131932..132945
                     /locus_tag="Mesop_0122"
                     /db_xref="GeneID:10823928"
     CDS             131932..132945
                     /locus_tag="Mesop_0122"
                     /note="COGs: COG0604 NADPH:quinone reductase and related
                     Zn-dependent oxidoreductase;
                     InterPro IPR002364:IPR013154:IPR013149;
                     KEGG: rru:Rru_A0384 NADPH-quinone reductase;
                     PFAM: Alcohol dehydrogenase zinc-binding domain protein;
                     Alcohol dehydrogenase GroES domain protein;
                     SPTR: Alcohol dehydrogenase zinc-binding domain protein;
                     PFAM: Alcohol dehydrogenase GroES-like domain;
                     Zinc-binding dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase zinc-binding
                     domain-containing protein"
                     /protein_id="YP_004608712.1"
                     /db_xref="GI:337264657"
                     /db_xref="GeneID:10823928"
                     /translation="MSDKMKAARLHAFGGPEVLVYEDAPRPDVKPGEVLVRVQAAGLN
                     PPDWYLRDGYRALPPEWRPNASFPLILGTDVSGVIEAVGADAGEFSIGDEVYAMVRFP
                     HELMTGSNAYAHYVSVPASQLALKPAGIDHIHAAGAPMSLLTAWQFLIELGHDEPNPF
                     QPFRHEPVPLDGKTVLINGAGGGVGHLAVQLAKWRGARVIAVASAKNEGLMRDLGVDQ
                     FVDYKTTATEEVVRDVDLVLDAVGGADMERFFHVLKPGGALFLINPLGFTGHEEAEKL
                     GITVSSTQVRSNGAQLAKIARLLEDGIVRVVIDSTFPLAEASRAHQRAADGSIQGKIV
                     LAV"
     misc_feature    131944..132942
                     /locus_tag="Mesop_0122"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    131944..132936
                     /locus_tag="Mesop_0122"
                     /note="alcohol dehydrogenase and quinone reductase-like
                     medium chain degydrogenases/reductases; Region:
                     MDR_like_2; cd05289"
                     /db_xref="CDD:176191"
     misc_feature    order(132061..132069,132076..132078,132349..132351,
                     132361..132363,132469..132486,132541..132546,
                     132550..132552,132592..132594,132649..132654,
                     132715..132720,132778..132786)
                     /locus_tag="Mesop_0122"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176191"
     gene            133014..133319
                     /locus_tag="Mesop_0123"
                     /db_xref="GeneID:10823929"
     CDS             133014..133319
                     /locus_tag="Mesop_0123"
                     /note="COGs: COG1359 conserved hypothetical protein;
                     InterPro IPR007138;
                     KEGG: rlt:Rleg2_4699 antibiotic biosynthesis
                     monooxygenase;
                     PFAM: Antibiotic biosynthesis monooxygenase;
                     SPTR: Antibiotic biosynthesis monooxygenase;
                     PFAM: Antibiotic biosynthesis monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Antibiotic biosynthesis monooxygenase"
                     /protein_id="YP_004608713.1"
                     /db_xref="GI:337264658"
                     /db_xref="GeneID:10823929"
                     /translation="MMLIVTGYMYVEPSSVAEFIQDLQNLAIATRQRDGNLSYDAAVD
                     DPLAGRLLVAERWRDQAALTAHLHATDTMAFVGRWGDTIRGEILKYDVLRKRGLMDE"
     misc_feature    133014..133304
                     /locus_tag="Mesop_0123"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1359"
                     /db_xref="CDD:224278"
     gene            complement(133390..133797)
                     /locus_tag="Mesop_0124"
                     /pseudo
                     /db_xref="GeneID:10823930"
     gene            134498..135688
                     /locus_tag="Mesop_0125"
                     /db_xref="GeneID:10823931"
     CDS             134498..135688
                     /locus_tag="Mesop_0125"
                     /note="InterPro IPR011701;
                     KEGG: rle:RL2626 putative transmembrane protein;
                     PFAM: major facilitator superfamily MFS_1;
                     SPTR: Major facilitator superfamily MFS_1;
                     PFAM: Major Facilitator Superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_004608714.1"
                     /db_xref="GI:337264659"
                     /db_xref="GeneID:10823931"
                     /translation="MSPVTAIRLIFFMDGLIIAKWLPHLPDIQAHLGLDVGQLGLALA
                     ALPLGIMSSLPLIGTFVISRFSERAAIRVTFLWLALTSTLPGLAWDFPSFAIALFFYG
                     SGIAGVEVAMNATADAVESRVGRRIMSSCHGLWSVGNLIGAALGSLALSLHLDAIVTL
                     IVAAPILMALAYASTGRLGHSPISSEPGPALALPDFPLLVLCLLPFCACVLEGAMADW
                     AAVYLRIEHGAQAALTGAGFGVFAAVMAATRLTGDRLVDRVGPVFIAHCCGVSGVLGL
                     LVIWVAPGVWPALVGFALMGFAASLIFPISVTAAARQSGRSAAMNVASLSLICFSGYV
                     IGPPVVGLIADLVGLRNALACLIPFALGVLLLAPRLQPRAAVTGTATAQGSTHLDHWR
                     ASSS"
     misc_feature    134507..135598
                     /locus_tag="Mesop_0125"
                     /note="Cyanate permease [Inorganic ion transport and
                     metabolism]; Region: CynX; COG2807"
                     /db_xref="CDD:225365"
     misc_feature    134522..135607
                     /locus_tag="Mesop_0125"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(134549..134551,134558..134566,134570..134575,
                     134624..134626,134633..134638,134645..134647,
                     134657..134662,134666..134671,134810..134815,
                     134822..134827,134834..134839,134843..134845,
                     134879..134884,134891..134896,134912..134914,
                     135122..135124,135131..135136,135143..135148,
                     135155..135157,135197..135199,135209..135211,
                     135221..135223,135230..135232,135242..135244,
                     135383..135385,135392..135397,135404..135406,
                     135416..135421,135428..135430,135458..135463,
                     135470..135475,135482..135487,135494..135496)
                     /locus_tag="Mesop_0125"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(135718..136440)
                     /locus_tag="Mesop_0126"
                     /db_xref="GeneID:10823932"
     CDS             complement(135718..136440)
                     /locus_tag="Mesop_0126"
                     /note="COGs: COG0546 phosphatase;
                     InterPro IPR005834:IPR005833:IPR006402:IPR006439;
                     KEGG: mlo:mlr5413 phosphoglycolate phosphatase;
                     PFAM: Haloacid dehalogenase domain protein hydrolase;
                     SPTR: HAD-superfamily hydrolase, subfamily IA, variant 3;
                     TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
                     3; HAD-superfamily hydrolase, subfamily IA, variant 1;
                     PFAM: haloacid dehalogenase-like hydrolase;
                     TIGRFAM: haloacid dehalogenase superfamily, subfamily IA,
                     variant 3 with third motif having DD or ED; haloacid
                     dehalogenase superfamily, subfamily IA, variant 1 with
                     third motif having Dx(3-4)D or Dx(3-4)E"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase"
                     /protein_id="YP_004608715.1"
                     /db_xref="GI:337264660"
                     /db_xref="GeneID:10823932"
                     /translation="MADIKGILFDKDGTLVDFNATWLGVADFMAMDAAEGDRWKADRL
                     LAAAGFDFANRRFKPDSIFASGTNMDVVELWFPRLSDEDQMLAVARFNEITSMQGSAM
                     AVALPGIVDTLAALHKRAYRLGVATNDSTSGAEKTLVTLGVAQLFDAAYGYDAVANPK
                     PAPDTIQAFCDLTGLKPAAIAMVGDNRHDLEMARAGGCGLAVGVLSGTGTRESLAEIA
                     DVILDSVADLPDFLSARVKETV"
     misc_feature    complement(135745..136440)
                     /locus_tag="Mesop_0126"
                     /note="Predicted phosphatases [General function prediction
                     only]; Region: Gph; COG0546"
                     /db_xref="CDD:223620"
     misc_feature    complement(135850..136425)
                     /locus_tag="Mesop_0126"
                     /note="haloacid dehalogenase superfamily, subfamily IA,
                     variant 1 with third motif having Dx(3-4)D or Dx(3-4)E;
                     Region: HAD-SF-IA-v1; TIGR01549"
                     /db_xref="CDD:233463"
     misc_feature    complement(135835..136128)
                     /locus_tag="Mesop_0126"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(136060..136062)
                     /locus_tag="Mesop_0126"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(136446..138089)
                     /locus_tag="Mesop_0127"
                     /db_xref="GeneID:10823933"
     CDS             complement(136446..138089)
                     /locus_tag="Mesop_0127"
                     /EC_number="5.3.1.9"
                     /note="COGs: COG0166 Glucose-6-phosphate isomerase;
                     InterPro IPR018189:IPR001672;
                     KEGG: mlo:mlr5411 glucose-6-phosphate isomerase;
                     PFAM: phosphoglucose isomerase (PGI);
                     PRIAM: Glucose-6-phosphate isomerase;
                     SPTR: Glucose-6-phosphate isomerase;
                     PFAM: Phosphoglucose isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glucose-6-phosphate isomerase"
                     /protein_id="YP_004608716.1"
                     /db_xref="GI:337264661"
                     /db_xref="GeneID:10823933"
                     /translation="MDQTAFQKQLAALRDHRAGAPGDMRQAFAADPQRFATFSATDGD
                     MLLDWSKCAVDATTMDLLEGLAKAADLEGRRAAMFAGKKINITEDRAVLHTALRNLSG
                     KGVTVDGQDVKADVIAVLDAMGAFADAIRSGKAAGATGKKITDIVNIGIGGSDLGPAM
                     VTLALAPYHDGPRAHYVSNIDGAHIHDTLKSLSAETTLFIIASKTFTTVETMTNAQTA
                     RDWVQKALGKEAVGKHFAAVSTALDLVAKFGIAPDRVFGFWDWVGGRYSVWGAIGLPV
                     MIAVGPRNFRAFLDGAHEMDEHFRTAPLRKNLPALLGLVGWWHRVICKYPARAVIPYD
                     QRLSRLPAYLQQLDMESNGKSVTLEGTAVTTPTGPLVWGEPGTNGQHAFFQLLHQGTD
                     FIPVEFLAAAVGHEPDLKHQHDLLLANCLAQSEAFMKGRTLEEARAQMLAKGMKPADV
                     DRIAPHRVFSGNRPSLTILYRKLDPRTLGRVIALYEHRVFVEGTLFNINSFDQWGVEL
                     GKELATGLLPVVEGKESAAKRDASTAGLVGHIHQLRGSE"
     misc_feature    complement(136455..138059)
                     /locus_tag="Mesop_0127"
                     /note="glucose-6-phosphate isomerase; Reviewed; Region:
                     pgi; PRK00179"
                     /db_xref="CDD:234679"
     misc_feature    complement(137253..137738)
                     /locus_tag="Mesop_0127"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the first SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_1; cd05015"
                     /db_xref="CDD:240146"
     misc_feature    complement(order(137298..137300,137466..137468,
                     137475..137483,137628..137633,137637..137639))
                     /locus_tag="Mesop_0127"
                     /note="active site"
                     /db_xref="CDD:240146"
     misc_feature    complement(order(137439..137441,137448..137450,
                     137460..137462,137547..137558))
                     /locus_tag="Mesop_0127"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240146"
     misc_feature    complement(136542..137114)
                     /locus_tag="Mesop_0127"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the second SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_2; cd05016"
                     /db_xref="CDD:240147"
     misc_feature    complement(order(136815..136817,136824..136826,
                     136848..136850,136854..136856,136923..136925,
                     136932..136937,136944..136949,136956..136964,
                     136968..136970,137028..137033,137040..137042,
                     137052..137054,137088..137090,137112..137114))
                     /locus_tag="Mesop_0127"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240147"
     misc_feature    complement(order(137040..137042,137052..137054))
                     /locus_tag="Mesop_0127"
                     /note="active site"
                     /db_xref="CDD:240147"
     gene            138377..139870
                     /locus_tag="Mesop_0128"
                     /db_xref="GeneID:10823934"
     CDS             138377..139870
                     /locus_tag="Mesop_0128"
                     /note="COGs: COG1167 Transcriptional regulators containing
                     a DNA-binding HTH domain and an aminotransferase domain
                     (MocR family) and their eukaryotic orthologs;
                     InterPro IPR000524:IPR004839;
                     KEGG: mlo:mll5410 transcriptional regulator;
                     PFAM: regulatory protein GntR HTH; aminotransferase class
                     I and II;
                     SMART: regulatory protein GntR HTH;
                     SPTR: Transcriptional regulator, GntR family with
                     aminotransferase domain;
                     PFAM: Aminotransferase class I and II; Bacterial
                     regulatory proteins, gntR family"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004608717.1"
                     /db_xref="GI:337264662"
                     /db_xref="GeneID:10823934"
                     /translation="MPQRNDTAIWSGLFRISAESGQTLQAQIRQAIVAAILDRQIAAS
                     MPLPSCRILAEKLGVARGTVVLAFQQLVDQGFLVARERRGHFVNPDVLATPAKPHQKA
                     PDQANEIDWKARRQIAASDMPPPAKHENWIKSSYPFVYGQFDPALFPTAEWRECNRMA
                     LAVLEIRNWASDMVDRDDPLLIEQIQARLLPRRGIFANPDEIIVTLGAQNALYMLATL
                     LMTKGSKVAMEDPGYPDARSIFRLAGADIQPVPVDQSGIVTSSIPNDSGFVFVTPSHH
                     CPTMVPLSAERRQDLLARANRHNQIIIEDGYDSQLLDEAPQQALKSLDRSGRVVYVGS
                     MSKTLAPGLRLGYIVASAGLIAELRALRRFMLRHPPANNQRAVALFLSLGHHEALVRR
                     LSSAFDERRKRLVHAISAFLPEWRSTDSAGGTSLWLEGPRGTDSRGLAEAAASRSVII
                     EPGDRFFDRTEKPSRFMRLGISSIALQHIEPGIRELATAAGRRPAAA"
     misc_feature    138434..139864
                     /locus_tag="Mesop_0128"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    138443..138640
                     /locus_tag="Mesop_0128"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(138443..138445,138449..138451,138518..138520,
                     138524..138529,138551..138565,138569..138574,
                     138581..138583,138611..138616,138620..138631)
                     /locus_tag="Mesop_0128"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    138782..139837
                     /locus_tag="Mesop_0128"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(138995..139003,139073..139075,139205..139207,
                     139298..139300,139376..139378,139382..139387,
                     139406..139408)
                     /locus_tag="Mesop_0128"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(139004..139006,139103..139105,139277..139279,
                     139400..139408,139493..139495,139502..139504)
                     /locus_tag="Mesop_0128"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    139385..139387
                     /locus_tag="Mesop_0128"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            140063..141649
                     /locus_tag="Mesop_0129"
                     /db_xref="GeneID:10823935"
     CDS             140063..141649
                     /locus_tag="Mesop_0129"
                     /note="COGs: COG5598 Trimethylamine:corrinoid
                     methyltransferase;
                     InterPro IPR010426;
                     KEGG: mlo:mll5409 trimethylamine methyltransferase MttB;
                     PFAM: trimethylamine methyltransferase;
                     SPTR: Trimethylamine methyltransferase;
                     PFAM: Trimethylamine methyltransferase (MTTB)"
                     /codon_start=1
                     /transl_table=11
                     /product="trimethylamine methyltransferase"
                     /protein_id="YP_004608718.1"
                     /db_xref="GI:337264663"
                     /db_xref="GeneID:10823935"
                     /translation="MSVVVEKQEAADQRSRRSGGREARRAMRAAPLADDIKPVRAGLE
                     GGSYGPLAGNDQERIHEAVLTLLETVGFANAIPSCIEALTKVGATYGDDGRIRFPRAL
                     VLDTIKKAARNFTLHGQDPKHDMVIQGKRVHYGTAGAAVHLVDVEKREYRESLLQDIY
                     DAARIVEGLDNIHFFQRPMVPRDIPDPLEMDFNTLYACVMGTSKHVGTSFTVRENVQP
                     ALEMLYAIAGGEENFRARPFVSNSNCFVVPPMKFAEDACGVLEACVDGGIPILLLSAG
                     QAGATAPAAIAGAVVQAVAEVLAGLVYVNALKPGHPAIFGTWPFVSDLRTGAMSGGSA
                     EQAVLTAACAQMAQFYDLPGGSAAGMTDSKLPDIQSGYEKGITDVMAGLAGLNLVYES
                     AGMHASLLGFCLESLIIDNDMLGHCLRCVRGIEVTDEALSIDTIADVCLRGPGHYLGN
                     EQTLRLMQTEYFYPAVGDRFSPKEWNEKGRPDILQRAIIEKKRVLAERFPRHVPKPLD
                     DKLRARFGEMIKLPRANMGG"
     misc_feature    140108..141643
                     /locus_tag="Mesop_0129"
                     /note="Trimethylamine methyltransferase (MTTB); Region:
                     MTTB; cl15385"
                     /db_xref="CDD:246944"
     gene            complement(141811..142209)
                     /locus_tag="Mesop_0130"
                     /db_xref="GeneID:10823936"
     CDS             complement(141811..142209)
                     /locus_tag="Mesop_0130"
                     /note="KEGG: mlo:mlr5408 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608719.1"
                     /db_xref="GI:337264664"
                     /db_xref="GeneID:10823936"
                     /translation="MAGRRSSLGFLGMFGRSGDLRQLDTALRGADLHPALVPEGVKLT
                     IVNLMKDHWPDEPPPQAYPQVARLFSYCIAGPETFERSQGLQQRQDAEQRIEAAVDAG
                     DSFDAKIVLMALHAKLINAEVVERYGLGTD"
     gene            complement(142350..143741)
                     /locus_tag="Mesop_0131"
                     /db_xref="GeneID:10823937"
     CDS             complement(142350..143741)
                     /locus_tag="Mesop_0131"
                     /note="COGs: COG2059 Chromate transport protein ChrA;
                     InterPro IPR014047:IPR003370;
                     KEGG: mlo:mlr5407 chromate transporter;
                     PFAM: Chromate transporter;
                     SPTR: Chromate transporter, chromate ion transporter (CHR)
                     family;
                     TIGRFAM: chromate transporter, chromate ion transporter
                     (CHR) family;
                     PFAM: Chromate transporter;
                     TIGRFAM: chromate transporter, chromate ion transporter
                     (CHR) family"
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transporter, chromate ion transporter
                     (CHR) family"
                     /protein_id="YP_004608720.1"
                     /db_xref="GI:337264665"
                     /db_xref="GeneID:10823937"
                     /translation="MSALVPQDAAVNSEAPAAPTFAEALRLWTKIGLLSFGGPAGQIA
                     LMHKELVEERRWIGEQRFLHALNYCMLLPGPEAQQLAVYIGWLLHRTIGGLVAGMLFV
                     VPGALVMLILSVLYALYGDVPLVEALFFGVKAAVLAIVVQAVIRIGRRALKNPVMVSI
                     AVAAFIAIYALNVPFPLIVLFAGLTGWLGDRVVPGLFSGSAHGKGDIADIKGAVDLMF
                     ERGELTHVTPTKWHAPRTVAIWLPIWLGPVLAIWWLTGSASVWTEIGRFFSLMAVVTF
                     GGAYAVLAYVAQAAVQSFGWLAPGEMVDGLGLAETTPGPLILVLQFVGFIAAFRHPGG
                     LDPLLAGSLGALLTLWVTFTPCFFWIFLGAPYIEALRGNKALSAALGAITAAVVGVIM
                     NLALWFALHVVFREVHTIGPGMNVPVLSSIDWRAALLSLAAMIAILKLKIGMLPTLAG
                     SALAGVLLLAVSG"
     misc_feature    complement(143178..143699)
                     /locus_tag="Mesop_0131"
                     /note="Chromate transport protein ChrA [Inorganic ion
                     transport and metabolism]; Region: ChrA; COG2059"
                     /db_xref="CDD:224970"
     misc_feature    complement(142371..143654)
                     /locus_tag="Mesop_0131"
                     /note="chromate transporter, chromate ion transporter
                     (CHR) family; Region: 2A51; TIGR00937"
                     /db_xref="CDD:233197"
     misc_feature    complement(142371..142955)
                     /locus_tag="Mesop_0131"
                     /note="Chromate transporter; Region: Chromate_transp;
                     pfam02417"
                     /db_xref="CDD:251281"
     gene            complement(143738..144562)
                     /locus_tag="Mesop_0132"
                     /db_xref="GeneID:10823938"
     CDS             complement(143738..144562)
                     /locus_tag="Mesop_0132"
                     /note="COGs: COG4275 conserved hypothetical protein;
                     InterPro IPR018634:IPR001763;
                     KEGG: mlo:mlr5406 hypothetical protein;
                     PFAM: Chromate resistance exported protein;
                     SMART: Rhodanese domain protein;
                     SPTR: Rhodanese domain protein;
                     PFAM: Chromate resistance exported protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Chromate resistance exported protein"
                     /protein_id="YP_004608721.1"
                     /db_xref="GI:337264666"
                     /db_xref="GeneID:10823938"
                     /translation="MPSTTAITVSQLSRLVGLPGAPMIIDVRIDEDFDADQRLLPASC
                     RRNFKTVSTWASEFAGSQVAVVCQKGQKLSQGVAAWLRHEGISAESLEGGFEAWRDAN
                     GLLVRTEKLPPRDEKGRTVWVTRSRPKVDRIACPWLIRRFVDPHAIFLFVEAAEVPAV
                     ADRFQAVPFDIDNVFWSHRGDRCTFDTMIEEFGLKSEALDRLALVVRAADTASLDLVP
                     QAAGFLAASLGLSRMFRDDLEQLEAGMLLYDAFFRWCRDATEETHNWPGAAGGKTA"
     misc_feature    complement(144263..144547)
                     /locus_tag="Mesop_0132"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cl00125"
                     /db_xref="CDD:260205"
     misc_feature    complement(144362..144364)
                     /locus_tag="Mesop_0132"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     misc_feature    complement(143777..144199)
                     /locus_tag="Mesop_0132"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG4275"
                     /db_xref="CDD:226725"
     gene            complement(144815..146620)
                     /locus_tag="Mesop_0133"
                     /db_xref="GeneID:10823939"
     CDS             complement(144815..146620)
                     /locus_tag="Mesop_0133"
                     /EC_number="4.2.1.9"
                     /note="COGs: COG0129 Dihydroxyacid
                     dehydratase/phosphogluconate dehydratase;
                     InterPro IPR020558:IPR000581;
                     KEGG: mlo:mlr5404 dihydroxy-acid dehydratase;
                     PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase;
                     PRIAM: Dihydroxy-acid dehydratase;
                     SPTR: Dihydroxy-acid dehydratase;
                     PFAM: Dehydratase family;
                     TIGRFAM: dihydroxy-acid dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="YP_004608722.1"
                     /db_xref="GI:337264667"
                     /db_xref="GeneID:10823939"
                     /translation="MAGAPTKKKKFRSQEWFDNPDNPGMTALYLERYLNYGLTRAELM
                     SGKPLIGIAQTGSDLSPCNRHHIELAKRVREGIVSMGGIPFEFPCHPIQETGKRPTAA
                     LDRNLAYLSLVEVLYGYPLDGVVLTIGCDKTTPALLMAAATVNIPAIALSVGPMLNGW
                     HKGKRTGSGTIVWESRQRLSAGEIGYDEFMDIVASSAPSTGYCNTMGTATTMNSLAEA
                     LGMQLPGSAAIPAPYRERGQISYETGKRIVEMVHEDLKPSDIMTRKAFENAIVVNSAI
                     GGSTNAPIHLNAIARHLGVPLDNDDWQKIGLKVPLIVNLQPTGEYLGEDYHHAGGVPA
                     VVAELMKGGLLPHPDALTVNGKSIGDNCKGVANENAEVIRSVDKPLKANAGFINLRGN
                     LFDSAIMKTSGISPEFRERYLSNPKDPEAFEGNAMVFDGPEDYHARIDDPAQGIDEHT
                     ILFMRGAGPVGYPGGAEVVNMQPPAYLIKKGIHALACIGDGRQSGTSGSPSILNASPE
                     AAIGGGLALLKTGDRVRIDLRKGTADILVTDDEITRRRAELQNNGGFHYPKHQTPWQE
                     IQRGMVDQFSEGMVLKPAVKYQDVAHTSGVPRDNH"
     misc_feature    complement(144818..146620)
                     /locus_tag="Mesop_0133"
                     /note="dihydroxy-acid dehydratase; Provisional; Region:
                     PRK13017"
                     /db_xref="CDD:237272"
     gene            146772..147221
                     /locus_tag="Mesop_0134"
                     /db_xref="GeneID:10823940"
     CDS             146772..147221
                     /locus_tag="Mesop_0134"
                     /note="COGs: COG3427 conserved hypothetical protein;
                     InterPro IPR010419;
                     KEGG: mlo:mll5403 hypothetical protein;
                     PFAM: carbon monoxide dehydrogenase subunit G;
                     SPTR: Carbon monoxide dehydrogenase subunit G;
                     PFAM: Carbon monoxide dehydrogenase subunit G (CoxG)"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase subunit G"
                     /protein_id="YP_004608723.1"
                     /db_xref="GI:337264668"
                     /db_xref="GeneID:10823940"
                     /translation="MALVIEGEERIAAPIQKVWEALNDPAVLKESIPGCQSLEMKSPT
                     EMAATVVLKIGPIKATFNGEVTLKNLKPPHAYTIQGEGKGGIAGFAKGGADVTLTEDG
                     PDATVLKYAAKADVGGKIAQLGSRLIESTSKKLAGQFFSTFGEKVGG"
     misc_feature    146784..147215
                     /locus_tag="Mesop_0134"
                     /note="Carbon monoxide dehydrogenase subunit G (CoxG);
                     Region: CoxG; cd05018"
                     /db_xref="CDD:176853"
     misc_feature    order(146784..146786,146790..146792,146796..146798,
                     146823..146831,146835..146840,146853..146855,
                     146865..146867,146883..146885,146901..146903,
                     146907..146909,146913..146915,146919..146921,
                     146925..146927,146940..146942,146952..146954,
                     146964..146972,146979..146981,146997..146999,
                     147003..147005,147009..147011,147045..147053,
                     147057..147059,147063..147065,147093..147095,
                     147099..147101,147105..147107,147111..147113,
                     147153..147167,147171..147179,147183..147191,
                     147198..147200)
                     /locus_tag="Mesop_0134"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176853"
     gene            complement(147239..148414)
                     /locus_tag="Mesop_0135"
                     /db_xref="GeneID:10823941"
     CDS             complement(147239..148414)
                     /locus_tag="Mesop_0135"
                     /note="COGs: COG0489 ATPase involved in chromosome
                     partitioning;
                     InterPro IPR000808:IPR002744:IPR019591;
                     KEGG: mlo:mlr5402 ATP/GTP-binding-like protein;
                     PFAM: ATPase-like, ParA/MinD; protein of unknown function
                     DUF59;
                     SPTR: Putative uncharacterized protein;
                     PFAM: ParA/MinD ATPase like; Domain of unknown function
                     DUF59"
                     /codon_start=1
                     /transl_table=11
                     /product="ParA/MinD ATPase-like protein"
                     /protein_id="YP_004608724.1"
                     /db_xref="GI:337264669"
                     /db_xref="GeneID:10823941"
                     /translation="MSVTKEIVTERLKTVNGPDFTSNIVDLGMVSEIFIADAKVFFSI
                     TVPAARAQEMEPLRAAAERVVKAIPGVAGAVVALTAEKKGGGMEAPVPARPAARPAPS
                     APPAAARAAPHAPASHSHGKRGVPGIEAIIAVASGKGGVGKSTTAVNIALGLAANGLR
                     VGVLDADIYGPSMPRLLNIHGRPQTVDGKILKPMENYGLKVMSMGFLVDEETPMIWRG
                     PMVMSALTQMLREVEWGRLDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALI
                     DARKGLNMFRKVDVPLLGIVENMSYFLAPDTGKRYDIFGHGGARREAERLGVTFLGEV
                     PLEMGIRESSDEGSPVVASKPDSAEAKIYRDIASKVWDRVNEERGAAEAAVPNIVFE"
     misc_feature    complement(148187..148402)
                     /locus_tag="Mesop_0135"
                     /note="Domain of unknown function DUF59; Region: DUF59;
                     pfam01883"
                     /db_xref="CDD:250939"
     misc_feature    complement(147305..148024)
                     /locus_tag="Mesop_0135"
                     /note="cell division ATPase MinD, archaeal; Region:
                     minD_arch; TIGR01969"
                     /db_xref="CDD:131024"
     misc_feature    complement(147401..148024)
                     /locus_tag="Mesop_0135"
                     /note="MRP (Multiple Resistance and pH adaptation) is a
                     homologue of the Fer4_NifH superfamily. Like the other
                     members of the superfamily, MRP contains a ATP-binding
                     domain at the N-termini. It is found in bacteria as a
                     membrane-spanning protein and functions...; Region:
                     MRP-like; cd02037"
                     /db_xref="CDD:238994"
     misc_feature    complement(147983..148006)
                     /locus_tag="Mesop_0135"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238994"
     misc_feature    complement(147299..>147448)
                     /locus_tag="Mesop_0135"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            148605..148982
                     /locus_tag="Mesop_0136"
                     /db_xref="GeneID:10823942"
     CDS             148605..148982
                     /locus_tag="Mesop_0136"
                     /note="InterPro IPR004360;
                     KEGG: mlo:mll5401 hypothetical protein;
                     PFAM: Glyoxalase/bleomycin resistance protein/dioxygenase;
                     SPTR: Glyoxalase/bleomycin resistance protein/dioxygenase;
                     PFAM: Glyoxalase/Bleomycin resistance protein/Dioxygenase
                     superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_004608725.1"
                     /db_xref="GI:337264670"
                     /db_xref="GeneID:10823942"
                     /translation="MLENSNATANIAVKDLARAKAFYAGTLGLKQVDDMGGELIVYKS
                     GDTFINVYHSQFAGTNKATAVTWTVGDQIETVVKSLKSKGVAFEHYEMPGLTIEGDVH
                     VGQSMKVAWFKDPDGNILNLVSQ"
     misc_feature    148632..148970
                     /locus_tag="Mesop_0136"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     misc_feature    order(148638..148640,148719..148721,148752..148754,
                     148758..148760,148935..148937,148959..148961,
                     148965..148967)
                     /locus_tag="Mesop_0136"
                     /note="active site"
                     /db_xref="CDD:211348"
     gene            complement(149027..150031)
                     /locus_tag="Mesop_0137"
                     /db_xref="GeneID:10823943"
     CDS             complement(149027..150031)
                     /locus_tag="Mesop_0137"
                     /note="COGs: COG0306 Phosphate/sulphate permease;
                     InterPro IPR001204;
                     KEGG: mlo:mlr8370 phosphate transport protein;
                     PFAM: phosphate transporter;
                     SPTR: Phosphate transporter;
                     PFAM: Phosphate transporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transporter"
                     /protein_id="YP_004608726.1"
                     /db_xref="GI:337264671"
                     /db_xref="GeneID:10823943"
                     /translation="MEATIAFPLLAGLVAVALFFDFLNGLHDAANSIATIVSTRVLRP
                     HYAVFWAAFFNFIAFMFFGLHVAETVGKGIVDVSIVTPAVIFSALVGAIVWNIVTWIA
                     GIPSSSSHALIGGLVGAGVAKAGVGAIVWSGLGKTVAAIVLSPATGFVLALVLILVVS
                     WLFVRQTPFAVDSTFRVLQFFSASLYSLGHGGNDAQKTMGIIAVLLYSQGMLGEKFYV
                     PLWVVLTCQSALALGTLFGGWRIVHTMGSKITRLNPMQGFCAETGGAITLFAATWLGI
                     PVSTTHTITGAIIGVGAARRVSAVRWGIAGNIVIAWIVTLPATAAISALTYLAVNLTG
                     "
     misc_feature    complement(149036..150013)
                     /locus_tag="Mesop_0137"
                     /note="Phosphate/sulphate permeases [Inorganic ion
                     transport and metabolism]; Region: PitA; COG0306"
                     /db_xref="CDD:223383"
     gene            complement(150035..150676)
                     /locus_tag="Mesop_0138"
                     /db_xref="GeneID:10823944"
     CDS             complement(150035..150676)
                     /locus_tag="Mesop_0138"
                     /note="COGs: COG1392 Phosphate transport regulator
                     (distant homolog of PhoU);
                     InterPro IPR018445;
                     KEGG: rhi:NGR_c35010 conserved hypothetical protein,
                     putative pit accessory protein;
                     PFAM: Putitive phosphate transport regulator;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function DUF47"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphate transport regulator"
                     /protein_id="YP_004608727.1"
                     /db_xref="GI:337264672"
                     /db_xref="GeneID:10823944"
                     /translation="MLGWFRKLLPREDRFFDLFERHSRTVVGGAEALQLLLQGKDIDR
                     WCQKIVDLEDEADHITAEVLLAVRRSFITPFDRGDIKDLIQSMDDAIDMMHKTVKTVR
                     LFEKKEFDPLMQEMGGVIVAAAKLVAEAIPLLAKVGTHTVRLNAIAEEVMRVESRADD
                     LHEQGLKNLFRKHGSSDPMAYLIGSEIYGQLEKVVDRFEDVANEISGIVIENV"
     misc_feature    complement(150041..150676)
                     /locus_tag="Mesop_0138"
                     /note="Phosphate transport regulator (distant homolog of
                     PhoU) [Inorganic ion transport and metabolism]; Region:
                     COG1392"
                     /db_xref="CDD:224310"
     misc_feature    complement(150062..>150532)
                     /locus_tag="Mesop_0138"
                     /note="TIGR00153 family protein; Region: TIGR00153"
                     /db_xref="CDD:232846"
     gene            150843..151742
                     /locus_tag="Mesop_0139"
                     /db_xref="GeneID:10823945"
     CDS             150843..151742
                     /locus_tag="Mesop_0139"
                     /note="COGs: COG0583 Transcriptional regulator;
                     InterPro IPR000847:IPR005119;
                     KEGG: mlo:mll5399 transcriptional regulator;
                     PFAM: LysR substrate-binding; regulatory protein LysR;
                     SPTR: Transcriptional regulator, LysR family;
                     PFAM: Bacterial regulatory helix-turn-helix protein, lysR
                     family; LysR substrate binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004608728.1"
                     /db_xref="GI:337264673"
                     /db_xref="GeneID:10823945"
                     /translation="MIDKLEFFIALAKEEHFGRAAEVCGVTQPTLSAGIKQLEGQLGV
                     MLVLRGSRFQGLTPEGKQVLVWARRIVGDSRTMREEMRAARHGLAGRIRIAAVPTALA
                     MVARLTTPFREKHPGVTFSVLSRTSIEVLTLLGNFDVDAGITYLDNEPLGRVTSVPLY
                     DERYQLITAVGNPYSDRDKVTWAEISHLPLCLLTPDMQNRRIIDQHLAEAGVQVRPTL
                     ESNSMIVLFSHIRTGKWSSIMPLNLAETFGFSEPIRAIPIVEPDASHTVGLVAAPREP
                     HTPLVQALLDEAMALADDFRTHR"
     misc_feature    150843..151700
                     /locus_tag="Mesop_0139"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    150846..151025
                     /locus_tag="Mesop_0139"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    150990..151160
                     /locus_tag="Mesop_0139"
                     /note="Phage protein; Region: DUF3653; pfam12375"
                     /db_xref="CDD:152810"
     misc_feature    151113..151706
                     /locus_tag="Mesop_0139"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(151155..151160,151164..151169,151176..151178,
                     151188..151190,151194..151214,151491..151508,
                     151524..151529,151533..151538)
                     /locus_tag="Mesop_0139"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            151936..152415
                     /locus_tag="Mesop_0140"
                     /db_xref="GeneID:10823946"
     CDS             151936..152415
                     /locus_tag="Mesop_0140"
                     /note="COGs: COG1905 NADH:ubiquinone oxidoreductase 24 kD
                     subunit;
                     InterPro IPR002023;
                     KEGG: mlo:mll5398 formate dehydrogenase subunit gamma;
                     PFAM: NADH dehydrogenase (ubiquinone) 24 kDa subunit;
                     SPTR: NADH dehydrogenase (Ubiquinone) 24 kDa subunit;
                     PFAM: Respiratory-chain NADH dehydrogenase 24 Kd subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
                     /protein_id="YP_004608729.1"
                     /db_xref="GI:337264674"
                     /db_xref="GeneID:10823946"
                     /translation="MTMQPASTEIASRTAAIVQELKDVEGPLLPILHGIQEEFGHVPH
                     DVLPVIADGLNLSRAEVHGVVTFYHDFRARPAGRHVLKLCQAEACQSMGSDAVAAKVK
                     QLLGIDFHETTRDGSVTLEPVYCLGLCACSPSAMLDGEVIGRLDDDKIDEIVAEVRS"
     misc_feature    151939..152412
                     /locus_tag="Mesop_0140"
                     /note="NADH:ubiquinone oxidoreductase 24 kD subunit
                     [Energy production and conversion]; Region: NuoE; COG1905"
                     /db_xref="CDD:224817"
     misc_feature    152167..152406
                     /locus_tag="Mesop_0140"
                     /note="TRX-like [2Fe-2S] Ferredoxin (Fd) family,
                     NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily,
                     NAD-dependent formate dehydrogenase (FDH) gamma subunit;
                     composed of proteins similar to the gamma subunit of
                     NAD-linked FDH of Ralstonia eutropha, a...; Region:
                     TRX_Fd_NuoE_FDH_gamma; cd03081"
                     /db_xref="CDD:239379"
     misc_feature    order(152173..152175,152179..152181,152299..152307)
                     /locus_tag="Mesop_0140"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239379"
     misc_feature    order(152185..152187,152200..152202,152308..152310,
                     152320..152322)
                     /locus_tag="Mesop_0140"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239379"
     gene            152412..153968
                     /locus_tag="Mesop_0141"
                     /db_xref="GeneID:10823947"
     CDS             152412..153968
                     /locus_tag="Mesop_0141"
                     /EC_number="1.6.99.5"
                     /note="COGs: COG1894 NADH:ubiquinone oxidoreductase
                     NADH-binding (51 kD) subunit;
                     InterPro IPR001949:IPR011538:IPR019554:IPR019575;
                     KEGG: mlo:mll5397 NAD-dependent formate dehydrogenase beta
                     subunit;
                     PFAM: Respiratory-chain NADH dehydrogenase domain 51 kDa
                     subunit; Soluble ligand binding domain; NADH ubiquinone
                     oxidoreductase, F subunit, iron sulphur binding;
                     PRIAM: NADH dehydrogenase (quinone);
                     SPTR: NADH dehydrogenase (Quinone);
                     PFAM: NADH-ubiquinone oxidoreductase-F iron-sulfur binding
                     region; Respiratory-chain NADH dehydrogenase 51 Kd
                     subunit; SLBB domain"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase (quinone)"
                     /protein_id="YP_004608730.1"
                     /db_xref="GI:337264675"
                     /db_xref="GeneID:10823947"
                     /translation="MIPRIYIPGDSGALALGAEKVAKAVRAELAERGIEAKIVRNGSR
                     GAYFLEPMVEVATANGRVAYGPVKASDVKSLFDSGFLTGGHHKRWLGAPDKIPFLAKQ
                     TRLTFARCGINDPLSLDAYKSLGGLKGLQNAVAMSPADIVKQVTESGLRGRGGAGFPT
                     GIKWKTVLDTTGDRKYIVCNADEGDSATFADRMIMEGDPFVLIEGMAIAGIATGATKG
                     FVYIRSEYPHAVAVMNKAVEVARKAGVLGTNVLGSPNAFDMEIRVGAGAYVCGEETSL
                     LNSLEGKRGVVRAKPPLPAIQGLFGKPTVINNVISLASVPVVMDKGAAFYKDFGMGRS
                     RGTIPIQIAGNVKHGGLFETAFGLTLGEIVDDIGGGTATGRPVKAVQVGGPLGAYFPR
                     ALFDTPFDYEEFAKRDGLIGHAGITVFDDTADMLKQARFAMEFCAIESCGKCTPCRIG
                     STRGVETIDRLAAGIEPEKNLALVTDLCNTMKFGSLCALGGFTPYPVMSSITHFPEDF
                     KPAPARVAAE"
     misc_feature    152418..152693
                     /locus_tag="Mesop_0141"
                     /note="TRX-like [2Fe-2S] Ferredoxin (Fd) family,
                     NAD-dependent formate dehydrogenase (FDH) beta subunit;
                     composed of proteins similar to the beta subunit of
                     NAD-linked FDH of Ralstonia eutropha, a soluble enzyme
                     that catalyzes the irreversible oxidation of...; Region:
                     TRX_Fd_FDH_beta; cd03063"
                     /db_xref="CDD:239361"
     misc_feature    order(152421..152423,152427..152429,152529..152537)
                     /locus_tag="Mesop_0141"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239361"
     misc_feature    152697..153959
                     /locus_tag="Mesop_0141"
                     /note="NADH:ubiquinone oxidoreductase, NADH-binding (51
                     kD) subunit [Energy production and conversion]; Region:
                     NuoF; COG1894"
                     /db_xref="CDD:224806"
     misc_feature    152844..153359
                     /locus_tag="Mesop_0141"
                     /note="Respiratory-chain NADH dehydrogenase 51 Kd subunit;
                     Region: Complex1_51K; pfam01512"
                     /db_xref="CDD:250674"
     misc_feature    153429..153566
                     /locus_tag="Mesop_0141"
                     /note="SLBB domain; Region: SLBB; pfam10531"
                     /db_xref="CDD:256045"
     misc_feature    153687..153803
                     /locus_tag="Mesop_0141"
                     /note="NADH-ubiquinone oxidoreductase-F iron-sulfur
                     binding region; Region: NADH_4Fe-4S; smart00928"
                     /db_xref="CDD:197996"
     gene            153979..156891
                     /locus_tag="Mesop_0142"
                     /db_xref="GeneID:10823948"
     CDS             153979..156891
                     /locus_tag="Mesop_0142"
                     /note="COGs: COG3383 Uncharacterized anaerobic
                     dehydrogenase;
                     InterProIPR017900:IPR006655:IPR001041:IPR001450:IPR
                     006963:IPR006656:IPR006657:IPR017896:IPR006478;
                     KEGG: mlo:mll5396 NAD-dependent formate dehydrogenase
                     alpha subunit;
                     PFAM: molybdopterin oxidoreductase; molybdopterin
                     oxidoreductase Fe4S4 region; ferredoxin; 4Fe-4S ferredoxin
                     iron-sulfur binding domain protein; molydopterin
                     dinucleotide-binding region;
                     SPTR: Formate dehydrogenase, alpha subunit;
                     TIGRFAM: formate dehydrogenase, alpha subunit;
                     PFAM: Molybdopterin oxidoreductase; Molydopterin
                     dinucleotide binding domain; 4Fe-4S binding domain;
                     Molybdopterin oxidoreductase Fe4S4 domain;
                     TIGRFAM: formate dehydrogenase, alpha subunit,
                     archaeal-type"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit alpha"
                     /protein_id="YP_004608731.1"
                     /db_xref="GI:337264676"
                     /db_xref="GeneID:10823948"
                     /translation="MNIKADFPTLIEELDYGTPESKAQKQVTLTVDGRSISVPEGTSI
                     MRAAMEAGVEIPKLCATDMLDSFGSCRVCLVEIEGRGGTPASCTTPVGEGMVVKTQSE
                     RLDAIRRGVMELYVSDHPTGWNEKAGTGASEFDAVAKSVGLAENRYGVEGRNHVKPED
                     GVAPGHGSLAVDYIARDESNPYFTYDPAQCIVCSRCVRACEEVQGTFALTIEGRGFES
                     RMVAGMHEDFIASECVSCGACVQACPTDALREKTVLAKGLPERSAVTTCAYCGVGCSF
                     KAEVKDDEVIRMMPYKEGKANHGHSCVKGRFAYGYATHKDRILSPMIREKVSDPWREV
                     SWEEAIAHTAKEFRRIQYQYGRTSIGGITSSRCTNEETYLVQKLVRQGFRNNNVDTCA
                     RVCHSPTGYGLGQTYGTSAGTQDFDSVDYTDVGVIIGANPASAHPVFASRLKKRLRQG
                     ARLIVLDPRRTEMVKSAHIEADYHLPLKPGTNVAVLTALAHVIVTEGLFNEAFIRERC
                     DWTEFQDWASFVALPENSPETVGKLSGVDPELIRGAARLYATGGNGAIYYGLGVTEHS
                     QGSTTVMAIANLAMATGNIGRPGVGVNPLRGQNNVQGSCDMGSFPHELPGYRHISGDA
                     VRDIYESLWGVKLDDEPGLRIPNMLDAAVDGSFKGIYIQGEDILQSDPDTKHVAAGLA
                     AMECVVVHDLFLNETANYAHVFLPGSTFLEKDGTFTNAERRINMVRKVLEPKARYADW
                     EATQELARAIGLDWNYQHPSEIMDEIAQTTPSFAGVSFELLDRVGSVQWPCNEKAPLG
                     TPIMHVDGFVRGKGKFIRTEYVATDERTGPRFPLLLTTGRILSQYNVGAQTRRTDNVM
                     WHSEDRLEIHPHDAENRGLRDGDWVRLTSRSGETTLRALITDRVSPGVVYTTFHHPDT
                     QANVITTDFSDWATNCPEYKVTAVQVGASNGPSDWQRDYDEQARNSRRIAPLEAAE"
     misc_feature    154042..156888
                     /locus_tag="Mesop_0142"
                     /note="Uncharacterized anaerobic dehydrogenase [General
                     function prediction only]; Region: COG3383"
                     /db_xref="CDD:225918"
     misc_feature    154057..154272
                     /locus_tag="Mesop_0142"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    order(154141..154146,154153..154155,154180..154182,
                     154186..154197,154234..154239)
                     /locus_tag="Mesop_0142"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    order(154153..154155,154186..154188,154195..154197,
                     154237..154239)
                     /locus_tag="Mesop_0142"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     misc_feature    154546..154716
                     /locus_tag="Mesop_0142"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    154771..156441
                     /locus_tag="Mesop_0142"
                     /note="Formate dehydrogenase H (Formate-Dh-H) catalyzes
                     the reversible oxidation of formate to CO2 with the
                     release of a proton and two electrons. It is a component
                     of the anaerobic formate hydrogen lyase complex. The E.
                     coli formate dehydrogenase H (Fdh-H) is...; Region:
                     MopB_Formate-Dh-H; cd02753"
                     /db_xref="CDD:239154"
     misc_feature    order(154777..154779,154783..154788,154792..154794,
                     154798..154800,154882..154884)
                     /locus_tag="Mesop_0142"
                     /note="[4Fe-4S] binding site [ion binding]; other site"
                     /db_xref="CDD:239154"
     misc_feature    order(154888..154890,155074..155076,155158..155163,
                     155260..155271,155278..155283,155344..155349,
                     155353..155355,155416..155418,155422..155424,
                     155653..155661,155668..155673,155767..155772,
                     155968..155970,155974..155976,155986..155988,
                     156046..156057,156061..156063,156097..156102,
                     156193..156195)
                     /locus_tag="Mesop_0142"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239154"
     misc_feature    156460..156798
                     /locus_tag="Mesop_0142"
                     /note="This CD includes formate dehydrogenases (Fdh) H and
                     N; nitrate reductases, Nap and Nas; and other related
                     proteins. Formate dehydrogenase H is a component of the
                     anaerobic formate hydrogen lyase complex  and catalyzes
                     the reversible oxidation of formate...; Region:
                     MopB_CT_Fdh-Nap-like; cd00508"
                     /db_xref="CDD:238282"
     misc_feature    order(156484..156498,156502..156513,156703..156705,
                     156727..156729,156775..156780)
                     /locus_tag="Mesop_0142"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:238282"
     gene            157277..158107
                     /locus_tag="Mesop_0143"
                     /db_xref="GeneID:10823949"
     CDS             157277..158107
                     /locus_tag="Mesop_0143"
                     /note="COGs: COG1526 Uncharacterized protein required for
                     formate dehydrogenase activity;
                     InterPro IPR003786;
                     KEGG: mlo:mll5395 formate dehydrogenase accessory protein;
                     PFAM: formate dehydrogenase subunit FdhD;
                     SPTR: Formate dehydrogenase family accessory protein FdhD;
                     TIGRFAM: formate dehydrogenase family accessory protein
                     FdhD;
                     PFAM: FdhD/NarQ family;
                     TIGRFAM: formate dehydrogenase family accessory protein
                     FdhD"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase family accessory protein
                     FdhD"
                     /protein_id="YP_004608732.1"
                     /db_xref="GI:337264677"
                     /db_xref="GeneID:10823949"
                     /translation="MTRKRQAITQISRLAHRASGTVAANRMVPEETPVAFSFAGTTHA
                     VMMASPADFEDFALGFSLTEGIIAVTGEIEAIEVEDHGAGIDIQIRLKDQANTRFEAR
                     RRRLAGPVGCGLCGIESIEEAMRSVDAVGASKLTLDANDIARSVKLLSKVQPLHAETG
                     AVHAAGFYVPGKGVVLAREDVGRHNALDKLAGALAKAGIDGSTGAVVVTSRVSVEMVQ
                     KTAAIGSAFIIAVSAPTALAIRTAQEAGMTLVALVRGDDFDVFTHPDRVVLGVAQHVA
                     "
     misc_feature    157277..158074
                     /locus_tag="Mesop_0143"
                     /note="formate dehydrogenase accessory protein; Reviewed;
                     Region: PRK00724"
                     /db_xref="CDD:234823"
     sig_peptide     157277..157348
                     /locus_tag="Mesop_0143"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            158097..158408
                     /locus_tag="Mesop_0144"
                     /db_xref="GeneID:10823950"
     CDS             158097..158408
                     /locus_tag="Mesop_0144"
                     /note="KEGG: mlo:mll5393 NAD-dependent formate
                     dehydrogenase delta subunit;
                     SPTR: NAD-dependent formate dehydrogenase delta subunit;
                     PFAM: NADH-dependant formate dehydrogenase delta subunit
                     FdsD"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent formate dehydrogenase delta
                     subunit"
                     /protein_id="YP_004608733.1"
                     /db_xref="GI:337264678"
                     /db_xref="GeneID:10823950"
                     /translation="MSHDEDHITSTSEKLVRMANQIAAFFHSRPREEGVAGVAEHINK
                     FWEPRMRRQFFEMLDSGGEGFDELVVVASARIKRPISPAEADLKLGLKASPADIAASQ
                     K"
     misc_feature    158136..158303
                     /locus_tag="Mesop_0144"
                     /note="NADH-dependant formate dehydrogenase delta subunit
                     FdsD; Region: FdsD; pfam11390"
                     /db_xref="CDD:151830"
     gene            158522..160075
                     /locus_tag="Mesop_0145"
                     /db_xref="GeneID:10823951"
     CDS             158522..160075
                     /locus_tag="Mesop_0145"
                     /note="COGs: COG0596 hydrolase or acyltransferase
                     (alpha/beta hydrolase superfamily);
                     InterPro IPR000792:IPR000073;
                     KEGG: mlo:mll5392 hypothetical protein;
                     PFAM: regulatory protein LuxR; alpha/beta hydrolase fold;
                     SMART: regulatory protein LuxR;
                     SPTR: Transcriptional regulator, LuxR family;
                     PFAM: Bacterial regulatory proteins, luxR family;
                     alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_004608734.1"
                     /db_xref="GI:337264679"
                     /db_xref="GeneID:10823951"
                     /translation="MRPIETRYALSGEVRIAYQVVGQGSFDLVFVPGFISNLDLHWDD
                     EGYSRLLKRLSAFSRLILFDKRGTGLSDRVDVHNLPSLETRMDDVRAVMDAAGSGRAA
                     LLGASEGAPMAMLFAATYPERTRALALYGGYAHFHKWVMPPERLDAFIEMAETAWGTG
                     ATLPHFAPGRVDDARFSTWWARFERLSASPTAAAALARMNAEIDIRGVLAAIGAPTLL
                     IHRRNDVRVDPDASRFLARKIPNARLVEIPGRDHPIWTGDVDRVADLIEEFLTGERAV
                     AEAERVLAALLVTRIYDTARLGDRMWSERSQHFHETWRTLVGRHGGRCVDIHGEMMIS
                     RFDGPGRALRCAAALRDAAQQIGVASAQGAHVGEIETRGPPIGLTGRVTIQLAAHAGR
                     GDILASRLVADLAVGSGLHFVEAGRVSIDELDEPLALVLAMSEQHLEPACRPKVKAAE
                     PASLTVRESEVVNLIADGKSNAAIAAELRLSEHTVKRHVANILLKLDLPSRAAAAAFS
                     VRHAGPDGP"
     misc_feature    158603..159316
                     /locus_tag="Mesop_0145"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    158690..>158914
                     /locus_tag="Mesop_0145"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    <159140..159343
                     /locus_tag="Mesop_0145"
                     /note="TAP-like protein; Region: Abhydrolase_4; pfam08386"
                     /db_xref="CDD:254767"
     misc_feature    159296..159799
                     /locus_tag="Mesop_0145"
                     /note="Adenylate cyclase, family 3 (some proteins contain
                     HAMP domain) [Signal transduction mechanisms]; Region:
                     CyaA; COG2114"
                     /db_xref="CDD:225025"
     misc_feature    159386..159808
                     /locus_tag="Mesop_0145"
                     /note="Class III nucleotidyl cyclases; Region:
                     Nucleotidyl_cyc_III; cl11967"
                     /db_xref="CDD:264492"
     misc_feature    159509..159511
                     /locus_tag="Mesop_0145"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143637"
     misc_feature    <159770..160054
                     /locus_tag="Mesop_0145"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    159881..160051
                     /locus_tag="Mesop_0145"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(159884..159892,159929..159937,159959..159964,
                     159968..159973,159977..159991,160022..160024)
                     /locus_tag="Mesop_0145"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(159917..159919,159923..159925,159929..159931,
                     160022..160030,160037..160039,160046..160051)
                     /locus_tag="Mesop_0145"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            160184..160663
                     /locus_tag="Mesop_0146"
                     /db_xref="GeneID:10823952"
     CDS             160184..160663
                     /locus_tag="Mesop_0146"
                     /note="COGs: COG0599 gamma-carboxymuconolactone
                     decarboxylase subunit;
                     InterPro IPR003779:IPR004675;
                     KEGG: mlo:mll5391 hypothetical protein;
                     PFAM: Carboxymuconolactone decarboxylase;
                     SPTR: Alkylhydroperoxidase like protein, AhpD family;
                     TIGRFAM: alkylhydroperoxidase like protein, AhpD family;
                     PFAM: Carboxymuconolactone decarboxylase family;
                     TIGRFAM: alkylhydroperoxidase AhpD family core domain"
                     /codon_start=1
                     /transl_table=11
                     /product="alkylhydroperoxidase like protein"
                     /protein_id="YP_004608735.1"
                     /db_xref="GI:337264680"
                     /db_xref="GeneID:10823952"
                     /translation="MLKSNLNVRSLVIAAGIGALFTISPARAEDASAAAAYKDIEATL
                     GSVPDMFKTLPDVAIAGAWAEIKGVQLNPNTALDGKTKELMGLAVAAQIPCQYCIYFH
                     TEAAKLNGASDEEIKETIAMAAIVRHWSTILNGSQVDLATFKKQTDDVFAAVKAKSQ"
     sig_peptide     160184..160267
                     /locus_tag="Mesop_0146"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    160295..160621
                     /locus_tag="Mesop_0146"
                     /note="Uncharacterized homolog of
                     gamma-carboxymuconolactone decarboxylase subunit [Function
                     unknown]; Region: COG0599"
                     /db_xref="CDD:223672"
     gene            160747..161109
                     /locus_tag="Mesop_0147"
                     /db_xref="GeneID:10823953"
     CDS             160747..161109
                     /locus_tag="Mesop_0147"
                     /note="KEGG: mlo:mll5389 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608736.1"
                     /db_xref="GI:337264681"
                     /db_xref="GeneID:10823953"
                     /translation="MLTKTQTVDGAAIKKAIEGRDGKMLSSFYADDALVRVIDRNNPP
                     SKPREIRGRAAITTFWDDICSRAMTHKVDTTIANGDSLAFTQACSYPDGTKVFAAAML
                     ELKNGQIARQTVVQAWDE"
     misc_feature    160789..161079
                     /locus_tag="Mesop_0147"
                     /note="SnoaL-like domain; Region: SnoaL_2; pfam12680"
                     /db_xref="CDD:257217"
     gene            161141..161455
                     /locus_tag="Mesop_0148"
                     /db_xref="GeneID:10823954"
     CDS             161141..161455
                     /locus_tag="Mesop_0148"
                     /note="KEGG: mlo:mll5388 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608737.1"
                     /db_xref="GI:337264682"
                     /db_xref="GeneID:10823954"
                     /translation="MFSARWQIDAKFGHKQTVLELLKKWEREIGSQVGIADLQFQIMT
                     GSIGAREATVESHHQVESLAQLEAFFAKIGKIDAHAKWGKEMEPFVVSGTSLWNIYRI
                     VE"
     gene            complement(161639..163066)
                     /locus_tag="Mesop_0149"
                     /db_xref="GeneID:10823955"
     CDS             complement(161639..163066)
                     /locus_tag="Mesop_0149"
                     /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
                     InterPro IPR016160:IPR015590;
                     KEGG: mlo:mlr5385 gamma-aminobutyraldehyde dehydrogenase;
                     PFAM: Aldehyde Dehydrogenase;
                     SPTR: Aldehyde Dehydrogenase;
                     PFAM: Aldehyde dehydrogenase family;
                     TIGRFAM: 1-pyrroline dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="YP_004608738.1"
                     /db_xref="GI:337264683"
                     /db_xref="GeneID:10823955"
                     /translation="MDTQMLIGSKFEKGTDAEEPILNPKTGAAILNLPEASQAQIEAA
                     VAAAEQAFVLWSRTTPAQRSGYLLKIADRIEAEAKEFAALEALNCGKPINSVLNDEIP
                     AIVDCYRFFAGAVRSMPGVVAGEYLPGHTSMVRRDPIGIVASIAPWNYPLMMMAWKVA
                     PAIAGGNTVVFKPSEQTPLTALKLAKILAEILPEGVVNVVLGRGDSVGNTLINHPKVN
                     MISITGDVATGKKVLQAAAKSVKRTHLELGGKAPVIVFDDADLGSVVAGLRAFGYYNA
                     GQDCTAACRIYAGKKIYDKLVADLSSAVSTIKYNLSDDTENEIGPLISRRQRDRVSSF
                     VERASELKHIEITTGGKPGEGTGFYYQPTVVAGALQEDEIVRREVFGPVVSVTRFTEV
                     DEAVGWANDSDYGLASSVWTKDVSRAMATAARLQYGCTWINTHFMLTNEMPHGGLKQS
                     GYGKDMSLYALEDYTAVRHVMVAHG"
     misc_feature    complement(161651..163006)
                     /locus_tag="Mesop_0149"
                     /note="Escherichia coli NAD+-dependent
                     gamma-aminobutyraldehyde dehydrogenase YdcW-like; Region:
                     ALDH_ABALDH-YdcW; cd07092"
                     /db_xref="CDD:143411"
     misc_feature    complement(order(161651..161668,161705..161707,
                     161720..161725,161738..161746,161771..161788,
                     161792..161794,161801..161803,161807..161812,
                     161819..161833,162326..162328,162347..162349,
                     162368..162370,162377..162379,162413..162415,
                     162662..162667,162683..162685,162689..162694,
                     162698..162709,162719..162721,162749..162751,
                     162890..162892))
                     /locus_tag="Mesop_0149"
                     /note="tetrameric interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143411"
     misc_feature    complement(order(161933..161935,162086..162088,
                     162227..162229,162323..162325,162329..162331,
                     162374..162376,162383..162385,162392..162400,
                     162440..162442,162455..162457,162542..162547,
                     162551..162553,162623..162625,162629..162634))
                     /locus_tag="Mesop_0149"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:143411"
     misc_feature    complement(order(162227..162229,162236..162238,
                     162329..162331,162620..162622))
                     /locus_tag="Mesop_0149"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143411"
     misc_feature    complement(order(161753..161755,162230..162232))
                     /locus_tag="Mesop_0149"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143411"
     gene            complement(163169..163984)
                     /locus_tag="Mesop_0150"
                     /db_xref="GeneID:10823956"
     CDS             complement(163169..163984)
                     /locus_tag="Mesop_0150"
                     /note="COGs: COG1177 ABC-type spermidine/putrescine
                     transport system permease component II;
                     InterPro IPR000515;
                     KEGG: mlo:mlr5384 ABC transporter, permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608739.1"
                     /db_xref="GI:337264684"
                     /db_xref="GeneID:10823956"
                     /translation="MRSDRGQSAPLGLKIAAACGLLFLHLPILLIFVYAFTTEEKSFV
                     WPPPGLTTQWFAVTWNRPDVWEALSLSVRVAAISTAIALILGTLCAAAVSRTKFFGRE
                     TISLLVILPIALPGIITGIALRSAFALADIPFSFWTIVLGHATFCVVVVYNNAVARFR
                     RTSGSMIEASMDLGADGFQTFRHVVLPNIATALLAGGMLAFALSFDEVIVTTFTAGQQ
                     QTVPIWMLEELIRPRQRPVTNVVAMVVVLVTLLPILFAYYLTRDGDQIAGGGK"
     misc_feature    complement(163289..163984)
                     /locus_tag="Mesop_0150"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    complement(163307..163783)
                     /locus_tag="Mesop_0150"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(163307..163309,163346..163351,
                     163358..163369,163388..163390,163397..163402,
                     163442..163444,163493..163495,163502..163507,
                     163520..163522,163526..163531,163538..163540,
                     163544..163546,163550..163555,163613..163615,
                     163619..163624,163631..163660,163664..163675,
                     163703..163705,163718..163723,163730..163735))
                     /locus_tag="Mesop_0150"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(163352..163369,163613..163657))
                     /locus_tag="Mesop_0150"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(163313..163315,163349..163351,
                     163568..163570,163613..163615))
                     /locus_tag="Mesop_0150"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(163421..163423,163433..163438,
                     163454..163492))
                     /locus_tag="Mesop_0150"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(163974..164939)
                     /locus_tag="Mesop_0151"
                     /db_xref="GeneID:10823957"
     CDS             complement(163974..164939)
                     /locus_tag="Mesop_0151"
                     /note="COGs: COG1176 ABC-type spermidine/putrescine
                     transport system permease component I;
                     InterPro IPR000515;
                     KEGG: mlo:mlr5383 ABC transporter permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608740.1"
                     /db_xref="GI:337264685"
                     /db_xref="GeneID:10823957"
                     /translation="MTIAALNANPAPAILPGSGGLRGALSDLFWRRPQLLLLLMLLPP
                     VLWLGIVYIGSLFALLAQSFFSIDEFSGLINREFTLKTYGDLFQAANLDIILRTVTMA
                     ALVTLASAIVAFPIAYYAARYARGRWKALFYLGVMLPLWSSYLVKIYAWKLILAKEGI
                     LTWLLAKLHLLWLLDAWLSLPVVGGNSLSVSFTGTFIVFVYVWLPFMILPVQAALERV
                     PANLVEASSDLGASPGQTFRNVLFPLALPGIVAGSIFSFSLTLGDYIIPQIIGTSRLF
                     IGQAVYSQQGTAGNIPLAAAFTVVPIVIMGFYLWGAKRMGAFDAL"
     misc_feature    complement(164013..164657)
                     /locus_tag="Mesop_0151"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(164013..164018,164025..164030,
                     164037..164042,164046..164051,164058..164063,
                     164091..164096,164133..164138,164145..164156,
                     164175..164177,164184..164189,164229..164231,
                     164280..164282,164289..164294,164304..164306,
                     164310..164315,164322..164324,164328..164330,
                     164334..164339,164484..164486,164490..164495,
                     164502..164531,164535..164546,164577..164579,
                     164592..164597,164604..164609))
                     /locus_tag="Mesop_0151"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(164139..164156,164484..164528))
                     /locus_tag="Mesop_0151"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(164061..164063,164091..164093,
                     164100..164102,164136..164138,164352..164354,
                     164484..164486))
                     /locus_tag="Mesop_0151"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(164208..164210,164220..164225,
                     164241..164279))
                     /locus_tag="Mesop_0151"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(164936..165166)
                     /locus_tag="Mesop_0152"
                     /db_xref="GeneID:10823958"
     CDS             complement(164936..165166)
                     /locus_tag="Mesop_0152"
                     /note="KEGG: mlo:mll2521 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608741.1"
                     /db_xref="GI:337264686"
                     /db_xref="GeneID:10823958"
                     /translation="MIEVCAKHPPLSYRTSPPQGGRFAVTNGFPNRLRCRTGRTDKLL
                     ISPLAGEMSGRTEGGVTDRGLASIDPIAAVAP"
     gene            complement(165163..166218)
                     /locus_tag="Mesop_0153"
                     /db_xref="GeneID:10823959"
     CDS             complement(165163..166218)
                     /locus_tag="Mesop_0153"
                     /note="COGs: COG3842 ABC-type spermidine/putrescine
                     transport systems ATPase components;
                     InterPro IPR017871:IPR003439:IPR013611:IPR003593;
                     KEGG: mlo:mlr5382 ABC transporter ATP-binding protein;
                     PFAM: ABC transporter related; Transport-associated OB
                     domain protein;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter; TOBE domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608742.1"
                     /db_xref="GI:337264687"
                     /db_xref="GeneID:10823959"
                     /translation="MKRRVNSSSFDPPKNRLAAMTSAVSFQKVSRHFGSVRAVDAVDL
                     DIAPGEFFAMLGPSGSGKTTCLRLIAGFEQPTAGSISIFGERAEGVPPYRRNVNTVFQ
                     DYALFPHLNVLDNVAYGLMVKGVGKAGRHKAAEEALTLVRLPGYGARRPGQLSGGQRQ
                     RVALARALVNQPKVLLLDEPLGALDLKLRENMQEELKSLQKALGITFVFVTHDQGEAL
                     SMADRVAVFNDGKIMQIGTPEDIYQRPKTRFVADFVGSSNVLPPDFVQRYSGQHRWGS
                     LRPESIRVGRAASGEGVAARLVSTNYLGATTRLAFDADGLKLHAIVPAGAALPAEGDA
                     VVLTFNRESLHLMDEPA"
     misc_feature    complement(165172..166164)
                     /locus_tag="Mesop_0153"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    complement(165454..166149)
                     /locus_tag="Mesop_0153"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(166030..166053)
                     /locus_tag="Mesop_0153"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(165583..165585,165682..165687,
                     165913..165915,166027..166035,166039..166044))
                     /locus_tag="Mesop_0153"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(165913..165924)
                     /locus_tag="Mesop_0153"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(165730..165759)
                     /locus_tag="Mesop_0153"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(165682..165699)
                     /locus_tag="Mesop_0153"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(165664..165675)
                     /locus_tag="Mesop_0153"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(165577..165597)
                     /locus_tag="Mesop_0153"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(165178..165393)
                     /locus_tag="Mesop_0153"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            complement(166341..167495)
                     /locus_tag="Mesop_0154"
                     /db_xref="GeneID:10823960"
     CDS             complement(166341..167495)
                     /locus_tag="Mesop_0154"
                     /note="COGs: COG0687 Spermidine/putrescine-binding
                     periplasmic protein;
                     InterPro IPR006059:IPR001188;
                     KEGG: mlo:mlr5381 ABC transporter, binding protein;
                     PFAM: extracellular solute-binding protein family 1;
                     SPTR: Extracellular solute-binding protein family 1;
                     PFAM: Bacterial extracellular solute-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 1 extracellular solute-binding protein"
                     /protein_id="YP_004608743.1"
                     /db_xref="GI:337264688"
                     /db_xref="GeneID:10823960"
                     /translation="MNSFLKSCTALTVALAFSGQAIAQVKELGKGEGEVNIVAWPGYI
                     ERGETDKGYDWVTAFEKESGCKVNVKTANTSDEMVSLMNEGGFDLVTASGDASLRLVA
                     GKRVQPINTDLIPSWKSVDDRLKDAPWFTVDKVHYGVPYQWGPNILMYNTEVFKEAPK
                     SWNVVFEEMKLPDGKSNKGRVQAYDGPIHIADAANYLMFHKPELGIKDPYELNEDQYK
                     AALDLLRVQRTLVGRYWHDAAIQVDDFQNEGVVASGSWPYQVNTLVAAKKPVASTVPE
                     EGVTGWADTTMMEADAAHPNCAYMWLEHSLSPKVQGDVSAWFGSLPVVPAACKGNELL
                     GEEGCKTNGYDNFDKIKFWKTPVSKCATQNNQCVPYYRWVSDYIGVIGGR"
     misc_feature    complement(166515..167495)
                     /locus_tag="Mesop_0154"
                     /note="Spermidine/putrescine-binding periplasmic protein
                     [Amino acid transport and metabolism]; Region: PotD;
                     COG0687"
                     /db_xref="CDD:223759"
     sig_peptide     complement(167427..167495)
                     /locus_tag="Mesop_0154"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            complement(167634..168545)
                     /locus_tag="Mesop_0155"
                     /db_xref="GeneID:10823961"
     CDS             complement(167634..168545)
                     /locus_tag="Mesop_0155"
                     /note="COGs: COG0583 Transcriptional regulator;
                     InterPro IPR000847:IPR005119;
                     KEGG: mlo:mlr5377 transcriptional regulator;
                     PFAM: LysR substrate-binding; regulatory protein LysR;
                     SPTR: Transcriptional regulator, LysR family;
                     PFAM: Bacterial regulatory helix-turn-helix protein, lysR
                     family; LysR substrate binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004608744.1"
                     /db_xref="GI:337264689"
                     /db_xref="GeneID:10823961"
                     /translation="MAFTIRQLQFFIAVAEQGTVSGAAQNLSISQSSVTEAIKELESD
                     LGVELFERHPRGLNITHKGHQFLRHATKILADVSDARRSFSGEQAATGGRLQLGVTSL
                     VAGYVLSDLLSRYRRAYPGVEVSAIEDNGDYLEHLLIGGKLDIAVMVTSNLRDRTALQ
                     SEILEVSAYRLWLPLGHPLAGADIIGIGDIASEPLIMLTVDEIEENTGKLLTAIGARP
                     HVAFRTRSVEAVRSLVATGAGVALLPDLVYRPWSLEGDRIESRDISGSLPVVQVGMVW
                     RRGSGLPQSARDFIGLAQSQRMVRQRL"
     misc_feature    complement(167658..168539)
                     /locus_tag="Mesop_0155"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(168354..168533)
                     /locus_tag="Mesop_0155"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(167667..168266)
                     /locus_tag="Mesop_0155"
                     /note="The C-terminal substrate-binding domain of putative
                     LysR-type transcriptional regulator PAO1-like, a member of
                     the type 2 periplasmic binding fold protein superfamily;
                     Region: PBP2_PAO1_like; cd08412"
                     /db_xref="CDD:176104"
     misc_feature    complement(order(167814..167816,167865..167867,
                     167937..167939,168039..168041,168099..168101,
                     168228..168230,168240..168242))
                     /locus_tag="Mesop_0155"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176104"
     misc_feature    complement(order(167781..167786,167805..167807,
                     167835..167840,167847..167852,167862..167870,
                     167874..167882,167898..167903,168129..168131,
                     168138..168140,168162..168164,168168..168170,
                     168207..168212,168216..168221,168228..168236))
                     /locus_tag="Mesop_0155"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176104"
     gene            complement(168628..169404)
                     /locus_tag="Mesop_0156"
                     /db_xref="GeneID:10823962"
     CDS             complement(168628..169404)
                     /locus_tag="Mesop_0156"
                     /note="COGs: COG1349 Transcriptional regulators of sugar
                     metabolism;
                     InterPro IPR001969:IPR018356:IPR001034:IPR014036;
                     KEGG: mlo:mlr5371 transcriptional regulator;
                     PFAM: regulatory protein DeoR;
                     SMART: regulatory protein DeoR;
                     SPTR: Transcriptional regulator, DeoR family;
                     PFAM: Bacterial regulatory proteins, deoR family;
                     DeoR-like helix-turn-helix domain"
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="YP_004608745.1"
                     /db_xref="GI:337264690"
                     /db_xref="GeneID:10823962"
                     /translation="MVHSKRHGEILRLLQEEGTVTIASLADRLGVSLETVRRDVKPLT
                     GDGSVLKMHGAIGLPSMVGEAPFERRMRENADAKRVIARMVAATIRDGESIMLDTGTT
                     TSFLARELLGHRRLTVVTNSSDIARTLATINGNKVYMAGGELRSDSGAAFGASAIEFV
                     SRFSVSHAVISTGAVDAVTGVMDYDLEEAEFARMVLSRGQRSLVITDHTKFGRQGLVQ
                     VCSFAGFSELATDRLPPRDIAAALAQAGARLSIAGDVAGF"
     misc_feature    complement(168691..169404)
                     /locus_tag="Mesop_0156"
                     /note="Transcriptional regulators of sugar metabolism
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: GlpR; COG1349"
                     /db_xref="CDD:224268"
     misc_feature    complement(169243..169389)
                     /locus_tag="Mesop_0156"
                     /note="DeoR-like helix-turn-helix domain; Region:
                     HTH_DeoR; cl17531"
                     /db_xref="CDD:248085"
     misc_feature    complement(168709..169191)
                     /locus_tag="Mesop_0156"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            169825..170712
                     /locus_tag="Mesop_0157"
                     /db_xref="GeneID:10823963"
     CDS             169825..170712
                     /locus_tag="Mesop_0157"
                     /note="COGs: COG0510 choline kinase involved in LPS
                     biosynthesis;
                     InterPro IPR002573;
                     KEGG: mlo:mll5370 hypothetical protein;
                     PFAM: Choline/ethanolamine kinase;
                     SPTR: Choline/ethanolamine kinase;
                     PFAM: Choline/ethanolamine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="Choline/ethanolamine kinase"
                     /protein_id="YP_004608746.1"
                     /db_xref="GI:337264691"
                     /db_xref="GeneID:10823963"
                     /translation="MIAEDRIRALPCWTGAIEIAPLPGGLSNANYVVSDAAGRHVVRF
                     GQDYPFHHVFREREVMTARAAHAAGFAPAVHYAEPGIMVTAYLGARTYLADDVRANLG
                     RVAALMRGFHREMPNHISGAGFMFWVFHVIRDYARTLEEGGSRKRSELPHLLTLADEL
                     ERAQKLLPIVFGHNDLLPANILDDGNRLWLIDFEYAGFNTAMFDLSGVASNAGMSDEE
                     SFAFLTAYFMKEPDEAIRRSHAAMQCASLLREAMWSMVSELYLDAPGIDYVAYTEENL
                     VRLDAALENYRTKYGILKS"
     misc_feature    169873..170517
                     /locus_tag="Mesop_0157"
                     /note="Choline Kinase (ChoK). The ChoK subfamily is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs), RIO
                     kinases, actin-fragmin kinase (AFK), and...; Region: ChoK;
                     cd05151"
                     /db_xref="CDD:240172"
     misc_feature    169876..170526
                     /locus_tag="Mesop_0157"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    order(169891..169893,169897..169899,169903..169908,
                     169912..169914,169945..169947,169951..169953,
                     170038..170040,170074..170085,170089..170097,
                     170347..170349,170353..170355,170359..170364,
                     170368..170370,170395..170400,170407..170409,
                     170455..170457,170470..170472)
                     /locus_tag="Mesop_0157"
                     /note="active site"
                     /db_xref="CDD:240172"
     misc_feature    order(169891..169893,169906..169908,169912..169914,
                     169945..169947,169951..169953,170038..170040,
                     170074..170085,170089..170097,170359..170361,
                     170368..170370,170395..170400)
                     /locus_tag="Mesop_0157"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240172"
     misc_feature    order(169897..169899,169903..169905,170347..170349,
                     170353..170355,170362..170364,170407..170409,
                     170455..170457,170470..170472)
                     /locus_tag="Mesop_0157"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240172"
     misc_feature    order(169990..169992,169999..170004,170011..170016,
                     170044..170055,170323..170325)
                     /locus_tag="Mesop_0157"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240172"
     gene            170709..173162
                     /locus_tag="Mesop_0158"
                     /db_xref="GeneID:10823964"
     CDS             170709..173162
                     /locus_tag="Mesop_0158"
                     /note="COGs: COG0404 Glycine cleavage system T protein
                     (aminomethyltransferase);
                     InterPro IPR006076:IPR006222:IPR013977;
                     KEGG: mlo:mll5369 sarcosine dehydrogenase;
                     PFAM: FAD dependent oxidoreductase; glycine cleavage T
                     protein (aminomethyl transferase); Glycine cleavage
                     T-protein barrel;
                     SPTR: FAD dependent oxidoreductase;
                     PFAM: Glycine cleavage T-protein C-terminal barrel domain;
                     Aminomethyltransferase folate-binding domain; FAD
                     dependent oxidoreductase;
                     TIGRFAM: glycine cleavage system T protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_004608747.1"
                     /db_xref="GI:337264692"
                     /db_xref="GeneID:10823964"
                     /translation="MTLPGHAAIVVIGGGIIGCSTAYHLARDHKAEVVLLEQGKLTSG
                     STWHAAGLVGQLRSSASITRVLKYSVELYKGLEAETGLATGWKMTGCLRLATNADRWT
                     EYKRLATTAKSFGMDMQLLSPAEVKAMWPLMETGDLVGASWLPTDGQASPSDITQSLA
                     KGARMHGAKLYEDVRVTGFEMKDGRITAVKTNKGDIACDKVVNCAGQWARQVGAMAGI
                     NVPLQPVKHQYIITEKIAGLATDAPTIRDPDRRTYFKEEVGGLVMGGYEPNPQAWKTD
                     LPGGDVPDDWEFRLFDDDYDHFEQHMTQAIARVPALETVGVKQMINGPESFTPDGNFI
                     LGTAPECANMFVGAGFNAFGIASGGGAGWVLAQWVVDGEAPLDLWVVDIRRFSNLHRD
                     RQWVCDRTLEAYGKHYTIGFPHEEYVSGRPRIVSPLYERLKRQQAVFGSKLGWERPNW
                     FAPEGVEPRDIYSMGRQNWFAAVGDEHRHVREKVGIFDQSSFAKYELSGPDAAKALDW
                     ICANDVSKPAGRLTYTQLLNTRGGIEADLTVARLAEETFYIVTGTGFRTHDASWISDH
                     IGEGLDATLADVTEDFGTLSLMGPRARDVLADVTDADVSNAAFPFGHVREIAIAGHTV
                     RALRVTYVGELGWELHVPIAATGEVFDALMTAGKRHGIRPVGYRALESLRLEKGYRAW
                     GADITPNDTPQEAGLGWAVKLRKNTDFVGRRALEKANGTALKKRFAGFTVDDPDIVLL
                     GRETILRNGEPVGYLTSGGYGYTLGKNIGYGYVRNADGVSDDFLASGDYELVVAMERA
                     PAKIHLEPMYDPAAGRVKA"
     misc_feature    170763..171881
                     /locus_tag="Mesop_0158"
                     /note="Glycine/D-amino acid oxidases (deaminating) [Amino
                     acid transport and metabolism]; Region: DadA; COG0665"
                     /db_xref="CDD:223737"
     misc_feature    170805..>171386
                     /locus_tag="Mesop_0158"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    171963..173159
                     /locus_tag="Mesop_0158"
                     /note="Glycine cleavage system T protein
                     (aminomethyltransferase) [Amino acid transport and
                     metabolism]; Region: GcvT; COG0404"
                     /db_xref="CDD:223481"
     misc_feature    172164..172808
                     /locus_tag="Mesop_0158"
                     /note="Aminomethyltransferase folate-binding domain;
                     Region: GCV_T; pfam01571"
                     /db_xref="CDD:250713"
     misc_feature    172830..173117
                     /locus_tag="Mesop_0158"
                     /note="Glycine cleavage T-protein C-terminal barrel
                     domain; Region: GCV_T_C; pfam08669"
                     /db_xref="CDD:254962"
     gene            complement(173244..173876)
                     /locus_tag="Mesop_0159"
                     /db_xref="GeneID:10823965"
     CDS             complement(173244..173876)
                     /locus_tag="Mesop_0159"
                     /note="InterPro IPR013216;
                     KEGG: mlo:mlr5368 hypothetical protein;
                     PFAM: Methyltransferase type 11;
                     SPTR: Methyltransferase type 11;
                     PFAM: Methyltransferase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_004608748.1"
                     /db_xref="GI:337264693"
                     /db_xref="GeneID:10823965"
                     /translation="MTDAKHLGALSAAYAATRPEEVAALYDRWSQTYDADMSAAGYRH
                     PTICLALLARHLPRGSVPLLDAGAGTGLIGEWLNIAGYPEVEALDISQGMLDQAARKG
                     VYSALHCLALGGKLPFADDAYAGIVSAGVFTSGHVGVEGLDELIRICRPGGIIVLTVK
                     NTLWDQGFAARIAELEAQSLVTRVEETRPYVSMPGEADTVPSRGLALRVN"
     misc_feature    complement(173400..173690)
                     /locus_tag="Mesop_0159"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(173490..173492,173541..173549,
                     173607..173612,173661..173681))
                     /locus_tag="Mesop_0159"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            173975..174877
                     /locus_tag="Mesop_0160"
                     /db_xref="GeneID:10823966"
     CDS             173975..174877
                     /locus_tag="Mesop_0160"
                     /note="COGs: COG0510 choline kinase involved in LPS
                     biosynthesis;
                     InterPro IPR002573;
                     KEGG: mlo:mll5367 hypothetical protein;
                     PFAM: Choline/ethanolamine kinase;
                     SPTR: Choline/ethanolamine kinase;
                     PFAM: Choline/ethanolamine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="Choline/ethanolamine kinase"
                     /protein_id="YP_004608749.1"
                     /db_xref="GI:337264694"
                     /db_xref="GeneID:10823966"
                     /translation="MVTDEARAKLAAIPMLAGYTGPLDRLGGLTNLVFRAGEFCLRIP
                     GKGTEEYINRANEAVAAHEAAKAGVSPEVLHVDPGTGMMVTRFIAGAETMSPEKFRTR
                     PGSPARAGEAFRKLHASGAVFPFRFELFAMIDDYLKVLSTKNVALPAGYHDVVREAET
                     VRSALAAHPLPVVACHCDPLCENFLDTGERMWIVDWEYSGMNDPLWDLGDLSVEGRFD
                     AAQDEEMMRAYFGGEATPAERGRVVIYKAMCDLLWTLWGLIQLANDNPVDDFRAYADG
                     RFARCKALMETPEFSRHLAAVRRG"
     misc_feature    174050..174673
                     /locus_tag="Mesop_0160"
                     /note="Choline Kinase (ChoK). The ChoK subfamily is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs), RIO
                     kinases, actin-fragmin kinase (AFK), and...; Region: ChoK;
                     cd05151"
                     /db_xref="CDD:240172"
     misc_feature    order(174050..174052,174056..174058,174062..174067,
                     174071..174073,174092..174094,174098..174100,
                     174185..174187,174227..174238,174242..174250,
                     174506..174508,174512..174514,174518..174523,
                     174527..174529,174554..174559,174566..174568,
                     174614..174616,174629..174631)
                     /locus_tag="Mesop_0160"
                     /note="active site"
                     /db_xref="CDD:240172"
     misc_feature    order(174050..174052,174065..174067,174071..174073,
                     174092..174094,174098..174100,174185..174187,
                     174227..174238,174242..174250,174518..174520,
                     174527..174529,174554..174559)
                     /locus_tag="Mesop_0160"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240172"
     misc_feature    174053..174661
                     /locus_tag="Mesop_0160"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    order(174056..174058,174062..174064,174506..174508,
                     174512..174514,174521..174523,174566..174568,
                     174614..174616,174629..174631)
                     /locus_tag="Mesop_0160"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240172"
     misc_feature    order(174137..174139,174146..174151,174158..174163,
                     174191..174202,174482..174484)
                     /locus_tag="Mesop_0160"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240172"
     gene            complement(174874..175797)
                     /locus_tag="Mesop_0161"
                     /db_xref="GeneID:10823967"
     CDS             complement(174874..175797)
                     /locus_tag="Mesop_0161"
                     /note="InterPro IPR000620;
                     KEGG: mlo:mlr5364 hypothetical protein;
                     PFAM: protein of unknown function DUF6 transmembrane;
                     SPTR: Putative uncharacterized protein;
                     PFAM: EamA-like transporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608750.1"
                     /db_xref="GI:337264695"
                     /db_xref="GeneID:10823967"
                     /translation="MTQPVAQNSTIRNVLLAGILLMLAGDFLFALNDAMGKWLVASFS
                     VGQVVLIRSIGAFFVLGPMIANQGAGRLFQMERPGLQILRVVATTLDTALFYAAVVYL
                     PLADVMSFYMAGPIYVAALSHFLLGEKVGWRRWAAILLGFCGVLIMLKPSSAAFSLSS
                     GFALVGSIAFAFAIILNRRLRGTSDTNLVTWQTIGTLVVGGVMTIGAWQTPSALDFGA
                     MLLLGIVSCGAHLMITRALKLAPASTLAPLHYTLLLWAVVFGLAFFGDVPGPRILIGS
                     GIVVLAGLFIFHRQKVVETTVPPENVPKGVN"
     misc_feature    complement(174919..175767)
                     /locus_tag="Mesop_0161"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    complement(175351..175719)
                     /locus_tag="Mesop_0161"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(175905..177185)
                     /locus_tag="Mesop_0162"
                     /db_xref="GeneID:10823968"
     CDS             complement(175905..177185)
                     /locus_tag="Mesop_0162"
                     /EC_number="3.5.4.1"
                     /note="COGs: COG0402 Cytosine deaminase and related
                     metal-dependent hydrolase;
                     InterPro IPR013108;
                     KEGG: mlo:mlr5363 cytosine deaminase;
                     PFAM: Amidohydrolase 3;
                     PRIAM: Cytosine deaminase;
                     SPTR: N-isopropylammelide isopropylaminohydrolase;
                     PFAM: Amidohydrolase family"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytosine deaminase"
                     /protein_id="YP_004608751.1"
                     /db_xref="GI:337264696"
                     /db_xref="GeneID:10823968"
                     /translation="MDFDLIVRGGTLPDGTIADIGIIGETIAAIEPELNVTAGVAIDA
                     YGNLVSPPFVDPHFHMDATLSYGIPRINASGTLLEGISLWGELKPLLTHEAVRDRALA
                     YCDWAVSMGLLAIRTHVDVCDDRLLAVEALLDVKKAIAPYIDLQLVAFPQDGFYRSPT
                     ARQNTIRALDMGVDVVGGIPHFERTMADGTRSVTELCEIAAKRGLMVDLHCDETDDPL
                     SRHIEQLAYETQRLGLQGKVAGSHLTSMHSMDNYYVSKLLPLIAEAGVSAIPNPLINI
                     MLQGRHDTFPKRRGLTRVKEMQALGIRVGWGQDCVLDPWYSLGTADMLDVAFMGLHVA
                     QMSSPADMARCFDMVTSVNAAIMGLDHLGLAVGKRASLVILDAGSPIEALRLRAERIC
                     VIARGKVVAERTRQDTRLSIPGRPATVNRRHQAG"
     misc_feature    complement(175914..177179)
                     /locus_tag="Mesop_0162"
                     /note="Cytosine deaminase and related metal-dependent
                     hydrolases [Nucleotide transport and metabolism / General
                     function prediction only]; Region: SsnA; COG0402"
                     /db_xref="CDD:223479"
     misc_feature    complement(175986..177170)
                     /locus_tag="Mesop_0162"
                     /note="Bacterial cytosine deaminase and related
                     metal-dependent hydrolases. Cytosine deaminases (CDs)
                     catalyze the deamination of cytosine, producing uracil and
                     ammonia. They play an important role in pyrimidine
                     salvage. CDs are present in prokaryotes and fungi; Region:
                     Bact_CD; cd01293"
                     /db_xref="CDD:238618"
     misc_feature    complement(order(176259..176261,176460..176462,
                     176547..176549,176556..176558,177009..177011,
                     177015..177017))
                     /locus_tag="Mesop_0162"
                     /note="active site"
                     /db_xref="CDD:238618"
     gene            177336..179090
                     /locus_tag="Mesop_0163"
                     /db_xref="GeneID:10823969"
     CDS             177336..179090
                     /locus_tag="Mesop_0163"
                     /note="COGs: COG1132 ABC-type multidrug transport system
                     ATPase and permease components;
                     InterProIPR017871:IPR001140:IPR003439:IPR003593:IPR
                     017940;
                     KEGG: mlo:mll5362 ABC transporter ATP-binding protein;
                     PFAM: ABC transporter related; ABC transporter
                     transmembrane region;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter transmembrane region; ABC
                     transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608752.1"
                     /db_xref="GI:337264697"
                     /db_xref="GeneID:10823969"
                     /translation="MFRFFRSTENQRLVARLLRESFRQHRVGYGAAILSMLVVAGMTA
                     ASAWILREITNEFVIDKRVDRVNMIALAVAGIFVVKGLANFVQAYFMSRVGNAIIAER
                     QRKIYDRILAQGIEFYHSTSSSDLITRMTNNAQAARNVLDLIVTSYVRDLVTLAALIG
                     VMVWQQPALSLICFVVGPVAIYGVNGILKRVRKFAAMEFRSVGQIVQVMQETAIGVRV
                     VKSFNLEGLMRKRMYKAVSDVEDRANNIAALEAVTSPVMETLAGLAIAGAVMVSGMLV
                     LQGGQMPGNIMAFIAALLLAYEPAKRLARVRISLESGIVGVRMMFQLADEPLTLAEKP
                     DARPLLAGPGEIRFDAVSFAYQNGPPVLDRFDLTLAPGKMTALVGPSGSGKSTILNLI
                     MRMYDPQGGKVLLDGQDISHATLASLREKIAYVSQDTFLFAGTIMHNIRLGRQDATDE
                     EVIAAARAANAHDFIIAQAKGYETDVGENGGLLSGGQRQRISIARAMLRNAEILLLDE
                     ATSALDAESEALFRDALQQLTEGRTTIVIAHRLSTVHQADTIVVLEGGKVVESGPHRT
                     LLKQGGLYQKLYEYQLMP"
     sig_peptide     177336..177476
                     /locus_tag="Mesop_0163"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    177381..179078
                     /locus_tag="Mesop_0163"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    177426..178223
                     /locus_tag="Mesop_0163"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    178371..179078
                     /locus_tag="Mesop_0163"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    178470..178493
                     /locus_tag="Mesop_0163"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(178479..178484,178488..178496,178614..178616,
                     178854..178859,178950..178952)
                     /locus_tag="Mesop_0163"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    178605..178616
                     /locus_tag="Mesop_0163"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    178782..178811
                     /locus_tag="Mesop_0163"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    178842..178859
                     /locus_tag="Mesop_0163"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    178866..178877
                     /locus_tag="Mesop_0163"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    178938..178958
                     /locus_tag="Mesop_0163"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(179259..181103)
                     /locus_tag="Mesop_0164"
                     /db_xref="GeneID:10823970"
     CDS             complement(179259..181103)
                     /locus_tag="Mesop_0164"
                     /EC_number="4.2.1.9"
                     /note="COGs: COG0129 Dihydroxyacid
                     dehydratase/phosphogluconate dehydratase;
                     InterPro IPR020558:IPR000581:IPR004404;
                     KEGG: mlo:mlr5361 dihydroxy-acid dehydratase;
                     PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase;
                     PRIAM: Dihydroxy-acid dehydratase;
                     SPTR: Dihydroxy-acid dehydratase;
                     TIGRFAM: dihydroxy-acid dehydratase;
                     PFAM: Dehydratase family;
                     TIGRFAM: dihydroxy-acid dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="YP_004608753.1"
                     /db_xref="GI:337264698"
                     /db_xref="GeneID:10823970"
                     /translation="MPAYRSRTTTHGRNMAGARGLWRATGMKDSDFGKPIIAVVNSFT
                     QFVPGHVHLKDLGQLVAREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRELIAD
                     SVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPTVFVSGGPMEAGKVVLAGKTQ
                     ALDLVDAMVAAADDKISDEDVKVIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGN
                     GSTLATHADRKRLFVEAGHLIVDLAQRYYEQDDETALPRSIASKGAFENAMTLDIAMG
                     GSTNTVLHILAAAHEGEVDFTMEDIDRLSRRVPVLCKVAPAKSDVHMEDVHRAGGIMA
                     ILGQLDNAGLINRDLPTVHTSSLGEALDHWDISRTTSQNVRDFFLAAPGGVPTQVAFS
                     QDRRWDDLDLDREKGVIRSAETPFSKDGGLAVLKGNLALDGCIVKTAGVDESILKFTG
                     PARVFESQDASVKAILSNEIKAGDVVVIRYEGPRGGPGMQEMLYPTSYLKSKGLGKAC
                     ALVTDGRFSGGTSGLSIGHASPEAAEGGTIGLVQEGDTIEIDIPNRTIRLAVSDEELD
                     ARRAAMEAKGALAWKPAEKRKRKVTTALRAYAAFATSADKGAVRHVPE"
     misc_feature    complement(179262..181100)
                     /locus_tag="Mesop_0164"
                     /note="dihydroxy-acid dehydratase; Provisional; Region:
                     PRK12448"
                     /db_xref="CDD:237104"
     gene            181369..181836
                     /locus_tag="Mesop_0165"
                     /db_xref="GeneID:10823971"
     CDS             181369..181836
                     /locus_tag="Mesop_0165"
                     /note="COGs: COG3865 conserved hypothetical protein;
                     InterPro IPR009725;
                     KEGG: mlo:mll5357 hypothetical protein;
                     PFAM: 3-demethylubiquinone-9 3-methyltransferase;
                     SPTR: 3-demethylubiquinone-9 3-methyltransferase;
                     PFAM: 3-demethylubiquinone-9 3-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-demethylubiquinone-9 3-methyltransferase"
                     /protein_id="YP_004608754.1"
                     /db_xref="GI:337264699"
                     /db_xref="GeneID:10823971"
                     /translation="MQKITTCLWFDGQAEEAMNFYVSIFKNSKVLSVMRWPEGHADEG
                     KVLVTTFELDGVPFQALNGGPQFKFNEAMSQSIDCKTQEEVDYFWEKLTEDGEPGPCS
                     WLKDKFGVSWQVVPEQLPKLLLDPDRAKAGRVMSAMMKMGKIDIATIEAAARG"
     misc_feature    181378..181713
                     /locus_tag="Mesop_0165"
                     /note="Escherichia coli PhnB and similar proteins; the E.
                     coli phnB gene is found next to an operon involved in the
                     cleavage of carbon-phosphorus bonds in unactivated
                     alkylphosphonates; Region: PhnB_like; cd06588"
                     /db_xref="CDD:176658"
     misc_feature    order(181378..181395,181441..181443,181531..181536,
                     181543..181545,181585..181602,181606..181608,
                     181618..181620,181675..181677,181705..181707)
                     /locus_tag="Mesop_0165"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176658"
     gene            complement(181919..183511)
                     /locus_tag="Mesop_0166"
                     /db_xref="GeneID:10823972"
     CDS             complement(181919..183511)
                     /locus_tag="Mesop_0166"
                     /note="COGs: COG4108 Peptide chain release factor RF-3;
                     InterPro IPR000795:IPR004161:IPR004548:IPR005225;
                     KEGG: mlo:mlr5356 peptide chain release factor 3;
                     PFAM: protein synthesis factor GTP-binding; elongation
                     factor Tu domain 2 protein;
                     SPTR: Peptide chain release factor 3;
                     TIGRFAM: peptide chain release factor 3; small GTP-binding
                     protein;
                     PFAM: Elongation factor Tu domain 2; Elongation factor Tu
                     GTP binding domain;
                     TIGRFAM: small GTP-binding protein domain; peptide chain
                     release factor 3"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="YP_004608755.1"
                     /db_xref="GI:337264700"
                     /db_xref="GeneID:10823972"
                     /translation="MAEDIEQAVSRRRTFAIIAHPDAGKTTLTEKLLLFGGAIQLAGE
                     VKAKKDRIQTRSDWMKIERERGISVVTSVMTFEYEDNVFNLLDTPGHEDFADDTYRTL
                     SAVDSAVMVIDAAKGIEPRTLKLFEVCRLRDIPIITFVNKMDRESRDPFEILDEIEQK
                     LALDTAPVTWPIGRGKTFSGTYHLALNAVRKGDDEKERTPVNGPDSNRVAGLLPENER
                     EAFIEELELAREACRPLDIEAFREGHLTPVYFGSALRNYGVRDLIEALGAFGPPPRAQ
                     EADTRTIEATEEKMTSFVFKIQANMDPNHRDRIAFVRVCSGKLERGMKAKLVRTGKPM
                     SLSAPQFFFARTRVTADEAFAGDVVGIPNHGTLRIGDTLTEGEEILFRGVPNFAPEIL
                     RRVRLGDAMKAKKLKEALHQMAEEGVVQLFSPEDGSPAIVGVVGALQLDVLKERLNFE
                     YTLPVEFEMSRFSVCRWISADDKAETLRFIEAHRGDIARDLDNDPVFLAQHAFSLNYE
                     AERWKAIRFATIKDYQVRDKAA"
     misc_feature    complement(181943..183511)
                     /locus_tag="Mesop_0166"
                     /note="Peptide chain release factor RF-3 [Translation,
                     ribosomal structure and biogenesis]; Region: PrfC;
                     COG4108"
                     /db_xref="CDD:226593"
     misc_feature    complement(182693..183481)
                     /locus_tag="Mesop_0166"
                     /note="Release Factor 3 (RF3) protein involved in the
                     terminal step of translocation in bacteria; Region: RF3;
                     cd04169"
                     /db_xref="CDD:206732"
     misc_feature    complement(183434..183457)
                     /locus_tag="Mesop_0166"
                     /note="G1 box; other site"
                     /db_xref="CDD:206732"
     misc_feature    complement(order(183044..183046,183056..183058,
                     183164..183169,183236..183241,183293..183298,
                     183410..183415,183422..183424,183431..183436,
                     183446..183448,183452..183454))
                     /locus_tag="Mesop_0166"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206732"
     misc_feature    complement(order(182750..182758,183080..183082,
                     183086..183091,183431..183448))
                     /locus_tag="Mesop_0166"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206732"
     misc_feature    complement(183296..183331)
                     /locus_tag="Mesop_0166"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206732"
     misc_feature    complement(183308..183310)
                     /locus_tag="Mesop_0166"
                     /note="G2 box; other site"
                     /db_xref="CDD:206732"
     misc_feature    complement(183242..183253)
                     /locus_tag="Mesop_0166"
                     /note="G3 box; other site"
                     /db_xref="CDD:206732"
     misc_feature    complement(183191..183247)
                     /locus_tag="Mesop_0166"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206732"
     misc_feature    complement(183080..183091)
                     /locus_tag="Mesop_0166"
                     /note="G4 box; other site"
                     /db_xref="CDD:206732"
     misc_feature    complement(182750..182758)
                     /locus_tag="Mesop_0166"
                     /note="G5 box; other site"
                     /db_xref="CDD:206732"
     misc_feature    complement(182384..182635)
                     /locus_tag="Mesop_0166"
                     /note="RF3_II: this subfamily represents the domain II of
                     bacterial Release Factor 3 (RF3). Termination of protein
                     synthesis by the ribosome requires two release factor (RF)
                     classes. The class II RF3 is a GTPase that removes class I
                     RFs (RF1 or RF2) from the...; Region: RF3_II; cd03689"
                     /db_xref="CDD:239660"
     gene            183653..184729
                     /locus_tag="Mesop_0167"
                     /db_xref="GeneID:10823973"
     CDS             183653..184729
                     /locus_tag="Mesop_0167"
                     /note="COGs: COG0665 Glycine/D-amino acid oxidase
                     (deaminating);
                     InterPro IPR006076;
                     KEGG: mlo:mll5352 hypothetical protein;
                     PFAM: FAD dependent oxidoreductase;
                     SPTR: FAD dependent oxidoreductase;
                     PFAM: FAD dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_004608756.1"
                     /db_xref="GI:337264701"
                     /db_xref="GeneID:10823973"
                     /translation="MGAAKQVIVIGAGIIGASMAWHLTRAGARVTVIAADSAAGGVAT
                     PNSFAWINATWGNPEPYFRLRTRAMAEWSRLARDLPGLPLSWCGGLCWDLSATDMETY
                     SAQHSTWGYGIERVDRAGAARIEPNLIELPDVALHVAEEGVVEPVAATKALLADAERR
                     GAGIISSTVTALVQTGGRISGVDTSHGLLATDEVVIAAGVGSADIAATAGINLPLETP
                     PGLIVHSRPHEKLLNGLVLAERLHMRQTAEGRIIAGSDFSGADPGMDAQVTASELFAV
                     LKASLRGGDGLTLDFHTVGYRPTPIDGFPIIGRAEGMDGVYVSVMHSGITLAPAVGLF
                     AAREILDGERDSLLAPYGLARFAQ"
     misc_feature    183653..184723
                     /locus_tag="Mesop_0167"
                     /note="Glycine/D-amino acid oxidases (deaminating) [Amino
                     acid transport and metabolism]; Region: DadA; COG0665"
                     /db_xref="CDD:223737"
     misc_feature    183713..184681
                     /locus_tag="Mesop_0167"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(184723..186096)
                     /locus_tag="Mesop_0168"
                     /db_xref="GeneID:10823974"
     CDS             complement(184723..186096)
                     /locus_tag="Mesop_0168"
                     /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
                     amidotransferase A subunit and related amidase;
                     InterPro IPR000120;
                     KEGG: mlo:mlr5350 amidase;
                     PFAM: Amidase;
                     SPTR: Amidase;
                     PFAM: Amidase"
                     /codon_start=1
                     /transl_table=11
                     /product="Amidase"
                     /protein_id="YP_004608757.1"
                     /db_xref="GI:337264702"
                     /db_xref="GeneID:10823974"
                     /translation="MDIAFSSTVDLAMAIAARKISAVEALDAHLAQIDSHNEAVNAVV
                     SLDREGARERAKKADAALVRGEALGPLHGVPFTLKDMHETAGMKTTVGFPPFADYVAK
                     EDGPVAGRLKAAGGVLMAKTNVASMLSDWQSNNPLFGRTSNPWNLERTSGGSSGGAAA
                     AIAAGMTPFDVGTDMQDSIRLPAAFCGVYGLKPTEHRVSLAGAFPNPGDAARSVRLMS
                     CVGPLARSVDDLSLIYRIIAGSDGRDTDLAPVPVEDMPKLELKTLRIAFAPTFPGFPV
                     TDAIGSAVENIARQLQSAGATVEKANLPKLDLHDDLAQGGALIGMMMEAAQPEPPDEP
                     TPVSRWFEALARRDRSILAWNQFLEKHDALLCPVAMTTAFSHCEPGTPIKVDGKDQSY
                     WMLPAYGAVFNYSGHPALSMPCGQNSDGLPIGLQLVGRRWSESRLLGIARAMTPLTGG
                     FSRPPGY"
     misc_feature    complement(184729..186096)
                     /locus_tag="Mesop_0168"
                     /note="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
                     and related amidases [Translation, ribosomal structure and
                     biogenesis]; Region: GatA; COG0154"
                     /db_xref="CDD:223232"
     gene            complement(186457..186681)
                     /locus_tag="Mesop_0169"
                     /db_xref="GeneID:10823975"
     CDS             complement(186457..186681)
                     /locus_tag="Mesop_0169"
                     /note="KEGG: slt:Slit_0521 peptidoglycan-associated
                     lipoprotein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-associated lipoprotein"
                     /protein_id="YP_004608758.1"
                     /db_xref="GI:337264703"
                     /db_xref="GeneID:10823975"
                     /translation="MKLVLSALLVLLVLSQAAEAKKKVAVTQDNAATAQVTRPPLDDT
                     STGGIRSAAGATATATEGQQYPPALYFNFQ"
     sig_peptide     complement(186622..186681)
                     /locus_tag="Mesop_0169"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            complement(186803..187045)
                     /locus_tag="Mesop_0170"
                     /db_xref="GeneID:10823976"
     CDS             complement(186803..187045)
                     /locus_tag="Mesop_0170"
                     /note="KEGG: bcu:BCAH820_3587 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608759.1"
                     /db_xref="GI:337264704"
                     /db_xref="GeneID:10823976"
                     /translation="MTANASSRLTFIVFTAGCIALVLLFRYAPAGDSHSRYLKGATAV
                     VAAKPTRIDVDNEAHAIRFYIDGKQVALLDESGFRQ"
     sig_peptide     complement(186956..187045)
                     /locus_tag="Mesop_0170"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            187334..188314
                     /locus_tag="Mesop_0171"
                     /db_xref="GeneID:10823977"
     CDS             187334..188314
                     /locus_tag="Mesop_0171"
                     /note="KEGG: vpr:Vpar_0209 carbon-monoxide dehydrogenase,
                     catalytic subunit;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608760.1"
                     /db_xref="GI:337264705"
                     /db_xref="GeneID:10823977"
                     /translation="MLWRKPNRKGSRVAQHIAQKLRLTSALLGTVTRKDLAAAFRSVN
                     PKTSFDLGRADKWLQGRAQPREHSVYDDWAKLLGLEQSGAWIADCDLPNFTAAIATRH
                     NIDSADLERRAGSQFETSSNHEERSLALALAGTYACYSRAWSPYYRGQFIRGILSMEP
                     GPGSHGLTASYREILPTGQLVIGGPVTPAKRALYMHLKEVGGDAQFFVSLFPRSQPGS
                     VLGGYMCGTAIIGPEAQPSLTRILMVRLRDQARGATPWGGYLLPDESISADLASVGMS
                     IEHPEQVDRQLTRFLVGGSDGGVHQIPPAEFRAILDVFDRHWLKHARQSP"
     gene            complement(188345..189145)
                     /locus_tag="Mesop_0172"
                     /db_xref="GeneID:10823978"
     CDS             complement(188345..189145)
                     /locus_tag="Mesop_0172"
                     /note="COGs: COG0121 glutamine amidotransferase;
                     InterPro IPR017932;
                     KEGG: mlo:mlr5349 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Glutamine amidotransferases class-II"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608761.1"
                     /db_xref="GI:337264706"
                     /db_xref="GeneID:10823978"
                     /translation="MCRWAAYLGEAVFLEDILTAPCHSLIAQSHCAQEAKSPTNGDGF
                     GLAWYGDRPEPGLYRDILPAWSDPNLKSLCRQIKSGLFLAHVRASTGGATSRMNCHPF
                     ISGRWSFMHNGQIGGFEKIRRALENTLCDAVFDQREGTTDSELFFLLMIDEGLADDPQ
                     GAVSRAASRVLDASRRAGLEPVLKLTAAFSDGQALHAVRYATDAHAPTLYTSALRKGG
                     GRCIVSEPFDREGGDWQAIPPSSFVTMTRDGIAIRPFAPASARLALAL"
     misc_feature    complement(188402..189145)
                     /locus_tag="Mesop_0172"
                     /note="Glutamine amidotransferases class-II
                     (Gn-AT)_YafJ-type.  YafJ is a glutamine
                     amidotransferase-like protein of unknown function found in
                     prokaryotes, eukaryotes and archaea.  YafJ has a conserved
                     structural fold similar to those of other class II...;
                     Region: YafJ; cd01908"
                     /db_xref="CDD:238889"
     misc_feature    complement(order(188720..188722,188804..188812,
                     188885..188887,189140..189142))
                     /locus_tag="Mesop_0172"
                     /note="putative active site [active]"
                     /db_xref="CDD:238889"
     misc_feature    complement(order(188681..188683,188771..188776,
                     188834..188836,188972..188977,188984..188986))
                     /locus_tag="Mesop_0172"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238889"
     gene            complement(189158..189406)
                     /locus_tag="Mesop_0173"
                     /db_xref="GeneID:10823979"
     CDS             complement(189158..189406)
                     /locus_tag="Mesop_0173"
                     /note="KEGG: mlo:msr5347 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608762.1"
                     /db_xref="GI:337264707"
                     /db_xref="GeneID:10823979"
                     /translation="MSVARIFTSHPAKVGETYFSHMAFAGWFSSRLLMAASAALVHAF
                     LPFLFETTASRIVRELYERTHNRGTHATNEPTGLLDRA"
     gene            189520..189990
                     /locus_tag="Mesop_0174"
                     /db_xref="GeneID:10823980"
     CDS             189520..189990
                     /locus_tag="Mesop_0174"
                     /note="COGs: COG1522 Transcriptional regulators;
                     InterPro IPR019885:IPR019887:IPR000485:IPR019888;
                     KEGG: mlo:mll5346 transcriptional regulator;
                     PFAM: Transcription regulator, AsnC-type-like;
                     SMART: Transcription regulator, AsnC-type;
                     SPTR: Transcriptional regulator, AsnC family;
                     PFAM: HTH domain; AsnC family"
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="YP_004608763.1"
                     /db_xref="GI:337264708"
                     /db_xref="GeneID:10823980"
                     /translation="MALNIDEIDRKLLTELQRDGTLSVDQLSERVALSRNACWRRVKR
                     LEEDGVITGRVALVDAEKLGLGLSVFILVRTSNHDPDWLQKFRAAVTGLSEITGVYRM
                     SGDLDYVLRARVADVKAYDRLYQRLIAKVALSDVSASFVMEEIKETTVVPMEVR"
     misc_feature    189520..189978
                     /locus_tag="Mesop_0174"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    189535..>189681
                     /locus_tag="Mesop_0174"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(189538..189546,189586..189594,189619..189630,
                     189634..189639,189646..189651,189655..189660,
                     189676..189681)
                     /locus_tag="Mesop_0174"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(189586..189588,189595..189597)
                     /locus_tag="Mesop_0174"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    189730..189951
                     /locus_tag="Mesop_0174"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     gene            190220..190705
                     /locus_tag="Mesop_0175"
                     /db_xref="GeneID:10823981"
     CDS             190220..190705
                     /locus_tag="Mesop_0175"
                     /EC_number="3.6.1.23"
                     /note="COGs: COG0756 dUTPase;
                     InterPro IPR008180:IPR008181;
                     KEGG: mlo:mll5345 deoxyuridine 5'-triphosphate
                     nucleotidohydrolase;
                     PFAM: deoxyUTP pyrophosphatase;
                     PRIAM: dUTP diphosphatase;
                     SPTR: Deoxyuridine 5'-triphosphate nucleotidohydrolase
                     Dut;
                     TIGRFAM: deoxyuridine 5'-triphosphate nucleotidohydrolase
                     Dut;
                     PFAM: dUTPase;
                     TIGRFAM: deoxyuridine 5'-triphosphate nucleotidohydrolase
                     (dut)"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
                     Dut"
                     /protein_id="YP_004608764.1"
                     /db_xref="GI:337264709"
                     /db_xref="GeneID:10823981"
                     /translation="MRAALQNSSVIGPTVGVVRLPHAEGLPLPAYESAGAAGMDLRAA
                     VPDDRPLLILPGKRALVPTGLILEIPEGMEGQVRPRSGLAFKHGLTVLNSPGTVDSDY
                     RGEVKVLLINLGDEDFAVTRGMRIAQLVFAAVTQVGVEERSLAGGTARGSGGFGSTGT
                     A"
     misc_feature    190328..190612
                     /locus_tag="Mesop_0175"
                     /note="Trimeric dUTP diphosphatases; Region:
                     trimeric_dUTPase; cd07557"
                     /db_xref="CDD:143638"
     misc_feature    order(190328..190333,190373..190375,190388..190393,
                     190397..190399,190445..190447,190451..190468,
                     190484..190492,190508..190510,190517..190519,
                     190538..190540,190544..190546,190550..190552,
                     190556..190558,190568..190582,190589..190591,
                     190601..190603)
                     /locus_tag="Mesop_0175"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143638"
     misc_feature    order(190457..190465,190508..190516,190523..190525,
                     190535..190540)
                     /locus_tag="Mesop_0175"
                     /note="active site"
                     /db_xref="CDD:143638"
     gene            190705..191364
                     /locus_tag="Mesop_0176"
                     /db_xref="GeneID:10823982"
     CDS             190705..191364
                     /locus_tag="Mesop_0176"
                     /note="COGs: COG0637 phosphatase/phosphohexomutase;
                     InterPro IPR005834:IPR006402;
                     KEGG: mlo:mll5344 hypothetical protein;
                     PFAM: Haloacid dehalogenase domain protein hydrolase;
                     SPTR: HAD-superfamily hydrolase, subfamily IA, variant 3;
                     TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
                     3;
                     PFAM: haloacid dehalogenase-like hydrolase;
                     TIGRFAM: haloacid dehalogenase superfamily, subfamily IA,
                     variant 3 with third motif having DD or ED"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase"
                     /protein_id="YP_004608765.1"
                     /db_xref="GI:337264710"
                     /db_xref="GeneID:10823982"
                     /translation="MQIPKLVIFDCDGILVDTENLANRRLAEWLTAAGYPTTFEYCRK
                     NFSGRSMVSVQKEIEAQTEVRLGADFVDRWNAGLPDLFAHGVEAIPYVREFIEAVRAA
                     GIAYCVATSARISKMHITLGQTGLLPLFEHAMFSATMVSRGKPFPDLFLHAAKTMGFP
                     PADCIVIEDSVAGTQAGIAAGMRVFSYHGDPYSDRDGLIHAGGILFDDMRELAGLVPI
                     H"
     misc_feature    190705..191349
                     /locus_tag="Mesop_0176"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     misc_feature    190714..191352
                     /locus_tag="Mesop_0176"
                     /note="Predicted phosphatase/phosphohexomutase [General
                     function prediction only]; Region: COG0637"
                     /db_xref="CDD:223710"
     misc_feature    190960..191253
                     /locus_tag="Mesop_0176"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    191032..191034
                     /locus_tag="Mesop_0176"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            191443..192291
                     /locus_tag="Mesop_0177"
                     /db_xref="GeneID:10823983"
     CDS             191443..192291
                     /locus_tag="Mesop_0177"
                     /note="KEGG: mlo:mll5341 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608766.1"
                     /db_xref="GI:337264711"
                     /db_xref="GeneID:10823983"
                     /translation="MPTNLFRFIIALVLLPFSWAVAGAQAVSFPDLGSALPGRADVTY
                     LDLARMVIPDLAADKDGFYKGGSPIDMRHIEGPDDGGSPPETSGFFNAAVLAIKAGGK
                     DRLAMLFDLGDSPDSAEGYAVLALYDITAKPKLLDAANVAVDRSTYFREPNKLSIGEG
                     DDALITMSAHFNSNQNYVATPLIMVAKDRFELVDMIYTFDEKLCAYSRKQDIGFQTIA
                     DGQPYAAIKATVTDATEPSGESCDEAAPKAASHEISVTYHWDKTHYVKDSDAFEKLAA
                     ENEKRF"
     sig_peptide     191443..191520
                     /locus_tag="Mesop_0177"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            192372..193172
                     /locus_tag="Mesop_0178"
                     /db_xref="GeneID:10823984"
     CDS             192372..193172
                     /locus_tag="Mesop_0178"
                     /note="COGs: COG2513 PEP phosphonomutase;
                     KEGG: mlo:mll5340 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608767.1"
                     /db_xref="GI:337264712"
                     /db_xref="GeneID:10823984"
                     /translation="MDKGKIFRDLHASTFVMPNPWDVGTTKLLGSFGFKALATTSAGF
                     AFSRGLPDGAVTFDQMIHHCRDVTAATSLPVSADLEKGKGDSAEQAAETIFAAEAAGL
                     AGCSIEDHTGDPDKPIYDFAHAVERVAAAVEAARALKRDFVFTARAENFLWGKSDLDD
                     TIKRLQAFEKAGADVLYAPGIDDVEMVRTICSAVSKPVNVMARPGFTIADLAMAGVKR
                     ISLGPWLTNFAYGMLETAAREIQQDGTFGFTRAAMPFGKLQALFRESS"
     misc_feature    192390..193088
                     /locus_tag="Mesop_0178"
                     /note="Members of the ICL/PEPM enzyme family catalyze
                     either P-C or C-C bond formation/cleavage. Known members
                     are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate
                     hydrolase (PPH), carboxyPEP mutase (CPEP mutase),
                     oxaloacetate hydrolase (OAH), isocitrate...; Region:
                     ICL_PEPM; cd00377"
                     /db_xref="CDD:119340"
     misc_feature    order(192396..192398,192411..192413,192417..192428,
                     192432..192446,192450..192455,192462..192464,
                     192468..192476,192495..192497,192507..192512,
                     192519..192524,192531..192533,192534..192539,
                     192543..192548,192555..192560,192564..192569,
                     192576..192581,192621..192623,192642..192647,
                     192657..192659,192666..192668,192735..192740,
                     192747..192749,192756..192761,192768..192770,
                     193053..193061,193065..193073,193077..193085)
                     /locus_tag="Mesop_0178"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119340"
     misc_feature    order(192483..192485,192489..192497,192525..192527,
                     192603..192605,192609..192611,192693..192695,
                     192810..192812,192906..192908,192972..192974,
                     192978..192980,193035..193037)
                     /locus_tag="Mesop_0178"
                     /note="active site"
                     /db_xref="CDD:119340"
     misc_feature    order(192525..192527,192603..192605,192609..192611,
                     192693..192695)
                     /locus_tag="Mesop_0178"
                     /note="Mg2+/Mn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:119340"
     gene            complement(193372..194082)
                     /locus_tag="Mesop_0179"
                     /db_xref="GeneID:10823985"
     CDS             complement(193372..194082)
                     /locus_tag="Mesop_0179"
                     /note="COGs: COG2981 Uncharacterized protein involved in
                     cysteine biosynthesis;
                     InterPro IPR007496;
                     KEGG: mlo:mlr5338 CysZ-like protein;
                     PFAM: protein of unknown function DUF540;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF540)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608768.1"
                     /db_xref="GI:337264713"
                     /db_xref="GeneID:10823985"
                     /translation="MIFDAARTAALELLSPPFRAVFLKTLGLTLLALVALWFGLTSLV
                     EWLALPWLQTLLPGIPSWAGWLGGIIAAIALAFGMALLVAPVTAAIAGLFLDDVAEVV
                     ERTDYPADPPGRAMPALRSLVLAIKFFGVVILGNIVALLLLLVPGINIAAFFIVNGYL
                     LGREFFEFAAMRFRPEEDARALRRHHAGTVFLAGLVIAAFLAVPLLNLVTPLFAAAMM
                     VHLHKAISAREAARRSRD"
     misc_feature    complement(193375..194079)
                     /locus_tag="Mesop_0179"
                     /note="CysZ-like protein; Reviewed; Region: PRK12768"
                     /db_xref="CDD:237196"
     gene            complement(194170..195072)
                     /locus_tag="Mesop_0180"
                     /db_xref="GeneID:10823986"
     CDS             complement(194170..195072)
                     /locus_tag="Mesop_0180"
                     /note="InterPro IPR000620;
                     KEGG: mlo:mlr5337 hypothetical protein;
                     PFAM: protein of unknown function DUF6 transmembrane;
                     SPTR: Putative uncharacterized protein;
                     PFAM: EamA-like transporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608769.1"
                     /db_xref="GI:337264714"
                     /db_xref="GeneID:10823986"
                     /translation="MPTRNDTTTDLALLGVLAVLWGASYTFIKIGVETIPPITFIATR
                     TLIAGAILLAIIHWRGLAMPSDAASWRRFAFQACLNSVVPFTLIAAAERSVDAGLATI
                     LNATSPIFTFLLTALITRHEPVTLRKLVGVGAGIAGICLIIGTEALGGLGHELWAQVA
                     IVVATVCYAGAAIFGRGFKGLDPMLPAAGSMLCGAVMLVPLSLVVDQPWTLTPSLASI
                     LALLGLSIFSTALAFVIYFRLIHTLGSVGTTSQAYLRVPIGVGIGAVFLGETLGPTVW
                     LGMACVVAGVAAMTIPVRKPALAR"
     misc_feature    complement(194182..195012)
                     /locus_tag="Mesop_0180"
                     /note="putative DMT superfamily transporter inner membrane
                     protein; Provisional; Region: PRK11272"
                     /db_xref="CDD:183067"
     misc_feature    complement(194644..195012)
                     /locus_tag="Mesop_0180"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    complement(194212..194577)
                     /locus_tag="Mesop_0180"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            195296..196288
                     /locus_tag="Mesop_0181"
                     /db_xref="GeneID:10823987"
     CDS             195296..196288
                     /locus_tag="Mesop_0181"
                     /note="COGs: COG0524 Sugar kinase ribokinase family;
                     InterPro IPR002173:IPR011611;
                     KEGG: mlo:mll5335 hypothetical protein;
                     PFAM: PfkB domain protein;
                     SPTR: PfkB domain protein;
                     PFAM: pfkB family carbohydrate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="PfkB domain-containing protein"
                     /protein_id="YP_004608770.1"
                     /db_xref="GI:337264715"
                     /db_xref="GeneID:10823987"
                     /translation="MPDYDVLCIGNAIVDIIAQCEEEFLETNGIIKGAMNLIDTQRAE
                     LLYSRMGPAIEASGGSAGNTAAGVASFGGRAAFFGKVSNDALGEIYAHDIHAQGVAFD
                     TKPLKGEPPTARSMIFVTPDGERSMNTYLGACVELGPEDVEADKASGAKVTYFEGYLW
                     DPPRAKEAIRQTARLAHAAGREVSMTLSDSFCVDRYRDEFLELMRSGTVDIVFANSHE
                     IKSLYQTSSFDDALAQIRKDCRIAAVTRSEKGSVIVRGDETVVIKATAIKELVDTTGA
                     GDLYAAGFLHGYTQGRDLKTCGDLGSLAAGLVIQQIGPRPRQNLRREAEQAGLL"
     misc_feature    195305..196246
                     /locus_tag="Mesop_0181"
                     /note="Adenosine kinase (AK) catalyzes the phosphorylation
                     of ribofuranosyl-containing nucleoside analogues at the
                     5'-hydroxyl using ATP or GTP as the phosphate donor.The
                     physiological function of AK is associated with the
                     regulation of extracellular...; Region: adenosine_kinase;
                     cd01168"
                     /db_xref="CDD:238573"
     misc_feature    195311..196234
                     /locus_tag="Mesop_0181"
                     /note="adenosine kinase; Provisional; Region: PTZ00247"
                     /db_xref="CDD:240328"
     misc_feature    order(195326..195328,195332..195334,195338..195340,
                     195398..195400,195467..195475,195482..195484,
                     195638..195640,195674..195676,195680..195682,
                     195686..195688,195767..195769,195866..195868,
                     196115..196120,196127..196129)
                     /locus_tag="Mesop_0181"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238573"
     misc_feature    order(196028..196030,196034..196039,196046..196048,
                     196079..196081,196085..196087,196103..196105,
                     196112..196114,196121..196126,196133..196135,
                     196208..196210,196220..196222)
                     /locus_tag="Mesop_0181"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238573"
     gene            196679..197365
                     /locus_tag="Mesop_0182"
                     /db_xref="GeneID:10823988"
     CDS             196679..197365
                     /locus_tag="Mesop_0182"
                     /note="KEGG: mlo:mll5333 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF2384);
                     TIGRFAM: putative toxin-antitoxin system antitoxin
                     component, TIGR02293 family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608771.1"
                     /db_xref="GI:337264716"
                     /db_xref="GeneID:10823988"
                     /translation="MNRFQTTGLGQDDFAEMVAEDVERALAHYDEAINQSTVVSVGKI
                     AGSIASAVTSLSPRHQRAIDTIHADLPGLAQKFVRALAAEAARRSEAGTAGLPVPLSA
                     GEPPSPQSDDLESMLIEDWAGRVAGSTYLEENLRIARSTLHRWQRRGDVIALRKGGRK
                     HVFPLAQFVDGRPVAGISDVLKLIGNPRLAWLWLTRPAAQLDGRIPIDLLRADQVEDV
                     VEAARVFPPG"
     misc_feature    197225..197347
                     /locus_tag="Mesop_0182"
                     /note="Protein of unknown function (DUF2384); Region:
                     DUF2384; pfam09722"
                     /db_xref="CDD:255508"
     gene            complement(197428..199707)
                     /locus_tag="Mesop_0183"
                     /db_xref="GeneID:10823989"
     CDS             complement(197428..199707)
                     /locus_tag="Mesop_0183"
                     /note="COGs: COG0281 Malic enzyme;
                     InterPro IPR012188:IPR012301:IPR012302:IPR002505;
                     KEGG: mlo:mlr5329 malic enzyme;
                     PFAM: malic protein NAD-binding; malic protein domain
                     protein; phosphate acetyl/butaryl transferase;
                     SPTR: Malate dehydrogenase (Oxaloacetate-decarboxylating)
                     (NADP(+))., Phosphate acetyltransferase;
                     PFAM: Malic enzyme, NAD binding domain; Phosphate
                     acetyl/butaryl transferase; Malic enzyme, N-terminal
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="malic protein NAD-binding protein"
                     /protein_id="YP_004608772.1"
                     /db_xref="GI:337264717"
                     /db_xref="GeneID:10823989"
                     /translation="MARKTENSGPSVSAQEALEFHAMGRPGKLEIVATKPMTTQRDLS
                     LAYSPGVAVPVRAIAEDPSRAFDYTTRGNMVAVISNGTAILGLGNLGALASKPVMEGK
                     AVLFKRFADVDSIDLEVDTEDAEEFINCVRYLGPSFGGINLEDIKAPECFIIEQRLRE
                     LMDIPVFHDDQHGTAIISSAGLINALEVTGRDMKTTRLVCNGAGAAGIACIELMKAMG
                     FAPENIILCDTKGVVYQGRTEGMNQWKSAHAVKTDRRSLAEALDGADVFLGLSAKGAL
                     TTAMVQSMAKNPIIFAMANPDPEITPEEVAEIRTDAIMATGRSDYPNQVNNVLGFPYI
                     FRGALDVRATTINDDMKIAAARALAELARQDVPDDVAAAYQGNRPRFGPNYIIPVPFD
                     PRLISAIPLAVAKAAMDSGVARKPILDLDRYAQELSARRDPIASTLQRIYDRVRRQPK
                     RIVFAEGEEEQVMRAAVSYVNQKLGTAILLGRDDVIKENAKHAGIDLNKQGIEIINAR
                     LSRRNGIYTDYLYERMQRKGFLFRDCQRLINNDRNHFAACMVALGDADGIVTGVTRNY
                     STALDDIRRVIDAKPGHRVIGVSIVLARGKTVLVADTAVHDMPNAEQIADIAEEAAGF
                     ARRMGYEPRLAMLAYSTFGHPQGERSERVQEAVRILDKRRVDFEYDGEMAADVALNAR
                     AMAQYPFIRLTGPANVLVMPAFHSASISTKMLQELGGSTVIGPLLVGLNKPVQIVSLN
                     AKDSDIVNMAAIAAYTAGT"
     misc_feature    complement(197431..199665)
                     /locus_tag="Mesop_0183"
                     /note="bifunctional malic enzyme
                     oxidoreductase/phosphotransacetylase; Reviewed; Region:
                     PRK07232"
                     /db_xref="CDD:235976"
     misc_feature    complement(199231..199632)
                     /locus_tag="Mesop_0183"
                     /note="Malic enzyme, N-terminal domain; Region: malic;
                     pfam00390"
                     /db_xref="CDD:249824"
     misc_feature    complement(198487..199197)
                     /locus_tag="Mesop_0183"
                     /note="NAD(P) binding domain of malic enzyme (ME),
                     subgroup 2; Region: NAD_bind_2_malic_enz; cd05311"
                     /db_xref="CDD:133453"
     misc_feature    complement(order(198727..198729,198733..198735,
                     198757..198759,198823..198831,198883..198885,
                     198895..198900,199021..199026,199090..199101))
                     /locus_tag="Mesop_0183"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:133453"
     misc_feature    complement(197431..198399)
                     /locus_tag="Mesop_0183"
                     /note="Phosphotransacetylase [Energy production and
                     conversion]; Region: Pta; COG0280"
                     /db_xref="CDD:223357"
     gene            199919..202642
                     /locus_tag="Mesop_0184"
                     /db_xref="GeneID:10823990"
     CDS             199919..202642
                     /locus_tag="Mesop_0184"
                     /note="COGs: COG0249 Mismatch repair ATPase (MutS family);
                     InterProIPR000432:IPR007695:IPR007860:IPR007696:IPR
                     007861:IPR005748;
                     KEGG: mlo:mll5328 DNA mismatch repair protein MutS;
                     PFAM: MutS III domain protein; DNA mismatch repair protein
                     MutS domain protein; MutS II domain protein; MutS IV
                     domain protein;
                     SMART: DNA mismatch repair protein MutS domain protein;
                     MutS III domain protein;
                     SPTR: DNA mismatch repair protein MutS;
                     TIGRFAM: DNA mismatch repair protein MutS;
                     PFAM: MutS family domain IV; MutS domain II; MutS domain
                     V; MutS domain I; MutS domain III;
                     TIGRFAM: DNA mismatch repair protein MutS"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="YP_004608773.1"
                     /db_xref="GI:337264718"
                     /db_xref="GeneID:10823990"
                     /translation="MNMHSPNEPDAPEAMTPLQPGAPAVTPMMEQFIEIKAANPDSLL
                     FYRMGDFYELFFDDAEKASRALGIVLTKRGKHQGHDIPMCGVPVHAADDYLQKLIGQG
                     FRVAVCEQIEDPAEAKKRGSKSVVRRDVVRLVTPGTITEDKLLAPSESSFLMALGRVK
                     GGADHSFALAWIDISTGAFRVAETTADRLLADIFRVDPRELIVAEPVFYDAELKPVFD
                     VLGRVANPQPPSLFDSASATGRIARFFDVATPDSFGTFSRAELSAISGAIAYVEKTQK
                     AERPPLSRPEREEQGSTLFIDPATRGNLELLRTLSGNREGSLFKAIDRTVTGGGARLL
                     ADRLMAPLTDPAAIGARLDSVSFFRSETRLCQAVRTSLKSVADMPRALSRLALNRGGP
                     RDLGALRAGFEAAGAIAEIFAETALPQELADALAAIHALPQALARHLTQALGEELPLL
                     KRDGGFLRGGYHGELDEMRALRDESRKVIAGLERSLIEETGIRSLKIRHNNVLGYYIE
                     VTANHHAVMTGSDGAKARFIHRQTMANAMRFTTTELAELETKIANAADRALGIELAAF
                     DALTAEAVGEADKIRAGADALAVLDVSAALALLSESEAWCRPVVDSSLAFEISGGRHP
                     VVEQALRRSGEGPFVANDCDLSPEGNAKNGAIWLLTGPNMGGKSTFLRQNALIAILAQ
                     TGSFVPAASAHIGVVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQAGERALVILD
                     EIGRGTATFDGLSIAWAAVEYLHEKNRCRAIFATHFHEMTSLAGKLARLHNVTMRVKE
                     WENDVVFLHEVGKGAADRSYGVQVARLAGLPEAVVDRAKQVLHQLEEGEVSGKTNRLV
                     DDLPLFSVAVKREAPKPVKSDALGAALGEINPDEMTPREALEALYRLKGLM"
     misc_feature    199973..202639
                     /locus_tag="Mesop_0184"
                     /note="DNA mismatch repair protein MutS; Provisional;
                     Region: PRK05399"
                     /db_xref="CDD:235444"
     misc_feature    199994..200344
                     /locus_tag="Mesop_0184"
                     /note="MutS domain I; Region: MutS_I; pfam01624"
                     /db_xref="CDD:250754"
     misc_feature    200369..200767
                     /locus_tag="Mesop_0184"
                     /note="MutS domain II; Region: MutS_II; pfam05188"
                     /db_xref="CDD:253070"
     misc_feature    200810..201709
                     /locus_tag="Mesop_0184"
                     /note="MutS domain III; Region: MutS_III; pfam05192"
                     /db_xref="CDD:253074"
     misc_feature    201767..202438
                     /locus_tag="Mesop_0184"
                     /note="ATP-binding cassette domain of MutS1 homolog;
                     Region: ABC_MutS1; cd03284"
                     /db_xref="CDD:213251"
     misc_feature    201899..201922
                     /locus_tag="Mesop_0184"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213251"
     misc_feature    order(201908..201913,201917..201925,202031..202033,
                     202136..202141,202241..202243)
                     /locus_tag="Mesop_0184"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213251"
     misc_feature    202022..202033
                     /locus_tag="Mesop_0184"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213251"
     misc_feature    202046..202087
                     /locus_tag="Mesop_0184"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213251"
     misc_feature    202124..202141
                     /locus_tag="Mesop_0184"
                     /note="Walker B; other site"
                     /db_xref="CDD:213251"
     misc_feature    202148..202159
                     /locus_tag="Mesop_0184"
                     /note="D-loop; other site"
                     /db_xref="CDD:213251"
     misc_feature    202229..202249
                     /locus_tag="Mesop_0184"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213251"
     gene            complement(202845..203690)
                     /locus_tag="Mesop_0185"
                     /db_xref="GeneID:10823991"
     CDS             complement(202845..203690)
                     /locus_tag="Mesop_0185"
                     /note="COGs: COG0656 Aldo/keto reductase related to
                     diketogulonate reductase;
                     InterPro IPR001395:IPR020471;
                     KEGG: mlo:mlr5327 oxidoreductase;
                     PFAM: aldo/keto reductase;
                     SPTR: Aldo/keto reductase;
                     PFAM: Aldo/keto reductase family"
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="YP_004608774.1"
                     /db_xref="GI:337264719"
                     /db_xref="GeneID:10823991"
                     /translation="MPSTVRTTTLPSGEAIAVLGQGTWKMGEDIRRRGDEIAALKLGL
                     DLGVTLIDTAEMYASGGAEEVVAEAIAGRRAEVFLVSKVLPSNASRAGVQRACENSLK
                     RLATDRIDLYLLHWPGSVPLAETVEAFEALKKAGKIRHWGVSNFDIEEMEDLAGLPDG
                     GNVQTNQVLYNLVRRGLEFDLAPWSRKRGIPLMAYSPVEQGALARNARLDAVAARHGA
                     TAAQIALAWVMQQEGVIAIPKASSQEHVRQNFAALDIKLIGEDLADLDRAFPPPTRKR
                     GLEMI"
     misc_feature    complement(202887..203657)
                     /locus_tag="Mesop_0185"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    complement(202890..203657)
                     /locus_tag="Mesop_0185"
                     /note="voltage-dependent potassium channel beta subunit,
                     animal; Region: Kv_beta; TIGR01293"
                     /db_xref="CDD:213602"
     misc_feature    complement(order(202944..202949,202956..202958,
                     202971..202982,203028..203030,203091..203108,
                     203190..203192,203256..203261,203343..203348,
                     203445..203447,203520..203522,203535..203537,
                     203619..203627))
                     /locus_tag="Mesop_0185"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(203346..203348,203445..203447,
                     203520..203522,203535..203537))
                     /locus_tag="Mesop_0185"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(203776..204168)
                     /locus_tag="Mesop_0186"
                     /db_xref="GeneID:10823992"
     CDS             complement(203776..204168)
                     /locus_tag="Mesop_0186"
                     /note="COGs: COG3544 conserved hypothetical protein;
                     InterPro IPR005183;
                     KEGG: mlo:mlr5326 hypothetical protein;
                     PFAM: protein of unknown function DUF305;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Domain of unknown function (DUF305)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608775.1"
                     /db_xref="GI:337264720"
                     /db_xref="GeneID:10823992"
                     /translation="MTLAKKLVLLLMAAGMLLAVFLESVPAQSEEMKHDMTGMAMGAE
                     SPSTEGYKAAMDKMHAGMMASQYTGNADVDFVRGMIPHHQGAIDMAKVELANGKDPEI
                     RKLAEAVIAAQETEIKQMQDWLAAHPVK"
     misc_feature    complement(203779..>204168)
                     /locus_tag="Mesop_0186"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3544"
                     /db_xref="CDD:226074"
     sig_peptide     complement(204082..204168)
                     /locus_tag="Mesop_0186"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            complement(204212..206710)
                     /locus_tag="Mesop_0187"
                     /db_xref="GeneID:10823993"
     CDS             complement(204212..206710)
                     /locus_tag="Mesop_0187"
                     /EC_number="3.6.3.4"
                     /note="COGs: COG2217 Cation transport ATPase;
                     InterProIPR018303:IPR007029:IPR008250:IPR005834:IPR
                     001757:IPR001756:IPR011017:IPR006403:IPR006416;
                     KEGG: mlo:mlr5325 cation transporting P-type ATPase;
                     PFAM: E1-E2 ATPase-associated domain protein; YHS domain
                     protein; Haloacid dehalogenase domain protein hydrolase;
                     SMART: TRASH domain protein;
                     SPTR: Heavy metal translocating P-type ATPase;
                     TIGRFAM: heavy metal translocating P-type ATPase;
                     copper-translocating P-type ATPase; ATPase, P-type
                     (transporting), HAD superfamily, subfamily IC;
                     PFAM: E1-E2 ATPase; YHS domain; haloacid dehalogenase-like
                     hydrolase;
                     TIGRFAM: copper-(or silver)-translocating P-type ATPase;
                     heavy metal translocating P-type ATPase; ATPase, P-type
                     (transporting), HAD superfamily, subfamily IC"
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="YP_004608776.1"
                     /db_xref="GI:337264721"
                     /db_xref="GeneID:10823993"
                     /translation="MAHSDHDHHTHGGCCAPKAVDAGAVLRDPVCGMTVDPAAGKPTA
                     EHGGRLYHFCSEGCRTKFQAEPEKYLTAIDPVCGISVDRATARHFVRHEGQGFYFCSA
                     GCKAKFEAAPQAYLGDKPVPAPMPKGTQYTCPMHPEIVRDKPGSCPICGMALEPMGVP
                     TGDEGPNPELVDFTRRFWVSAALSIPLLIVAMAPMVGLSFEGLVGDRTKVWIELALAS
                     PVVLWAAFPFFHRGWESILNRSPNMWTLISLGVGAAYLYSVVATLFPDIFPHQFRGHG
                     GAVPVYFEAAAVIVALVFLGQVLELRAREKTGSAIRALLDLAPKTARRIAEDGSESDV
                     PLDGVKAGDRLRVRPGEAVPVDGTVLEGRSSIDESMITGEPLPVEKTEGDALTGGTLN
                     RQGSLIMRAERIGSETTLARIVELVAKAQRSRAPIQGLADRVSFYFVPAVVLVAVAAF
                     IAWAVLGPEPSLVFAVVSAVSVLIIACPCALGLATPMSIMTATGRGALAGVLIKEAAA
                     LERFASVDTLIVDKTGTLTEGRPKLTDIVTASGFAEDDLLGLAASLEKGSEHPLAEAI
                     VEGAAARGVTVAHVGDFEATTGKGVSGTVSGKTVALGNAAMMRDLGVDVSAVAASAEA
                     LQGDGKTAMFVAVGGRLAGIVAVADPVKATTAEAIKALHDSGLRIIMATGDNERTAKA
                     IAGSLGIDEVRAGLLPEQKAALVDELRGTSAGVAMAGDGVNDAPALAAADVGIAMGTG
                     ADVAVESAGITLVKGDLNGIVRARALAQATIRNIRQNLFFAFLYNVLGVPVAAGVLYP
                     LTGTLLSPMLAAAAMSLSSVSVIANALRLRTLKL"
     misc_feature    complement(206495..206632)
                     /locus_tag="Mesop_0187"
                     /note="YHS domain; Region: YHS; pfam04945"
                     /db_xref="CDD:203128"
     misc_feature    complement(206354..206497)
                     /locus_tag="Mesop_0187"
                     /note="YHS domain; Region: YHS; pfam04945"
                     /db_xref="CDD:203128"
     misc_feature    complement(204284..206041)
                     /locus_tag="Mesop_0187"
                     /note="copper-(or silver)-translocating P-type ATPase;
                     Region: ATPase-IB1_Cu; TIGR01511"
                     /db_xref="CDD:233445"
     misc_feature    complement(205178..205849)
                     /locus_tag="Mesop_0187"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    complement(<204506..204796)
                     /locus_tag="Mesop_0187"
                     /note="Soluble P-type ATPase [General function prediction
                     only]; Region: COG4087"
                     /db_xref="CDD:226572"
     gene            206900..207745
                     /locus_tag="Mesop_0188"
                     /db_xref="GeneID:10823994"
     CDS             206900..207745
                     /locus_tag="Mesop_0188"
                     /note="COGs: COG3306 Glycosyltransferase involved in LPS
                     biosynthesis;
                     InterPro IPR002654;
                     KEGG: mlo:mll5323 glycosyl transferase;
                     PFAM: glycosyl transferase family 25;
                     SPTR: Glycosyl transferase family 25;
                     PFAM: Glycosyltransferase family 25 (LPS biosynthesis
                     protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_004608777.1"
                     /db_xref="GI:337264722"
                     /db_xref="GeneID:10823994"
                     /translation="MKCLVINLDRSPDRLAHITAEFARIGIAFARIVATDARDHPELV
                     LQPQFSIYAVRRLSSSEVACMHSHRACWSIIAQDDAPYGAVFEDDVVFSAKAGALLAD
                     SGWISADADAVKLETFFSKTMIQRKRIAVGNGFSLFRLRRSHMGTGGYIVSRQMARDL
                     LEATAQASAAADDLLFNPVFPTSASKTIYQLVPALCAQDQFVGDRLPSLLYEEREAEW
                     VASGLTIKRRKPLAEKIRVEIRRVVEWVVDHCKLRHYTVIALDPPAAEEPMSCLAAGG
                     NENAL"
     misc_feature    206903..207424
                     /locus_tag="Mesop_0188"
                     /note="Glycosyltransferase family 25 [lipooligosaccharide
                     (LOS) biosynthesis protein] is a family of
                     glycosyltransferases involved in LOS biosynthesis. The
                     members include the beta(1,4) galactosyltransferases: Lgt2
                     of Moraxella catarrhalis, LgtB and LgtE of...; Region:
                     Glyco_transf_25; cd06532"
                     /db_xref="CDD:133474"
     gene            207956..208753
                     /locus_tag="Mesop_0189"
                     /db_xref="GeneID:10823995"
     CDS             207956..208753
                     /locus_tag="Mesop_0189"
                     /note="COGs: COG3306 Glycosyltransferase involved in LPS
                     biosynthesis;
                     InterPro IPR002654;
                     KEGG: mlo:mll5323 glycosyl transferase;
                     PFAM: glycosyl transferase family 25;
                     SPTR: Glycosyl transferase family 25;
                     PFAM: Glycosyltransferase family 25 (LPS biosynthesis
                     protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_004608778.1"
                     /db_xref="GI:337264723"
                     /db_xref="GeneID:10823995"
                     /translation="MKRLVINLDRSPDRLVHMTSEFARIGIGFERVAGIDAQEHPNLV
                     QQPQHAIHAIRPLAGSEIACLHSHRACWTIIAQDDAPYGAVFEDDMVFSGRAGALLGD
                     TSWVPEDADVVKLETFFSRTVIQRRRAPAGHGFSTVRLRKGHPGAGGYLLSRQMAREF
                     LEATAQVNIAVDDLIFNPAMSAGRNIYQLVPALCAQDQFVGYRLPSLLDQERDAARTA
                     SGLMTRQRKPTAVRISREAGRTMRWIADFCRLRRQIVVPFGPIEAID"
     misc_feature    207959..208480
                     /locus_tag="Mesop_0189"
                     /note="Glycosyltransferase family 25 [lipooligosaccharide
                     (LOS) biosynthesis protein] is a family of
                     glycosyltransferases involved in LOS biosynthesis. The
                     members include the beta(1,4) galactosyltransferases: Lgt2
                     of Moraxella catarrhalis, LgtB and LgtE of...; Region:
                     Glyco_transf_25; cd06532"
                     /db_xref="CDD:133474"
     gene            208843..211644
                     /locus_tag="Mesop_0190"
                     /db_xref="GeneID:10823996"
     CDS             208843..211644
                     /locus_tag="Mesop_0190"
                     /EC_number="2.7.7.59"
                     /note="COGs: COG2844 UTP:GlnB (protein PII)
                     uridylyltransferase;
                     InterProIPR010043:IPR013546:IPR006674:IPR002912:IPR
                     003607;
                     KEGG: mlo:mll5321 PII uridylyl-transferase;
                     PFAM: GlnD PII-uridylyltransferase; metal-dependent
                     phosphohydrolase HD sub domain; amino acid-binding ACT
                     domain protein;
                     PRIAM: [Protein-PII] uridylyltransferase;
                     SMART: metal-dependent phosphohydrolase HD region;
                     SPTR: UTP-GlnB uridylyltransferase, GlnD;
                     TIGRFAM: protein-P-II uridylyltransferase;
                     PFAM: GlnD PII-uridylyltransferase; HD domain; ACT domain;
                     Nucleotidyltransferase domain;
                     TIGRFAM: [Protein-PII] uridylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="UTP-GlnB uridylyltransferase, GlnD"
                     /protein_id="YP_004608779.1"
                     /db_xref="GI:337264724"
                     /db_xref="GeneID:10823996"
                     /translation="MAKISLKLDELIDGETLRREMTALTAASAGDGSSPVIRAAVLQL
                     LKGRLAEGRRKAEAMLRQDGGGNACAERLSHVMDELIRALYDFAATHVYRVKNPSSAE
                     RMVVVAVGGYGRGTLAPGSDIDLLFLLPYKQTPWGEQTVEYMLYMLWDLGLKVGHATR
                     NIDECLRLSRTDITIRTSILEARFLWGERKLYDELMLRFDHEVVRTTGPEYVQAKLAE
                     RDERHAKAGESRYLVEPNVKDGKGGLRDLQTLFWIGKYFYRVRTGEELVEKGVFTDAE
                     YREFQKAEDFLWAVRCHMHFLTGKAEERLHFDIQREIAERLGYTTHPGLSAVERFMKH
                     YFLVAKDVGDLTRIFCAALEEEQAKHVPGFNRIFLTFQRRKRKLAGTSDFIVDNHRIN
                     IADDQVFERDPVNLLRLFWFADKHGLEFHPDALKLLTRSLGLVNKSLRRDEEANRLFL
                     DILTSDRNAELNLRRMNEAGLLGRLIPDFGKIVAMMQFSMYHHYTVDEHLIRCIGVLA
                     EIERGDGEKVHPLSHSLMPGLKKSREALYVAVLLHDIAKGRPEDHSEAGARIARRICP
                     HMGLSPADTETVAWLVENHLVMSMTAQTRDLNDRKTIEDFAAIVQSVERLKMLLILTV
                     CDIRGVGPGVWNGWKGQLLRTLYYETELLLTGGFSEVSRAQRTAASRERLAEALADWP
                     DKARKRYVGQHYENYLLTVDLPDQLRHAEFIRDADAAGKKLATMVKTHQFEAVTEITV
                     LAQDHPRLLSVIAGACAGAGGNIVDAQIFTTSDGRALDTILISREFDRDEDERRRAER
                     VGRLIEDVLSGKSWLPEMIEKRTKPRRGSKVFKIPPRAEIRNALSNRFSVIEVEGLDR
                     PGLLSEITRTLSDLSLDIASAHITTFGEKVIDTFYVTDLTGQKIDSPARIATIRNRLI
                     ATLEGAAPERGGRAKAAAE"
     misc_feature    208843..211641
                     /locus_tag="Mesop_0190"
                     /note="PII uridylyl-transferase; Provisional; Region:
                     PRK05092"
                     /db_xref="CDD:235342"
     misc_feature    208978..209427
                     /locus_tag="Mesop_0190"
                     /note="Nucleotidyltransferase (NT) domain of Escherichia
                     coli adenylyltransferase (GlnE), Escherichia coli uridylyl
                     transferase (GlnD), and similar proteins; Region:
                     NT_GlnE_GlnD_like; cd05401"
                     /db_xref="CDD:143391"
     misc_feature    order(209206..209208,209212..209214,209290..209292)
                     /locus_tag="Mesop_0190"
                     /note="metal binding triad; metal-binding site"
                     /db_xref="CDD:143391"
     misc_feature    209473..209892
                     /locus_tag="Mesop_0190"
                     /note="GlnD PII-uridylyltransferase; Region:
                     GlnD_UR_UTase; pfam08335"
                     /db_xref="CDD:254738"
     misc_feature    210322..210783
                     /locus_tag="Mesop_0190"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(210337..210339,210469..210474,210718..210720)
                     /locus_tag="Mesop_0190"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    210472..210474
                     /locus_tag="Mesop_0190"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    211045..211263
                     /locus_tag="Mesop_0190"
                     /note="ACT domain family, ACT_UUR-like_1, includes the
                     first of two C-terminal ACT domains of the bacterial
                     signal-transducing uridylyltransferase /uridylyl-removing
                     (UUR) enzyme, GlnD and related domains; Region:
                     ACT_UUR-like_1; cd04900"
                     /db_xref="CDD:153172"
     misc_feature    211381..211593
                     /locus_tag="Mesop_0190"
                     /note="C-terminal ACT domains of the bacterial
                     signal-transducing uridylyltransferase /uridylyl-removing
                     (UUR) enzyme, GlnD and related domains; Region:
                     ACT_ACR-UUR-like_2; cd04899"
                     /db_xref="CDD:153171"
     gene            211793..213391
                     /locus_tag="Mesop_0191"
                     /db_xref="GeneID:10823997"
     CDS             211793..213391
                     /locus_tag="Mesop_0191"
                     /note="COGs: COG0728 membrane protein putative virulence
                     factor;
                     InterPro IPR004268;
                     KEGG: mlo:mll5320 virulence factor MviN-like protein;
                     PFAM: virulence factor MVIN family protein;
                     SPTR: Integral membrane protein MviN;
                     TIGRFAM: integral membrane protein MviN;
                     PFAM: MviN-like protein;
                     TIGRFAM: integral membrane protein MviN"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein MviN"
                     /protein_id="YP_004608780.1"
                     /db_xref="GI:337264725"
                     /db_xref="GeneID:10823997"
                     /translation="MSLVKKFATVASGTLMSRALGFGREMLMAAALGTGPVADAFNAA
                     FQFPNTFRRLFAEGAFNAAFVPLFAKEIETHGTDGAKRFSEEVFGVLFTALLALTIVM
                     ELAMPLIVRYLVAPGFADTPGKFETTVALATIMFPYLICMSLAAMMAGMLNSLRRYFA
                     AAIAPAFLNIILISVLGYAWYHGLDARAVGFSLSWGVLAAGIVQLAIVWVAVRNAGIS
                     IGFRRPKMTPNVKRLLILALPAAITGGITQINQLIGTAIASAQDSAVSSLAYADRVYQ
                     LPLGVVGVAVAIVLLPELSRALKSGNLIEAANLQNRSVEFTLFMTLPAAAALWVMSEP
                     IVRLVYERGAFAANHSTPTVAAILAIFGLGLPAFVLIKAFTPGYFAREDTRTPMIFAA
                     ISVAVNVATALTLFPRMGAPGIAVASAVAGWVNALMLLGVLIRRGHWGRDVPLLKRIP
                     RLVLSAAVMAVALYFAEHWLAVRLGPGSPLVVKATTLLTLVAGGALLYFVTAFATGGA
                     DFGMIRRNVGRKETPQPKEQSSDP"
     misc_feature    211793..213340
                     /locus_tag="Mesop_0191"
                     /note="Uncharacterized membrane protein, putative
                     virulence factor [General function prediction only];
                     Region: MviN; COG0728"
                     /db_xref="CDD:223800"
     sig_peptide     211793..211855
                     /locus_tag="Mesop_0191"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    211823..213100
                     /locus_tag="Mesop_0191"
                     /note="MurJ/MviN, a subfamily of the multidrug and toxic
                     compound extrusion (MATE)-like proteins; Region:
                     MATE_MurJ_like; cd13123"
                     /db_xref="CDD:240528"
     gene            complement(213366..213770)
                     /locus_tag="Mesop_0192"
                     /db_xref="GeneID:10823998"
     CDS             complement(213366..213770)
                     /locus_tag="Mesop_0192"
                     /note="COGs: COG3742 conserved hypothetical protein;
                     InterPro IPR002716;
                     KEGG: ara:Arad_8382 PilT protein, N-terminal;
                     PFAM: PilT protein domain protein;
                     SPTR: PilT protein domain protein;
                     PFAM: PIN domain"
                     /codon_start=1
                     /transl_table=11
                     /product="PilT protein domain-containing protein"
                     /protein_id="YP_004608781.1"
                     /db_xref="GI:337264726"
                     /db_xref="GeneID:10823998"
                     /translation="MFVDAAAIVAMLSHEAEAQRCARAVLEASAPFTSAIAVWEAAMA
                     LSRSEKLAVPVEVSLKIVSRFLEERAIAVRELPPAADATSLSVEAASRFRNKAIRLNL
                     ADCFHYACARYYAVPMLSTADEFRLTDLKTVP"
     misc_feature    complement(213372..213770)
                     /locus_tag="Mesop_0192"
                     /note="PIN domain of the VapC-like UPF0110 protein Mb0640
                     and homologs; Region: PIN_UPF0110; cd09871"
                     /db_xref="CDD:189041"
     misc_feature    complement(order(213459..213461,213651..213653,
                     213759..213761))
                     /locus_tag="Mesop_0192"
                     /note="putative active site [active]"
                     /db_xref="CDD:189041"
     gene            complement(213770..214015)
                     /locus_tag="Mesop_0193"
                     /db_xref="GeneID:10823999"
     CDS             complement(213770..214015)
                     /locus_tag="Mesop_0193"
                     /note="InterPro IPR011660;
                     KEGG: mes:Meso_4324 Rv0623-like transcription factor;
                     PFAM: Rv0623 family protein transcription factor;
                     SPTR: Rv0623 family protein transcription factor;
                     PFAM: Rv0623-like transcription factor"
                     /codon_start=1
                     /transl_table=11
                     /product="protein transcription factor"
                     /protein_id="YP_004608782.1"
                     /db_xref="GI:337264727"
                     /db_xref="GeneID:10823999"
                     /translation="MTININNKEADDLTRTFARIEGVGITEAIVIAMREALERRRNRE
                     TPLETAARLRAEFGIELSEQARKPLPRSVYDELSGED"
     misc_feature    complement(213773..214015)
                     /locus_tag="Mesop_0193"
                     /note="Rv0623-like transcription factor; Region:
                     PSK_trans_fac; pfam07704"
                     /db_xref="CDD:203734"
     gene            214256..215323
                     /locus_tag="Mesop_0194"
                     /db_xref="GeneID:10824000"
     CDS             214256..215323
                     /locus_tag="Mesop_0194"
                     /EC_number="6.1.1.2"
                     /note="COGs: COG0180 Tryptophanyl-tRNA synthetase;
                     InterPro IPR001412:IPR002305:IPR002306;
                     KEGG: mlo:mll5317 tryptophanyl-tRNA synthetase;
                     PFAM: aminoacyl-tRNA synthetase class Ib;
                     PRIAM: Tryptophan--tRNA ligase;
                     SPTR: Tryptophanyl-tRNA synthetase;
                     TIGRFAM: tryptophanyl-tRNA synthetase;
                     PFAM: tRNA synthetases class I (W and Y);
                     TIGRFAM: tryptophanyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="YP_004608783.1"
                     /db_xref="GI:337264728"
                     /db_xref="GeneID:10824000"
                     /translation="MSAFKPLVFSGVQPTGNLHLGNYLGAIKKFVALQDTSDCIYCVV
                     DLHSLTAQLVYDDLADQTRSITAAFLASGIDPKKHIVFNQSRVMQHAELAWIFNCVAR
                     IGWMNKMTQFKDKAGKDRENASLGLLAYPSLMAADILLYRATHVPVGEDQKQHLELTR
                     DIAQKFNNDFSDRIASLGVGVEMQVGDETVNGFFPITEPVIGGPAARIMSLRDGSKKM
                     SKSDPSDLSRINLTDDADTISKKIRKAKTDPEALPSEVDGLETRPEAENLVGIYAGLA
                     ELSKAEVLKEFGGQQFSVFKPALADLAVEKLAPIASEMRRIQGDRAYVDAVLRDGGER
                     AGVLAETTMKTVRDIVGLLQG"
     misc_feature    214268..215317
                     /locus_tag="Mesop_0194"
                     /note="tryptophanyl-tRNA synthetase; Reviewed; Region:
                     PRK00927"
                     /db_xref="CDD:234866"
     misc_feature    214277..215170
                     /locus_tag="Mesop_0194"
                     /note="catalytic core domain of tryptophanyl-tRNA
                     synthetase; Region: TrpRS_core; cd00806"
                     /db_xref="CDD:173903"
     misc_feature    order(214280..214294,214310..214312,214316..214321,
                     214328..214330,214379..214381,214394..214396,
                     214505..214507,214643..214645,214655..214657,
                     214664..214666,214691..214693,214697..214702,
                     214706..214711,214718..214720,214874..214876,
                     214904..214909,214913..214915)
                     /locus_tag="Mesop_0194"
                     /note="active site"
                     /db_xref="CDD:173903"
     misc_feature    214310..214321
                     /locus_tag="Mesop_0194"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173903"
     misc_feature    order(214391..214393,214400..214405,214523..214528,
                     214532..214540,214547..214552,214556..214567,
                     214571..214576,214631..214633,214637..214642,
                     214649..214654)
                     /locus_tag="Mesop_0194"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173903"
     misc_feature    214904..214918
                     /locus_tag="Mesop_0194"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173903"
     gene            215414..215905
                     /locus_tag="Mesop_0195"
                     /db_xref="GeneID:10824001"
     CDS             215414..215905
                     /locus_tag="Mesop_0195"
                     /note="InterPro IPR006016;
                     KEGG: mlo:mll5316 hypothetical protein;
                     PFAM: UspA domain protein;
                     SPTR: UspA domain protein;
                     PFAM: Universal stress protein family"
                     /codon_start=1
                     /transl_table=11
                     /product="UspA domain-containing protein"
                     /protein_id="YP_004608784.1"
                     /db_xref="GI:337264729"
                     /db_xref="GeneID:10824001"
                     /translation="MVSKRLIREAGHRRKFLTIIDDTPECERAVAYASKRAQSTSGTL
                     VLLYVIVPDDFQHWLGVEKIMREEANATARAALDGYANKVRQKLGIEPEMVVREGKPT
                     EEIHRLIEEDQDIAILVLAAGAGKEGPGPLVGAVAGKGAAFPIPVTVVPQNLSDEEID
                     SLA"
     misc_feature    215471..215863
                     /locus_tag="Mesop_0195"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    order(215471..215476,215558..215560,215771..215773,
                     215786..215788,215792..215797,215825..215836)
                     /locus_tag="Mesop_0195"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            216053..216622
                     /locus_tag="Mesop_0196"
                     /db_xref="GeneID:10824002"
     CDS             216053..216622
                     /locus_tag="Mesop_0196"
                     /note="COGs: COG0694 Thioredoxin-like protein and domains;
                     InterPro IPR017065:IPR014824:IPR001075;
                     KEGG: mlo:mll5315 hypothetical protein;
                     PFAM: Scaffold protein Nfu/NifU ; nitrogen-fixing NifU
                     domain protein;
                     SPTR: Scaffold protein Nfu/NifU;
                     PFAM: Scaffold protein Nfu/NifU N terminal; NifU-like
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Scaffold protein Nfu/NifU"
                     /protein_id="YP_004608785.1"
                     /db_xref="GI:337264730"
                     /db_xref="GeneID:10824002"
                     /translation="MFIQTESTPNPATLKFLPGKEVLLEGTADFRDADSAAVASPLAG
                     RLFEIPGVTGVFFGYDFITVTKDGPDWQHLKPAILGAIMEHFMSGAPVMAKAGPAAET
                     SQTGEFYDKADEELVITIKELLDTRVRPAVAQDGGDITFRGFENGTVFLHMKGACAGC
                     PSSTATLKHGIQNLLRHFVPEVQQVEQVA"
     misc_feature    216059..216319
                     /locus_tag="Mesop_0196"
                     /note="Scaffold protein Nfu/NifU N terminal; Region:
                     Nfu_N; pfam08712"
                     /db_xref="CDD:254992"
     misc_feature    216371..216616
                     /locus_tag="Mesop_0196"
                     /note="Thioredoxin-like proteins and domains
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0694"
                     /db_xref="CDD:223766"
     gene            complement(216757..217374)
                     /locus_tag="Mesop_0197"
                     /db_xref="GeneID:10824003"
     CDS             complement(216757..217374)
                     /locus_tag="Mesop_0197"
                     /note="COGs: COG1376 conserved hypothetical protein;
                     InterPro IPR005490;
                     KEGG: mlo:mlr5313 hypothetical protein;
                     PFAM: ErfK/YbiS/YcfS/YnhG family protein;
                     SPTR: ErfK/YbiS/YcfS/YnhG family protein;
                     PFAM: L,D-transpeptidase catalytic domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ErfK/YbiS/YcfS/YnhG family protein"
                     /protein_id="YP_004608786.1"
                     /db_xref="GI:337264731"
                     /db_xref="GeneID:10824003"
                     /translation="MRMKSLAIVAAMALSTALAGCSTIGGQIFSNDYGAVTDAGYQLP
                     RIPIEKVPSKYHRQEVNYDTKEKPGTIIVDTQNKFLYFVEGDGLAIRYGIGVGREGFE
                     WHGTAHIAIKREWPTWTPPSQMIKRQPELAKFASGMEPGLKNPLGARAMYLFNKGGDM
                     GYRLHGSPEWNSIGKAMSSGCIRLMNQDVIDLYDRASVGAKVIVL"
     misc_feature    complement(216763..217374)
                     /locus_tag="Mesop_0197"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: ErfK; COG1376"
                     /db_xref="CDD:224294"
     misc_feature    complement(<217132..217374)
                     /locus_tag="Mesop_0197"
                     /note="SmpA / OmlA family; Region: SmpA_OmlA; cl19285"
                     /db_xref="CDD:267638"
     sig_peptide     complement(217318..217374)
                     /locus_tag="Mesop_0197"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(216763..217173)
                     /locus_tag="Mesop_0197"
                     /note="L,D-transpeptidase catalytic domain; Region: YkuD;
                     pfam03734"
                     /db_xref="CDD:252135"
     gene            217601..218017
                     /locus_tag="Mesop_0198"
                     /db_xref="GeneID:10824004"
     CDS             217601..218017
                     /locus_tag="Mesop_0198"
                     /note="COGs: COG0789 transcriptional regulator protein;
                     InterPro IPR000551:IPR015358:IPR011789;
                     KEGG: mlo:mll5312 transcriptional regulator;
                     PFAM: Transcription regulator MerR DNA binding; regulatory
                     protein MerR;
                     SMART: regulatory protein MerR;
                     SPTR: Transcriptional regulator, MerR family;
                     TIGRFAM: Cu(I)-responsive transcriptional regulator;
                     PFAM: MerR, DNA binding; MerR family regulatory protein;
                     TIGRFAM: Cu(I)-responsive transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="YP_004608787.1"
                     /db_xref="GI:337264732"
                     /db_xref="GeneID:10824004"
                     /translation="MNVGDAANRSGLPAKTIRYYEEIGLIAPARAANGYRDYSGDDIH
                     RLAFLRRARNLGFSIDDCHQLMALYQDRSRASHDVREIAAAHVKAIEEKVRELQSMRS
                     TLQTLIHACHGDNRPDCPILDDMAGAAGDGAVSARR"
     misc_feature    217601..217978
                     /locus_tag="Mesop_0198"
                     /note="Cu(I)-responsive transcriptional regulator; Region:
                     CueR; TIGR02044"
                     /db_xref="CDD:131099"
     misc_feature    217601..217978
                     /locus_tag="Mesop_0198"
                     /note="Helix-Turn-Helix DNA binding domain of CueR-like
                     transcription regulators; Region: HTH_CueR; cd01108"
                     /db_xref="CDD:133383"
     misc_feature    order(217604..217612,217652..217654,217700..217708)
                     /locus_tag="Mesop_0198"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133383"
     misc_feature    order(217742..217744,217751..217753,217763..217768,
                     217793..217795,217805..217807,217826..217831,
                     217838..217840,217847..217849,217859..217861,
                     217877..217879,217889..217891,217898..217903,
                     217922..217924,217937..217951,217955..217957,
                     217961..217963,217970..217975)
                     /locus_tag="Mesop_0198"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133383"
     misc_feature    order(217826..217828,217931..217933,217955..217957)
                     /locus_tag="Mesop_0198"
                     /note="copper binding site [ion binding]; other site"
                     /db_xref="CDD:133383"
     gene            218486..218620
                     /locus_tag="Mesop_0199"
                     /db_xref="GeneID:10824005"
     CDS             218486..218620
                     /locus_tag="Mesop_0199"
                     /note="SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608788.1"
                     /db_xref="GI:337264733"
                     /db_xref="GeneID:10824005"
                     /translation="MVLLNTLREVTAKEVEAQDMSAHVGIPQMSSREIRTSRTKRKPG
                     "
     gene            218839..219066
                     /locus_tag="Mesop_0200"
                     /db_xref="GeneID:10824006"
     CDS             218839..219066
                     /locus_tag="Mesop_0200"
                     /note="SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608789.1"
                     /db_xref="GI:337264734"
                     /db_xref="GeneID:10824006"
                     /translation="MVRSRKAGLYLVISLFFEEQLGVFAPFRNRGLVLLNVLAEGLAQ
                     SGKVKCPKMFALIVVQRHFTNPIESMVLPPN"
     gene            219168..219680
                     /locus_tag="Mesop_0201"
                     /db_xref="GeneID:10824007"
     CDS             219168..219680
                     /locus_tag="Mesop_0201"
                     /note="COGs: COG5321 conserved hypothetical protein;
                     InterPro IPR009394;
                     KEGG: mlo:mll5310 hypothetical protein;
                     PFAM: protein of unknown function DUF1052;
                     SPTR: Mll5310 protein;
                     manually curated;
                     PFAM: Protein of unknown function (DUF1052)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608790.1"
                     /db_xref="GI:337264735"
                     /db_xref="GeneID:10824007"
                     /translation="MVPAMPIISPIAINPLIDGRQSERAMLVRRGVQRLLMEMGAHVL
                     PELSLATGRRADLVALTRQGDVWIIEIKSSIEDFRVDRKWPDYRLHSDRFFFATHPGV
                     PSEIFPEECGFILSDGYGAEILRDAPEHRMAAATRKALMLRIARAGASRLLAAELAGV
                     SVPALDGESE"
     misc_feature    219180..219671
                     /locus_tag="Mesop_0201"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5321"
                     /db_xref="CDD:227631"
     gene            complement(219695..220885)
                     /locus_tag="Mesop_0202"
                     /db_xref="GeneID:10824008"
     CDS             complement(219695..220885)
                     /locus_tag="Mesop_0202"
                     /note="COGs: COG3004 Na+/H+ antiporter;
                     InterPro IPR004670;
                     KEGG: mlo:mlr5309 Na+/H+ antiporter;
                     PFAM: Na+/H+ antiporter NhaA;
                     SPTR: Na+/H+ antiporter NhaA;
                     TIGRFAM: Na+/H+ antiporter NhaA;
                     PFAM: Na+/H+ antiporter 1;
                     TIGRFAM: Na+/H+ antiporter NhaA"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter NhaA"
                     /protein_id="YP_004608791.1"
                     /db_xref="GI:337264736"
                     /db_xref="GeneID:10824008"
                     /translation="MQDLKQRPVSVFREFLDSEAAGGVILMVAAALALIVANSPLSET
                     YFSVLHAYLGPLSVSHWVNDGLMAVFFLLVGLEIKREMLDGQLSTWPRRVLPGVAAAG
                     GMVVPALVYVFVNRGNSAALAGWAIPTATDIAFALGVLSLLGSRVPASLKVFLTALAI
                     IDDLGAVIIIAIFYTSGLSLAYLGAAFAVIAALVVLNRMRVMTLVPYLVLGAILWVLV
                     LKSGVHATLAGVALALTIPLERSAGIGHDLDRSPLHRLEHGLHKIVPFIVIPIFGFAN
                     AGVSFAGLSLGALIEPLTLGVAAGLVLGKLVGVFGSSALAIGLGLADLPAHAGWRHMI
                     GISLLCGIGFTMSLFIGLLAFASDVALQDAVKVGILAGSFIAAILGAAVLLMAPAAGE
                     ESEE"
     misc_feature    complement(219710..220864)
                     /locus_tag="Mesop_0202"
                     /note="pH-dependent sodium/proton antiporter; Reviewed;
                     Region: nhaA; PRK09560"
                     /db_xref="CDD:236568"
     gene            complement(221183..221746)
                     /locus_tag="Mesop_0203"
                     /db_xref="GeneID:10824009"
     CDS             complement(221183..221746)
                     /locus_tag="Mesop_0203"
                     /note="COGs: COG4567 Response regulator consisting of a
                     CheY-like receiver domain and a Fis-type HTH domain;
                     InterPro IPR001789;
                     KEGG: mlo:mlr5308 two-component, response regulator;
                     PFAM: response regulator receiver;
                     SMART: response regulator receiver;
                     SPTR: Response regulator receiver protein;
                     PFAM: Response regulator receiver domain"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_004608792.1"
                     /db_xref="GI:337264737"
                     /db_xref="GeneID:10824009"
                     /translation="MTGDENIGAMVEGEDTSLLIVDDDKPFLTRLARAMETRGFVVET
                     AESVEEAVGKARANPPAYAVVDMRLGDGNGLDVVAAIREKREDSRTIILTGYGNIATA
                     VTAVKLGAVDYLSKPADADDIFAALTRTAGERAAPPENPMSADRVRWEHIQRVYEMCE
                     RNVSETARRLNMHRRTLQRILAKRAPR"
     misc_feature    complement(221186..221725)
                     /locus_tag="Mesop_0203"
                     /note="Response regulator consisting of a CheY-like
                     receiver domain and a Fis-type HTH domain [Signal
                     transduction mechanisms / Transcription]; Region: COG4567"
                     /db_xref="CDD:226933"
     misc_feature    complement(221360..221692)
                     /locus_tag="Mesop_0203"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(221396..221401,221408..221410,
                     221465..221467,221525..221527,221549..221551,
                     221678..221683))
                     /locus_tag="Mesop_0203"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(221549..221551)
                     /locus_tag="Mesop_0203"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(221525..221533,221537..221542))
                     /locus_tag="Mesop_0203"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(221393..221401)
                     /locus_tag="Mesop_0203"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(<221207..221287)
                     /locus_tag="Mesop_0203"
                     /note="PucR C-terminal helix-turn-helix domain; Region:
                     HTH_30; pfam13556"
                     /db_xref="CDD:257873"
     gene            complement(221810..223141)
                     /locus_tag="Mesop_0204"
                     /db_xref="GeneID:10824010"
     CDS             complement(221810..223141)
                     /locus_tag="Mesop_0204"
                     /note="COGs: COG0642 Signal transduction histidine kinase;
                     InterPro IPR003661:IPR003594:IPR004358:IPR005467;
                     KEGG: mlo:mlr5307 two-component, sensor histidine protein
                     kinase;
                     PFAM: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein;
                     SMART: ATP-binding region ATPase domain protein; histidine
                     kinase A domain protein;
                     SPTR: Sensor protein;
                     PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
                     ATPase; His Kinase A (phosphoacceptor) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="YP_004608793.1"
                     /db_xref="GI:337264738"
                     /db_xref="GeneID:10824010"
                     /translation="MAMINVLRSPDFQQSQRLRLNTLIRLRWLAIVGQSVTVLVVAYG
                     LKFPLPVSLCFALIACSAWMNLYLAFRFPAAHRLTPFAAFGILIFDSLQLAGLLYMTG
                     GLTNPFSLLMTVPVVISATSLPLRLTALLGGLVMIAATLLVFIHLPLPWHEGAPLEMP
                     FIYVAGMWMAVLSSIAFTAMYAFRVAAEARLLANALAATELVLQREQHLSALDGLAAA
                     AAHELGTPLATITLVVKEMEKALGSDPKYGEDVKLLRSQSERCREILKRLTSLSTEGE
                     AHLSRLPLTSLVEEVTAPHRDFGISIKLRPGERTGPEPVGRRNPGVIYGLGNLVENAV
                     DFARKSVTVRWSWDEAIVTFSIIDDGPGFPPEIIDRIGEPYMSTRQGNEAGGGLGLGL
                     FIAKTLLERSGATLDFRNSSGLGEGAVVQISWPRNVFLNPESAPATMFDTA"
     misc_feature    complement(221843..222868)
                     /locus_tag="Mesop_0204"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(222326..222481)
                     /locus_tag="Mesop_0204"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(222479..222481)
                     /locus_tag="Mesop_0204"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(222338..222340,222350..222352,
                     222359..222361,222371..222373,222380..222382,
                     222392..222394,222443..222445,222452..222454,
                     222464..222466,222473..222475))
                     /locus_tag="Mesop_0204"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(221873..222166)
                     /locus_tag="Mesop_0204"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(221882..221884,221888..221893,
                     221906..221908,221918..221920,221966..221977,
                     222053..222058,222062..222064,222068..222070,
                     222074..222076,222137..222139,222146..222148,
                     222158..222160))
                     /locus_tag="Mesop_0204"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(222146..222148)
                     /locus_tag="Mesop_0204"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(221969..221971,221975..221977,
                     222056..222058,222062..222064))
                     /locus_tag="Mesop_0204"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(223475..225937)
                     /locus_tag="Mesop_0205"
                     /db_xref="GeneID:10824011"
     CDS             complement(223475..225937)
                     /locus_tag="Mesop_0205"
                     /note="COGs: COG1643 HrpA-like helicase;
                     InterProIPR010225:IPR011545:IPR001650:IPR007502:IPR
                     013689:IPR014001:IPR014021;
                     KEGG: mlo:mlr5306 ATP-dependent helicase;
                     PFAM: Helicase ATP-dependent domain protein;
                     helicase-associated domain protein; helicase domain
                     protein; DEAD/DEAH box helicase domain protein;
                     SMART: DEAD-like helicase ; helicase domain protein;
                     SPTR: ATP-dependent helicase HrpB;
                     TIGRFAM: ATP-dependent helicase HrpB;
                     PFAM: Helicase conserved C-terminal domain; Helicase
                     associated domain (HA2); ATP-dependent helicase
                     C-terminal; DEAD/DEAH box helicase;
                     TIGRFAM: ATP-dependent helicase HrpB"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase HrpB"
                     /protein_id="YP_004608794.1"
                     /db_xref="GI:337264739"
                     /db_xref="GeneID:10824011"
                     /translation="MIAEPLPQLPVSAVLPALSEALGSGNSAVLVAPPGAGKTTLVPL
                     ALLDAPWLGAGKIVLLEPRRLAARAAARRMAELLDEEPGAAVGYAMRMENRTSAKTRI
                     LVVTEGVLARMILDDPELPGVSAVIFDEFHERSLDGDFGLALALDVQGALRPDLRLLV
                     MSATLDGARVAKLLSGAPVIESEGRAFPVDIRYDERPAGIPIEDAMAKAIRNALADES
                     GSVLAFLPGQREIERTAERLSGKIGADTDIVPLYGMLDGKAQDAAIKPAQPGRRKVVL
                     ATSIAETSITIDGVRVVIDSGLSRLPRYEPASGLTRLETVRVSKASADQRAGRAGRTQ
                     AGVAIRLWRAEQTAALPAFTPPEILEADLSGLLLDCAAFGVADPATLAFLDPPPAPAL
                     NEARVLLRALHAIDEAGRLTEAGASMRKLALPVRLAHMVAEAAKSGHAGEAAMLAVLL
                     TERGLGGDGADLERRLMRFRGERSPRATAARQLAERLARQVGGTKQSEAASAGPLLIH
                     AWPDRVAKARGERGRFVLANGSGAMLDAADPLAGEPFLVVADLQGKAQNARIAAAAAI
                     GEDDIRAALADRIETRRQTSFDRERSAVRVRETVRLGAITLAERMLPPPSGADADRAI
                     LDALREHGLSLLSWNKEAETLRQRLSWLHRGLGSPWPDMSDAALIERLDDWLLPFLSG
                     AASFAAIDSAAVSAGLASLVPHDLQRKIDTLAPTHFDAPSGSHLPIRYDGEWPVLAVR
                     VQELFGLDRHPSIANGTVPLTLELLSPAHRPIQTTRDLPGFWRGSWADVRADMRGRYP
                     KHVWPENPLQAAATARAKPRGT"
     misc_feature    complement(223481..225913)
                     /locus_tag="Mesop_0205"
                     /note="ATP-dependent helicase HrpB; Region: DEAH_box_HrpB;
                     TIGR01970"
                     /db_xref="CDD:233660"
     misc_feature    complement(225443..225862)
                     /locus_tag="Mesop_0205"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(225821..225835)
                     /locus_tag="Mesop_0205"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(225542..225553)
                     /locus_tag="Mesop_0205"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(224915..225370)
                     /locus_tag="Mesop_0205"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(225098..225106,225179..225184,
                     225251..225262))
                     /locus_tag="Mesop_0205"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(224942..224944,224951..224953,
                     224963..224965,225080..225082))
                     /locus_tag="Mesop_0205"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    complement(224516..224758)
                     /locus_tag="Mesop_0205"
                     /note="Helicase associated domain (HA2); Region: HA2;
                     pfam04408"
                     /db_xref="CDD:252575"
     misc_feature    complement(223520..223915)
                     /locus_tag="Mesop_0205"
                     /note="ATP-dependent helicase C-terminal; Region: HrpB_C;
                     pfam08482"
                     /db_xref="CDD:254823"
     gene            complement(225985..226875)
                     /locus_tag="Mesop_0206"
                     /db_xref="GeneID:10824012"
     CDS             complement(225985..226875)
                     /locus_tag="Mesop_0206"
                     /note="InterPro IPR000620;
                     KEGG: mlo:mlr5305 hypothetical protein;
                     PFAM: protein of unknown function DUF6 transmembrane;
                     SPTR: Putative uncharacterized protein;
                     PFAM: EamA-like transporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608795.1"
                     /db_xref="GI:337264740"
                     /db_xref="GeneID:10824012"
                     /translation="MTNGILLALIAYASYSGSDAVIKSLGGQFTVFEIGFFATLFAGC
                     FLFFTRPAGERWRDFWRMKRPWAVQARAWAGIPSGVLSVYAFTHIPLAEVYALIFLAP
                     LLVTILSTVILKEKVGPWRWLAVVAGFAGVMLVVRPGFRELNLGHLAAFVVAFLAATS
                     VILMRSLAQQEKRTSMLGVLVGYGLVFNGLGAATTSFTLPNAMQLVWLALAGAFTAGG
                     QLLQLLAAKYAPANRIAPTHYSQIVWAVILGALFFQEYPDWLSLVGLAVVGGSGLLTM
                     VREEARLGTVRWNPFSRTRL"
     misc_feature    complement(226030..226875)
                     /locus_tag="Mesop_0206"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     sig_peptide     complement(226816..226875)
                     /locus_tag="Mesop_0206"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(226465..226836)
                     /locus_tag="Mesop_0206"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            226903..227592
                     /locus_tag="Mesop_0207"
                     /db_xref="GeneID:10824013"
     CDS             226903..227592
                     /locus_tag="Mesop_0207"
                     /note="COGs: COG2120 conserved hypothetical protein LmbE
                     homologs;
                     InterPro IPR003737;
                     KEGG: mlo:mll5304 hypothetical protein;
                     PFAM: LmbE family protein;
                     SPTR: LmbE family protein;
                     PFAM: GlcNAc-PI de-N-acetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE family protein"
                     /protein_id="YP_004608796.1"
                     /db_xref="GI:337264741"
                     /db_xref="GeneID:10824013"
                     /translation="MKILALGAHPDDIEIFMFGTMAAYAAQGAELTFAVATDGARGGK
                     SDPVILARVRREEATAAAALLGATPRFLDFPDGELVADAALIGALKGLIREIGPDLVI
                     THAPNDYHADHRALSDGVRIAASFSVPVLHADTMGGTGFSPTHYIDISNHAEIKAQAI
                     RMHQSQDPDRFADAARTQNLFRSGQCNGEQASQAEAFRFEPIFPFGDIRALLPPAPPI
                     RTVMVSTKKVD"
     misc_feature    226903..227532
                     /locus_tag="Mesop_0207"
                     /note="Uncharacterized proteins, LmbE homologs [Function
                     unknown]; Region: COG2120"
                     /db_xref="CDD:225031"
     sig_peptide     226903..226977
                     /locus_tag="Mesop_0207"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            227879..229210
                     /locus_tag="Mesop_0208"
                     /db_xref="GeneID:10824014"
     CDS             227879..229210
                     /locus_tag="Mesop_0208"
                     /note="COGs: COG1653 ABC-type sugar transport system
                     periplasmic component;
                     InterPro IPR006059;
                     KEGG: mlo:mll5302 ABC transporter, periplasmic
                     substrate-binding protein;
                     PFAM: extracellular solute-binding protein family 1;
                     SPTR: Extracellular solute-binding protein family 1;
                     PFAM: Bacterial extracellular solute-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 1 extracellular solute-binding protein"
                     /protein_id="YP_004608797.1"
                     /db_xref="GI:337264742"
                     /db_xref="GeneID:10824014"
                     /translation="MKSSFKLALGLTSAISASTAVSNAAHAEDLTLCWAAWDPANALV
                     ELSKDFTKETGIGMKFEFVPWTNYADRFLNELNSHGKLCDLIIGDSQWIGGAAENGHY
                     VKLNDFFDKEKISMDDFVPATVVGYSEWPKNTPNYWALPAMGDVVGWTYRKDWFSKPE
                     LQKEFREKYGWDLGPPATFDQLKQIAEFFQKRQIDGKTVYGASIYTERGSEGITMGAM
                     DVLYSYGFQYENPKKPYEMEGFVNSDKSVKGLEFYKALYDCCTPPGASNSYMGEGVDA
                     FKSGQVAMHMNFAFTWPGLQKDENVGGDKIGYFVNPKGPDGEQFAQLGGQGISVVSYS
                     DKQESALKYIKWFANKDVQAKWWSLGGYSCLNAVVKDPKFPASQPYAQTFLDSMAIVK
                     DFWAEPSYAPLLQASQKRFHDYVVAGQGSAKDALDGLVKDWTQVFQDDGKM"
     misc_feature    227879..229192
                     /locus_tag="Mesop_0208"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     sig_peptide     227879..227959
                     /locus_tag="Mesop_0208"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    228002..228940
                     /locus_tag="Mesop_0208"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            229320..230267
                     /locus_tag="Mesop_0209"
                     /db_xref="GeneID:10824015"
     CDS             229320..230267
                     /locus_tag="Mesop_0209"
                     /note="COGs: COG1175 ABC-type sugar transport systems
                     permease components;
                     InterPro IPR000515;
                     KEGG: mlo:mll5301 ABC transporter, permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608798.1"
                     /db_xref="GI:337264743"
                     /db_xref="GeneID:10824015"
                     /translation="MLNRTAENVARATPEPLARKVRGISDKGLAWLFISPTILLLLAI
                     NIFPLFWAIYLSFTNYRANRPNEMVKNLGFANYQRILGDKDIWIAMQTTAHFVFWTIL
                     LQTLIGFTLAWLIDRKFRGHAFWTTLILVPMMLSPAVVGNFWRFLYEPQIGLFSYVIS
                     FVSGIPPTSIQMLSNVSLAPWSIIIVDTWMWTPYVMLICLAGLRSIPEYIYEAAEVDR
                     ASNWRQFWSITLPMALPFIMLAVLFRGIENFKMFDMVNLLTGGGPGSTTEVASITLKR
                     QAFESWRTGYSSAFAIILFVAVFGLANIYVKALNKVKQR"
     misc_feature    229398..230264
                     /locus_tag="Mesop_0209"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    229608..230216
                     /locus_tag="Mesop_0209"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(229635..229640,229647..229652,229665..229667,
                     229692..229703,229707..229736,229743..229748,
                     229752..229754,229881..229886,229893..229895,
                     229899..229901,229908..229913,229917..229919,
                     229929..229934,229941..229943,229992..229994,
                     230034..230039,230046..230048,230067..230078,
                     230085..230090,230133..230138,230166..230171,
                     230178..230183,230187..230192,230199..230204,
                     230211..230216)
                     /locus_tag="Mesop_0209"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(229710..229754,230067..230084)
                     /locus_tag="Mesop_0209"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(229752..229754,229866..229868,230085..230087,
                     230127..230129,230136..230138,230166..230168)
                     /locus_tag="Mesop_0209"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(229944..229982,229998..230003,230013..230015)
                     /locus_tag="Mesop_0209"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            230264..231214
                     /locus_tag="Mesop_0210"
                     /db_xref="GeneID:10824016"
     CDS             230264..231214
                     /locus_tag="Mesop_0210"
                     /note="COGs: COG0395 ABC-type sugar transport system
                     permease component;
                     InterPro IPR000515;
                     KEGG: mlo:mll5300 ABC transporter, permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608799.1"
                     /db_xref="GI:337264744"
                     /db_xref="GeneID:10824016"
                     /translation="MSLTTAHSVVAPSANSKRIAGAIIIAYALISIVPLLWIFATSFK
                     TPPDSIAYPPKVLFQPSIEGYCNLFTTRTRQTPEYINSLGPATGFCDETVRKRNMVIA
                     GPSNFLPRFANSLIIAFGSTFCAVFLGTLSAYGFSRFKVPLADDLLFFILSTRFMPPI
                     AVAIPIYLMYRELGLSDTALGMILLYTAVNVSLAVWLLKGFIDEIPREYEEAAMIDGY
                     TRLQAFWRTVLPQATTGIAATAIFCLIFAWNEYAFAALLTSGTAQTAPPFIPTIIGEG
                     GQDWPAVAAGTTIFLVPILVFTILLRKQLLRGITFGAVRK"
     misc_feature    230360..231205
                     /locus_tag="Mesop_0210"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    230594..231148
                     /locus_tag="Mesop_0210"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(230642..230647,230654..230659,230672..230674,
                     230702..230713,230717..230746,230753..230758,
                     230762..230764,230825..230830,230834..230836,
                     230840..230842,230849..230854,230858..230860,
                     230870..230875,230882..230884,230933..230935,
                     230975..230980,230987..230989,231008..231019,
                     231026..231031,231068..231073,231098..231103,
                     231110..231115,231119..231124,231131..231136,
                     231143..231148)
                     /locus_tag="Mesop_0210"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(230720..230764,231008..231025)
                     /locus_tag="Mesop_0210"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(230762..230764,230810..230812,231026..231028,
                     231062..231064,231071..231073,231098..231100)
                     /locus_tag="Mesop_0210"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(230885..230923,230939..230944,230954..230956)
                     /locus_tag="Mesop_0210"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            231429..231632
                     /locus_tag="Mesop_0211"
                     /db_xref="GeneID:10824017"
     CDS             231429..231632
                     /locus_tag="Mesop_0211"
                     /note="KEGG: mlo:msl5299 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608800.1"
                     /db_xref="GI:337264745"
                     /db_xref="GeneID:10824017"
                     /translation="MTRLAISRKSSWPRWARRGLMENIATALIAVGFLMLFQPFALSL
                     YTYSFITMLAGTVMFIIVSKFPE"
     sig_peptide     231429..231551
                     /locus_tag="Mesop_0211"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            231635..232747
                     /locus_tag="Mesop_0212"
                     /db_xref="GeneID:10824018"
     CDS             231635..232747
                     /locus_tag="Mesop_0212"
                     /note="COGs: COG3839 ABC-type sugar transport systems
                     ATPase components;
                     InterPro IPR017871:IPR003439:IPR013611:IPR003593;
                     KEGG: mlo:mll5298 ABC transporter, ATP-binding protein;
                     PFAM: ABC transporter related; Transport-associated OB
                     domain protein;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter; TOBE domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608801.1"
                     /db_xref="GI:337264746"
                     /db_xref="GeneID:10824018"
                     /translation="MAEIRVQHLRKAFGDFVAVQDSNFVVEDGEFFVMLGPSGCGKTT
                     TLRMIAGLELPTGGEILLGGDDVTMLRARERDIAFVFQLFALYPHMNVRKNIGFPLLA
                     QGMPAAEIRTRVEETARLLRIDHLLNKSVSGLAGGDRQRVALGRAIVRRPKCFLMDEP
                     LGTLDTEFRDLMVHELRELHNRIHATTVYVTHDQMEAMSMADKIAVMNHGVIEQFGTP
                     REIYDRPATMFVADFIGSPPMNFLGFGGGLTKGAKEIVVQGAKIAVPEVREDIAPAEM
                     ALGIRPEHIRFDDASKLRGAIYGTEYLGTTQIVAVETADGIIKARVPAEIRLSAGDHV
                     GLTLNSARLSLFDKGSGRAVRTAVHDTASERRVQHG"
     misc_feature    231635..232678
                     /locus_tag="Mesop_0212"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    231644..232282
                     /locus_tag="Mesop_0212"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    231740..231763
                     /locus_tag="Mesop_0212"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(231749..231754,231758..231766,231878..231880,
                     232106..232111,232208..232210)
                     /locus_tag="Mesop_0212"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    231869..231880
                     /locus_tag="Mesop_0212"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    232034..232063
                     /locus_tag="Mesop_0212"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    232094..232111
                     /locus_tag="Mesop_0212"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    232118..232129
                     /locus_tag="Mesop_0212"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    232196..232216
                     /locus_tag="Mesop_0212"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    232466..232672
                     /locus_tag="Mesop_0212"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            232740..233753
                     /locus_tag="Mesop_0213"
                     /db_xref="GeneID:10824019"
     CDS             232740..233753
                     /locus_tag="Mesop_0213"
                     /note="COGs: COG3839 ABC-type sugar transport systems
                     ATPase components;
                     InterPro IPR017871:IPR003439:IPR013611:IPR003593;
                     KEGG: mlo:mll5297 ABC transporter ATP-binding protein;
                     PFAM: ABC transporter related; Transport-associated OB
                     domain protein;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter; TOBE domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608802.1"
                     /db_xref="GI:337264747"
                     /db_xref="GeneID:10824019"
                     /translation="MADVHIKNVTKSFGDHVAVDGLDLHISDGEFVVLLGPTGAGKTT
                     TLRLIAGLERPDAGTIEIGGHDATTLSPAERDTAFVFQQYSLYPHLSVFDNLAFPLRS
                     PARKMPEDQIRRRVEEVAKMVRIHHKLTNRSTKLSGGEMQRVAIGRALVRKPAIYLMD
                     EPLSSLDAKLRADLRLELKRIQSELGATMLYVTHDQIEAMTMADRIGILADGVLVQIG
                     SPRTIYSEPANLHVAARLGQPAINLLPTGLLPDGGAPAGTRTIGARTEHLTIEKAMNG
                     HADGVVDWVEHLGDQNHLHVTVGPKKLVTLTDPDTDLAQGDRVVIRYRSPLYFGADGQ
                     RLM"
     misc_feature    232740..233705
                     /locus_tag="Mesop_0213"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    232749..233393
                     /locus_tag="Mesop_0213"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    232845..232868
                     /locus_tag="Mesop_0213"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(232854..232859,232863..232871,232983..232985,
                     233217..233222,233319..233321)
                     /locus_tag="Mesop_0213"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    232974..232985
                     /locus_tag="Mesop_0213"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    233145..233174
                     /locus_tag="Mesop_0213"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    233205..233222
                     /locus_tag="Mesop_0213"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    233229..233240
                     /locus_tag="Mesop_0213"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    233307..233327
                     /locus_tag="Mesop_0213"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    233529..233705
                     /locus_tag="Mesop_0213"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            233828..235471
                     /locus_tag="Mesop_0214"
                     /db_xref="GeneID:10824020"
     CDS             233828..235471
                     /locus_tag="Mesop_0214"
                     /EC_number="2.7.1.29"
                     /note="COGs: COG2376 Dihydroxyacetone kinase;
                     InterPro IPR004006:IPR004007;
                     KEGG: mlo:mll5296 dihydroxyacetone kinase;
                     PFAM: Dak kinase; Dak phosphatase;
                     PRIAM: Glycerone kinase;
                     SPTR: Glycerone kinase;
                     PFAM: DAK2 domain; Dak1 domain;
                     TIGRFAM: dihydroxyacetone kinase, ATP-dependent"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerone kinase"
                     /protein_id="YP_004608803.1"
                     /db_xref="GI:337264748"
                     /db_xref="GeneID:10824020"
                     /translation="MKHFFNRRETIVTEALDGLLRTIGSGDLARLDGYPEIKVVLRAD
                     WDKSKVSVVSGGGAGHEPSHAGFVGKGMLTAAVSGEIFASPSVEAVLAAIRAVTGPAG
                     CLLIVKNYTGDRLNFGLAAEKARAEGFRVEMVIVADDIALPDIAQPRGVAGTLFVHKI
                     AGHLSESGQDLATVAEAARAAAKDIVSLGMSLSSCSIPGQPHEDRFGENDGELGLGIH
                     GEPGVERIAVQSADRLVAIMAERLAVRLDPKESYALLINNLGSVPPLEMSVIANAVLA
                     SPLGKAVKLTVGPGPLMTALNMNGFSLSLIRLDAARETALLAPVGPHAWMPAKPAAAP
                     AVVPMAKAAGQSAAYKASQDAGTRRVIVTVCERLISLEATLNGLDAKAGDGDTGSTVA
                     TGARSILERLDSLPLADPAATLGAIGDVLSASMGGSSGVLLSIFFTAAAQALDGGADV
                     AKALLAGLERMTFYGGAQLGDRTMVDALEPALKALDANGLEEAAAAARRGAETTAAMA
                     KAKAGRSAYVGSQLQGVADPGAHAVAEVFAAAATLLVAA"
     misc_feature    233828..234787
                     /locus_tag="Mesop_0214"
                     /note="Dak1 domain; Region: Dak1; cl10557"
                     /db_xref="CDD:263999"
     misc_feature    233831..235414
                     /locus_tag="Mesop_0214"
                     /note="dihydroxyacetone kinase, ATP-dependent; Region:
                     dak_ATP; TIGR02361"
                     /db_xref="CDD:233835"
     misc_feature    234968..235414
                     /locus_tag="Mesop_0214"
                     /note="DAK2 domain; Region: Dak2; pfam02734"
                     /db_xref="CDD:251502"
     gene            235544..236146
                     /locus_tag="Mesop_0215"
                     /db_xref="GeneID:10824021"
     CDS             235544..236146
                     /locus_tag="Mesop_0215"
                     /note="COGs: COG2376 Dihydroxyacetone kinase;
                     InterPro IPR004007:IPR012737;
                     KEGG: mlo:mll5295 hypothetical protein;
                     PFAM: Dak phosphatase;
                     SPTR: Dihydroxyacetone kinase, L subunit;
                     TIGRFAM: dihydroxyacetone kinase, L subunit;
                     PFAM: DAK2 domain;
                     TIGRFAM: dihydroxyacetone kinase,
                     phosphoprotein-dependent, L subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase, L subunit"
                     /protein_id="YP_004608804.1"
                     /db_xref="GI:337264749"
                     /db_xref="GeneID:10824021"
                     /translation="MAALNLARLIAAAADTIAAHAEELTALDQAIGDGDHGLNMKRGF
                     EAVRAEADAFAAKPLPDALKAIGTKLVMTVGGASGPLFGTLFMALGKEISAEPDRANL
                     TAAFGRAIEAVAARGKSQVGQKTMLDVLQPVHDALAGGKTAAEITDIADAAAEATVPM
                     KAQRGRASFLGDRSIGHMDPGARSTALLVRTVGQAIGESA"
     sig_peptide     235544..235606
                     /locus_tag="Mesop_0215"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    235607..236119
                     /locus_tag="Mesop_0215"
                     /note="DAK2 domain; Region: Dak2; cl03685"
                     /db_xref="CDD:261838"
     gene            236143..236532
                     /locus_tag="Mesop_0216"
                     /db_xref="GeneID:10824022"
     CDS             236143..236532
                     /locus_tag="Mesop_0216"
                     /note="COGs: COG3412 conserved hypothetical protein;
                     InterPro IPR004701:IPR012844;
                     KEGG: mlo:mll5293 hypothetical protein;
                     PFAM: PTS system fructose subfamily IIA component;
                     SPTR: Dihydroxyacetone kinase, phosphotransfer subunit;
                     TIGRFAM: dihydroxyacetone kinase, phosphotransfer subunit;
                     PFAM: PTS system fructose IIA component;
                     TIGRFAM: dihydroxyacetone kinase, phosphotransfer subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase, phosphotransfer
                     subunit"
                     /protein_id="YP_004608805.1"
                     /db_xref="GI:337264750"
                     /db_xref="GeneID:10824022"
                     /translation="MSNVGIVIVSHSPLVAEGTADMVRQMVGDEVPLAWCGGNGHGGL
                     GTNVEAIMGAIDKAWSEAGVAILVDLGGAETNSEMAVEMIGEPRAQKIIVCNAPIVEG
                     AVMAATEASGGASLREVVATAHELSPS"
     misc_feature    236149..236526
                     /locus_tag="Mesop_0216"
                     /note="phosphotransferase mannnose-specific family
                     component IIA; Provisional; Region: PRK14484"
                     /db_xref="CDD:184702"
     misc_feature    order(236173..236175,236218..236223,236254..236256,
                     236362..236364,236455..236457)
                     /locus_tag="Mesop_0216"
                     /note="active pocket/dimerization site"
                     /db_xref="CDD:237978"
     misc_feature    order(236173..236175,236347..236349,236362..236364)
                     /locus_tag="Mesop_0216"
                     /note="active site"
                     /db_xref="CDD:237978"
     misc_feature    236173..236175
                     /locus_tag="Mesop_0216"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237978"
     gene            236555..236857
                     /locus_tag="Mesop_0217"
                     /db_xref="GeneID:10824023"
     CDS             236555..236857
                     /locus_tag="Mesop_0217"
                     /note="COGs: COG1925 Phosphotransferase system HPr-related
                     protein;
                     InterPro IPR001020:IPR005698:IPR000032;
                     KEGG: mlo:msl5292 phosphocarrier protein HP;
                     PFAM: phosphoryl transfer system HPr;
                     SPTR: Phosphotransferase system, phosphocarrier protein
                     HPr;
                     TIGRFAM: phosphocarrier, HPr family;
                     PFAM: PTS HPr component phosphorylation site;
                     TIGRFAM: Phosphotransferase System HPr (HPr) Family"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system, phosphocarrier
                     protein HPr"
                     /protein_id="YP_004608806.1"
                     /db_xref="GI:337264751"
                     /db_xref="GeneID:10824023"
                     /translation="MSAAAEATVLITHDVGLHARPSVKFTKLAKTFAADVEIALAANG
                     PWFDAKSIVKVMAAKAPKGTVLHIRARGDGANDAVDALVELVRRDFDEGAGHVRSA"
     misc_feature    236576..236812
                     /locus_tag="Mesop_0217"
                     /note="Histidine-containing phosphocarrier protein
                     (HPr)-like proteins. HPr is a central component of the
                     bacterial phosphoenolpyruvate sugar phosphotransferase
                     system (PTS). The PTS catalyses the phosphorylation of
                     sugar substrates during their translocation...; Region:
                     PTS-HPr_like; cd00367"
                     /db_xref="CDD:238217"
     misc_feature    236576..236587
                     /locus_tag="Mesop_0217"
                     /note="dimerization domain swap beta strand [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238217"
     misc_feature    order(236603..236605,236609..236614,236618..236623,
                     236633..236635,236642..236644,236702..236713,
                     236720..236725)
                     /locus_tag="Mesop_0217"
                     /note="regulatory protein interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238217"
     misc_feature    236606..236608
                     /locus_tag="Mesop_0217"
                     /note="active site"
                     /db_xref="CDD:238217"
     misc_feature    236705..236707
                     /locus_tag="Mesop_0217"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:238217"
     gene            236898..238472
                     /locus_tag="Mesop_0218"
                     /db_xref="GeneID:10824024"
     CDS             236898..238472
                     /locus_tag="Mesop_0218"
                     /note="COGs: COG1080 Phosphoenolpyruvate-protein kinase
                     (PTS system EI component);
                     InterPro IPR008731:IPR000121:IPR006318;
                     KEGG: mlo:mll5291 phosphoenolpyruvate-protein
                     phosphotransferase;
                     PFAM: PEP-utilizing protein; PEP-utilising protein domain
                     protein;
                     SPTR: Phosphoenolpyruvate-protein phosphotransferase;
                     TIGRFAM: phosphoenolpyruvate-protein phosphotransferase;
                     PFAM: PEP-utilising enzyme, TIM barrel domain;
                     PEP-utilising enzyme, mobile domain; PEP-utilising enzyme,
                     N-terminal;
                     TIGRFAM: phosphoenolpyruvate-protein phosphotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate-protein phosphotransferase"
                     /protein_id="YP_004608807.1"
                     /db_xref="GI:337264752"
                     /db_xref="GeneID:10824024"
                     /translation="MRIEGVPASAGYAEGPLFELDRPPAVYASKATPEEEKTSLREAI
                     GKAVSRLMAMVETADSDAAGVLEFHIAMLEDDALSGPAFASIDSGRTADAAWRQALDG
                     EIAGYEASDQDYFRARAGDLRDIRDQVLHALTDDGGSAAPAGAILYGEDIAPTRFLET
                     DWSSGGGIALRAGSTASHVAMLARSRGVPMVVSLREPPAGLAGMALLDAEHGNIVLAP
                     SPAEIGSFRQSSSSFAARQGKAQTFLARPALTKAGTAVRVQVNIADPSDVDAIDIATC
                     DGVGLMRTEFLFGKTLPDEETQYRVYRKVLEWAGDKPVTIRTVDAGGDKPVPGFTVEE
                     GNPFLGLRGIRLSLARLDIFRVQIRALLRAAPHGNLRVMFPMIATAEEYERAAALFTE
                     EQAALTARGTAQRMPPLGIMVEVPSVAIAPEAFANAAFFSIGSNDLTQYVMAAARDNA
                     AVAHLNSVRHPAVLRLIGSVTAFGRDNGIPVSLCGDAGGDPTLIPALLEAGLRDLSVA
                     PAQLAMAKAAIADISV"
     misc_feature    236898..238469
                     /locus_tag="Mesop_0218"
                     /note="Phosphoenolpyruvate-protein kinase (PTS system EI
                     component in bacteria) [Carbohydrate transport and
                     metabolism]; Region: PtsA; COG1080"
                     /db_xref="CDD:224006"
     misc_feature    236904..237254
                     /locus_tag="Mesop_0218"
                     /note="PEP-utilizing enzyme, N-terminal; Region:
                     PEP-utilizers_N; pfam05524"
                     /db_xref="CDD:253237"
     misc_feature    237321..>237473
                     /locus_tag="Mesop_0218"
                     /note="PEP-utilizing enzyme, mobile domain; Region:
                     PEP-utilizers; pfam00391"
                     /db_xref="CDD:249825"
     misc_feature    237636..238463
                     /locus_tag="Mesop_0218"
                     /note="PEP-utilizing enzyme, TIM barrel domain; Region:
                     PEP-utilizers_C; pfam02896"
                     /db_xref="CDD:251603"
     gene            238484..238909
                     /locus_tag="Mesop_0219"
                     /db_xref="GeneID:10824025"
     CDS             238484..238909
                     /locus_tag="Mesop_0219"
                     /note="KEGG: mlo:mll5290 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608808.1"
                     /db_xref="GI:337264753"
                     /db_xref="GeneID:10824025"
                     /translation="MVDKTPEPGSEEAIRAYKTILSHVIDQRPSGMRQRLADALGKHR
                     SFVTQISSPTYSIPIPSKHLPAIFSVCHFSPAERDQFLAAYHQAHPGKMSVAAGMRKT
                     RHVSLVVPDFGDDKQNAALDRAVNDFIQKITSITGKGGG"
     gene            238941..239927
                     /locus_tag="Mesop_0220"
                     /db_xref="GeneID:10824026"
     CDS             238941..239927
                     /locus_tag="Mesop_0220"
                     /EC_number="2.7.1.29"
                     /note="COGs: COG2376 Dihydroxyacetone kinase;
                     InterPro IPR004006:IPR012736;
                     KEGG: mlo:mll5289 hypothetical protein;
                     PFAM: Dak kinase;
                     PRIAM: Glycerone kinase;
                     SPTR: Dihydroxyacetone kinase, DhaK subunit;
                     TIGRFAM: dihydroxyacetone kinase, DhaK subunit;
                     PFAM: Dak1 domain;
                     TIGRFAM: dihydroxyacetone kinase, DhaK subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase, DhaK subunit"
                     /protein_id="YP_004608809.1"
                     /db_xref="GI:337264754"
                     /db_xref="GeneID:10824026"
                     /translation="MKKFMNSVDTVLTESLDGFVAAHADILTLGEEHKFIRRRTLRPG
                     KVALISGGGSGHEPLHGGFVGHGMLDAACPGQVFTSPTPDQMLAAAQAVDTGAGCLFI
                     VKNYEGDVMNFDMAAEMSDGILQVVTNDDVAVENSSYTTGRRGVAGTLVVEKIVGAAA
                     EHDMALPALKVLGERVNAATRSMGVALTSGTVPAAGKPTFDIGDGEMEFGVGIHGEPG
                     RRRDTLKSADAIAEEICAAILGDLGDKAKGPALLFVNGFGGTPLMELYLMYNSARRIF
                     EKHGVTITRSLVGTYVTSLDMAGCSVTLTMLDDEMTGWWDAPVHTAALRWGM"
     misc_feature    238941..239921
                     /locus_tag="Mesop_0220"
                     /note="dihydroxyacetone kinase subunit DhaK; Provisional;
                     Region: PRK14481"
                     /db_xref="CDD:237724"
     gene            239990..241012
                     /locus_tag="Mesop_0221"
                     /db_xref="GeneID:10824027"
     CDS             239990..241012
                     /locus_tag="Mesop_0221"
                     /note="KEGG: rmr:Rmar_1153 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608810.1"
                     /db_xref="GI:337264755"
                     /db_xref="GeneID:10824027"
                     /translation="MLPFLNSAEEKLLLRFADPEAAAVEDDLSAKALSALLDNAEFHG
                     VLPIMLRKLHERGNAHLTSDANVQSKLHELRQKAPIATGQSMLLNYHGGRIMKVLAAE
                     GIPARIVKGPVFAGKLYRHVTDRPFTDIDILVEPANLARANRVIASCGFELGSNEAES
                     YQLQEFKWLEKGNSSLLVELHGDLVHDTGMRRRLSLGFRELQVIDGEAIDTPAALLTI
                     AIVHAAGGHKFHRLQLCVDVLQGVRALQSPDAEARLLDAARMTGIELELAIVLNVTGE
                     LFGERRALELAGRIKPDLSIRLAKRLITTNTLLRVNSREKIGSRLRRDAFRWIQRLAK
                     ARPYPA"
     misc_feature    240089..240826
                     /locus_tag="Mesop_0221"
                     /note="Uncharacterized nucleotidyltransferase; Region:
                     NTP_transf_5; pfam14907"
                     /db_xref="CDD:259044"
     gene            complement(241022..242002)
                     /locus_tag="Mesop_0222"
                     /db_xref="GeneID:10824028"
     CDS             complement(241022..242002)
                     /locus_tag="Mesop_0222"
                     /note="KEGG: rmr:Rmar_1585 HPr kinase;
                     SPTR: HPr kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="HPr kinase"
                     /protein_id="YP_004608811.1"
                     /db_xref="GI:337264756"
                     /db_xref="GeneID:10824028"
                     /translation="MRSACYGLNGQILGISAERPDLWEDFDRMLGVLRITDPVEPGFR
                     LDITEADVLDETPGGSLVFDGEIPEDGHCRMIADGATIHLVFPGRQTVAINDEEAWAK
                     LRIRPGTKAAWTPSMLVLDAALDAGGQHMLHTAGLTLPGRDAVVLIHAPSGTGKTTTS
                     LALATQGFGLCSDDAMILDLTSGKPVAWGLPRHVKIHQITAEMIPQVAPCLGPSWDRN
                     GEQAVSLERLSEIVRIESPVARPVAALLHLARSADRQTRLVAMARTDAMVALAMDNVR
                     TGMTGLLPLQKRRLATIGKLVSSVPTFTLEVGARPADAAALINAILARQD"
     misc_feature    complement(241076..>241612)
                     /locus_tag="Mesop_0222"
                     /note="HprK-related kinase A; Region: HprK_rel_A;
                     TIGR04352"
                     /db_xref="CDD:213965"
     gene            complement(242005..242439)
                     /locus_tag="Mesop_0223"
                     /db_xref="GeneID:10824029"
     CDS             complement(242005..242439)
                     /locus_tag="Mesop_0223"
                     /note="KEGG: ttr:Tter_2831 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608812.1"
                     /db_xref="GI:337264757"
                     /db_xref="GeneID:10824029"
                     /translation="MAAGPLLRALFRCHLWASARLMPILIANRSFEQVLKWAPLASST
                     PYRGLPVAYIVARVSRTVRHPWLMRDRRCLREGLLGHRFLRLAGFDPELRFGVDPKSL
                     QAPHLSAHCWVCLDGRPVVSDRLPGMVEIYRHNADPTKVRVA"
     misc_feature    complement(242080..242382)
                     /locus_tag="Mesop_0223"
                     /note="Transglutaminase-like superfamily; Region:
                     Transglut_core3; pfam13471"
                     /db_xref="CDD:257795"
     gene            complement(242473..242757)
                     /locus_tag="Mesop_0224"
                     /db_xref="GeneID:10824030"
     CDS             complement(242473..242757)
                     /locus_tag="Mesop_0224"
                     /note="KEGG: tfu:Tfu_1144 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Coenzyme PQQ synthesis protein D (PqqD)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608813.1"
                     /db_xref="GI:337264758"
                     /db_xref="GeneID:10824030"
                     /translation="MEIASGTVLRLAEDASVQHVGDGAVVLLARSGQLYTCNGTTEAF
                     LDKVDGARSLDQIVGLLCEEFEVDKGTLDEDMAALATELVSEGILAAPAA"
     misc_feature    complement(242491..242691)
                     /locus_tag="Mesop_0224"
                     /note="Coenzyme PQQ synthesis protein D (PqqD); Region:
                     PqqD; pfam05402"
                     /db_xref="CDD:253180"
     gene            complement(243199..244029)
                     /locus_tag="Mesop_0225"
                     /db_xref="GeneID:10824031"
     CDS             complement(243199..244029)
                     /locus_tag="Mesop_0225"
                     /note="COGs: COG5497 secreted protein;
                     InterPro IPR018725;
                     KEGG: mes:Meso_1286 hypothetical protein;
                     PFAM: Protein of unknown function DUF2259, secreted;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Predicted secreted protein (DUF2259)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608814.1"
                     /db_xref="GI:337264759"
                     /db_xref="GeneID:10824031"
                     /translation="MRHRWSIAAWPLITLAIGTAIMVSAGVARAGDAAARRIIGFSAD
                     GAYFAFEQYGTLDAGASDSGYSEIDIIDTRTDQFVGGKPILVVDETEESTLTLEQARA
                     QAAAKAAPILAKYAIASRGTQTASDQFTFPGEIVGYNDISRLEQVSQKWLSPLYDETE
                     VSTIRLDEILADSAIDCSASFNDTQHGDQALQGDKTGKALGFRLALQGQDGKPFKTLH
                     EDKAVPGSRNCPTSYSLSESYEFTPVGKPAVIVVLVQRFSQGFEGRDRRFIAVTGQPR
                     "
     sig_peptide     complement(243940..244029)
                     /locus_tag="Mesop_0225"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(243211..243885)
                     /locus_tag="Mesop_0225"
                     /note="Predicted secreted protein (DUF2259); Region:
                     DUF2259; cl02309"
                     /db_xref="CDD:261239"
     gene            244185..246092
                     /locus_tag="Mesop_0226"
                     /db_xref="GeneID:10824032"
     CDS             244185..246092
                     /locus_tag="Mesop_0226"
                     /note="COGs: COG0365 Acyl-coenzyme A
                     synthetase/AMP-(fatty) acid ligase;
                     InterPro IPR018039:IPR020845:IPR000873;
                     KEGG: mlo:mll5286 acetyl-CoA synthetase;
                     PFAM: AMP-dependent synthetase and ligase;
                     SPTR: AMP-dependent synthetase and ligase;
                     PFAM: Domain of unknown function (DUF3448); AMP-binding
                     enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="YP_004608815.1"
                     /db_xref="GI:337264760"
                     /db_xref="GeneID:10824032"
                     /translation="MASRYHEVYDGWRRDPEKFWADAASAIDWYSPWDKVFDATAGVY
                     GRWFTGATCNTCYNAIDRHVAGGRADQIALIHDSAITGTVKKFTYAELKREVVALTSV
                     LKNRGVGKGDRVIIYMPMVAEAAIAMLACARIGAVHSVVFGGFASHELATRIDDARPK
                     LIISASCGLEPGRIVAYKPLLDKAIEMSRHKPEACLILKRDQLRCELRDHFDIDYADA
                     VARERAAGANVDCVPVLATDPLYIIYTSGTTGQPKGIVRDNGGHMVALKWTMENEFGV
                     KPGEVFWAASDVGWVVGHSYIVYGPLLHGCTSILFEGKPIGTPDAGTYWRVIAEHGVV
                     ALFTAPTAFRAIKGQDPKGEFVAKYDLSKFRTLFLAGERADPETIKWAEQKLNVPVVD
                     HWWQTETGSPMTINPAGLGLLPVKYGSPGVPMPGYDIRVLDDAGHEVARGTLGNVVVK
                     LPLPAGCLPTLWHADQRFRQAYLDEFPGFYKTADAGMIDEDGYLYVMARTDDIINVAG
                     HRLSTGAMEEVLAAHPDVAECAVVGIADAMKGQIPLGFVVLNAGVARDGGTIEKEVVA
                     LVRERIGPVAAFKTVVTIKRLPKTRSGKILRGTMQKIADKEEWTMPATIDDPVILDEI
                     AAAMKERGIGV"
     misc_feature    244188..246074
                     /locus_tag="Mesop_0226"
                     /note="propionyl-CoA synthetase; Provisional; Region:
                     prpE; PRK10524"
                     /db_xref="CDD:182517"
     misc_feature    244224..246056
                     /locus_tag="Mesop_0226"
                     /note="Propionyl-CoA synthetase (PrpE); Region: PrpE;
                     cd05967"
                     /db_xref="CDD:213314"
     misc_feature    order(244908..244910,244917..244934,244938..244943)
                     /locus_tag="Mesop_0226"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213314"
     misc_feature    order(244917..244919,245292..245297,245358..245375,
                     245634..245636,245670..245672,245679..245681,
                     245712..245714,245964..245966)
                     /locus_tag="Mesop_0226"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213314"
     misc_feature    order(244917..244919,245040..245045,245199..245201,
                     245205..245210,245217..245219,245292..245297,
                     245358..245375,245634..245636,245670..245672,
                     245679..245681,245703..245714,245907..245909)
                     /locus_tag="Mesop_0226"
                     /note="putative active site [active]"
                     /db_xref="CDD:213314"
     misc_feature    order(245040..245042,245205..245210,245217..245219,
                     245292..245294,245703..245711,245889..245891,
                     245907..245909)
                     /locus_tag="Mesop_0226"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213314"
     gene            246219..247301
                     /locus_tag="Mesop_0227"
                     /db_xref="GeneID:10824033"
     CDS             246219..247301
                     /locus_tag="Mesop_0227"
                     /note="COGs: COG1835 acyltransferase;
                     InterPro IPR002656;
                     KEGG: mlo:mll5285 hypothetical protein;
                     PFAM: acyltransferase 3;
                     SPTR: Acyltransferase 3;
                     PFAM: Acyltransferase family"
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase 3"
                     /protein_id="YP_004608816.1"
                     /db_xref="GI:337264761"
                     /db_xref="GeneID:10824033"
                     /translation="MAQQKITFGGVDILRFLAAVLVMVYHYGFWVWAYPDGISAQATG
                     GVPQQPAIGAWVESGWVGVEIFFVISGFVIAFSAENSTPLRFFEARVKRLAPAVWICA
                     PVAAVLLLAIGLSWPTDAVVRLVRTGLFAPYGPWVDSVYWTLGIEIAFYAIVWVLLRL
                     GRFHLMEAVAIAIGLVSTLFWCLYYPLGWSDFAETRWLQLVLVHHGCFFAVGVLLWLM
                     RFKALTPSRLGFCLLFLGGGVLQIASSVDVHSIKVGAVMPYAPPILIFLVAIALMALS
                     LRLQLSWTGWRRIGLMTYPLYLIHDVIGAAMLGSMVRAGLPYLLSMVTVAATMIAASW
                     LVATEAEPRVRQLLDYTVFRYRLKAA"
     misc_feature    246219..247286
                     /locus_tag="Mesop_0227"
                     /note="Predicted acyltransferases [Lipid metabolism];
                     Region: COG1835"
                     /db_xref="CDD:224748"
     gene            247544..247702
                     /locus_tag="Mesop_0228"
                     /db_xref="GeneID:10824034"
     CDS             247544..247702
                     /locus_tag="Mesop_0228"
                     /note="SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608817.1"
                     /db_xref="GI:337264762"
                     /db_xref="GeneID:10824034"
                     /translation="MTENKRAALQKAFEKGQQSAREGRYDNRYPSISPYHDRYDQGFE
                     VEMETIFD"
     gene            complement(247841..250231)
                     /locus_tag="Mesop_0229"
                     /db_xref="GeneID:10824035"
     CDS             complement(247841..250231)
                     /locus_tag="Mesop_0229"
                     /note="COGs: COG3206 Uncharacterized protein involved in
                     exopolysaccharide biosynthesis;
                     InterPro IPR003856:IPR005700:IPR005702;
                     KEGG: mlo:mlr5276 exopolysaccharide transporter;
                     PFAM: lipopolysaccharide biosynthesis protein;
                     SPTR: Exopolysaccharide transport protein family;
                     TIGRFAM: exopolysaccharide transport protein family;
                     capsular exopolysaccharide family;
                     PFAM: Chain length determinant protein;
                     CobQ/CobB/MinD/ParA nucleotide binding domain;
                     TIGRFAM: capsular exopolysaccharide family;
                     exopolysaccharide transport protein family"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide transport protein family"
                     /protein_id="YP_004608818.1"
                     /db_xref="GI:337264763"
                     /db_xref="GeneID:10824035"
                     /translation="MNYANFPLDKRMPLPNSDAGDGEDFIDIERLLGMAARQAKVVAV
                     CAVIGLFLGLLYIQTTPPKYVSVASVLIDEGLNKIVDDISAASTTMQTDSAILSQIEI
                     LTSTRLAAVVVDKLKLDQNDAFMNPPQSALAQGVGLIRGLIQYVRPSPVMPGVGDVSQ
                     LSPAARDALIATSRRDYAILKLQNEIQADRVGRSYVIALGYQATDPGLATAITKAYAD
                     AYLADQLDASFDATERAAVWLQGRLTELRESSQQASLAVEKFRAEHGLSANSDGQLMS
                     DKQLADLNAQLIVAQADTARASARYQQYKSIVDSGSENAFKDAAISSDQPSGALISAL
                     KTRYLAVSKRQQDVEANFGAQHPQAVALAKEKADISAQIFGELKQLTQNYRNEYEVAQ
                     ARETALRANVAAAQGKSSIDNQSQVKLRDLDQKATALSTLYQTFLGRYEEAAQQQSFP
                     VGKIRIISDASTPLSASSPRTIIVLGLSLVLGMLMGAGFGGLNEFNERFFRTGEEVRD
                     RVGLKFLGYLPTIGSKAVTKEDKAVDGQLDAKVARSPAAIERRARMRVSIDAPASMFS
                     ETLRSAKIAFDVVMEGQGSRVIGVISVLPGEGKSTVAANLAGLLAANGAKTLLIDGDL
                     RNPGLSRSLGMEAEQGLMEAVVNGQTWQSVGKIDRQTKLAIIPAVSRGHFSHTSELLS
                     SAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSM
                     LESEPYVANKIVGAVLNKVDLKRLAKYGSFGASEKFFDKYSNYYLDKSEVRTKATV"
     misc_feature    complement(247880..250165)
                     /locus_tag="Mesop_0229"
                     /note="exopolysaccharide transport protein family; Region:
                     eps_transp_fam; TIGR01005"
                     /db_xref="CDD:130078"
     misc_feature    complement(<249863..250162)
                     /locus_tag="Mesop_0229"
                     /note="Chain length determinant protein; Region: Wzz;
                     pfam02706"
                     /db_xref="CDD:251487"
     misc_feature    complement(248765..>248938)
                     /locus_tag="Mesop_0229"
                     /note="G-rich domain on putative tyrosine kinase; Region:
                     GNVR; pfam13807"
                     /db_xref="CDD:258087"
     misc_feature    complement(248048..248476)
                     /locus_tag="Mesop_0229"
                     /note="AAA domain; Region: AAA_31; pfam13614"
                     /db_xref="CDD:257927"
     gene            complement(250464..251360)
                     /locus_tag="Mesop_0230"
                     /db_xref="GeneID:10824036"
     CDS             complement(250464..251360)
                     /locus_tag="Mesop_0230"
                     /EC_number="2.7.7.9"
                     /note="COGs: COG1210 UDP-glucose pyrophosphorylase;
                     InterPro IPR005835;
                     KEGG: mlo:mlr5275 UTP-glucose-1-phosphate
                     uridylyltransferase ExoN;
                     PFAM: Nucleotidyl transferase;
                     SPTR: Nucleotidyl transferase;
                     PFAM: Nucleotidyl transferase;
                     TIGRFAM: UTP-glucose-1-phosphate uridylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleotidyl transferase"
                     /protein_id="YP_004608819.1"
                     /db_xref="GI:337264764"
                     /db_xref="GeneID:10824036"
                     /translation="MKKIRKAVIPVAGLGTRFLPATKSMPKEMLPVVDRPVVQYAVDE
                     AFEAGIEHIVFVTGRNKAVIEDYFDLHPELIGTLEQTGKKTQLEALESMLPVAGATSF
                     IRQQSPQGLGHAVWCAREVIGNEPFALLLPDMVSFGRRGCLAETVDLYERTGGNVIAV
                     ERCDPSETNKYGIVGRGADIGGGFEVSAMVEKPAPANAPSNFYINGRYILQPEIFALL
                     GNQQRGAGNEIQLTDAMVRLSKDQPFFAQPFLGRMFDCGSKEGFIQANIAFALARDDM
                     KGPVFEMLQEFVQSHERQEEAA"
     misc_feature    complement(250548..251348)
                     /locus_tag="Mesop_0230"
                     /note="Prokaryotic UGPase catalyses the synthesis of
                     UDP-glucose; Region: UGPase_prokaryotic; cd02541"
                     /db_xref="CDD:133021"
     misc_feature    complement(<250659..251348)
                     /locus_tag="Mesop_0230"
                     /note="dTDP-glucose pyrophosphorylase [Cell envelope
                     biogenesis, outer membrane]; Region: RfbA; COG1209"
                     /db_xref="CDD:224130"
     misc_feature    complement(order(250665..250667,250749..250751,
                     250785..250790,250845..250850,250959..250964,
                     250968..250970,251028..251039,251046..251048,
                     251277..251282,251322..251333))
                     /locus_tag="Mesop_0230"
                     /note="active site"
                     /db_xref="CDD:133021"
     misc_feature    complement(order(250548..250550,250557..250565,
                     250569..250577,250581..250589,250605..250607,
                     250677..250679,250851..250853,251037..251039,
                     251043..251045,251049..251054,251139..251144,
                     251154..251156,251160..251168,251172..251174,
                     251244..251246,251256..251264,251268..251276,
                     251286..251294,251298..251312,251319..251321))
                     /locus_tag="Mesop_0230"
                     /note="tetramer interface; other site"
                     /db_xref="CDD:133021"
     gene            complement(251435..252421)
                     /locus_tag="Mesop_0231"
                     /db_xref="GeneID:10824037"
     CDS             complement(251435..252421)
                     /locus_tag="Mesop_0231"
                     /note="COGs: COG0463 Glycosyltransferase involved in cell
                     wall biogenesis;
                     InterPro IPR001173;
                     KEGG: mlo:mlr5274 glycosyltransferase, succinoglycan
                     biosynthesis protein ExoO;
                     PFAM: glycosyl transferase family 2;
                     SPTR: Glycosyl transferase family 2;
                     PFAM: Glycosyl transferase family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="family 2 glycosyl transferase"
                     /protein_id="YP_004608820.1"
                     /db_xref="GI:337264765"
                     /db_xref="GeneID:10824037"
                     /translation="MQPDVSPIPNVSFVPDVSFIIAAYNAEATLDRAIASALAQRDVS
                     VEIIVVDDKSRDATLDVARAYPQDIVRVVALAQNRGPGGARNAGLDVARGRWVAVLDS
                     DDAVFPGRMAAMIGRAEKANAQIAVDNLQVVREDGVVEDAMFPRQYLERLGEISLATY
                     IAGNVVFESKFNLGYLKPIFQRRFLDENRLRYDEKLRIGEDYILFADALAKGGRCVVE
                     PDIGYAYHILSGSISRVLELHHVEAMREADAKFAQTHRMDEAALAAFARRGRSLRKAA
                     SFLAMVQHIKARSPFKAIRMALSDPAAVRHMGMPIAVRLRRVAAQFAVGVGR"
     misc_feature    complement(251702..252379)
                     /locus_tag="Mesop_0231"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    complement(<252041..252364)
                     /locus_tag="Mesop_0231"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cd00761"
                     /db_xref="CDD:132997"
     misc_feature    complement(order(252113..252115,252119..252121,
                     252272..252274,252350..252352,252356..252358))
                     /locus_tag="Mesop_0231"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(252411..253361)
                     /locus_tag="Mesop_0232"
                     /db_xref="GeneID:10824038"
     CDS             complement(252411..253361)
                     /locus_tag="Mesop_0232"
                     /note="COGs: COG1215 Glycosyltransferase probably involved
                     in cell wall biogenesis;
                     InterPro IPR001173;
                     KEGG: mlo:mlr5273 glycosyltransferase, succinoglycan
                     biosynthesis protein ExoM;
                     PFAM: glycosyl transferase family 2;
                     SPTR: Glycosyl transferase family 2;
                     PFAM: Glycosyl transferase family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="family 2 glycosyl transferase"
                     /protein_id="YP_004608821.1"
                     /db_xref="GI:337264766"
                     /db_xref="GeneID:10824038"
                     /translation="MAVQAKNRSIDIGVCTFRRPELADTLRSLAAMDMPRGFDVGIIV
                     ADNDDTPSARELVTALSRELSVPVRYRHCPARNISIARNACLDASEADFLAFIDDDET
                     ATARWLAELVATAETSGAAAILGPVRALYRPDAPDWMRRGDFHSTLPVWVQGEIRTGY
                     TCNVLLRVGADSLRGRRFSLARGQTGGEDTEYFDQMHKAGGRIAFSPDAWVNEVVPRT
                     RAAFDWLGRRRFRVGQTHGHLLGHNAGGIGLVKQVGLASVKALYCFAAALPVVASPVR
                     RNRSVLRGIMHVGVVSGLVGIREIRLYGQPSPREGGKRAA"
     misc_feature    complement(252669..253337)
                     /locus_tag="Mesop_0232"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:257951"
     misc_feature    complement(<252957..253328)
                     /locus_tag="Mesop_0232"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cd00761"
                     /db_xref="CDD:132997"
     misc_feature    complement(order(253062..253064,253068..253070,
                     253227..253229,253311..253313,253317..253319))
                     /locus_tag="Mesop_0232"
                     /note="active site"
                     /db_xref="CDD:132997"
     misc_feature    complement(252558..253085)
                     /locus_tag="Mesop_0232"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     gene            complement(253361..254350)
                     /locus_tag="Mesop_0233"
                     /db_xref="GeneID:10824039"
     CDS             complement(253361..254350)
                     /locus_tag="Mesop_0233"
                     /note="COGs: COG1215 Glycosyltransferase probably involved
                     in cell wall biogenesis;
                     InterPro IPR001173;
                     KEGG: mlo:mlr5272 glycosyltransferase, succinoglycan
                     biosynthesis protein ExoA;
                     PFAM: glycosyl transferase family 2;
                     SPTR: Glycosyl transferase family 2;
                     PFAM: Glycosyl transferase family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="family 2 glycosyl transferase"
                     /protein_id="YP_004608822.1"
                     /db_xref="GI:337264767"
                     /db_xref="GeneID:10824039"
                     /translation="MTQALPSSLIVIPCLNEAAHIGALLDQLRPSAERLGARIVVADG
                     GSTDGTLAIVEDVAARDARVILLHNQRRIQSAAINLAVGTYGEGAQYLIRIDAHGGYP
                     DDYCDRLVEEALATGADSVVVSMLTSGSGPVQKAAAAAQNSKLGTGGSKHRHLSAGEW
                     IDHGHHALMRISAFGAVGGYDETFSHNEDAELDYRLRQAGYRIWMSGKTQMVYYPRTS
                     LKGLYFQYLGYGRGRAKNVLKHRVIPKVRQMVPLAVFPVVLLAAFSFVHWIAAVPLLV
                     WASVCLGYGLVAAIRQRKADVALAGVSAMVMHLGWSVGFWLQLLGLGSRRGVA"
     misc_feature    complement(253586..254326)
                     /locus_tag="Mesop_0233"
                     /note="ExoA is involved in the biosynthesis of
                     succinoglycan; Region: Succinoglycan_BP_ExoA; cd02525"
                     /db_xref="CDD:133016"
     misc_feature    complement(253451..254323)
                     /locus_tag="Mesop_0233"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    complement(order(254057..254059,254306..254308,
                     254312..254314))
                     /locus_tag="Mesop_0233"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133016"
     gene            complement(254366..255538)
                     /locus_tag="Mesop_0234"
                     /db_xref="GeneID:10824040"
     CDS             complement(254366..255538)
                     /locus_tag="Mesop_0234"
                     /note="KEGG: mlo:mlr5271 glycosyltransferase,
                     succinoglycan biosynthesis protein ExoL;
                     SPTR: Glycosyltransferase, succinoglycan biosynthesis
                     protein ExoL"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase, succinoglycan biosynthesis
                     protein ExoL"
                     /protein_id="YP_004608823.1"
                     /db_xref="GI:337264768"
                     /db_xref="GeneID:10824040"
                     /translation="MLHVLYLVHDVSDPAVRRRITMLRTGGARVTLAGFRRTTTPIAD
                     IEGLRPIDLGATRDGRFAQRLAAVAKAAVSLRAKLSGTPRPDLIIARNLEMLALAGRA
                     RSAFGATVPIVYECLDIHRLVLRNDVLGKALRATERHLARDVKLLVTSSPAFIANYFK
                     PFRQVAAPIELVENKYFETAAILPGARQVAETPAAPPWRIGWFGALRCRRSLELLADF
                     TRRMDGRFEVVLRGRPALSEFPDFHAFVEAEPHLSFRGPYRNPEDMASIYQDVHFSWA
                     IDFFEEGQNSEWLLPNRLYEGCRFGAVPISMGHTETGRFLSQQDIGILLPQATPDALE
                     SALGQMEEHRFDRLKARVLAQNPRMWSYDRSDCRVLVEKLRRLTIVREPLAAEALA"
     misc_feature    complement(254471..255388)
                     /locus_tag="Mesop_0234"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            255723..257219
                     /locus_tag="Mesop_0235"
                     /db_xref="GeneID:10824041"
     CDS             255723..257219
                     /locus_tag="Mesop_0235"
                     /note="COGs: COG2244 Membrane protein involved in the
                     export of O-antigen and teichoic acid;
                     InterPro IPR002797;
                     KEGG: mlo:mll5270 succinoglycan transport protein;
                     PFAM: polysaccharide biosynthesis protein;
                     SPTR: Polysaccharide biosynthesis protein;
                     PFAM: Polysaccharide biosynthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="YP_004608824.1"
                     /db_xref="GI:337264769"
                     /db_xref="GeneID:10824041"
                     /translation="MEANPFDPPEGSLRKSVGRGAVVTAMSQSVRVATQIISVIVLSR
                     LLSPQDFGVVAMCAPVLAFIALFQDFGLTQATIQKSCIRHEEVNYLFWINVAVSAILA
                     CVLAGAAPLVAAFYSEPRVAGLVAAFGLQIMAYGLGAQHLALLTRRMQFGRLAIIDVA
                     SAVAGLAVSIAWTFIDRSYWALFAGTLTGAVLPTLCYWASSRWRPGLPRKVAGIGELI
                     NFGAGITGFNFANFFARNLDNVLIGKYWGEAQLGLYDRAYKLLLFPLSQITNPLSKVM
                     VPALSRLKDEPDRYRSAYLRVMPLILLVALPGVAFATAMSDELIPFVLGEQWRASASI
                     FLALGFAGLLQPLNNPAGWLFVSQGRSGDFMRWGIITAVTSVLAFALGLPYGALGVAV
                     AYAVSEYLRTPFLWLYVGRSGPLRASHVLRAATPFVLGAHLALAAVWLAKPLLPQQHV
                     VALAGGAILAYAITIVVALAFAAGREALREAVKMLPARPPTAAPRQAQ"
     misc_feature    255756..257189
                     /locus_tag="Mesop_0235"
                     /note="colanic acid exporter; Provisional; Region:
                     PRK10459"
                     /db_xref="CDD:236697"
     misc_feature    255771..256988
                     /locus_tag="Mesop_0235"
                     /note="Uncharacterized subfamily of the multidrug and
                     toxic compound extrusion (MATE) proteins; Region:
                     MATE_tuaB_like; cd13127"
                     /db_xref="CDD:240532"
     gene            257274..258296
                     /locus_tag="Mesop_0236"
                     /db_xref="GeneID:10824042"
     CDS             257274..258296
                     /locus_tag="Mesop_0236"
                     /note="COGs: COG5663 conserved hypothetical protein;
                     InterPro IPR000836;
                     KEGG: mlo:mll5269 hypothetical protein;
                     PFAM: phosphoribosyltransferase;
                     SPTR: Phosphoribosyltransferase;
                     PFAM: Phosphoribosyl transferase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="YP_004608825.1"
                     /db_xref="GI:337264770"
                     /db_xref="GeneID:10824042"
                     /translation="MHYRSISDMNDAIVSNLHRLPRDIDLVVGVPRSGVLAATLVSLA
                     ANIPMTDLDSFLDGRVYTSGITKRRAALDRKVSDMRKVLVIDDSVSGGNAMRDARARI
                     QAAGIEADYTFAAVFGLQPQHQETDIVFEVVPHPRMFQWNFMHHKFLAQCCVDIDGVL
                     CLDPTEAENDDGPAYEKFLSEARPLHAPTHRIGWLVTSRLEKYRALTEAWLAKNGIQY
                     DQLVMLDLPSKAERQRLGAHGSFKADFYRKSDAMLFIESEHAQALKITELSGKPVLCV
                     ETHIVSFPDALSLPALGQAARNLPARLRQVNSQEGRKGVAKTLARALLGARGYETLKS
                     RVKRPA"
     misc_feature    257304..257621
                     /locus_tag="Mesop_0236"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(257364..257366,257370..257372,257529..257537,
                     257541..257555)
                     /locus_tag="Mesop_0236"
                     /note="active site"
                     /db_xref="CDD:206754"
     misc_feature    257703..258293
                     /locus_tag="Mesop_0236"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5663"
                     /db_xref="CDD:227950"
     gene            complement(258332..259411)
                     /locus_tag="Mesop_0237"
                     /db_xref="GeneID:10824043"
     CDS             complement(258332..259411)
                     /locus_tag="Mesop_0237"
                     /note="COGs: COG0438 Glycosyltransferase;
                     InterPro IPR001296;
                     KEGG: mlo:mlr5268 hypothetical protein;
                     PFAM: glycosyl transferase group 1;
                     SPTR: Glycosyl transferase group 1;
                     PFAM: Glycosyl transferases group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_004608826.1"
                     /db_xref="GI:337264771"
                     /db_xref="GeneID:10824043"
                     /translation="MKVLFAGGNGYTPEFSGGVQSSTHHLAEQLIENGHEASVLAALF
                     GDGVFGFKARAKMKLLRQPAVVDSFPGYPVVRAWFPWEAASFAVDRVKPDVAVVQCHK
                     SVPIGKALQAKGVPLVVYLRNVEFHELGGDLRELRSALYIANSEFTARTYRREFGIET
                     TVIPPTINPTQYSTPTTGQFVTLINPYEEKGFELAVRLAGACPEIPFLFVESWKLDDD
                     HRASIEETIAPLGNVTLESRTSDMKTVYGRTRILLAPSKWEEAWGRVASEAHCSGIPV
                     VGSRRGGLPEAIGPGGVVLDYDSPLVDWVAAVRRLWNDNQEYDRVSSLARSFAARPEL
                     DPDRQFVTFFSILDKAIQQRALQAA"
     misc_feature    complement(258350..259411)
                     /locus_tag="Mesop_0237"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(258452..259408)
                     /locus_tag="Mesop_0237"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            complement(259478..259927)
                     /locus_tag="Mesop_0238"
                     /db_xref="GeneID:10824044"
     CDS             complement(259478..259927)
                     /locus_tag="Mesop_0238"
                     /note="KEGG: mlo:mlr5267 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608827.1"
                     /db_xref="GI:337264772"
                     /db_xref="GeneID:10824044"
                     /translation="MIEVSRRSALAIVAGGVVSTGVAYAAVSSFSDEDLVRVTLEKYL
                     GRLNMRIEHLQQFALEFRNRNPWIFPSAKLSDAVTLVEELKLGAVRRLLPQEKREDLT
                     HFDRWVIAEFHMLTDYAWRSSPDDPIRFTGWQSCTNPFANLEPPKLA"
     sig_peptide     complement(259853..259927)
                     /locus_tag="Mesop_0238"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            complement(259941..261383)
                     /locus_tag="Mesop_0239"
                     /db_xref="GeneID:10824045"
     CDS             complement(259941..261383)
                     /locus_tag="Mesop_0239"
                     /note="COGs: COG2303 Choline dehydrogenase and related
                     flavoprotein;
                     KEGG: mlo:mlr5266 2-keto-gluconate dehydrogenase subunit;
                     SPTR: 2-keto-gluconate dehydrogenase subunit;
                     PFAM: GMC oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-gluconate dehydrogenase subunit"
                     /protein_id="YP_004608828.1"
                     /db_xref="GI:337264773"
                     /db_xref="GeneID:10824045"
                     /translation="MVLDVKPEQITRDHFDLVAIGSGFGSAFFLHEFAKRRKARILVL
                     EWGRHNTHEWQLNQNANTDIEDETTYKTNSDKPWNYTIGLGGGTNCWFAQTPRFHPND
                     FRLKSTYGIGNDWPISYDDVEPFYCDAEDIMSISGDPDMATMLPRSKPFPQPPHRMST
                     PDKMMKAAQPGQHFVMPTARARVPTSQRTSCCANLRCWLCPVDAKFTANNGLMHVFEH
                     PDISVCLGSEVRRLDHVGGTVRSVTFVHDGKEYQVSGDLFILGANAIQSAAIMLRSGL
                     GDEFVGRGLHESYGWNFEVYLDGVDNFDGSTITTGLNFGLYDGPHRSEHAAALVYFEN
                     RWQHGMRAEKGRLRQALPLVVVTENLLDHENFVTLDEDDNAFVSFKAPSDYAVKGMAR
                     ALEKLPGLLAPLPVEGLFDRGIRPTESHVQGTLRMGTGPADSVVDSGMIHHRLRNLVV
                     VGTSTYPSCSCANPSLTAAALSLRAAGRIA"
     misc_feature    complement(259944..261344)
                     /locus_tag="Mesop_0239"
                     /note="Choline dehydrogenase and related flavoproteins
                     [Amino acid transport and metabolism]; Region: BetA;
                     COG2303"
                     /db_xref="CDD:225186"
     misc_feature    complement(260526..261137)
                     /locus_tag="Mesop_0239"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(259971..260294)
                     /locus_tag="Mesop_0239"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            complement(261460..262791)
                     /locus_tag="Mesop_0240"
                     /db_xref="GeneID:10824046"
     CDS             complement(261460..262791)
                     /locus_tag="Mesop_0240"
                     /EC_number="1.1.1.22"
                     /note="COGs: COG1004 UDP-glucose 6-dehydrogenase;
                     InterPro IPR001732:IPR014026:IPR014027:IPR017476;
                     KEGG: mlo:mlr5265 UDP-glucose dehydrogenase;
                     PFAM: UDP-glucose/GDP-mannose dehydrogenase;
                     UDP-glucose/GDP-mannose dehydrogenase dimerisation;
                     UDP-glucose/GDP-mannose dehydrogenase;
                     PRIAM: UDP-glucose 6-dehydrogenase;
                     SPTR: Nucleotide sugar dehydrogenase;
                     TIGRFAM: nucleotide sugar dehydrogenase;
                     PFAM: UDP-glucose/GDP-mannose dehydrogenase family, NAD
                     binding domain; UDP-glucose/GDP-mannose dehydrogenase
                     family, central domain; UDP-glucose/GDP-mannose
                     dehydrogenase family, UDP binding domain;
                     TIGRFAM: nucleotide sugar dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide sugar dehydrogenase"
                     /protein_id="YP_004608829.1"
                     /db_xref="GI:337264774"
                     /db_xref="GeneID:10824046"
                     /translation="MNLTVFGIGYVGLVQAAVLAEVGHQVVCVDVDANKVERLNQGLV
                     PIFEPGLESIVKENHAAGRIKFTTDAAAAVRHGEIQMIAVGTPPGEDGSADLKYVLAV
                     AETIGREMETPKIVVGKSTVPVGTCEKVKARIAETLKKRGREDLAFDVASNPEFLKEG
                     SAVADCMKPDRIIVGTNSEATEAVMRELYAPFNRNHEKMIVMDVRSAEFTKYAANCML
                     ATKISFMNEMANLAEQLGADIEEVRKGIGSDPRIGYHFIYPGLGYGGSCFPKDVRALI
                     KTAEGVKFDAKLLRAVEERNNEQKSVLFDKVNRYFKGNLKGKTFALWGLAFKPNTDDM
                     REAPARTLMEALWQAGARVQAYDPEAMQECQAIYGLRDDLLLCGTKEAALRGADALLI
                     ATEWKSFRAPSFDAVKDALTTPVIFDGRNLYDPKVIARHGIEYHSIGRMAA"
     misc_feature    complement(261514..262791)
                     /locus_tag="Mesop_0240"
                     /note="Predicted UDP-glucose 6-dehydrogenase [Cell
                     envelope biogenesis, outer membrane]; Region: Ugd;
                     COG1004"
                     /db_xref="CDD:223936"
     misc_feature    complement(262228..262791)
                     /locus_tag="Mesop_0240"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family, NAD
                     binding domain; Region: UDPG_MGDP_dh_N; pfam03721"
                     /db_xref="CDD:252123"
     misc_feature    complement(261895..262182)
                     /locus_tag="Mesop_0240"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family,
                     central domain; Region: UDPG_MGDP_dh; pfam00984"
                     /db_xref="CDD:250272"
     misc_feature    complement(261520..261831)
                     /locus_tag="Mesop_0240"
                     /note="UDP binding domain; Region: UDPG_MGDP_dh_C;
                     smart00984"
                     /db_xref="CDD:214954"
     gene            complement(262841..263713)
                     /locus_tag="Mesop_0241"
                     /db_xref="GeneID:10824047"
     CDS             complement(262841..263713)
                     /locus_tag="Mesop_0241"
                     /EC_number="3.2.1.73"
                     /note="COGs: COG2273 Beta-glucanase/Beta-glucan
                     synthetase;
                     InterPro IPR000757:IPR008264;
                     KEGG: mlo:mlr5264 endo-1,3-1,4-beta-glycanase ExoK;
                     PFAM: glycoside hydrolase family 16;
                     PRIAM: Licheninase;
                     SPTR: Licheninase;
                     PFAM: Glycosyl hydrolases family 16"
                     /codon_start=1
                     /transl_table=11
                     /product="Licheninase"
                     /protein_id="YP_004608830.1"
                     /db_xref="GI:337264775"
                     /db_xref="GeneID:10824047"
                     /translation="MNSDPKTTSKAAVGAHQAGQAGWRRLAWLGASLLLVALGSLSTI
                     PSHAQDIQSSPSFVDDFKSLDRSRWYVSDGWTNGSHQNCTWSKGQVSLSEGTLSLGFE
                     KQKTKDREFACGEIQTKQRFGYGTYEARMKTDAGPGLNAAFFSYIGPSDKQPWDEIDF
                     EILTKDTSKVQVNAYIAGKGKNEKLVEVPGGTDKAFNDYAFVWEKDSLRWYVNGQLVN
                     TITDPAKLPSHAQKIFFSLWGSDTMKGWMGAFADPGRKLSLQIERVAFTALGEPCQFP
                     ESLVCSVKELGKTN"
     sig_peptide     complement(263570..263713)
                     /locus_tag="Mesop_0241"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(262844..263644)
                     /locus_tag="Mesop_0241"
                     /note="Beta-glucanase/Beta-glucan synthetase [Carbohydrate
                     transport and metabolism]; Region: SKN1; COG2273"
                     /db_xref="CDD:225182"
     misc_feature    complement(262910..263545)
                     /locus_tag="Mesop_0241"
                     /note="lichenase, member of glycosyl hydrolase family 16;
                     Region: GH16_lichenase; cd02175"
                     /db_xref="CDD:185684"
     misc_feature    complement(order(263000..263002,263006..263008,
                     263012..263014,263231..263233,263237..263239,
                     263243..263245,263249..263251,263276..263278,
                     263282..263284,263288..263290,263294..263296,
                     263363..263365,263369..263371,263471..263473,
                     263483..263485,263489..263491))
                     /locus_tag="Mesop_0241"
                     /note="active site"
                     /db_xref="CDD:185684"
     misc_feature    complement(order(263000..263002,263006..263008,
                     263159..263161,263195..263197,263201..263203,
                     263231..263233,263237..263239,263243..263245,
                     263282..263284,263288..263290,263294..263296,
                     263378..263380))
                     /locus_tag="Mesop_0241"
                     /note="active site"
                     /db_xref="CDD:185684"
     misc_feature    complement(order(263231..263233,263237..263239,
                     263243..263245))
                     /locus_tag="Mesop_0241"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:185684"
     gene            complement(263862..264263)
                     /locus_tag="Mesop_0242"
                     /db_xref="GeneID:10824048"
     CDS             complement(263862..264263)
                     /locus_tag="Mesop_0242"
                     /note="KEGG: mlo:mlr5262 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608831.1"
                     /db_xref="GI:337264776"
                     /db_xref="GeneID:10824048"
                     /translation="MASIFGFRSRDPARDRQTDIARFDRLAKLFEQIAAEIEAERTGL
                     ESRYRKTSTNAAFLVEAMENDPASDRRSSEVSALTTSILNCERRIAALSRQDGKMKDL
                     RHALDMVFDENGAPDPAATVEFNKPAGAGRG"
     gene            complement(264552..265646)
                     /locus_tag="Mesop_0243"
                     /db_xref="GeneID:10824049"
     CDS             complement(264552..265646)
                     /locus_tag="Mesop_0243"
                     /note="COGs: COG0463 Glycosyltransferase involved in cell
                     wall biogenesis;
                     InterPro IPR001173;
                     KEGG: mlo:mlr5261 succinoglycan biosynthesis
                     glycosyltransferase ExoU;
                     PFAM: glycosyl transferase family 2;
                     SPTR: Glycosyl transferase family 2;
                     PFAM: Glycosyl transferase family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="family 2 glycosyl transferase"
                     /protein_id="YP_004608832.1"
                     /db_xref="GI:337264777"
                     /db_xref="GeneID:10824049"
                     /translation="MVVLSEIECVQGEGRSEPVQEAKPMSMTKSEVCVIIAAKNAART
                     IAVAIASALREPEVAEVVVVDDGSTDNTAEVAVSADDGSGRLMVMRLDVNRGPSFARN
                     AAIAGSKAPFISILDADDFFLEGRFRNLFAGADWDFAADNIMLIRDDATKDATTIVAP
                     DFAAEPEFLDFERFVEGNISRRRVQRGELGFLKPVISRAFLDRHGLRYDENLRLGEDY
                     ELYARAVAHGARFKVIRSCGYGAIVRADSLSGRHKTQDLKRLADADLALLAIDSLPEG
                     SKAVLRRHERHVRDKYRLRNFLDVKAERGLASAAAYAFASQSNLVPIVQGVASDKLEA
                     LFRRVGLMSGQRHMPPLRFLMAGTSTGKAR"
     misc_feature    complement(264744..265562)
                     /locus_tag="Mesop_0243"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    complement(<265206..265547)
                     /locus_tag="Mesop_0243"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cd00761"
                     /db_xref="CDD:132997"
     misc_feature    complement(order(265290..265292,265296..265298,
                     265455..265457,265530..265532,265536..265538))
                     /locus_tag="Mesop_0243"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(265646..266770)
                     /locus_tag="Mesop_0244"
                     /db_xref="GeneID:10824050"
     CDS             complement(265646..266770)
                     /locus_tag="Mesop_0244"
                     /note="KEGG: mlo:mlr5260 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608833.1"
                     /db_xref="GI:337264778"
                     /db_xref="GeneID:10824050"
                     /translation="MALPESSYERLRAADCADEVAYVQACLRLYFAGPTAGKVSTPGL
                     SNDAVADIARLNKVAIFVLKALSRAPVGERPADLFQWLDTYRRRTVSMNAACLMDSMT
                     IHEALRDRQIDFVFLKGPFQQHLLYDDHFMKPSGDVDILVSPAGFSRARDALRSIGYE
                     VSGKSRSVWWVRFLGEQHMIRGNGPKSSTVDLHYRLQQPGSPSPRDADGFLRRKRLVE
                     IAGTEVPFTSVADTLMLSCISVAKALFNREPCAGYVCDIRASANRLDEADQQRLLDAA
                     MSQGLDDTLLLGLRAADVLLGGTGTLLSERAKPILSRIGNEDLLSMVIAPWLSSLRWP
                     QRRTVLWELCGRAPVRYLAEAGWAASADISRRIFERPASP"
     misc_feature    complement(265943..266632)
                     /locus_tag="Mesop_0244"
                     /note="Uncharacterized nucleotidyltransferase; Region:
                     NTP_transf_5; pfam14907"
                     /db_xref="CDD:259044"
     gene            267289..267441
                     /locus_tag="Mesop_0245"
                     /db_xref="GeneID:10824051"
     CDS             267289..267441
                     /locus_tag="Mesop_0245"
                     /note="KEGG: mlo:msl5259 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608834.1"
                     /db_xref="GI:337264779"
                     /db_xref="GeneID:10824051"
                     /translation="MEQNVEKHEYETPSLTVHGSIETITQGGGGNTAIDASFPAHTPI
                     GDLTFS"
     gene            267596..267895
                     /locus_tag="Mesop_0246"
                     /db_xref="GeneID:10824052"
     CDS             267596..267895
                     /locus_tag="Mesop_0246"
                     /note="KEGG: mlo:msl5258 hymidylate synthase;
                     SPTR: Hymidylate synthase;
                     PFAM: Coenzyme PQQ synthesis protein D (PqqD)"
                     /codon_start=1
                     /transl_table=11
                     /product="hymidylate synthase"
                     /protein_id="YP_004608835.1"
                     /db_xref="GI:337264780"
                     /db_xref="GeneID:10824052"
                     /translation="MNWNPSDHDCISANKDAVACEFGDGLALLNLKSNIYYSLNGVGA
                     FIWELIQEPKSIADIRSAVLASYNVDAERCKADVDALLKGLAENGLARLQHEALV"
     misc_feature    267665..267865
                     /locus_tag="Mesop_0246"
                     /note="Coenzyme PQQ synthesis protein D (PqqD); Region:
                     PqqD; pfam05402"
                     /db_xref="CDD:253180"
     gene            267879..268397
                     /locus_tag="Mesop_0247"
                     /db_xref="GeneID:10824053"
     CDS             267879..268397
                     /locus_tag="Mesop_0247"
                     /note="KEGG: mlo:mll5257 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608836.1"
                     /db_xref="GI:337264781"
                     /db_xref="GeneID:10824053"
                     /translation="MRHLSRQVSQKAMVSRQRPATEKSPRQAKSRSGRRSLTGILSLS
                     GSEALFLCQCLVVVAVVRLGLTLFSYNRVRAMVTRLNAHQCASMGELRLVAWGVAAAA
                     RFVPRATCLTQALSGQYMLARQGNASNIRIGVERGTGEQLKAHAWLISDNHIVLGGSV
                     DGFAHLVDHGSR"
     misc_feature    268038..268352
                     /locus_tag="Mesop_0247"
                     /note="Transglutaminase-like superfamily; Region:
                     Transglut_core3; pfam13471"
                     /db_xref="CDD:257795"
     gene            268394..270313
                     /locus_tag="Mesop_0248"
                     /db_xref="GeneID:10824054"
     CDS             268394..270313
                     /locus_tag="Mesop_0248"
                     /note="COGs: COG0367 Asparagine synthase
                     (glutamine-hydrolyzing);
                     InterPro IPR000583:IPR001962:IPR017932;
                     KEGG: mlo:mll5256 asparagine synthetase;
                     PFAM: asparagine synthase; glutamine amidotransferase
                     class-II;
                     SPTR: Asparagine synthase (Glutamine-hydrolyzing);
                     PFAM: Asparagine synthase;
                     TIGRFAM: asparagine synthase (glutamine-hydrolyzing)"
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthase"
                     /protein_id="YP_004608837.1"
                     /db_xref="GI:337264782"
                     /db_xref="GeneID:10824054"
                     /translation="MSGVAGIVLRQGPAPADAATDIQQMLARMRHRGPDGSSWWLDAG
                     IALGHAWLNTLDEAGPGPLTMAGGKLAITADCRLDNRDELLARLGIRDSSVADAVLLM
                     RAYLRWGEACPEHLQGDFAFAIWDAERQLLFCARDHFGVKPFYYHAADRRFAFASEIG
                     PMLGLDGVGARISEHRISGFLAGLPDDPQSTPYSDIFSLPARHSLTVSAQQVLLRRYW
                     QIEPSSRPPPSDAAEEFAHLFSQSVRNHMRGTSSIGAMLSGGLDSSSIACVAGLRNAA
                     ERKPRLPTFSLIFEKGSSMDERPFIDAVLDQQKVDPTLIAVGDYAPFAEFERVLEEQE
                     GTFLAPGLTLTRGIYRTAGAKGIKVLLDGHGGDEVVSQGHGHLHELANGGRWLDLWRE
                     IRSASNTYGDSTLALYFQFLTLYGPAWRIAKLRQLANRTLNKIRRPTPTRGRSWRDLV
                     NPDLARRTELIDRFHRAGYMPRGVQASDALSHRWILSNGYVPHSFEVLDKAAANFGVE
                     PRYPFWDKPLVEFCLGLPGEEKLSHGFGRSVLRRAMEGILPPPVQWRRDKIDFTANLV
                     NGMVRNHRDLLEQLLVSDTDRIAPYVNLPQVSAAYARLLRQPDRAAPLDVQYVWRSAS
                     LSLWLRQVQQGGSAA"
     misc_feature    268394..270271
                     /locus_tag="Mesop_0248"
                     /note="Asparagine synthase (glutamine-hydrolyzing) [Amino
                     acid transport and metabolism]; Region: AsnB; COG0367"
                     /db_xref="CDD:223444"
     misc_feature    268397..269050
                     /locus_tag="Mesop_0248"
                     /note="Glutamine amidotransferases class-II (GATase)
                     asparagine synthase_B type.  Asparagine synthetase B
                     catalyses the ATP-dependent conversion of aspartate to
                     asparagine. This enzyme is a homodimer, with each monomer
                     composed of a  glutaminase domain and a...; Region: AsnB;
                     cd00712"
                     /db_xref="CDD:238364"
     misc_feature    order(268397..268399,268544..268546,268616..268624,
                     268682..268684)
                     /locus_tag="Mesop_0248"
                     /note="active site"
                     /db_xref="CDD:238364"
     misc_feature    order(268442..268444,268472..268474,268481..268483,
                     268490..268504,268541..268543)
                     /locus_tag="Mesop_0248"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238364"
     misc_feature    269102..270076
                     /locus_tag="Mesop_0248"
                     /note="The C-terminal domain of Asparagine Synthase B.
                     This domain is always found associated n-terminal
                     amidotransferase domain. Family members that contain this
                     domain catalyse the conversion of aspartate to asparagine.
                     Asparagine synthetase B  catalyzes the...; Region:
                     Asn_Synthase_B_C; cd01991"
                     /db_xref="CDD:238949"
     misc_feature    order(269159..269167,269252..269260,269435..269437,
                     269477..269485)
                     /locus_tag="Mesop_0248"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238949"
     misc_feature    order(269159..269167,269252..269260,269435..269437,
                     269477..269485)
                     /locus_tag="Mesop_0248"
                     /note="Molecular Tunnel; other site"
                     /db_xref="CDD:238949"
     gene            270310..271287
                     /locus_tag="Mesop_0249"
                     /db_xref="GeneID:10824055"
     CDS             270310..271287
                     /locus_tag="Mesop_0249"
                     /note="KEGG: mlo:mll5255 hypothetical protein;
                     SPTR: HPr kinase;
                     PFAM: HPr Serine kinase C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="HPr kinase"
                     /protein_id="YP_004608838.1"
                     /db_xref="GI:337264783"
                     /db_xref="GeneID:10824055"
                     /translation="MMPRNGPLPLAPHYPAVAGVPERQSHFYRAYGLTVASDVALPEL
                     EPVEPAAADITIAVGAIDMPKPSPQAATTFRFEPDRQYLAWHAVGAFLISGGRRIDVE
                     PAPGVDDALLAFPLLGPVMALLLHRRGLLVLHASAIAVAGKGAIFMGDKGAGKSTTAS
                     ALIRAGHELLTDDVVALDLSNPDRPMIVPGFPQIKLAADAAAAIPLGQAEVRPQVHPA
                     IDKMQHRLHGAFSGSVVPVARIYVLERGQRAAMTPLPAIAALPAIIKFSYVTRFGRAA
                     LSGDFAAMHLRQCSAIANHVGVCRLEVPAGLDRIGEAVALLERELAEDV"
     sig_peptide     270310..270363
                     /locus_tag="Mesop_0249"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    270706..>270843
                     /locus_tag="Mesop_0249"
                     /note="Phosphoenolpyruvate carboxykinase (PEPCK), a
                     critical gluconeogenic enzyme, catalyzes the first
                     committed step in the diversion of tricarboxylic acid
                     cycle intermediates toward gluconeogenesis. It catalyzes
                     the reversible decarboxylation and...; Region: PEPCK_HprK;
                     cl00270"
                     /db_xref="CDD:260315"
     misc_feature    order(270709..270711,270760..270780,270823..270828)
                     /locus_tag="Mesop_0249"
                     /note="active site"
                     /db_xref="CDD:238418"
     misc_feature    order(270709..270711,270775..270777,270823..270828)
                     /locus_tag="Mesop_0249"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238418"
     misc_feature    order(270760..270765,270769..270780)
                     /locus_tag="Mesop_0249"
                     /note="nucleotide-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238418"
     gene            271298..273124
                     /locus_tag="Mesop_0250"
                     /db_xref="GeneID:10824056"
     CDS             271298..273124
                     /locus_tag="Mesop_0250"
                     /note="COGs: COG1132 ABC-type multidrug transport system
                     ATPase and permease components;
                     InterPro IPR017871:IPR003439:IPR003593:IPR017940;
                     KEGG: mlo:mll5254 ABC transporter, ATP-binding protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter transmembrane region; ABC
                     transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608839.1"
                     /db_xref="GI:337264784"
                     /db_xref="GeneID:10824056"
                     /translation="MSLSLFRDVAAFGAVIAQIGGRRTWTALLFLVLGSLTEGISILL
                     LVPLLHLVGRADQDFAVRLPNIDFVRWLVPGGTLQLTTVLVALVGLVAAQAAFNRFKS
                     VYMARLLFDFINRLRMNLFESIGKARWGVFSRMRGSDLDHALTGDIDRVQGAAFSLLM
                     LVQIAVLLVGYLVISMFISPVMTAFAIIIGIVMFVALQPFRSRATAFGRVLTSNRQDQ
                     YRTVSEFLGGIKVAKSLNVEASYFAQLQATLEKMKADNIDYVRNSSIGTAVFQVASVV
                     GLSLFIYVALVRFNLSLAEIVVLLLVFMRIAPRFMDMQTQAQQVLINLPAYTAMRSLQ
                     ARFDAEREPGHSEVEDASKLALDTGLNIRGVSFAYDDGAGKAVVSDITFGLPAGKVTA
                     LIGPSGSGKSTIADMLLGLLEPTAGKILVDGVEIDAANRRRWRDQVAYVPQDVFLLHD
                     TIAANLRLAAPEASDDDLWTALRAAHAGEFVERLDHRLDTVVGDRGVRLSGGERQRIA
                     LARALLRKPSLLILDEATSALDWQNQSLIARSIEGLRGAMTILTIAHRPSMIAFADWV
                     VAMEDGRVVEVGQYQRLKAKPASRLSRMLSGEQSETEPAHVA"
     misc_feature    271499..273055
                     /locus_tag="Mesop_0250"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    271535..272206
                     /locus_tag="Mesop_0250"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    272375..273055
                     /locus_tag="Mesop_0250"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    272480..272503
                     /locus_tag="Mesop_0250"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(272489..272494,272498..272506,272624..272626,
                     272864..272869,272960..272962)
                     /locus_tag="Mesop_0250"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    272615..272626
                     /locus_tag="Mesop_0250"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    272792..272821
                     /locus_tag="Mesop_0250"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    272852..272869
                     /locus_tag="Mesop_0250"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    272876..272887
                     /locus_tag="Mesop_0250"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    272948..272968
                     /locus_tag="Mesop_0250"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(273150..273395)
                     /locus_tag="Mesop_0251"
                     /db_xref="GeneID:10824057"
     CDS             complement(273150..273395)
                     /locus_tag="Mesop_0251"
                     /note="KEGG: mlo:mlr5253 exopolysaccharide production
                     repressor ExoX protein;
                     SPTR: Exopolysaccharide production repressor ExoX protein"
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide production repressor ExoX
                     protein"
                     /protein_id="YP_004608840.1"
                     /db_xref="GI:337264785"
                     /db_xref="GeneID:10824057"
                     /translation="MIFALAIVVGWSWIDGVSLGTTLLRVVICAVVIQAGYFAIIYVM
                     VARSAPTPADRLREAERKLNSPEVEGEKLGSARRGLH"
     gene            274022..274699
                     /locus_tag="Mesop_0252"
                     /db_xref="GeneID:10824058"
     CDS             274022..274699
                     /locus_tag="Mesop_0252"
                     /EC_number="2.7.8.6"
                     /note="COGs: COG2148 Sugar transferase involved in
                     lipopolysaccharide synthesis;
                     InterPro IPR013838:IPR003362;
                     KEGG: mlo:mll5252 exopolysaccharide production protein
                     ExoY;
                     PFAM: sugar transferase;
                     PRIAM: Undecaprenyl-phosphate galactose
                     phosphotransferase;
                     SPTR: Undecaprenyl-phosphate galactose phosphotransferase;
                     PFAM: Bacterial sugar transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-phosphate galactose phosphotransferase"
                     /protein_id="YP_004608841.1"
                     /db_xref="GI:337264786"
                     /db_xref="GeneID:10824058"
                     /translation="MRDIAKSATADFSQADTDFPPPIGGLMKRSFDIVGSLAGLIALS
                     PLFVMIALLVKFSDGGSVFYGHRRIGRGGRVFPCLKFRTMVPDGDKVLAAYLATNPEA
                     NAEWIATRKLKNDPRVTRVGAVLRKLSLDELPQIINILQGDMSLVGPRPVVRDELEIY
                     GSAAVYYLKSRPGLTGLWQVSGRNDVSYDSRVAFDRHYVENWSLFEDVRIIVRTVPAV
                     WMSRGSY"
     misc_feature    274103..274696
                     /locus_tag="Mesop_0252"
                     /note="Bacterial sugar transferase; Region: Bac_transf;
                     pfam02397"
                     /db_xref="CDD:251270"
     gene            274785..276041
                     /locus_tag="Mesop_0253"
                     /db_xref="GeneID:10824059"
     CDS             274785..276041
                     /locus_tag="Mesop_0253"
                     /note="COGs: COG1596 Periplasmic protein involved in
                     polysaccharide export;
                     InterPro IPR003715:IPR019554;
                     KEGG: mlo:mll5251 exopolysaccharide production protein
                     ExoF;
                     PFAM: polysaccharide export protein; Soluble ligand
                     binding domain;
                     SPTR: Polysaccharide export protein;
                     PFAM: Polysaccharide biosynthesis/export protein; SLBB
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide export protein"
                     /protein_id="YP_004608842.1"
                     /db_xref="GI:337264787"
                     /db_xref="GeneID:10824059"
                     /translation="MFEAFGSGPLSGRSRLMATCLALSLAFPQLATADEYHLGSQDKL
                     TIRIAEWQTVEGTFRDWTAVNGQYTVGPSGTLSVPFVGELPAAGKTTAEVAAAIGEAL
                     QRKLALSDKPEASVEMAQFRPFYISGEVQNPGQFPFVPDLTVLKAISVAGGIRRTADY
                     GPQLGKDLVTAKGNFDISDDQRVRLLVRRARIDADLAGKTSFEAPKEVEGDPRLPTIV
                     ADEMTILTADQKALKLKLEALDDLKSVLQAEIESLQKKIVNQQKQVDLAQQQLASIGP
                     LAQKGLVANARLLDSQQSVTDLQGKILDYETAILTAKQAISKATQDAIDAQNTLSSSL
                     AADRQQTEADLNEAALKVNMQKGLIAQATDPATTAAITNDQQPTLLYSLVRNVDGKTS
                     EIAAKEETQVLPGDVIKVKLAPLASQ"
     sig_peptide     274785..274883
                     /locus_tag="Mesop_0253"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    274818..>275261
                     /locus_tag="Mesop_0253"
                     /note="Periplasmic protein involved in polysaccharide
                     export, contains    SLBB domain of b-grasp fold [Cell
                     wall/membrane/envelope biogenesis]; Region: Wza; COG1596"
                     /db_xref="CDD:224512"
     misc_feature    274860..275144
                     /locus_tag="Mesop_0253"
                     /note="Polysaccharide biosynthesis/export protein; Region:
                     Poly_export; pfam02563"
                     /db_xref="CDD:251377"
     misc_feature    275154..275306
                     /locus_tag="Mesop_0253"
                     /note="SLBB domain; Region: SLBB; pfam10531"
                     /db_xref="CDD:256045"
     misc_feature    <275445..275744
                     /locus_tag="Mesop_0253"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     gene            complement(276331..277644)
                     /locus_tag="Mesop_0254"
                     /db_xref="GeneID:10824060"
     CDS             complement(276331..277644)
                     /locus_tag="Mesop_0254"
                     /note="COGs: COG3307 Lipid A core - O-antigen ligase;
                     InterPro IPR007016;
                     KEGG: mlo:mlr5249 exopolysaccharide production protein
                     ExoQ;
                     PFAM: O-antigen polymerase;
                     SPTR: O-antigen polymerase;
                     PFAM: O-Antigen ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen polymerase"
                     /protein_id="YP_004608843.1"
                     /db_xref="GI:337264788"
                     /db_xref="GeneID:10824060"
                     /translation="MKIPKSLLVDPEKNSAYGAFAVAVSIWAFSYSVIFGQVLILAYY
                     AVWLPLILVDYRRFLRQLSSAWLPLLFAAYVCFSVFWSQAPGTTARTAIQYLSHIACA
                     YVAARTVSARTLTLGALIGIFFVLLYSLKVGGYSEDVLDGTYNFVGAFASKNQIGFVG
                     SLGIYFSVVFLAFLRRGRLSFILTVPVVLLSAYVLVVSHSATSMASIPAVLALIALLA
                     MSKLLSRRYRRVIFLVGAGMIVVVAVVALNLGLMDFVLGIFGKDSTLTGRTYLWEQGW
                     DAAQRSPILGVGYAAYWVQGFAEAERLWNEFYITTRTGFHFHNTYIEALVELGFTGAT
                     MVSLIMLRTLYGHVSMVIFKAWQAESVVLFGVMVLLLIRSFVEVEILNPYIMGSFLMY
                     FSYFKLARLPVTGTRRSPAFEPADANRGEAEWPRHAGRPATADPS"
     misc_feature    complement(276448..277644)
                     /locus_tag="Mesop_0254"
                     /note="Lipid A core - O-antigen ligase and related enzymes
                     [Cell envelope biogenesis, outer membrane]; Region: RfaL;
                     COG3307"
                     /db_xref="CDD:225844"
     misc_feature    complement(276640..277086)
                     /locus_tag="Mesop_0254"
                     /note="O-Antigen ligase; Region: Wzy_C; pfam04932"
                     /db_xref="CDD:252887"
     gene            277994..278746
                     /locus_tag="Mesop_0255"
                     /db_xref="GeneID:10824061"
     CDS             277994..278746
                     /locus_tag="Mesop_0255"
                     /note="COGs: COG1028 Dehydrogenase with different
                     specificities (related to short-chain alcohol
                     dehydrogenase);
                     InterPro IPR002198:IPR002347;
                     KEGG: mlo:mll5243 3-oxoacyl-(acyl carrier protein)
                     reductase;
                     PFAM: short-chain dehydrogenase/reductase SDR;
                     SPTR: Short-chain dehydrogenase/reductase SDR;
                     PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004608844.1"
                     /db_xref="GI:337264789"
                     /db_xref="GeneID:10824061"
                     /translation="MPMHFAGRFAGRSAVITGGASGIGLAVAQRIVGEGGRVSVWDRD
                     PAQIEQAKAVVAGLHGVTLDVADAQGVEAATARTIEALGGVDILVTSAAITGPNMTTW
                     SYSTEDWQKVIDININGVFYCNKALVAHMLERDYGRIVNIASIAGKEGNPNASAYSTS
                     KAAVIGLTKSLGKELAKTKITVNCVTPAAVRTAIFKQMSQEHIDFMLSKIPMARFGEV
                     EEVAALICWIASEECSFTTAAVFDVSGGRATY"
     misc_feature    278015..278731
                     /locus_tag="Mesop_0255"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    278027..278731
                     /locus_tag="Mesop_0255"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(278045..278047,278051..278056,278060..278062,
                     278117..278125,278264..278272,278417..278425,
                     278462..278464,278474..278476,278552..278563)
                     /locus_tag="Mesop_0255"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(278339..278341,278423..278425,278462..278464,
                     278474..278476)
                     /locus_tag="Mesop_0255"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            278981..280330
                     /locus_tag="Mesop_0256"
                     /db_xref="GeneID:10824062"
     CDS             278981..280330
                     /locus_tag="Mesop_0256"
                     /note="COGs: COG5368 conserved hypothetical protein;
                     InterPro IPR016883:IPR019282;
                     KEGG: mlo:mll5242 hypothetical protein;
                     PFAM: Protein of unknown function DUF2329;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Uncharacterized protein conserved in bacteria
                     (DUF2329)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608845.1"
                     /db_xref="GI:337264790"
                     /db_xref="GeneID:10824062"
                     /translation="MPEAYPATLSDDELLDRYQRAAFGYFLENVNPDNGLVADTSRPN
                     SPASIAVVGFALSCYPIGVERGWMTRETAVELTLAALRFFSASPQGSGDEVTGHKGFY
                     YHFLDMRTGLRVWRCELSMVDTALLIAGFLVASAYFAGRDEKETEIRELAEALYRRVD
                     WRWAQGSSPTLRQGWKPRSGFLHYGWEGYNEATILYVLSMASPDSPTSDDCYEGWTAT
                     YQWENIYGHDVLYGGPLFMHQFSHAWIDFAGIRDAFMREKNSDYFENSRRSTYLHRDY
                     ARHNPYGFDGYGENLWGLSAGDGPGGFRASVERRRHRFSGYAARGAPFGPDDGTIAPW
                     SYPASLPFAPDICLAALRHLGDRYPQVIDNFRLPSGFNPTLASRRKFGRNGWISEGHY
                     GLDQGIVAMMIENHRSRLIWELMRSNPHIRRGLDKAGFTGGWLSQLASPEPGGRDVA"
     misc_feature    279008..280291
                     /locus_tag="Mesop_0256"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG5368"
                     /db_xref="CDD:227662"
     gene            280320..281849
                     /locus_tag="Mesop_0257"
                     /db_xref="GeneID:10824063"
     CDS             280320..281849
                     /locus_tag="Mesop_0257"
                     /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
                     complex dihydrolipoamide dehydrogenase (E3);
                     InterPro IPR008143:IPR013027:IPR004099:IPR000815;
                     KEGG: mlo:mll5241 mercuric reductase;
                     PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase; pyridine nucleotide-disulphide
                     oxidoreductase dimerisation region;
                     SPTR: Pyridine nucleotide-disulphide oxidoreductase
                     dimerisation region;
                     PFAM: Pyridine nucleotide-disulphide oxidoreductase;
                     Pyridine nucleotide-disulphide oxidoreductase,
                     dimerisation domain"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_004608846.1"
                     /db_xref="GI:337264791"
                     /db_xref="GeneID:10824063"
                     /translation="MSRERTKAAAFPVDRNDVELIQGAHPPRWKNPEPDGSYNLVVIG
                     AGPAGLTAARDAASLGAKVALIERRLIGGACVNVGGVPSKSIIRTARLYADMRDAENF
                     GGDTPERLHVDFERAMMRMRQIRERISRADSAAAIASQGIDLYFGEARFAGTDTVVVA
                     GKTLRFRKALIATGAHPSGPAIPGLAEAGYLNNETMFDLTKCPPRLLVIGGGPLGCET
                     AQAFCLLGAKVILAQSDPMFLPGEERDAAQILSDALAREGVEVCLNTEVVAVRTKGGQ
                     KLADLMRDGDVTTISVDEIITGVGRSPNVDGLGLEDAGVAYNANGIKVDDYLKTTNPH
                     IYAAGDVCLEYKFTHTAEATARIVVRNALFRGRGKLSDLVVPWCTYTDPEIAHVGLYP
                     VEARQNGIPVKTYTVLMHDVPRAVMDGEEEGFVKIHVREGSDRILGATVVAAHAGEMI
                     NAVTLAIRSGMGLHALADVIHPFPTQAQGIKMAGDAYRRTRFTTLRRRLAARWLAWSR
                     R"
     misc_feature    280416..281780
                     /locus_tag="Mesop_0257"
                     /note="mercuric reductase; Validated; Region: PRK06370"
                     /db_xref="CDD:235787"
     misc_feature    280437..>280565
                     /locus_tag="Mesop_0257"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    280932..281162
                     /locus_tag="Mesop_0257"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    281442..281768
                     /locus_tag="Mesop_0257"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            281949..282629
                     /locus_tag="Mesop_0258"
                     /db_xref="GeneID:10824064"
     CDS             281949..282629
                     /locus_tag="Mesop_0258"
                     /note="InterPro IPR015330;
                     KEGG: sim:M1627_0399 bifunctional DNA primase/polymerase;
                     PFAM: Bifunctional DNA primase/polymerase;
                     SPTR: Bifunctional DNA primase/polymerase;
                     PFAM: Bifunctional DNA primase/polymerase, N-terminal"
                     /codon_start=1
                     /transl_table=11
                     /product="Bifunctional DNA primase/polymerase"
                     /protein_id="YP_004608847.1"
                     /db_xref="GI:337264792"
                     /db_xref="GeneID:10824064"
                     /translation="MHGATAEHSGMQPVTETEYAIRLLAKGYICVPLCAGGKHLDLQA
                     MEYRPLHLQSRRRDLKELAFQSVAFHLSQKPPTGDDIRRWFRKFAGNVGILGGFSNLL
                     ILDFDDAATYLSWSSKHEALLNRTPIARSPNGFHVYLRTRDPTASSSLYAGMRRIGHV
                     KALGGYVVGSPSMLKDGSSYSWLKDHSPFDVDPSPIEGLASLSLRAVSPFKYHYDRML
                     NRGFFEPP"
     misc_feature    282006..282533
                     /locus_tag="Mesop_0258"
                     /note="Bifunctional DNA primase/polymerase, N-terminal;
                     Region: Prim-Pol; smart00943"
                     /db_xref="CDD:214927"
     misc_feature    order(282225..282227,282261..282263,282267..282269,
                     282339..282341,282345..282350,282354..282356,
                     282423..282425,282444..282446)
                     /locus_tag="Mesop_0258"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238291"
     gene            282643..284775
                     /locus_tag="Mesop_0259"
                     /db_xref="GeneID:10824065"
     CDS             282643..284775
                     /locus_tag="Mesop_0259"
                     /note="COGs: COG0463 Glycosyltransferase involved in cell
                     wall biogenesis;
                     InterPro IPR001173:IPR001296;
                     KEGG: mlo:mll5238 hypothetical protein;
                     PFAM: glycosyl transferase family 2; glycosyl transferase
                     group 1;
                     SPTR: Glycosyl transferase family 2;
                     PFAM: Glycosyl transferases group 1; Glycosyl transferase
                     family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="family 2 glycosyl transferase"
                     /protein_id="YP_004608848.1"
                     /db_xref="GI:337264793"
                     /db_xref="GeneID:10824065"
                     /translation="MSLPDGARPDISIVIPARNAAATIDATLRSLVADRDLIGEILLV
                     DDGSNDQTAAISIQSAREYELPLQVLSIRLGSAGAARNAGMARAKGKFLFFLDADDEV
                     IAGGLGLLREALVSNPGAGLSIGSSIRRTAGRPDKLKAPHGYTSDRALNARRYLFNEA
                     WPIAVGSALVAAAATAAISFPETTGLDEDTCYWAALLARSDVATTPAPVLLYHHDEAR
                     MARRFVQTPRATFLAIALELDKLAGLGLAKDILQWRKAWIAQRISRQLLKHKQYRAAK
                     RMMRAVRAHKTLGGSWKTLQYHTRIHAGAIVERPGHQLDARRDRERRTLIVSYDPASP
                     PTSGSDLRNFRNADAAARFGPVCLVSVKPKIAGNAPDPLIRVEGLSIQGEPRTASVGW
                     WRTRAENRIPRSALTRLETLAREFRPDTIIVEGVGLFKLLRPLRPLAAQLILDMHNVE
                     SDLAAQIRRLSAKRTAAAFGVRFLERKALSLVDRVWVCSNLDRQKLMRLSRHKIPIHV
                     VPNGIPQAGDVPTDMPAEPSTGNGFPVIVFIGHLAYPPNVDAAQRLASVILPRIRNAL
                     PDARLVLAGRTPRPAVQALAGLPGVELIEDPADVAPLLSSAHLTVVPLTAGGGTRIKI
                     LEAMAAGVPVIATPIAAEGLDLVENDEVLLADTDETLAEMAIGLCLDPERRARQRLRA
                     HQAAWARFGLQAIRDAVRDGLGPNGPAA"
     misc_feature    282664..283551
                     /locus_tag="Mesop_0259"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    282679..>283038
                     /locus_tag="Mesop_0259"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cd00761"
                     /db_xref="CDD:132997"
     misc_feature    order(282688..282690,282694..282696,282772..282774,
                     282931..282933,282937..282939)
                     /locus_tag="Mesop_0259"
                     /note="active site"
                     /db_xref="CDD:132997"
     misc_feature    283810..284745
                     /locus_tag="Mesop_0259"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     misc_feature    284248..284655
                     /locus_tag="Mesop_0259"
                     /note="Glycosyl transferases group 1; Region:
                     Glyco_trans_1_4; pfam13692"
                     /db_xref="CDD:257994"
     gene            284772..286346
                     /locus_tag="Mesop_0260"
                     /db_xref="GeneID:10824066"
     CDS             284772..286346
                     /locus_tag="Mesop_0260"
                     /note="COGs: COG3774 Mannosyltransferase OCH1;
                     InterPro IPR007577:IPR005109;
                     KEGG: rba:RB9614 surface protein SUR1;
                     PFAM: glycosyltransferase sugar-binding region containing
                     DXD motif; Anp1;
                     SPTR: Glycosyltransferase sugar-binding region containing
                     DXD motif;
                     PFAM: Glycosyltransferase sugar-binding region containing
                     DXD motif; Anp1"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase sugar-binding region
                     containing DXD motif"
                     /protein_id="YP_004608849.1"
                     /db_xref="GI:337264794"
                     /db_xref="GeneID:10824066"
                     /translation="MIPAILHQTWKTDRVPARFQAYADSWKRHNPHWTVMFWSDRMLL
                     DFVAEHYPDFLPVFCTYPNGVERSDAARYMLLHHFGGVYADIDCECVAPFDPVMNETR
                     IVLCKEPASHSAVQLEFRGLPYLLFNGTMASPPGHPFWLHLLSMMPGLAGAKDVLDAT
                     GPCLLTSAQRDYDDQAAFAIHPSGLFTPVTSAGSAEREAADDTTALSIHHWAGTWWIP
                     EPPPNWTTKLRNRAYRLWYQLTRGAYLDEAVAKAGVDKAVLSAPPPSGKNIAVLVPLR
                     DAADLIQPFLDALEGLDYPKERIKLVFCEGDSLDGSWERLQAATAGLTGKYRDIVLLQ
                     RRVGTSLDRAKRARPRMQRVRRGAIAKVRNYLIDHGLSKDDDWALWIDIDVWRFPGDA
                     LNRLIATGHRIAVPNCVKIAGGGSFDLNSFIVRRQTRDYRYYRDIRGGLHQPPAQTPN
                     RYHLSDVRHLDIIGLDAVGGTMLLVDAALHRGGLRFPEIPYRDLIETEAFGVLANDLG
                     IRPVGLPKLEILHVPW"
     misc_feature    <284772..285443
                     /locus_tag="Mesop_0260"
                     /note="Mannosyltransferase OCH1 and related enzymes [Cell
                     envelope biogenesis, outer membrane]; Region: OCH1;
                     COG3774"
                     /db_xref="CDD:226297"
     misc_feature    284817..285077
                     /locus_tag="Mesop_0260"
                     /note="Glycosyltransferase sugar-binding region containing
                     DXD motif; Region: Gly_transf_sug; pfam04488"
                     /db_xref="CDD:252625"
     misc_feature    285582..286232
                     /locus_tag="Mesop_0260"
                     /note="Anp1; Region: Anp1; pfam03452"
                     /db_xref="CDD:251963"
     gene            complement(286416..286991)
                     /locus_tag="Mesop_0261"
                     /db_xref="GeneID:10824067"
     CDS             complement(286416..286991)
                     /locus_tag="Mesop_0261"
                     /note="COGs: COG3506 conserved hypothetical protein;
                     InterPro IPR015987:IPR009784;
                     KEGG: mlo:mlr5237 hypothetical protein;
                     PFAM: protein of unknown function DUF1349;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF1349)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608850.1"
                     /db_xref="GI:337264795"
                     /db_xref="GeneID:10824067"
                     /translation="MALQDLTWLNPPPHHAIDGDTVHARTGKETDFWRETFYGFWRDN
                     GHFLHRPVEGDFTAEVTVKGDYKVLYDQAGLMVRLSETHWIKAGIEYTDGLAYVSVVV
                     TNDASDWSLVAIHAGPDGVRIRLTRHAEAIRVQYLDASDGHWKPVRLAYFPVSKTVDV
                     GMMCCSPQREGFEVTFSGYSVGPPISRELHD"
     misc_feature    complement(286422..286991)
                     /locus_tag="Mesop_0261"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3506"
                     /db_xref="CDD:226037"
     gene            complement(287071..288510)
                     /locus_tag="Mesop_0262"
                     /db_xref="GeneID:10824068"
     CDS             complement(287071..288510)
                     /locus_tag="Mesop_0262"
                     /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
                     InterPro IPR016160:IPR015590;
                     KEGG: mlo:mlr5236 aldehyde dehydrogenase;
                     PFAM: Aldehyde Dehydrogenase;
                     SPTR: Aldehyde Dehydrogenase;
                     PFAM: Aldehyde dehydrogenase family"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="YP_004608851.1"
                     /db_xref="GI:337264796"
                     /db_xref="GeneID:10824068"
                     /translation="MNVFRKNLIDGEWVGDAGSRNINPSDTGDVVGEYASAGVEQAGQ
                     AIAAAKAAFPAWSRSGPLARHAVLKKTADEIMARKDEIGRNLAREEGKTLAEGIGETI
                     RAAQIFDFFAGETLRLSGEMVPSVRPGVGVEITREAVGVVGIITPWNFPIAIPAWKIA
                     PALAHGNTIVFKPAELVPESAWSIVDILHRAGLPKGVLNLVMGKGSVVGQAMLDSPDV
                     NAITFTGSVGTGKRVAAASVEHMRKFQLEMGGKNPLVVLDDADLAVAVDCALNGAFFS
                     TGQRCTASSRLIVTDAIHDRFVDALKDRMGKLVIGDALDAQTQIGPVVDATQLKQDED
                     YIAIGVREGATLAFGGERLDRKTPGFFLRPALLTEATNAMRSSREEIFGPVASVIRVK
                     DYDEALAVANDTPFGLTSGICTSSLKHATHFKRNSEAGMVMVNLPTAGVDFHVPFGGR
                     KGSSFGPREQGRYAMEFYTTVKTAYTFAG"
     misc_feature    complement(287083..288495)
                     /locus_tag="Mesop_0262"
                     /note="Bacillus subtilis NADP+-dependent
                     alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like;
                     Region: ALDH_KGSADH-YcbD; cd07097"
                     /db_xref="CDD:143415"
     misc_feature    complement(order(287170..287172,287287..287289,
                     287365..287367,287371..287373,287668..287670,
                     287764..287772,287812..287817,287824..287826,
                     287833..287844,287986..287991,287995..287997,
                     288040..288042,288064..288078))
                     /locus_tag="Mesop_0262"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143415"
     misc_feature    complement(order(287668..287670,287677..287679,
                     287770..287772,288064..288066))
                     /locus_tag="Mesop_0262"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143415"
     gene            288750..289451
                     /locus_tag="Mesop_0263"
                     /db_xref="GeneID:10824069"
     CDS             288750..289451
                     /locus_tag="Mesop_0263"
                     /note="InterPro IPR001647;
                     KEGG: mlo:mll5233 hypothetical protein;
                     PFAM: regulatory protein TetR;
                     SPTR: Transcriptional regulator, TetR family;
                     PFAM: Bacterial regulatory proteins, tetR family"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004608852.1"
                     /db_xref="GI:337264797"
                     /db_xref="GeneID:10824069"
                     /translation="MTLIWPVRRVMRRAMAALETTIQRTGATGNVKATREDWLKLALE
                     TLISDGVERVRVLTLGQQLDVSRSSFYWYFKSRQDLLDQLLDHWRQTNTKFIVERARR
                     PSATVVRGVMSIFECWVDERLFDPRLDFAIRAWARRSPAIRRALDEADEERVNAIRDM
                     FMRHGYDEEDAFVRARILYFMQIGYYSLELDEPMSSRLPHVASYLRSFTGQEPTTADV
                     EDFSRYVVETMARKG"
     sig_peptide     288750..288797
                     /locus_tag="Mesop_0263"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    288843..289340
                     /locus_tag="Mesop_0263"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    288864..289001
                     /locus_tag="Mesop_0263"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            289544..290797
                     /locus_tag="Mesop_0264"
                     /db_xref="GeneID:10824070"
     CDS             289544..290797
                     /locus_tag="Mesop_0264"
                     /note="COGs: COG0665 Glycine/D-amino acid oxidase
                     (deaminating);
                     InterPro IPR006076:IPR006278;
                     KEGG: mlo:mll5232 sarcosine oxidase beta subunit;
                     PFAM: FAD dependent oxidoreductase;
                     SPTR: Sarcosine oxidase, beta subunit family;
                     TIGRFAM: sarcosine oxidase, beta subunit family;
                     PFAM: FAD dependent oxidoreductase;
                     TIGRFAM: sarcosine oxidase, beta subunit family,
                     heterotetrameric form"
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit beta family protein"
                     /protein_id="YP_004608853.1"
                     /db_xref="GI:337264798"
                     /db_xref="GeneID:10824070"
                     /translation="MTRRYSALSLFKEGLAGQTGWKQAWRSPEPKPAYDVIVIGGGGH
                     GLATAYYLAKNHNIARVAVLEKGWIGGGNTGRNTTVVRSNYYYPESVELYGLAHRLYE
                     GLSKDLNYNVMLSQRGMVNLCHSTAEMEIGARTVNAMQINGIDAELFSPKDVRRVAPI
                     YNFSADARFPVFGGIWQGRAGTARHDAVAWGYARAGSRLGVDIIQNCEITDFIIEGGH
                     CRGVQTTRGVIRAERIGMAVAGHSSVLAAKAGFRLPVNSYALQACVSEPVKPILDTVV
                     LSPGCGVYVSQSDKGEIVIGGGLDRIPSYAQRGNLPTLETVIAGVLEMFPIFGQLKLM
                     RQWAGIVDVVPDSSPIIGETPLPNLFLNCGWGTGGFKAIPAGGTLLANLLATGKHNDI
                     SRPFDLDRFAGGRLIDEAAGSGIAH"
     misc_feature    289553..290770
                     /locus_tag="Mesop_0264"
                     /note="sarcosine oxidase, beta subunit family,
                     heterotetrameric form; Region: soxB; TIGR01373"
                     /db_xref="CDD:233383"
     misc_feature    289691..290707
                     /locus_tag="Mesop_0264"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            290806..291072
                     /locus_tag="Mesop_0265"
                     /db_xref="GeneID:10824071"
     CDS             290806..291072
                     /locus_tag="Mesop_0265"
                     /note="COGs: COG4311 Sarcosine oxidase delta subunit;
                     InterPro IPR006279;
                     KEGG: mlo:msl5231 sarcosine oxidase delta subunit;
                     PFAM: Sarcosine oxidase delta subunit heterotetrameric;
                     SPTR: Sarcosine oxidase, delta subunit family;
                     TIGRFAM: sarcosine oxidase, delta subunit family;
                     PFAM: Sarcosine oxidase, delta subunit family;
                     TIGRFAM: sarcosine oxidase, delta subunit family,
                     heterotetrameric form"
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit delta family protein"
                     /protein_id="YP_004608854.1"
                     /db_xref="GI:337264799"
                     /db_xref="GeneID:10824071"
                     /translation="MQLFPCPFCGPRDETEFHYGGDAGNVRPDGAEVPIERWADYLYL
                     RGNPKGTAREIWVHMTCGEFFVMERDTVTHKVLSSAALGGEQAA"
     misc_feature    290812..291057
                     /locus_tag="Mesop_0265"
                     /note="sarcosine oxidase, delta subunit family,
                     heterotetrameric form; Region: soxD; TIGR01374"
                     /db_xref="CDD:130441"
     gene            291069..293942
                     /locus_tag="Mesop_0266"
                     /db_xref="GeneID:10824072"
     CDS             291069..293942
                     /locus_tag="Mesop_0266"
                     /note="COGs: COG0404 Glycine cleavage system T protein
                     (aminomethyltransferase);
                     InterProIPR001986:IPR013027:IPR006222:IPR013977:IPR
                     000103:IPR006277;
                     KEGG: mlo:mll5230 sarcosine oxidase alpha subunit;
                     PFAM: glycine cleavage T protein (aminomethyl
                     transferase); FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase; Glycine cleavage T-protein barrel;
                     SPTR: Sarcosine oxidase, alpha subunit family;
                     TIGRFAM: sarcosine oxidase, alpha subunit family;
                     PFAM: Pyridine nucleotide-disulphide oxidoreductase;
                     Glycine cleavage T-protein C-terminal barrel domain;
                     Aminomethyltransferase folate-binding domain;
                     TIGRFAM: sarcosine oxidase, alpha subunit family,
                     heterotetrameric form"
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit alpha family protein"
                     /protein_id="YP_004608855.1"
                     /db_xref="GI:337264800"
                     /db_xref="GeneID:10824072"
                     /translation="MTASRLATGGSAIDRSRPIRFSFDGTTVQGFAGDTIASALLAGD
                     VAVVGRSFKYHRPRGIWGAGVEEPNALVDVGGATPNTRATTEPARDGLVAKSVNATPN
                     ALVDRNAFLDRFSRFIPAAFYYKTFMWPDWHMFEPRIRAMAGLGKVDAGWASPGLSDQ
                     INHHCDVLVVGAGPAGLAAAKLAAGADQSVVLVDDQLRAGGSLGHRAGEVDGKSATEW
                     VDETVANLAANGHLILPWTTAFGIYDHNLVGLNQRHLDGRSDTLWRVRPRRIVLATGA
                     IERPLPFANNDLPGILSADAALAYLRRHAVLVGRRIVVATNNDSAYEVAEAVAEAGAD
                     VTLVDIRRDGMPAAPVNARVLKGRALASARGKLRVEGVTLDDGSRLDADCVLVSGGWT
                     PTIHLFGQARGKLAWSEARAAFLPGDPVDGISVVGAAAGAVCLSDVFAGVADAFPGKG
                     SAATPRSTGPEATGGIVAAWPMPGSKGRIWIDYQNDVTVKDVELAARENFVSVEHLKR
                     YTTLGMATDQGKTSNLPGLALMAGITGRTVPEVGTTTYRPPFTPVPLASFAGARVGEL
                     MAPVRRLPLENVHRASGAVFQEYGGWLRPAHYGGRDADADRAIQDEARRARQSVALFD
                     GSTLGKIEVIGPQAAAFVDFLYYNTMSTLKPGRCRYGFMLSENGVVFDDGVLVRLDEH
                     RFVISCSSSHVAAVHARLEEWRQDRFGRDAVYIHNATSEMATLTVSGPNARKLLERLK
                     LGLSLDDADLPHMAVGHGRYGGDQVRIARVSFTGDRSYEISIRADRAEPLWAHLRQAG
                     QALDAVVIGLEALMILRAEKGFIVIGKDTDGTTLPHDLGSEGPRAKRKTEYVGRRSLF
                     TEEASRGNRLQLVGLTVPSGEAPLPTGAHGIDRRDGKLKSQGFVTSSYQSPTLGRPVA
                     LGLIERGATRHGETIEIQHLGKIRTATIAAACAFDPAGDRLNA"
     misc_feature    291087..293939
                     /locus_tag="Mesop_0266"
                     /note="sarcosine oxidase, alpha subunit family,
                     heterotetrameric form; Region: soxA; TIGR01372"
                     /db_xref="CDD:233382"
     misc_feature    291114..291365
                     /locus_tag="Mesop_0266"
                     /note="2Fe-2S iron-sulfur cluster binding domain; Region:
                     Fer2_4; pfam13510"
                     /db_xref="CDD:257830"
     misc_feature    292932..293579
                     /locus_tag="Mesop_0266"
                     /note="Aminomethyltransferase folate-binding domain;
                     Region: GCV_T; pfam01571"
                     /db_xref="CDD:250713"
     misc_feature    293610..293900
                     /locus_tag="Mesop_0266"
                     /note="Glycine cleavage T-protein C-terminal barrel
                     domain; Region: GCV_T_C; pfam08669"
                     /db_xref="CDD:254962"
     gene            293935..294468
                     /locus_tag="Mesop_0267"
                     /db_xref="GeneID:10824073"
     CDS             293935..294468
                     /locus_tag="Mesop_0267"
                     /note="InterPro IPR013838;
                     KEGG: mlo:mll5229 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Sarcosine oxidase, gamma subunit family;
                     TIGRFAM: sarcosine oxidase, gamma subunit family,
                     heterotetrameric form"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608856.1"
                     /db_xref="GI:337264801"
                     /db_xref="GeneID:10824073"
                     /translation="MRDLAEKWPIAPDWPAAMITTPGLAVRTVTGLDQMLVSGDLDAW
                     ARLSGVKAEGVGAFGAAQGERYAARLARDRLLVVSNAPLAIAAGWHKEGFAVTEISTG
                     LQLFEIEGVGLDAFIARGTTIDPRQSSASATLSFAGVSAIVYRHGSKLRIHVDRGLAA
                     YLWTWMEQAAGHVAAGS"
     misc_feature    <294109..294459
                     /locus_tag="Mesop_0267"
                     /note="Aminomethyltransferase folate-binding domain;
                     Region: GCV_T; cl01893"
                     /db_xref="CDD:261109"
     gene            complement(294485..294970)
                     /locus_tag="Mesop_0268"
                     /db_xref="GeneID:10824074"
     CDS             complement(294485..294970)
                     /locus_tag="Mesop_0268"
                     /note="KEGG: mlo:mlr5228 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608857.1"
                     /db_xref="GI:337264802"
                     /db_xref="GeneID:10824074"
                     /translation="MSKALISFALVAVLTALLMALSLAVARHGYPYGAIGVRRLDGIA
                     DAGTFIPLAAVYFFSALLMMILPIRAASIVLTHAADAIFWTVIVLLATIVGGLLARWA
                     FGQGSALLALLNWRFLFAVAVVGCHFVMNELRRNVLLRSLFFVVFAAAMLACLFWSFT
                     L"
     sig_peptide     complement(294899..294970)
                     /locus_tag="Mesop_0268"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            complement(295089..295649)
                     /locus_tag="Mesop_0269"
                     /db_xref="GeneID:10824075"
     CDS             complement(295089..295649)
                     /locus_tag="Mesop_0269"
                     /note="COGs: COG0431 flavoprotein;
                     InterPro IPR005025:IPR019912;
                     KEGG: mlo:mlr5227 NADH-dependent FMN reductase MsuE;
                     PFAM: NADPH-dependent FMN reductase;
                     SPTR: NADPH-dependent FMN reductase;
                     TIGRFAM: FMN reductase;
                     PFAM: NADPH-dependent FMN reductase;
                     TIGRFAM: FMN reductase, MsuE subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="YP_004608858.1"
                     /db_xref="GI:337264803"
                     /db_xref="GeneID:10824075"
                     /translation="MSNPTVVGFSGNITRPSKTRAFVDFVARDIAARHGLSASTYDIE
                     DVGPSLGTARWARDLDSQAQPILAQILSADVLVVGSPTYKGSYTGLFKHFFDLIDPAA
                     LRGKPILLTATGGGERHALIVEHQLRPLFGFFEAFTLPTAVYATDKDFTDGVLRSEAI
                     LKRAAQAVDEVGFVLANRSAGRVAAE"
     misc_feature    complement(295116..295637)
                     /locus_tag="Mesop_0269"
                     /note="FMN reductase, MsuE subfamily; Region:
                     FMN_reduc_MsuE; TIGR03566"
                     /db_xref="CDD:211840"
     gene            complement(295712..296959)
                     /locus_tag="Mesop_0270"
                     /db_xref="GeneID:10824076"
     CDS             complement(295712..296959)
                     /locus_tag="Mesop_0270"
                     /note="COGs: COG1960 Acyl-CoA dehydrogenase;
                     InterPro IPR006092:IPR013107;
                     KEGG: mlo:mlr5225 dibenzothiophene desulfurization enzyme;
                     PFAM: Acyl-CoA dehydrogenase type 2 domain; acyl-CoA
                     dehydrogenase domain protein;
                     SPTR: Acyl-CoA dehydrogenase type 2 domain protein;
                     PFAM: Acyl-CoA dehydrogenase, C-terminal domain; Acyl-CoA
                     dehydrogenase, N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA dehydrogenase type 2 domain-containing
                     protein"
                     /protein_id="YP_004608859.1"
                     /db_xref="GI:337264804"
                     /db_xref="GeneID:10824076"
                     /translation="MTVSTVKTDHASAAVPPVARPSAPAHIIKDDAEAIAIAHALAAE
                     FAKDSSRRDRERIWPVAELDAFSQSGLWSINVPRAFGGPELSYATLAKVIEIISAADS
                     SIGQVAQNHLGVIAAIRTVSDAEQQKLLFGEALKGTRFGNAFSEFGSKRAADFETRFT
                     DAGDHVVVNGRKFYSSGALLAHLVPIVALDDEGRAWYAIADRGAPGLTVIDDWSSFGQ
                     RTTLSGTVIIDNVKVPKTFLVPGYKGYDRPTADGAIFQIIQVAVDTGIAQAAIDETVH
                     FVRTRSRAWIDSGVDNAWDDPYTIQAIGDLTLRLHAAQALLEKAGHAIDRAVIEPTAE
                     TVAHAQIVTAEAKILSTEIAIAATNKLFELAGTRSTLAEHNLDRHWRNARTHTLHDPV
                     RWKYSILGKYFLNGENPPLHAWS"
     misc_feature    complement(295715..296887)
                     /locus_tag="Mesop_0270"
                     /note="sulfur acquisition oxidoreductase, SfnB family;
                     Region: sulfur_SfnB; TIGR04022"
                     /db_xref="CDD:188537"
     misc_feature    complement(295733..296827)
                     /locus_tag="Mesop_0270"
                     /note="Dibenzothiophene (DBT) desulfurization enzyme C;
                     Region: DszC; cd01163"
                     /db_xref="CDD:173852"
     misc_feature    complement(order(296432..296434,296438..296440))
                     /locus_tag="Mesop_0270"
                     /note="Flavin binding site [chemical binding]; other site"
                     /db_xref="CDD:173852"
     gene            complement(296984..297790)
                     /locus_tag="Mesop_0271"
                     /db_xref="GeneID:10824077"
     CDS             complement(296984..297790)
                     /locus_tag="Mesop_0271"
                     /note="COGs: COG0410 ABC-type branched-chain amino acid
                     transport systems ATPase component;
                     InterPro IPR003439:IPR003593;
                     KEGG: mlo:mlr5224 ABC transporter, ATP-binding protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608860.1"
                     /db_xref="GI:337264805"
                     /db_xref="GeneID:10824077"
                     /translation="MPDNDVILAVNAVHATYNHAITALHGVSFEIRRGEILALLGANG
                     AGKTTTLKAVSNLLPAVRGQVNAGTIRYDGSDVSRRKPGDLVRAGLVPVLEGRHCFKS
                     LTVEENLVAGGIGRSGRRAEINVDLERIYGYFPRLREKRRTLSGLTSGGEQQMTAIGR
                     ALMSRPRLLVLDEPSMGLAPLIVQDIFQTLRKLNRETGLSILVAEQNSAVALRYADHA
                     TVLENGVSVLSGPAAELRQREDVRAFYLGQSTSGQQPSPATKTAHLHAVA"
     misc_feature    complement(297050..297778)
                     /locus_tag="Mesop_0271"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    complement(297080..297769)
                     /locus_tag="Mesop_0271"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    complement(297647..297670)
                     /locus_tag="Mesop_0271"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(order(297173..297175,297272..297277,
                     297506..297508,297644..297652,297656..297661))
                     /locus_tag="Mesop_0271"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(297506..297517)
                     /locus_tag="Mesop_0271"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(297320..297349)
                     /locus_tag="Mesop_0271"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(297272..297289)
                     /locus_tag="Mesop_0271"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(297254..297265)
                     /locus_tag="Mesop_0271"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(297167..297187)
                     /locus_tag="Mesop_0271"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            complement(297867..299204)
                     /locus_tag="Mesop_0272"
                     /db_xref="GeneID:10824078"
     CDS             complement(297867..299204)
                     /locus_tag="Mesop_0272"
                     /note="COGs: COG0683 ABC-type branched-chain amino acid
                     transport systems periplasmic component;
                     KEGG: mlo:mlr5223 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Receptor family ligand binding region"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608861.1"
                     /db_xref="GI:337264806"
                     /db_xref="GeneID:10824078"
                     /translation="MNFLSTIKAAALSAAMIASVALPAANADEQYFPLQSYRVGPYAA
                     GGTGFFGGFIDYLNLINIRDGGVNGVKLTWDECETQYEVERGVECYERQKSHAGAAAW
                     NPLSVGIAYAMIDRITADKVPLITVNHGRTDSTDGRVFPYVFPLLLNPYSETSGIVNY
                     IASKEGGIDKLKGKKIVVLYHGSPYGKETIPIYELLAQKYGFTIQQIEVPHPGNEQQS
                     QWLTIRRAKPDFVVLRGWGVMNPVALKTAVKVGYPVDHIVGNVWSNSEEDVIPAGDAA
                     KGYTAITTQASGNSYPVVQEIVKTVYGAGKGNLEDKSRIGSVYHNLGIVNGILNVEAI
                     RVAQEKFGHRTLTGDEVRWGFEHLKLDPAKVEALGAKDLFHSINVSWDNHEGEGYVTF
                     QQWDGKKWNVVSDWIAPDWALLRPIIEKSAEAYAAEKGIKLRTADDANAVTTN"
     sig_peptide     complement(299124..299204)
                     /locus_tag="Mesop_0272"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(298041..299114)
                     /locus_tag="Mesop_0272"
                     /note="Type I periplasmic ligand-binding domain of
                     uncharacterized ABC (ATPase Binding Cassette)-type active
                     transport systems that are predicted to be involved in
                     transport of amino acids, peptides, or inorganic ions;
                     Region: PBP1_ABC_ligand_binding_like_1; cd06334"
                     /db_xref="CDD:107329"
     misc_feature    complement(order(298422..298424,298497..298499,
                     298650..298652,298815..298823,298884..298892))
                     /locus_tag="Mesop_0272"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107329"
     gene            complement(299287..300327)
                     /locus_tag="Mesop_0273"
                     /db_xref="GeneID:10824079"
     CDS             complement(299287..300327)
                     /locus_tag="Mesop_0273"
                     /note="COGs: COG4177 ABC-type branched-chain amino acid
                     transport system permease component;
                     InterPro IPR001851;
                     KEGG: mlo:mlr5222 ABC transporter, permease protein;
                     PFAM: inner-membrane translocator;
                     SPTR: Inner-membrane translocator;
                     PFAM: Branched-chain amino acid transport system /
                     permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_004608862.1"
                     /db_xref="GI:337264807"
                     /db_xref="GeneID:10824079"
                     /translation="MTAIASDFSSTPALPKWLAPVLLLAFAYGVVPLIGSSYLFEAIL
                     LPFLALSLAGVGLNILTGYAGQVSLGSAAFMAAGAFAAYNFNLRVEGLPLIGSIVLAG
                     LVAAAIGIVFGLPSLRLKGFYLAVSTLAAQFFVQWALTKFSWFSNNSASGVIDAPRLS
                     ISGFALDGAVGRYLFALTIVAVLTFLAHRLVSSQTGRNFIAIRDNETAARIIGIPVLK
                     TKLLAFAISSFIIGVAGVIWAFAYLRTVEPDGFDLDRSFQILFIIIIGGLASVRGAFF
                     GAALIVVFPLGLSRLGGFLLGDVFDSGVLDMSQRIVLGALIILFLILEPDGLVALWDR
                     LRRRLLFAWQTS"
     misc_feature    complement(299341..300189)
                     /locus_tag="Mesop_0273"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    complement(299653..299709)
                     /locus_tag="Mesop_0273"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            complement(300331..301230)
                     /locus_tag="Mesop_0274"
                     /db_xref="GeneID:10824080"
     CDS             complement(300331..301230)
                     /locus_tag="Mesop_0274"
                     /note="COGs: COG0559 Branched-chain amino acid ABC-type
                     transport system permease components;
                     InterPro IPR001851;
                     KEGG: mlo:mlr5220 ABC transporter, permease protein;
                     PFAM: inner-membrane translocator;
                     SPTR: Inner-membrane translocator;
                     PFAM: Branched-chain amino acid transport system /
                     permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_004608863.1"
                     /db_xref="GI:337264808"
                     /db_xref="GeneID:10824080"
                     /translation="MIADFDYQFFIEVLVGGLLSGVMYSLVAIGFVLIYKTSGVLNFA
                     QGALLLFAALTFVSLVERGVPFALALVATFAIMVAIGVAIERTVLRPLTNKPPITLFM
                     ATLGLSYIIEGAAQLIWGTQVHGLDLGIEDVPLEVGGVLISQFDIFAAVVAAGMVLLL
                     SLFFRYTRIGLSFRAVADDQFAALAVGLRLPLIWATVWAAAGLVALVAGLLWGARLGV
                     QFSLSLVVLKALPVLVLGGFDSILGAIVGGLLIGASEKLAEVYIGDYFGGGIESWFAY
                     VVALVFLLIRPSGLFGQKLVERV"
     misc_feature    complement(300358..301182)
                     /locus_tag="Mesop_0274"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    complement(300634..300690)
                     /locus_tag="Mesop_0274"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            complement(301227..302162)
                     /locus_tag="Mesop_0275"
                     /db_xref="GeneID:10824081"
     CDS             complement(301227..302162)
                     /locus_tag="Mesop_0275"
                     /note="COGs: COG0411 ABC-type branched-chain amino acid
                     transport systems ATPase component;
                     InterPro IPR003439:IPR003593;
                     KEGG: mlo:mlr5219 ABC transporter, ATP-binding protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter; Branched-chain amino acid
                     ATP-binding cassette transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608864.1"
                     /db_xref="GI:337264809"
                     /db_xref="GeneID:10824081"
                     /translation="MPLASYSLGMMEASVYAPEIFARGLPSAPQPALPSAGRIEPAGS
                     VSGTAAPLLSLQGIGLSFGGVVALADIDLSVQPGEIRAIIGPNGAGKSSLINVISGVY
                     RPDRGHVLLDGVSHAQVPTQRLARLGVARTFQNLALFKGLSVLDNVASGLAYKVRSNF
                     AGQVLGIGRSRGEQRETRGRADQVLEFLDLTAVRDRLAGTLPYGLQKRVELARALVAQ
                     PRLLLLDEPMAGMTSGEKSEMAGFVRAARDRFATTVVLIEHDVGVVMGLSDRIAVLDY
                     GRKIADGTPDEVRNDQRVIDAYLGVASDNEDGAGI"
     misc_feature    complement(301260..302018)
                     /locus_tag="Mesop_0275"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    complement(301281..302006)
                     /locus_tag="Mesop_0275"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    complement(301887..301910)
                     /locus_tag="Mesop_0275"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(order(301386..301388,301485..301490,
                     301761..301763,301884..301892,301896..301901))
                     /locus_tag="Mesop_0275"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(301761..301772)
                     /locus_tag="Mesop_0275"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(301533..301562)
                     /locus_tag="Mesop_0275"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(301485..301502)
                     /locus_tag="Mesop_0275"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(301467..301478)
                     /locus_tag="Mesop_0275"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(301380..301400)
                     /locus_tag="Mesop_0275"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            complement(302288..303391)
                     /locus_tag="Mesop_0276"
                     /db_xref="GeneID:10824082"
     CDS             complement(302288..303391)
                     /locus_tag="Mesop_0276"
                     /note="COGs: COG2141 Coenzyme F420-dependent N5
                     N10-methylene tetrahydromethanopterin reductase;
                     InterPro IPR016048;
                     KEGG: mlo:mlr5218 sulfonate monooxygenase;
                     PFAM: Luciferase-like, subgroup;
                     SPTR: Luciferase-like monooxygenase;
                     PFAM: Luciferase-like monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="luciferase-like protein"
                     /protein_id="YP_004608865.1"
                     /db_xref="GI:337264810"
                     /db_xref="GeneID:10824082"
                     /translation="MAHADTDAIKFAYWVPNVSGGLVISNIEQRTNHSAEYNRKLAQI
                     AEKAGFDYALSQIRFTAGYGADEQHESVAFSHDLLAATTTLKVIAAILPGPWNPALAA
                     KQIATISYLTNGRVAINLVSGWFRGEFHAIGEHWLDHDERYRRSEEFIRALRGIWTED
                     SFTFRGDFYRFNEYSLKPKPPQPLPEIFQGGSSRAARDMASRVSDWYFTNGNTPAEIA
                     KQVEDLRTKAKANSHSVKVGVNAFAVVRETEDEAKAVLAEIIAKANPEAVNAFGHEVK
                     NAGKASPEGEGNWAKSSFDDLVQYNDGFRSNLIGTPRQVAERIVDLKRAGADLILLGF
                     LHFQEEVEYFGKHVIPLVRELEDAEQAASLAAE"
     misc_feature    complement(302618..303367)
                     /locus_tag="Mesop_0276"
                     /note="Alkanesulfonate monoxygenase is the monoxygenase of
                     a two-component system that catalyzes the conversion of
                     alkanesulfonates to the corresponding aldehyde and
                     sulfite. Alkanesulfonate monoxygenase (SsuD) has an
                     absolute requirement for reduced flavin...; Region:
                     Alkanesulfonate_monoxygenase; cd01094"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(302666..302668,302672..302674,
                     302768..302770,302810..302815,302966..302968,
                     303029..303031,303188..303190,303338..303340,
                     303350..303352))
                     /locus_tag="Mesop_0276"
                     /note="active site"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(302861..302866,302870..302878,
                     302882..302884,302999..303004,303011..303013,
                     303062..303064,303071..303073,303080..303085,
                     303092..303097,303101..303103,303152..303154,
                     303161..303166,303173..303175,303182..303190,
                     303194..303202))
                     /locus_tag="Mesop_0276"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(303119..303124)
                     /locus_tag="Mesop_0276"
                     /note="non-prolyl cis peptide bond; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(302618..302635,302654..302665,
                     302846..302878,302879..302884,302969..302977,
                     302999..303025))
                     /locus_tag="Mesop_0276"
                     /note="insertion regions; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(302333..>302761)
                     /locus_tag="Mesop_0276"
                     /note="probable oxidoreductase, LLM family; Region:
                     LLM_2I7G; TIGR03858"
                     /db_xref="CDD:234374"
     gene            complement(303556..305016)
                     /locus_tag="Mesop_0277"
                     /db_xref="GeneID:10824083"
     CDS             complement(303556..305016)
                     /locus_tag="Mesop_0277"
                     /note="COGs: COG4529 conserved hypothetical protein;
                     InterPro IPR006076;
                     KEGG: mlo:mlr5217 hypothetical protein;
                     PFAM: FAD dependent oxidoreductase;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Pyridine nucleotide-disulphide oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_004608866.1"
                     /db_xref="GI:337264811"
                     /db_xref="GeneID:10824083"
                     /translation="MNALPQSRRLRVAIIGGGFSGAAVAWHLAQLPWFERLSISVIEP
                     RPALGGGLAYSSAEPAHRVNVPAIRMSMAPDDPQHFARWLTGSGELERDTDAIWKNGD
                     AYPRRRVFGRYVAEHLAPWLGSGVVRHVQGLATRVTRDADGAGWSVHTSGGPVAADIV
                     VLAATHLPPGIPDALAALAEAPGFVADPYAASALAHIGREASVLIVGSGLSSADMVAE
                     LDRRGHRGRILALSRRGLRSRGHPDVRGEPFGDFASSPAATALGLLKTIRATLAAARA
                     ANVNWQSVFDQLRLQGPVLWAALAPRERARLVRQLRVFWDVHRFRIAPQVAAVLDRRQ
                     AAGTYETVAARLVASNHEDDGPAVSFQRRGRTRIETVRFDAIINTTGPAHGQALRLNP
                     ALRSLAEAGLIRADAYGLGIETSLDSRAIGRGDKAVATLFVAGPLARGTFGELMGLPE
                     VARHAQAVARETARLLDTVPSAETIGVDADSVAAAR"
     sig_peptide     complement(304942..305016)
                     /locus_tag="Mesop_0277"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(303598..304992)
                     /locus_tag="Mesop_0277"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4529"
                     /db_xref="CDD:226906"
     misc_feature    complement(304516..304980)
                     /locus_tag="Mesop_0277"
                     /note="FAD-NAD(P)-binding; Region: NAD_binding_9;
                     pfam13454"
                     /db_xref="CDD:257778"
     gene            complement(305013..306185)
                     /locus_tag="Mesop_0278"
                     /db_xref="GeneID:10824084"
     CDS             complement(305013..306185)
                     /locus_tag="Mesop_0278"
                     /EC_number="1.14.14.5"
                     /note="COGs: COG2141 Coenzyme F420-dependent N5
                     N10-methylene tetrahydromethanopterin reductase;
                     InterPro IPR019911;
                     KEGG: mlo:mlr5216 alkanesulfonate monooxygenase;
                     PRIAM: Alkanesulfonate monooxygenase;
                     SPTR: Alkanesulfonate monooxygenase;
                     TIGRFAM: alkanesulfonate monooxygenase, FMNH(2)-dependent;
                     PFAM: Luciferase-like monooxygenase;
                     TIGRFAM: alkanesulfonate monooxygenase, FMNH(2)-dependent"
                     /codon_start=1
                     /transl_table=11
                     /product="alkanesulfonate monooxygenase,
                     FMNH(2)-dependent"
                     /protein_id="YP_004608867.1"
                     /db_xref="GI:337264812"
                     /db_xref="GeneID:10824084"
                     /translation="MTIDVPDRIKVLWFLPTHGDSRYLGTTEGGRAVDLPYLTQVAKA
                     ADTLGYYGVLLPTGRACEDSWVIASALAPLTERLRFLVAVRPGLQSPTLAARMTATLD
                     RISNGRLLINVVTGGDPLENKGDGIFLSHAERYEVTQEFLRIYKRVLSGETVEHQGKH
                     FRIEDGRLLFPPVQTPYPPLYFGGSSDAGSVVAAQEIDKYLTWGEPPADVERKLDAVR
                     ELAEKAGRKLSFGIRLHVIARETTEQAWAAADSLISRLDDATIASAQKVFARMDSVGQ
                     ARMSALHGGSRDRLEIAPNLWAGVGLVRGGAGTALVGDPDTIAERIDEYRRLGIDTFI
                     LSGYPHLEEAYRFGELVLPKLPTDHPVKSAVSSVNTGPFGETIAGDHRPKSLASAS"
     misc_feature    complement(305436..306161)
                     /locus_tag="Mesop_0278"
                     /note="Alkanesulfonate monoxygenase is the monoxygenase of
                     a two-component system that catalyzes the conversion of
                     alkanesulfonates to the corresponding aldehyde and
                     sulfite. Alkanesulfonate monoxygenase (SsuD) has an
                     absolute requirement for reduced flavin...; Region:
                     Alkanesulfonate_monoxygenase; cd01094"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(305481..305483,305487..305489,
                     305583..305585,305625..305630,305784..305786,
                     305844..305846,306003..306005,306132..306134,
                     306144..306146))
                     /locus_tag="Mesop_0278"
                     /note="active site"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(305676..305681,305685..305696,
                     305700..305702,305814..305819,305826..305828,
                     305877..305879,305886..305888,305895..305900,
                     305907..305912,305916..305918,305967..305969,
                     305976..305981,305988..305990,305997..306014))
                     /locus_tag="Mesop_0278"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(305934..305939)
                     /locus_tag="Mesop_0278"
                     /note="non-prolyl cis peptide bond; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(order(305436..305450,305469..305480,
                     305661..305702,305787..305795,305814..305840))
                     /locus_tag="Mesop_0278"
                     /note="insertion regions; other site"
                     /db_xref="CDD:238527"
     misc_feature    complement(305154..>305672)
                     /locus_tag="Mesop_0278"
                     /note="Flavin-utilizing monoxygenases; Region:
                     Flavin_utilizing_monoxygenases; cl19096"
                     /db_xref="CDD:267449"
     gene            complement(306441..307346)
                     /locus_tag="Mesop_0279"
                     /db_xref="GeneID:10824085"
     CDS             complement(306441..307346)
                     /locus_tag="Mesop_0279"
                     /note="COGs: COG0329 Dihydrodipicolinate
                     synthase/N-acetylneuraminate lyase;
                     InterPro IPR002220;
                     KEGG: vei:Veis_3541 dihydrodipicolinate synthetase;
                     PFAM: dihydrodipicolinate synthetase;
                     SPTR: Dihydrodipicolinate synthetase;
                     PFAM: Dihydrodipicolinate synthetase family"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="YP_004608868.1"
                     /db_xref="GI:337264813"
                     /db_xref="GeneID:10824085"
                     /translation="MANFQPDDLHGIHAILYALFDENERLDRAAMRSQVEICLATGVH
                     GMAALGLATEVAKLTEAERRTVMDWTAQDTAGKVPLAFTILGASMAEQISQVRHAESV
                     GADWVILQPPPGGSYGALEYIRFFGRVAEATDLPVAIQNAPAFFGRGLTSDEIRDLVT
                     LHPNIRLIKGEGPVTDIAGLIERTEGRIPVFNGRGGLELIDNFRIGCRGMILAPDCVD
                     YAVRAWKAFRAGNEAIAEAEYAKMLPAAVFVMQGIENLICYGKRLFGARTGIPIHDRA
                     PAMRPNETGLAIVERFAAGLGRLPG"
     misc_feature    complement(306471..307313)
                     /locus_tag="Mesop_0279"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(306840..306842,306927..306929,
                     307191..307199,307206..307208,307302..307304))
                     /locus_tag="Mesop_0279"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(306714..306716,306840..306842,
                     306927..306929,307191..307199,307206..307208))
                     /locus_tag="Mesop_0279"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(306516..306521,306972..306974,
                     306984..306986,307005..307010,307080..307085,
                     307176..307181,307194..307196))
                     /locus_tag="Mesop_0279"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    complement(306840..306842)
                     /locus_tag="Mesop_0279"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            complement(307358..309070)
                     /locus_tag="Mesop_0280"
                     /db_xref="GeneID:10824086"
     CDS             complement(307358..309070)
                     /locus_tag="Mesop_0280"
                     /EC_number="4.2.1.9"
                     /note="COGs: COG0129 Dihydroxyacid
                     dehydratase/phosphogluconate dehydratase;
                     InterPro IPR000581;
                     KEGG: vei:Veis_3540 dihydroxy-acid dehydratase;
                     PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase;
                     PRIAM: Dihydroxy-acid dehydratase;
                     SPTR: Dihydroxy-acid dehydratase;
                     PFAM: Dehydratase family;
                     TIGRFAM: dihydroxy-acid dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="YP_004608869.1"
                     /db_xref="GI:337264814"
                     /db_xref="GeneID:10824086"
                     /translation="MTKRRSQHWFGGNGKDAFIHRSWMKNNGLPDDAFDGRPVIGICN
                     TFSEFTPCHVHFRGLIEHIKAGVLEAGGLPLEFPVFSCGESNLRPTAMLFRNLASMDV
                     EEAIRGNPMDGVVLMAGCDKTTPSLVMGAASCDLPSIVISGGPMLNGRFQGREIGSGT
                     DVWKFSEDVRAGVMSEQDFANAESAMSRSPGHCMTMGTASTMASMVEALGLALPGNAA
                     YPAVDARRSRIARMTGRRIVEMVNEDLRPSAILTRQAFANAIRVNGAIGGSTNAVVHL
                     LAIAGRVGAELTLDDWDAFGRDVPTILDLMPSGRFLMEDFCYAGGIPAVMKEIADMLD
                     LDALTVTGRRLRDNIADAQNYNPEVIRPRDKALTRHGGIAVLRGNLAPDGAIIKPSAA
                     SPALMKHRGRAVVFEDIDDYKARVDDPALDIDESSIMVLRNCGPKGYPGMAEVGNMAL
                     PQKLLKQGVRDMIRISDARMSGTAFGTVVLHAAPEAAVGGPLALVRSGDIIELDVEAR
                     RLHLDVSEQELARRRIGWAPPEPAMRGGYQGLYVDHVLQADRGADLDFLVGSRGHAIP
                     RESH"
     misc_feature    complement(307361..309064)
                     /locus_tag="Mesop_0280"
                     /note="dihydroxy-acid dehydratase; Validated; Region:
                     PRK06131"
                     /db_xref="CDD:235708"
     gene            complement(309087..309866)
                     /locus_tag="Mesop_0281"
                     /db_xref="GeneID:10824087"
     CDS             complement(309087..309866)
                     /locus_tag="Mesop_0281"
                     /note="COGs: COG1028 Dehydrogenase with different
                     specificities (related to short-chain alcohol
                     dehydrogenase);
                     InterPro IPR002198:IPR002347;
                     KEGG: rec:RHECIAT_CH0003965 short chain dehydrogenase;
                     PFAM: short-chain dehydrogenase/reductase SDR;
                     SPTR: Short-chain dehydrogenase/reductase SDR;
                     PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004608870.1"
                     /db_xref="GI:337264815"
                     /db_xref="GeneID:10824087"
                     /translation="MAERLSGKRIFLTGAAQGIGLAIAEACLAEGARLFLVDRDGALL
                     DRSVAGLAASQGHVGHQAADISDGAAIAAAVGQAGDEIGPINALINNAGMNVFSTPLD
                     ATEEEWNRNFDVNVKGAWNCSKAVLPGMIASGGGAILNVASTHSFTIIPHTFPYPVAK
                     HALLGLTKSLALEYAAQGVRVNALAPGYVETRKAIDYWNSFADPVAARAKTLALHPGG
                     RIASVREIALAAVFMISDECPFMNAATLVVDGGLSQLQHPA"
     misc_feature    complement(309093..309866)
                     /locus_tag="Mesop_0281"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK07063"
                     /db_xref="CDD:235924"
     misc_feature    complement(309120..309839)
                     /locus_tag="Mesop_0281"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(309291..309296,309300..309311,
                     309387..309389,309399..309401,309438..309446,
                     309525..309527,309588..309596,309672..309677,
                     309681..309683,309747..309755,309810..309821,
                     309825..309827))
                     /locus_tag="Mesop_0281"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(309387..309389,309399..309401,
                     309438..309440,309522..309524))
                     /locus_tag="Mesop_0281"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(309892..310842)
                     /locus_tag="Mesop_0282"
                     /db_xref="GeneID:10824088"
     CDS             complement(309892..310842)
                     /locus_tag="Mesop_0282"
                     /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
                     ABC-type transport systems permease components;
                     InterPro IPR001851;
                     KEGG: rlt:Rleg2_3475 L-arabinose transporter permease
                     protein;
                     PFAM: inner-membrane translocator;
                     SPTR: Monosaccharide-transporting ATPase;
                     PFAM: Branched-chain amino acid transport system /
                     permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_004608871.1"
                     /db_xref="GI:337264816"
                     /db_xref="GeneID:10824088"
                     /translation="MTGQLKKILLGEQGLVVIFVVAFALVSVLVPNFLTDRNMLGLLQ
                     SVVTVGIVACTMMFCLAARDFDLSVGSIVAFAGMVAVMASNYTGSILLGLLAAIACGA
                     FVGFINGVVIAKFRINALITTLATMQIVRGLALIASDGRAVGINSPDFYQLALSKLLG
                     IPTPIWVLAVLFGIFGFVLNRTVFGKNTLAIGGNPEASRLAGVNVDRTRIWIFALQGV
                     VCGIAGILLASRITSGQPNAAVGLELSVISACVLGGVSLAGGRATMSGVIVGVLIMGI
                     AENAMNLLNIPAFYQYIVRGVILLLAVLLDNLRSSALGRR"
     misc_feature    complement(309949..310707)
                     /locus_tag="Mesop_0282"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    complement(310201..310257)
                     /locus_tag="Mesop_0282"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(310854..312365)
                     /locus_tag="Mesop_0283"
                     /db_xref="GeneID:10824089"
     CDS             complement(310854..312365)
                     /locus_tag="Mesop_0283"
                     /note="COGs: COG1129 ABC-type sugar transport system
                     ATPase component;
                     InterPro IPR017871:IPR003439:IPR003593:IPR017917;
                     KEGG: smd:Smed_3601 L-arabinose transporter ATP-binding
                     protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608872.1"
                     /db_xref="GI:337264817"
                     /db_xref="GeneID:10824089"
                     /translation="MSFLDFSRITKTYPGVKALSDVSFGVDKGAVHGLMGENGAGKST
                     LIKILSGDQHADEGEISIDGKAQAYASTRDAFDNGVIVIHQELQLVPELTVAENLSLG
                     RFPASAGIIAGRKMLDDVGAKLKSAGIDIDMRRKVKTLSIGERQMVEIAKAIMLDARV
                     IALDEPTSSLSSRESEILFALIDRLRGEGKVIIYVSHRLDEVFRLCDSLTVLRDGKLA
                     AHHASLKGVTRDQVVAEMVGREISDIWGFRPRGSGDVRLEVEGISGAKLKTPASFEAR
                     AGEIVGFFGLIGAGRSELMRLVFGADPRSSGTISVDGKLVHATDPHGSIRAGIVLCSE
                     DRKHDGIIQGRSIEENINISSRRHHTRFGVLDRASEIATAETFIKKLKVRTPSRRQDI
                     INLSGGNQQKVILGRWLSEQGVRVLIVDEPTRGIDVGAKSEIYELLYQLAEDGMAIVV
                     ISSELPEVMGICDRILVMCGGRISAVLTRDQFAEKAILAAALPDQKTPDAIAS"
     misc_feature    complement(310866..312365)
                     /locus_tag="Mesop_0283"
                     /note="L-arabinose transporter ATP-binding protein;
                     Provisional; Region: araG; PRK11288"
                     /db_xref="CDD:183077"
     misc_feature    complement(311706..312356)
                     /locus_tag="Mesop_0283"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    complement(312237..312260)
                     /locus_tag="Mesop_0283"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(order(311775..311777,311871..311876,
                     312111..312113,312234..312242,312246..312251))
                     /locus_tag="Mesop_0283"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(312111..312122)
                     /locus_tag="Mesop_0283"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(311919..311948)
                     /locus_tag="Mesop_0283"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(311871..311888)
                     /locus_tag="Mesop_0283"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(311853..311864)
                     /locus_tag="Mesop_0283"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(311769..311789)
                     /locus_tag="Mesop_0283"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(310947..311609)
                     /locus_tag="Mesop_0283"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            complement(312436..313425)
                     /locus_tag="Mesop_0284"
                     /db_xref="GeneID:10824090"
     CDS             complement(312436..313425)
                     /locus_tag="Mesop_0284"
                     /note="COGs: COG1879 ABC-type sugar transport system
                     periplasmic component;
                     InterPro IPR001761;
                     KEGG: rec:RHECIAT_CH0003969 probable sugar ABC
                     transporter, substrate-binding protein;
                     PFAM: periplasmic binding protein/LacI transcriptional
                     regulator;
                     SPTR: Monosaccharide-transporting ATPase;
                     PFAM: family"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein/LacI transcriptional
                     regulator"
                     /protein_id="YP_004608873.1"
                     /db_xref="GI:337264818"
                     /db_xref="GeneID:10824090"
                     /translation="MRLLKTALVAGALAVLSVTTIAAYAQDTKIGFIVKQPEEPWFQD
                     EWKFADQAAKEKGFTLVKIGAEDGEKLMSAIDNLGAQGAQGFIVCTPDVKLGPGIVAK
                     AAANNLKLMTVDDRLVGADGKALEDVPHMGISATKIGEAVGQAIVDEMKARGWKADEV
                     GAIRVSYDQLPTAVDRVEGAISVLKANGFKAENIFDAPQAKTDTEAALNAATVVLNAH
                     ADIKKWVSFGLNDEAVLGAVRASESVGIPADGMIGVGIGGADSAINEFKKPTATGFVG
                     TVIISPKRHGYETALNMYDWVANNKEPEKLILTSGALAKRDDYQKVRQGLGIE"
     misc_feature    complement(312460..313425)
                     /locus_tag="Mesop_0284"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     RbsB; COG1879"
                     /db_xref="CDD:224791"
     sig_peptide     complement(313351..313425)
                     /locus_tag="Mesop_0284"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(312472..313341)
                     /locus_tag="Mesop_0284"
                     /note="Periplasmic L-arabinose-binding protein (ABP), a
                     member of a family of pentose/hexose sugar-binding
                     proteins of the type I periplasmic binding protein
                     superfamily; Region: PBP1_arabinose_binding; cd01540"
                     /db_xref="CDD:107253"
     misc_feature    complement(order(312655..312657,312736..312741,
                     312898..312900,313084..313086))
                     /locus_tag="Mesop_0284"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107253"
     gene            313626..314372
                     /locus_tag="Mesop_0285"
                     /db_xref="GeneID:10824091"
     CDS             313626..314372
                     /locus_tag="Mesop_0285"
                     /note="COGs: COG2186 Transcriptional regulators;
                     InterPro IPR000524:IPR011711;
                     KEGG: smd:Smed_3599 GntR domain-containing protein;
                     PFAM: GntR domain protein; regulatory protein GntR HTH;
                     SMART: regulatory protein GntR HTH;
                     SPTR: GntR domain protein;
                     PFAM: Bacterial regulatory proteins, gntR family; FCD
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_004608874.1"
                     /db_xref="GI:337264819"
                     /db_xref="GeneID:10824091"
                     /translation="MTDILKKTPGDTATRRPRVMPDVTKAIASDIFSGRYPAGSSLPT
                     ENELGVEYGVSRTVIREALKVLAAKGLVLSRPRVGTVVCTEDDWNIIDPQVLAWHAPH
                     ALHDKLFDAILETRRAIEPLVAELAAARATLQEIANLEAAWRGMAGAGEDLGTFSRSD
                     IAFHQILYAASHNPIFRQIGNLIDTGLKFSLEATATISLDRRMEAVAAHREVVEALRM
                     RDAEAARSAANRILDLAARDLVSAKKLKNN"
     misc_feature    313659..314351
                     /locus_tag="Mesop_0285"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    313692..313874
                     /locus_tag="Mesop_0285"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(313752..313754,313758..313763,313785..313799,
                     313803..313808,313815..313817,313845..313850,
                     313854..313865)
                     /locus_tag="Mesop_0285"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    313959..314324
                     /locus_tag="Mesop_0285"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            314380..315528
                     /locus_tag="Mesop_0286"
                     /db_xref="GeneID:10824092"
     CDS             314380..315528
                     /locus_tag="Mesop_0286"
                     /note="COGs: COG4948 L-alanine-DL-glutamate epimerase;
                     InterPro IPR018110:IPR013341:IPR013342;
                     KEGG: sme:SM_b20510 galactonate dehydratase;
                     PFAM: Mandelate racemase/muconate lactonizing protein;
                     SPTR: Mandelate racemase/muconate lactonizing protein;
                     PFAM: Mandelate racemase / muconate lactonizing enzyme,
                     C-terminal domain; Mandelate racemase / muconate
                     lactonizing enzyme, N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase/muconate lactonizing protein"
                     /protein_id="YP_004608875.1"
                     /db_xref="GI:337264820"
                     /db_xref="GeneID:10824092"
                     /translation="MKIISLTTYIVPPRWLFLKIETDAGVTGWGEPVVEGRALTVEAA
                     VKELGDYLIGKDPRLIEDHWTVMHRGGFYRGGPILMSAIAGIDQALWDIKGKALGVPV
                     HELLGGKLRDTIKVYSWIGGDRPAEVAAGAKEVVARGFLALKMNGTEELQIVDSHDKI
                     DAAVERVAMVREAVGPNIGIAVDFHGRVHRPMARILVKELEPYRLMFIEEPVLSENRE
                     ALKEIAALGSTPIALGERLYSRWDFKSVFEQGVVDIIQPDLSHAGGITECRKIAAMAE
                     AYDVAVAPHCPLGPIALAACLQLDAVSYNCFIQEQSLGIHYNAGNDLLDYAANKDVFR
                     YEDGYVAIPDGPGLGVEIDEDYVKERAKEGHRWRNPIWRHKDGSFAEW"
     misc_feature    314380..315525
                     /locus_tag="Mesop_0286"
                     /note="galactonate dehydratase; Provisional; Region:
                     PRK14017"
                     /db_xref="CDD:184455"
     misc_feature    314383..315438
                     /locus_tag="Mesop_0286"
                     /note="D-galactonate dehydratase catalyses the dehydration
                     of galactonate to 2-keto-3-deoxygalactnate (KDGal), as
                     part of the D-galactonate nonphosphorolytic catabolic
                     Entner-Doudoroff pathway. D-galactonate dehydratase
                     belongs to the enolase superfamily of...; Region:
                     D-galactonate_dehydratase; cd03325"
                     /db_xref="CDD:239441"
     misc_feature    order(314728..314730,314809..314811,314815..314817,
                     314926..314928,314998..315000,315004..315006,
                     315082..315084,315151..315153,315232..315234,
                     315307..315309)
                     /locus_tag="Mesop_0286"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:239441"
     misc_feature    order(314926..314928,315004..315006,315082..315084)
                     /locus_tag="Mesop_0286"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239441"
     gene            315649..316371
                     /locus_tag="Mesop_0287"
                     /db_xref="GeneID:10824093"
     CDS             315649..316371
                     /locus_tag="Mesop_0287"
                     /note="COGs: COG0664 cAMP-binding protein - catabolite
                     gene activator and regulatory subunit of cAMP-dependent
                     protein kinase;
                     InterPro IPR000524:IPR012318;
                     KEGG: rec:RHECIAT_PC0000048 hypothetical protein;
                     PFAM: regulatory protein GntR HTH;
                     SPTR: Putative transcriptional regulator, Crp/Fnr family;
                     PFAM: Bacterial regulatory proteins, gntR family"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Crp/Fnr family transcriptional
                     regulator"
                     /protein_id="YP_004608876.1"
                     /db_xref="GI:337264821"
                     /db_xref="GeneID:10824093"
                     /translation="MPVWERALPQSLFRNQVLKALSSQDFALLRPSLHHVELDIKDQL
                     EVAHQPIKDVYFPERGIASVVATMTGGRQSEVGIIGYDGMTGIAVILGQESTATETYI
                     QVAGNGWRLPVETLRSAIAESPSLRASLLDYAHAFLVQSSRTALVNGHSKIEERLARW
                     LLMVHDRAEGDKIYLTHEFLATMLGAHRPGVTTALQMLEYRGLVHAKRGEITIVDRAG
                     LIKLTHGAYGEEEQRYFGLAAA"
     misc_feature    315682..316296
                     /locus_tag="Mesop_0287"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    315697..316041
                     /locus_tag="Mesop_0287"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    order(315904..315906,315931..315939)
                     /locus_tag="Mesop_0287"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    order(316000..316008,316018..316026)
                     /locus_tag="Mesop_0287"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    316111..316314
                     /locus_tag="Mesop_0287"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     gene            316547..316786
                     /locus_tag="Mesop_0288"
                     /db_xref="GeneID:10824094"
     CDS             316547..316786
                     /locus_tag="Mesop_0288"
                     /note="KEGG: mlo:mlr0694 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608877.1"
                     /db_xref="GI:337264822"
                     /db_xref="GeneID:10824094"
                     /translation="MTNSFRTITVEKAAEAYVLSRGRARFLSIAQAIRAIRTLMPACK
                     ATDRELEELVAAASFVHGVPVAFDARTAKAPRLHS"
     gene            316795..317058
                     /locus_tag="Mesop_0289"
                     /db_xref="GeneID:10824095"
     CDS             316795..317058
                     /locus_tag="Mesop_0289"
                     /note="KEGG: smd:Smed_5306 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608878.1"
                     /db_xref="GI:337264823"
                     /db_xref="GeneID:10824095"
                     /translation="MSAPVETPTLSDVRLAIVRHLIDNVESTSISISEVNRAVRRMFP
                     LCELTDWELDDLIARSAIGAGFAIDFDAGGSWPYRKPIGKSAA"
     gene            complement(317067..317142)
                     /locus_tag="Mesop_R0003"
                     /db_xref="GeneID:10824096"
     tRNA            complement(317067..317142)
                     /locus_tag="Mesop_R0003"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:10824096"
     gene            complement(317316..317702)
                     /locus_tag="Mesop_0290"
                     /db_xref="GeneID:10824097"
     CDS             complement(317316..317702)
                     /locus_tag="Mesop_0290"
                     /note="COGs: COG4530 conserved hypothetical protein;
                     InterPro IPR012644;
                     KEGG: mlo:mlr5215 hypothetical protein;
                     PFAM: conserved hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (FYDLN_acid);
                     TIGRFAM: conserved hypothetical protein TIGR02300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608879.1"
                     /db_xref="GI:337264824"
                     /db_xref="GeneID:10824097"
                     /translation="MAKNELGTKRIDPETGRKFYDLNKDPIVSPYTGKTYPRSYFEEG
                     KIAALEEEEEVAEKEVDAEDEEGVEVVSLEEADEDAKGDDLPDLGDDEDVDLGDDEDD
                     TFLADEEEEDDDVADMIGVGDDDDEV"
     misc_feature    complement(317319..317702)
                     /locus_tag="Mesop_0290"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4530"
                     /db_xref="CDD:226907"
     gene            317909..319267
                     /locus_tag="Mesop_0291"
                     /db_xref="GeneID:10824098"
     CDS             317909..319267
                     /locus_tag="Mesop_0291"
                     /EC_number="2.5.1.19"
                     /note="COGs: COG0128 5-enolpyruvylshikimate-3-phosphate
                     synthase;
                     InterPro IPR016228:IPR001986:IPR006264;
                     KEGG: mlo:mll5213 3-phosphoshikimate
                     1-carboxyvinyltransferase;
                     PFAM: EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase);
                     PRIAM: 3-phosphoshikimate 1-carboxyvinyltransferase;
                     SPTR: 3-phosphoshikimate 1-carboxyvinyltransferase;
                     TIGRFAM: 3-phosphoshikimate 1-carboxyvinyltransferase;
                     PFAM: EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase);
                     TIGRFAM: 3-phosphoshikimate 1-carboxyvinyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="YP_004608880.1"
                     /db_xref="GI:337264825"
                     /db_xref="GeneID:10824098"
                     /translation="MSHAAAAKPATARKSSALSGTARVPGDKSISHRSFMFGGLASGE
                     TRITGLLEGEDVMRTGAAMKAMGAHIEKRGTEWVIRGTGNGALLQPEGPLDFGNAGTG
                     SRLTMGLVGTYDMETTFIGDASLSGRPMGRVLEPLRQMGVQVLKATPGDRMPITLHGP
                     KHAAPITYRVPMASAQVKSAVLLAGLNTPGITTVIEPVMTRDHTEKMLKGFGANLSVE
                     TDERGVRHIFIEGQGKLHGQTIAVPGDPSSAGFPLVAALIVPGSDITIENVLMNPTRT
                     GLLLTLQEMGGNIEILNPRNAGGEDVADLRVRYSELKGVTVPPERAPSMIDEYPVLAV
                     AASFAEGETLMQGLEELRVKESDRLSAVANGLKLNGVDCTEGEASLAVRGKPGGKGLG
                     GHPNGLDTTVQTHLDHRIAMSFLVMGLATEKPVTIDDQAMISTSFPEFMGLMKGLGAE
                     IG"
     misc_feature    317945..319261
                     /locus_tag="Mesop_0291"
                     /note="3-phosphoshikimate 1-carboxyvinyltransferase;
                     Provisional; Region: PRK02427"
                     /db_xref="CDD:235037"
     misc_feature    317960..319249
                     /locus_tag="Mesop_0291"
                     /note="EPSP synthase domain. 3-phosphoshikimate
                     1-carboxyvinyltransferase
                     (5-enolpyruvylshikimate-3-phosphate synthase) (EC
                     2.5.1.19) catalyses the reaction between
                     shikimate-3-phosphate (S3P) and phosphoenolpyruvate (PEP)
                     to form...; Region: EPSP_synthase; cd01556"
                     /db_xref="CDD:238797"
     misc_feature    order(317978..317989,318632..318643)
                     /locus_tag="Mesop_0291"
                     /note="hinge; other site"
                     /db_xref="CDD:238797"
     misc_feature    order(317990..317995,318005..318007,318200..318202,
                     318206..318211,318290..318292,318428..318436,
                     318497..318499,318506..318508,318887..318889,
                     318956..318958,318968..318973,318980..318982,
                     319130..319135,319211..319213)
                     /locus_tag="Mesop_0291"
                     /note="active site"
                     /db_xref="CDD:238797"
     gene            319378..320028
                     /locus_tag="Mesop_0292"
                     /db_xref="GeneID:10824099"
     CDS             319378..320028
                     /locus_tag="Mesop_0292"
                     /EC_number="2.7.4.14"
                     /note="COGs: COG0283 Cytidylate kinase;
                     InterPro IPR011994:IPR003136;
                     KEGG: mlo:mll5212 cytidylate kinase;
                     PFAM: cytidylate kinase region;
                     PRIAM: Cytidylate kinase;
                     SPTR: Cytidylate kinase;
                     TIGRFAM: cytidylate kinase;
                     PFAM: Cytidylate kinase;
                     TIGRFAM: cytidylate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidylate kinase"
                     /protein_id="YP_004608881.1"
                     /db_xref="GI:337264826"
                     /db_xref="GeneID:10824099"
                     /translation="MTHVFTIAIDGPAGAGKGTLARRLADHYRLNLLDTGLTYRAVAH
                     ALLRLGLPLDNVSAAETAARQVDLATLDRAVLSAHAVGEAASKVAVYPTVRRILVEKQ
                     REFAKTPPGAVLDGRDIGTVVCPDADIKLYVTASAEVRARRRLAEIESIGGTADFAEI
                     LADIERRDERDMGRADSPLKPAADAHLLDTSEMAIEAAFLAAMTVIDDVLAKRNKA"
     misc_feature    319378..320013
                     /locus_tag="Mesop_0292"
                     /note="cytidylate kinase; Provisional; Region: cmk;
                     PRK00023"
                     /db_xref="CDD:234579"
     misc_feature    319396..319950
                     /locus_tag="Mesop_0292"
                     /note="Cytidine monophosphate kinase (CMPK) catalyzes the
                     reversible phosphorylation of cytidine monophosphate (CMP)
                     to produce cytidine diphosphate (CDP), using ATP as the
                     preferred phosphoryl donor; Region: CMPK; cd02020"
                     /db_xref="CDD:238978"
     misc_feature    order(319660..319662,319726..319731,319897..319899)
                     /locus_tag="Mesop_0292"
                     /note="CMP-binding site; other site"
                     /db_xref="CDD:238978"
     misc_feature    order(319876..319878,319888..319890)
                     /locus_tag="Mesop_0292"
                     /note="The sites determining sugar specificity; other
                     site"
                     /db_xref="CDD:238978"
     gene            320234..321931
                     /locus_tag="Mesop_0293"
                     /db_xref="GeneID:10824100"
     CDS             320234..321931
                     /locus_tag="Mesop_0293"
                     /note="COGs: COG0539 Ribosomal protein S1;
                     InterPro IPR003029:IPR000110:IPR018032;
                     KEGG: mlo:mll5210 30S ribosomal protein S1;
                     PFAM: RNA binding S1 domain protein;
                     SPTR: Ribosomal protein S1;
                     TIGRFAM: ribosomal protein S1;
                     PFAM: S1 RNA binding domain;
                     TIGRFAM: ribosomal protein S1"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="YP_004608882.1"
                     /db_xref="GI:337264827"
                     /db_xref="GeneID:10824100"
                     /translation="MSAANPTRDDFASLLEESFTAGHSGEGQVVKGTITAIEKDMAII
                     DVGLKVEGRVPLKEFGVKGKDTTLKVGDTVEVYVERIENALGEAMLSREKARREESWV
                     RLEEKFTKGERVEGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVSPLMHNPQPF
                     EILKMDRRRGNIVVSRRTVLEESRAEQRSEIVQNLEEGQVVEGVVKNITDYGAFVDLG
                     GIDGLLHVTDMAWRRVNHPTEILNIGQTVKVQIIRINQETHRISLGMKQLESDPWSEI
                     GTKFPIGKKIKGTVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNVHPGKILSTTQEV
                     DVVVLEVDPAKRRISLGLKQTLENPWQAFASSHPVGSQVEGEVKNKTEFGLFIGLEGD
                     VDGMVHLSDLDWTRPGEQVIEEYNRGDMVKAQVLDVDIDKERISLGIKQLAKDTVGEA
                     ANSGELRKNAVVTCEVIGVKDGGLEVRLVESGIETFIKRSDLSRDRDEQRPERFTVGQ
                     KVDARVIAFDKKTRKLQVSIKALEIAEEKEAVAQYGSTDSGASLGDILGAALKKQGN"
     misc_feature    320234..321922
                     /locus_tag="Mesop_0293"
                     /note="30S ribosomal protein S1; Reviewed; Region: rpsA;
                     PRK06299"
                     /db_xref="CDD:235775"
     misc_feature    320312..320512
                     /locus_tag="Mesop_0293"
                     /note="S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture...; Region: S1_RPS1_repeat_ec1_hs1;
                     cd05687"
                     /db_xref="CDD:240192"
     misc_feature    order(320336..320338,320360..320362,320390..320392,
                     320396..320398)
                     /locus_tag="Mesop_0293"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240192"
     misc_feature    320564..320764
                     /locus_tag="Mesop_0293"
                     /note="S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture...; Region: S1_RPS1_repeat_ec2_hs2;
                     cd04465"
                     /db_xref="CDD:239911"
     misc_feature    order(320588..320590,320612..320614,320639..320641,
                     320645..320647)
                     /locus_tag="Mesop_0293"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239911"
     misc_feature    320822..321025
                     /locus_tag="Mesop_0293"
                     /note="S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture consists...; Region:
                     S1_RPS1_repeat_ec3; cd05688"
                     /db_xref="CDD:240193"
     misc_feature    order(320849..320851,320873..320875,320900..320902,
                     320906..320908)
                     /locus_tag="Mesop_0293"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240193"
     misc_feature    321071..321286
                     /locus_tag="Mesop_0293"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    order(321104..321106,321128..321130,321158..321160,
                     321164..321166)
                     /locus_tag="Mesop_0293"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    321341..321547
                     /locus_tag="Mesop_0293"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    order(321365..321367,321389..321391,321419..321421,
                     321425..321427)
                     /locus_tag="Mesop_0293"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    321608..321829
                     /locus_tag="Mesop_0293"
                     /note="S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture consists...; Region:
                     S1_RPS1_repeat_ec6; cd05691"
                     /db_xref="CDD:240196"
     misc_feature    order(321632..321634,321656..321658,321689..321691,
                     321695..321697)
                     /locus_tag="Mesop_0293"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240196"
     gene            322065..323933
                     /locus_tag="Mesop_0294"
                     /db_xref="GeneID:10824101"
     CDS             322065..323933
                     /locus_tag="Mesop_0294"
                     /note="KEGG: mlo:mll5209 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608883.1"
                     /db_xref="GI:337264828"
                     /db_xref="GeneID:10824101"
                     /translation="MSNGANNAAARPSWLLRLYTNAPVLFCFCAMAILMTALWCLGFR
                     LNNDADDLLKLHEIRTLLETGNIFDRTLPGIVQPEPYVSHWPWIVDLPYAAFARLVTP
                     FAGFEPALMLASFAVPLLLLAPALYFYNRLVIATGFAYPAVAFPLALIFAARTFFEFA
                     PGRIDYHNLQILLLLAALVLMMSRNRFSAFVNGLLTALSIAVSAEFAPFYALVIAVYA
                     FDWIFDREGGESRIVGFGIALAAGAIGLFAAIVPPSAYTAVRCDTYSTPHVTALVAAG
                     LSFAVVPSLAGRRGGWAMRTAILLVFAAASAAALAKLFPQCLASPYASLDAYVRDNMI
                     NRILQEMSLFRRPDVVLSTGFPSMALLFIGALAPAVICAGRHGRSRPLVILALFSLLA
                     LVLAVGYVRYYRYLPIFAGIGLVFVLASLLSPDARLGRYLKSPVPAASRRYTLILPGL
                     VLSVAMALYNLSVKPSEAAVPAGELADNCYSSPFEPEQGWPAGAIVLSPPLVGSRFVA
                     LADGPKVVTIANHPSAKGIERSYRFLDPATADPRAILDATKATHVAICAWRGPPLPAL
                     EAAYPFAAGLIEGRPPAWLRECPTAASSPLRIYSYRNADGTDAVCPASTLAIQARP"
     misc_feature    <322683..>323534
                     /locus_tag="Mesop_0294"
                     /note="oligosaccharyl transferase, archaeosortase A
                     system-associated; Region: archaeo_STT3; TIGR04154"
                     /db_xref="CDD:234485"
     gene            complement(323918..324625)
                     /locus_tag="Mesop_0295"
                     /db_xref="GeneID:10824102"
     CDS             complement(323918..324625)
                     /locus_tag="Mesop_0295"
                     /note="COGs: COG1028 Dehydrogenase with different
                     specificities (related to short-chain alcohol
                     dehydrogenase);
                     InterPro IPR002198:IPR002347;
                     KEGG: mlo:mlr5208 short-chain dehydrogenase/reductase
                     family protein;
                     PFAM: short-chain dehydrogenase/reductase SDR;
                     SPTR: Short-chain dehydrogenase/reductase SDR;
                     PFAM: short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_004608884.1"
                     /db_xref="GI:337264829"
                     /db_xref="GeneID:10824102"
                     /translation="MTETLKGRHIVVTGGTGALGGAVVGRLLEQGAICHVPNAHAAAP
                     QHFPFAAHENVKLAHNVDLSDSAKVEAFYAQVPALWGSVHLAGGFAAAPVEKIESASF
                     AEMMDTNARTTFLCSRAAIRSMLESGTAGRIVNVTARAGLDLRRGAGMVAYAASKAAV
                     AAMTVAMAEELKAEGILVNAVAPSTLDTPANRADMPDADFTRWVSLEAAAEAIAYLAS
                     PANQAMSGTLVPLYGRA"
     misc_feature    complement(323921..324625)
                     /locus_tag="Mesop_0295"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK12828"
                     /db_xref="CDD:237220"
     misc_feature    complement(323927..324469)
                     /locus_tag="Mesop_0295"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(324068..324079,324155..324157,
                     324167..324169,324212..324220,324365..324373))
                     /locus_tag="Mesop_0295"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(324155..324157,324167..324169,
                     324212..324214,324299..324301))
                     /locus_tag="Mesop_0295"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(324863..326443)
                     /locus_tag="Mesop_0296"
                     /db_xref="GeneID:10824103"
     CDS             complement(324863..326443)
                     /locus_tag="Mesop_0296"
                     /note="COGs: COG0028 Thiamine pyrophosphate-requiring
                     protein;
                     InterPro IPR000399:IPR012001:IPR012000:IPR011766;
                     KEGG: mlo:mlr5207 hypothetical protein;
                     PFAM: thiamine pyrophosphate protein TPP binding domain
                     protein; thiamine pyrophosphate protein central region;
                     thiamine pyrophosphate protein domain protein TPP-binding;
                     SPTR: Thiamine pyrophosphate protein TPP binding domain
                     protein;
                     PFAM: Thiamine pyrophosphate enzyme, central domain;
                     Thiamine pyrophosphate enzyme, N-terminal TPP binding
                     domain; Thiamine pyrophosphate enzyme, C-terminal TPP
                     binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate protein TPP binding
                     domain-containing protein"
                     /protein_id="YP_004608885.1"
                     /db_xref="GI:337264830"
                     /db_xref="GeneID:10824103"
                     /translation="MTTLGEALITLLEAHGVDTVFGIPGVHTVELYRGLARSKIRHVT
                     PRHEQGAGFMADGYARASGRPGVAFVITGPGLTNTITAMGQARADSVPMLVISGVNAM
                     PTLGKGLGFLHELPDQRGMMETVALFSQRITEADELPGALARAFALFSSSRPGPVHIE
                     IPTDVMVKPADGIAALLSNVAPPAPDGAAIADAAKLIAAARRPLILAGGGAKRADMAL
                     RRLAETMGAPVVETTNARGLLHRHPLCVPASPSLKAVRALMADADLVIAAGTEFGPTD
                     YDGYGDGGFVLPSNLIRIDIGADQLARRPMTVAIQADCTEAIEALLAAIGAAHPAAPD
                     GQVRAAAAREAGFAELSPAYVAQVHAVEMIRDTLPGAIIVGDSTQPIYAANLYYDHDR
                     PGGWFNASTGFGALGYGPPAAIGAALAMPDAPVVCLTGDGGFQFTLPELGAALDAAAP
                     VIFVVWNNRGYREIETSMLDVGVEPVGVSPAPPDFCKLAEAYGIGAERLADIGALPRA
                     LKRARATGLPCVIEITID"
     misc_feature    complement(324875..326443)
                     /locus_tag="Mesop_0296"
                     /note="hypothetical protein; Provisional; Region:
                     PRK07524"
                     /db_xref="CDD:236041"
     misc_feature    complement(325958..326428)
                     /locus_tag="Mesop_0296"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(326177..326182,326189..326191,
                     326201..326203,326222..326224,326258..326266,
                     326270..326275,326282..326287,326294..326296,
                     326303..326323,326345..326347,326357..326359,
                     326369..326374,326387..326389))
                     /locus_tag="Mesop_0296"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(326072..326074,326081..326083,
                     326192..326194,326201..326206,326210..326215,
                     326222..326224,326297..326299,326303..326314,
                     326318..326320,326345..326347,326357..326359,
                     326366..326374))
                     /locus_tag="Mesop_0296"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(326210..326212,326222..326224,
                     326300..326302,326372..326374))
                     /locus_tag="Mesop_0296"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(325481..325843)
                     /locus_tag="Mesop_0296"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    complement(324869..325369)
                     /locus_tag="Mesop_0296"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cd00568"
                     /db_xref="CDD:238318"
     misc_feature    complement(order(325064..325066,325070..325072,
                     325145..325156,325226..325228))
                     /locus_tag="Mesop_0296"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            complement(326440..327114)
                     /locus_tag="Mesop_0297"
                     /db_xref="GeneID:10824104"
     CDS             complement(326440..327114)
                     /locus_tag="Mesop_0297"
                     /note="InterPro IPR001647;
                     KEGG: mlo:mlr5206 transcriptional regulator;
                     PFAM: regulatory protein TetR;
                     SPTR: Transcriptional regulator, TetR family;
                     PFAM: Bacterial regulatory proteins, tetR family"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_004608886.1"
                     /db_xref="GI:337264831"
                     /db_xref="GeneID:10824104"
                     /translation="MPDTADPAPMNTPSRRSFRREGEERRRQDLIEATLDSVAEHGLQ
                     GATLRTIALRAGVTAGLIRHYFPSKEELLQEAYAALMGRMTEQAKAALVMEDASPRQR
                     LAAFITANLDAPIIDARVFSLWATFIGRARADPTLAHAHREGYLGFRNEVEAVVAEVL
                     AAERRNPDTSQLRHHAIAINAIIDGLWIEGCLAGEMFSPGELAAIGIKTVEAELGLAP
                     EGKKNQ"
     misc_feature    complement(326887..327027)
                     /locus_tag="Mesop_0297"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    complement(326470..326820)
                     /locus_tag="Mesop_0297"
                     /note="Bacterial transcriptional repressor; Region:
                     TetR_C_6; pfam13977"
                     /db_xref="CDD:258229"
     gene            complement(327084..327932)
                     /locus_tag="Mesop_0298"
                     /db_xref="GeneID:10824105"
     CDS             complement(327084..327932)
                     /locus_tag="Mesop_0298"
                     /note="COGs: COG1834 N-Dimethylarginine
                     dimethylaminohydrolase;
                     InterPro IPR003198;
                     KEGG: mlo:mlr5205 hypothetical protein;
                     PFAM: amidinotransferase;
                     SPTR: Amidinotransferase;
                     PFAM: Amidinotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="amidinotransferase"
                     /protein_id="YP_004608887.1"
                     /db_xref="GI:337264832"
                     /db_xref="GeneID:10824105"
                     /translation="MAAPLRRVLMRSAANAMRNADRDAWHYGPGFNPAKAASQHALLA
                     ELVTASGAEIEWIEDTADGLSDSVFTHDPSLMTDRGALILSMGKPLRAREPSLHEETY
                     RRLGIPILGRVEAPGQVEGGDCVWLDARTLVIGRGVRSNQEGIQQVSNLLTPLGVSVY
                     GFDLPLWQGEEACLHLMSVISPLADDLALVYSPLLPAPFYQMLKARNIRLVEGDAEEF
                     AASNGLSLNVLPTSPLKVIAVAGFPKTKAAMEAAGCTVEIFEADALCIACEGGPTCLT
                     RPILRQ"
     sig_peptide     complement(327825..327932)
                     /locus_tag="Mesop_0298"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(327096..327923)
                     /locus_tag="Mesop_0298"
                     /note="N-Dimethylarginine dimethylaminohydrolase [Amino
                     acid transport and metabolism]; Region: COG1834"
                     /db_xref="CDD:224747"
     gene            328167..328982
                     /locus_tag="Mesop_0299"
                     /db_xref="GeneID:10824106"
     CDS             328167..328982
                     /locus_tag="Mesop_0299"
                     /note="COGs: COG4598 ABC-type histidine transport system
                     ATPase component;
                     InterPro IPR017871:IPR003439:IPR003593;
                     KEGG: mlo:mll5204 amino acid ABC transporter, ATP-binding
                     protein;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     SPTR: ABC transporter related protein;
                     PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_004608888.1"
                     /db_xref="GI:337264833"
                     /db_xref="GeneID:10824106"
                     /translation="MTVVEAATVQSGKVQDGAAEAIHVENLHKKFGELHVLKGVSLSA
                     RDGEVIAIIGGSGSGKSTLLRCINCLENPTSGIIRVNGEEIKLRADSYGHTVPADRKQ
                     IERIRSKLGMVFQNFNLWSHMTLIENVIEVPVHVLGVKRDEAIAQAEKLLARVGLAEK
                     RDVYPAYLSGGQQQRAAIARALAINPRVMLFDEPTSALDPELVGEVLKVIGDLAREGR
                     TMVLVTHEMKFAREVATHVVYLYNGLVEEEGPPEQIFGAPKSERLKQFIRNIG"
     misc_feature    328212..328979
                     /locus_tag="Mesop_0299"
                     /note="ABC-type histidine transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     HisP; COG4598"
                     /db_xref="CDD:226961"
     misc_feature    328230..328895
                     /locus_tag="Mesop_0299"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    328326..328349
                     /locus_tag="Mesop_0299"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(328335..328340,328344..328352,328509..328511,
                     328740..328745,328839..328841)
                     /locus_tag="Mesop_0299"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    328500..328511
                     /locus_tag="Mesop_0299"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    328668..328697
                     /locus_tag="Mesop_0299"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    328728..328745
                     /locus_tag="Mesop_0299"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    328752..328763
                     /locus_tag="Mesop_0299"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    328827..328847
                     /locus_tag="Mesop_0299"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            329037..329837
                     /locus_tag="Mesop_0300"
                     /db_xref="GeneID:10824107"
     CDS             329037..329837
                     /locus_tag="Mesop_0300"
                     /note="COGs: COG0834 ABC-type amino acid transport/signal
                     transduction systems periplasmic component/domain;
                     InterPro IPR001638;
                     KEGG: mlo:mll5202 amino acid ABC transporter, binding
                     protein;
                     PFAM: extracellular solute-binding protein family 3;
                     SMART: extracellular solute-binding protein family 3;
                     SPTR: Extracellular solute-binding protein family 3;
                     PFAM: Bacterial extracellular solute-binding proteins,
                     family 3;
                     TIGRFAM: lysine-arginine-ornithine-binding periplasmic
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 3 extracellular solute-binding protein"
                     /protein_id="YP_004608889.1"
                     /db_xref="GI:337264834"
                     /db_xref="GeneID:10824107"
                     /translation="MKTVLKTFAAALLLGVAAMGVAKADPVKIGVAAEPYPPFTSPDA
                     SGKWVGWEIEFIDAVCAEEKLDCVITPVAWDGIIPALTTKKIDLIVSSMSITAEREKT
                     IDFSDKYYNTPTAIIGPKDQKFGSTPEDLKGKVVGVQVSTVHAVYAKKHFGATASEIK
                     EYQTQDEANNDLAAGRLDAVQADSIALGEFLKSDQGKACCDLKGMVAPDDEVLGPGVG
                     AGVRKEDTDLKEKINAGIKAIRANGKYDEISKKYFDFDIYGGGGAQSN"
     sig_peptide     329037..329108
                     /locus_tag="Mesop_0300"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    329094..329795
                     /locus_tag="Mesop_0300"
                     /note="lysine-arginine-ornithine-binding periplasmic
                     protein; Region: 3A0103s03R; TIGR01096"
                     /db_xref="CDD:233269"
     misc_feature    329115..329795
                     /locus_tag="Mesop_0300"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(329142..329144,329256..329258,329331..329333,
                     329463..329465,329583..329585)
                     /locus_tag="Mesop_0300"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(329532..329534,329544..329546,329562..329564)
                     /locus_tag="Mesop_0300"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    329673..329690
                     /locus_tag="Mesop_0300"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            329963..330712
                     /locus_tag="Mesop_0301"
                     /db_xref="GeneID:10824108"
     CDS             329963..330712
                     /locus_tag="Mesop_0301"
                     /note="COGs: COG4215 ABC-type arginine transport system
                     permease component;
                     InterPro IPR000515:IPR010065;
                     KEGG: mlo:mll5200 amino acid ABC transporter, permease
                     protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     TIGRFAM: polar amino acid ABC transporter, inner membrane
                     subunit;
                     manually curated;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component;
                     TIGRFAM: amine acid ABC transporter, permease protein,
                     3-TM region, His/Glu/Gln/Arg/opine family"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter permease"
                     /protein_id="YP_004608890.1"
                     /db_xref="GI:337264835"
                     /db_xref="GeneID:10824108"
                     /translation="MIDAFLSASAAGIIELLSPNPPGWGGTLLLGLLHSIEIALGATC
                     LGLLIGTGGAFGKLYGGPVVRDLLAVYTTVVRAVPELVLILLLYYAGTDLINQALTAM
                     GYQRVDISGLAAGIAVLGFVQGAYSTEVIRGAILAIPQGQIEAARAYGMSPGLMLRRI
                     TLPAMLPFAIPGLANLWLIATKDTALLAVVGFYELALATRQAAGVTKAYFTFFFAAAV
                     LYLLLSLISNFLIGRVEAWSRRGMPSLKEAR"
     misc_feature    330062..330694
                     /locus_tag="Mesop_0301"
                     /note="ABC-type arginine transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     ArtQ; COG4215"
                     /db_xref="CDD:226670"
     misc_feature    330062..330649
                     /locus_tag="Mesop_0301"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(330104..330109,330116..330121,330134..330136,
                     330164..330175,330179..330208,330215..330220,
                     330224..330226,330323..330328,330332..330334,
                     330338..330340,330347..330352,330356..330358,
                     330368..330373,330380..330382,330431..330433,
                     330473..330478,330485..330487,330506..330517,
                     330524..330529,330566..330571,330599..330604,
                     330611..330616,330620..330625,330632..330637,
                     330644..330649)
                     /locus_tag="Mesop_0301"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(330182..330226,330506..330523)
                     /locus_tag="Mesop_0301"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(330224..330226,330308..330310,330524..330526,
                     330560..330562,330569..330571,330599..330601)
                     /locus_tag="Mesop_0301"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(330383..330421,330437..330442,330452..330454)
                     /locus_tag="Mesop_0301"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            330712..331521
                     /locus_tag="Mesop_0302"
                     /db_xref="GeneID:10824109"
     CDS             330712..331521
                     /locus_tag="Mesop_0302"
                     /note="COGs: COG4160 ABC-type arginine/histidine transport
                     system permease component;
                     InterPro IPR000515:IPR010065;
                     KEGG: mlo:mll5199 ABC transporter, permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Polar amino acid ABC transporter, inner membrane
                     subunit;
                     TIGRFAM: polar amino acid ABC transporter, inner membrane
                     subunit;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component;
                     TIGRFAM: amine acid ABC transporter, permease protein,
                     3-TM region, His/Glu/Gln/Arg/opine family"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter permease"
                     /protein_id="YP_004608891.1"
                     /db_xref="GI:337264836"
                     /db_xref="GeneID:10824109"
                     /translation="MANEAAVINVVARTSLWLQPHRIVLILVALGLVLGAIFFMRWDW
                     LPQYYEMGLLGIWRSLWILAVTCVLGFLLAVPLGLAQATGSFWFAALAKAFCTVIRGT
                     PLLIQLWLLYYGLGSLFPQYPWIRESWMWPYLRQAWPYGVLALTLSFAGYEGEVMRGA
                     FAGVPKGQLEAARAFGMSRWKIFRRIWLPQAFYRALPTLTGETVLQLKSTPLVATISV
                     IDIFAVSSKVRQDTYLTYEPLLLLALIYMTITGILVFAFGRIEARIPNKIG"
     misc_feature    330829..331506
                     /locus_tag="Mesop_0302"
                     /note="ABC-type arginine/histidine transport system,
                     permease component [Amino acid transport and metabolism];
                     Region: ArtM; COG4160"
                     /db_xref="CDD:226634"
     misc_feature    330877..331476
                     /locus_tag="Mesop_0302"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(330925..330930,330937..330942,330955..330957,
                     330985..330996,331000..331029,331036..331041,
                     331045..331047,331150..331155,331159..331161,
                     331165..331167,331174..331179,331183..331185,
                     331195..331200,331207..331209,331258..331260,
                     331300..331305,331312..331314,331333..331344,
                     331351..331356,331393..331398,331426..331431,
                     331438..331443,331447..331452,331459..331464,
                     331471..331476)
                     /locus_tag="Mesop_0302"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(331003..331047,331333..331350)
                     /locus_tag="Mesop_0302"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(331045..331047,331135..331137,331351..331353,
                     331387..331389,331396..331398,331426..331428)
                     /locus_tag="Mesop_0302"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(331210..331248,331264..331269,331279..331281)
                     /locus_tag="Mesop_0302"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            331778..332740
                     /locus_tag="Mesop_0303"
                     /db_xref="GeneID:10824110"
     CDS             331778..332740
                     /locus_tag="Mesop_0303"
                     /note="COGs: COG2055 Malate/L-lactate dehydrogenase;
                     InterPro IPR003767;
                     KEGG: mlo:mll5197 malate dehydrogenase;
                     PFAM: Malate/L-lactate dehydrogenase;
                     SPTR: Malate/L-lactate dehydrogenase;
                     PFAM: Malate/L-lactate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="malate/L-lactate dehydrogenase"
                     /protein_id="YP_004608892.1"
                     /db_xref="GI:337264837"
                     /db_xref="GeneID:10824110"
                     /translation="MAALGAGANEEAAQSLTASIISAEAEGLSSVGLTHFIDYLEALE
                     AGRIDGNADPVITRPALAVYLSDARGGLAHTGFDRTIDDLAKAARLFGVAIFSQKNAY
                     TCGALGYFTGRLAAQGLVSFAATNGPAVLAGSGSVKPVYCTNPMSFAAPAADGAPLVI
                     DQSSSATAFVNIRKAAEDGKKIPEGWALDESGNPTTDPAAAMKGAMLAFGGQRGANIA
                     LMVEVLAAGLSGANWSLDAPWFSGGPDSPGTGLFVLAVEPKLLDPDFEQRMKDQLDRL
                     RRRYGVHVPGRARAEAAEKAQARGITAPKAVVQRISEFAERYST"
     misc_feature    331778..332737
                     /locus_tag="Mesop_0303"
                     /note="Malate/L-lactate dehydrogenase; Region: Ldh_2;
                     cl00900"
                     /db_xref="CDD:260688"
     gene            332983..333264
                     /locus_tag="Mesop_0304"
                     /db_xref="GeneID:10824111"
     CDS             332983..333264
                     /locus_tag="Mesop_0304"
                     /note="KEGG: nca:Noca_2395 peptidase S1 and S6,
                     chymotrypsin/Hap;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608893.1"
                     /db_xref="GI:337264838"
                     /db_xref="GeneID:10824111"
                     /translation="MTNTKITMLTAVLLLGSFMGATQAATLKAAPVKPSTPGVITAPS
                     GGATEDHYCKNGHAKFANCSADFVAACKKVGGTMSDVQGWGGRTCFTPS"
     sig_peptide     332983..333054
                     /locus_tag="Mesop_0304"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            333549..334526
                     /locus_tag="Mesop_0305"
                     /db_xref="GeneID:10824112"
     CDS             333549..334526
                     /locus_tag="Mesop_0305"
                     /note="COGs: COG0702 nucleoside-diphosphate-sugar
                     epimerase;
                     InterPro IPR001509;
                     KEGG: mlo:mll5193 NADH dehydrogenase (ubiquinone) 1 alpha
                     subcomplex;
                     PFAM: NAD-dependent epimerase/dehydratase;
                     SPTR: NAD-dependent epimerase/dehydratase;
                     PFAM: NAD dependent epimerase/dehydratase family"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="YP_004608894.1"
                     /db_xref="GI:337264839"
                     /db_xref="GeneID:10824112"
                     /translation="MTEILQTPKLVVVFGGSGFVGRHVVRALAKRGYRIRVACRRPDL
                     AGHLQPLGNVGQIQPVQANVRVRWSVDRAVQGADHVINLVAVLHESGRQKFSAVHEFG
                     ARAVAEAARSVGAGLTHISALGADLGSGSDYARTKALGEQAVLETIKDAVIFRPSINF
                     GPEDSFFNRFANMARYSPVLPLIGGGHNKLQPVYVGDVAEAVARSVEGKVDGGQIYEL
                     GGPKVLTFRECMEELLEVIERKRLLVPVPWWVANIQASILGLLPNPLLTKDQVMQLRE
                     HNIVSDAATKANRTLTGLGIQPQSIATVLPSYLWRFRAAGQFQQRKPAA"
     misc_feature    333573..334409
                     /locus_tag="Mesop_0305"
                     /note="Predicted nucleoside-diphosphate-sugar epimerases
                     [Cell envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: COG0702"
                     /db_xref="CDD:223774"
     misc_feature    333573..334382
                     /locus_tag="Mesop_0305"
                     /note="NADH dehydrogenase (ubiquinone) 1 alpha subcomplex,
                     subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs;
                     Region: NDUFA9_like_SDR_a; cd05271"
                     /db_xref="CDD:187579"
     misc_feature    order(333591..333593,333597..333608,333663..333671,
                     333795..333803,333840..333842,333906..333914,
                     333945..333947,333957..333959,334014..334025)
                     /locus_tag="Mesop_0305"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187579"
     misc_feature    order(333945..333947,333957..333959)
                     /locus_tag="Mesop_0305"
                     /note="active site"
                     /db_xref="CDD:187579"
     gene            complement(334681..336048)
                     /locus_tag="Mesop_0306"
                     /db_xref="GeneID:10824113"
     CDS             complement(334681..336048)
                     /locus_tag="Mesop_0306"
                     /note="COGs: COG2124 Cytochrome P450;
                     InterPro IPR017972:IPR001128:IPR002401:IPR017973;
                     KEGG: mlo:mlr5192 cytochrome P450;
                     PFAM: cytochrome P450;
                     SPTR: Cytochrome P450;
                     PFAM: Cytochrome P450"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="YP_004608895.1"
                     /db_xref="GI:337264840"
                     /db_xref="GeneID:10824113"
                     /translation="MDTQPAPFVPPAPKPRTSPPSTLEMIRIVYRNPLELWGEPTYNE
                     PWISANGAGGPLVIANDPGLIRHVLVDNAKNYKMATVRQKILRPILRDGLLTAEGEVW
                     KRSRKAMAPVFTPRHIFGFAQPMLKRTREFATRYEAGGMSDIAHDMTLLTYDILAETL
                     FSGEIAGEQGSFANEIDRLFETMGRVDPLDLLRAPDWLPRLTRIRGRKTMAYFRKIVT
                     DTVKMREEKVRRDPDAVPQDFLTLLLKAEGPEGLTRAEVEDNIITFIGAGHETTARAL
                     GWTLYCLAESPWERNRVEQEIDQVLAREADPTKWLDAMPLTRAAFEEALRLYPPAPSI
                     NREPIVPEMWKDLYIPKHAAVLVMPWVVHRHRKLWDRPDAFLPERFHPGNREKIDRFQ
                     YLPFGAGPRVCIGASFAMQEAIIALAILLSRFRFDVTAETKPWPVQKLTTQPHGGLPM
                     QVTPR"
     misc_feature    complement(334684..336030)
                     /locus_tag="Mesop_0306"
                     /note="Cytochrome P450 [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: CypX;
                     COG2124"
                     /db_xref="CDD:225035"
     gene            complement(336455..337486)
                     /locus_tag="Mesop_0307"
                     /db_xref="GeneID:10824114"
     CDS             complement(336455..337486)
                     /locus_tag="Mesop_0307"
                     /note="COGs: COG3547 Transposase and inactivated
                     derivatives;
                     InterPro IPR003346;
                     KEGG: mlo:mlr6069 transposase;
                     PFAM: transposase IS116/IS110/IS902 family protein;
                     SPTR: Transposase IS116/IS110/IS902 family protein;
                     PFAM: Transposase IS116/IS110/IS902 family; Transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902 family protein"
                     /protein_id="YP_004608896.1"
                     /db_xref="GI:337264841"
                     /db_xref="GeneID:10824114"
                     /translation="MEHYIGLDVSMKETAISIRQNGKRIWRGKCASDPQLLAAVIRKR
                     APHVRRVVFETGPLSVWFYHALTAEGLPVICIDARHAKAALDMAANKTDANDADGLAH
                     LAEVGFYREVRVKGFDSMLIRTLITARRQLLKMRLQISNQIRGLMKTFGLVVPKGAGS
                     VFERNVRDLLQGEEKLARIVVPMLQAWSGIRYQIAELSKQLAATAREDQHCRLLMSVP
                     GVGTVTATAFAAAVEDPANFRNSRAVGAWVGLTPRRYQSGEVDNDGHISRRGDNQLRG
                     LLYEAAAVILNRSTDTSSLRTWALELKDRIGFKRAAVALARKLAVIMHAMLRTGELFD
                     PHGGTQAAV"
     misc_feature    complement(337061..337477)
                     /locus_tag="Mesop_0307"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    complement(336506..337468)
                     /locus_tag="Mesop_0307"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    complement(336614..336856)
                     /locus_tag="Mesop_0307"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            337569..338303
                     /locus_tag="Mesop_0308"
                     /db_xref="GeneID:10824115"
     CDS             337569..338303
                     /locus_tag="Mesop_0308"
                     /note="COGs: COG0431 flavoprotein;
                     InterPro IPR005025;
                     KEGG: mlo:mll5191 hypothetical protein;
                     PFAM: NADPH-dependent FMN reductase;
                     SPTR: NADPH-dependent FMN reductase;
                     PFAM: NADPH-dependent FMN reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent FMN reductase"
                     /protein_id="YP_004608897.1"
                     /db_xref="GI:337264842"
                     /db_xref="GeneID:10824115"
                     /translation="MFEHRRHISGGHRFRDYFMFVHPIVTAMRRLPPCPSLRSAVGTV
                     SNGYRQSKEPALKHQLNIIIGSTRPGRAGPVFAEWLEAFAREHGKFEPVLTDIAAFDL
                     PVLDEPHHPRLGNYQNDHTKAWSKATDAADAFVFVAPEYNYFVAPAIVNAVDYLAREW
                     KYKPAAIFSYGGVSGGLRAAQALKPLLTSVGIMPIPEGVALPMYQKLLDENRAFNASE
                     QVAGGAKIMLDELSRWSEALKPMRAA"
     misc_feature    337752..338300
                     /locus_tag="Mesop_0308"
                     /note="Predicted flavoprotein [General function prediction
                     only]; Region: COG0431"
                     /db_xref="CDD:223508"
     gene            338385..341015
                     /locus_tag="Mesop_0309"
                     /db_xref="GeneID:10824116"
     CDS             338385..341015
                     /locus_tag="Mesop_0309"
                     /note="COGs: COG4249 Uncharacterized protein containing
                     caspase domain;
                     InterProIPR001309:IPR011600:IPR001440:IPR015917:IPR
                     019734;
                     KEGG: mlo:mll5190 hypothetical protein;
                     PFAM: peptidase C14 caspase catalytic subunit p20; TPR
                     repeat-containing protein;
                     SMART: Peptidase C14, caspase precursor p45, core;
                     Tetratricopeptide repeat;
                     SPTR: Peptidase C14 caspase catalytic subunit p20;
                     PFAM: Caspase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C14 caspase catalytic subunit p20"
                     /protein_id="YP_004608898.1"
                     /db_xref="GI:337264843"
                     /db_xref="GeneID:10824116"
                     /translation="MRLLFALLLMLATTATAVAERRVALVMADDDYRLVRALANPVHD
                     GEAMEASLKKLGFEVVLETNRDLRRMRRALDDFREDAKGADVALVYFSGHGVEISGDN
                     RLLPVDADASSLDALDKTSLPLEEVRDAVAATAKVGLIVLDACRSDPFSGNGGEGRGA
                     TALAKDVVDKVKPGLGRVGRAENILFAFSAAPGETAADGTGQNSPFTTALTKYLGTDG
                     LEIRSVLTLVQQEVYDLSRGKQLPYVESGLPKLFFAATAREQLPERERLLLAMADVTP
                     EMRGQVEQIASDADMPLAPLYGALISADTSHLSADRLNARLREAADAFVKVRAEMKTL
                     AADDPRVTELRRQAEEQLALGAFGAAQAKLAEAVAVDEVSRKALKANFVDRTLSQAAT
                     LFLSAGAARADLSYAAAIKGYETVLSLYGEAGQTALNLEQADRQSRTLEELGQLYTTV
                     GNVEAAGRAFTALLGDLEQRSRQEADPSVKRDLAISHIKLANIKMAQGDLPTSLENYE
                     AARGMLQQLTASMPNKKDWLGDLAMANDKIGNVLATQGDVGAAAQAYRESLSIKQKLA
                     DAEPDSAYRLRDLTISYDEIGDLARAAGQLDDAQTAFEESLRIRLVLTGNKPDDPERQ
                     RAVAVSQERIGDVLRQRGDAAGALVAYSNSQAIAEDLVRRDPNDTDLKRDLSISYAKI
                     GNALNDQENWPAALASYRQALAVARDLAADDPANTEWQRDLSVCLEKVAGVLDAQGNT
                     GDALQNYQDSLAIADRLAKLDPGNSDWQRDLSITLSEIGMLETKQRHFEGSKKAFEAS
                     LGIRQQLARSDPNNAIWQFDLVQAYINYAYVAKDPKAVLTKALNLALELDRTGRLAPR
                     DKPTIKYLRGLLAKFGTRKK"
     sig_peptide     338385..338441
                     /locus_tag="Mesop_0309"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    338439..339698
                     /locus_tag="Mesop_0309"
                     /note="Uncharacterized protein containing caspase domain
                     [General function prediction only]; Region: COG4249"
                     /db_xref="CDD:226700"
     misc_feature    338448..339143
                     /locus_tag="Mesop_0309"
                     /note="Caspase domain; Region: Peptidase_C14; pfam00656"
                     /db_xref="CDD:250035"
     misc_feature    order(338664..338666,338817..338819)
                     /locus_tag="Mesop_0309"
                     /note="active site"
                     /db_xref="CDD:237997"
     misc_feature    order(338667..338669,338811..338813,338844..338846,
                     338967..338984,338994..338999)
                     /locus_tag="Mesop_0309"
                     /note="substrate pocket [chemical binding]; other site"
                     /db_xref="CDD:237997"
     misc_feature    order(338847..338849,338922..338927,338946..338948,
                     338955..338957,338964..338966,339027..339029,
                     339051..339053,339069..339071,339099..339101,
                     339114..339119,339123..339125,339132..339137)
                     /locus_tag="Mesop_0309"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:237997"
     misc_feature    order(338850..338852,338919..338921)
                     /locus_tag="Mesop_0309"
                     /note="proteolytic cleavage site; other site"
                     /db_xref="CDD:237997"
     misc_feature    339825..340076
                     /locus_tag="Mesop_0309"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    339972..340214
                     /locus_tag="Mesop_0309"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    340263..340508
                     /locus_tag="Mesop_0309"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    340401..340652
                     /locus_tag="Mesop_0309"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     gene            341161..343632
                     /locus_tag="Mesop_0310"
                     /db_xref="GeneID:10824117"
     CDS             341161..343632
                     /locus_tag="Mesop_0310"
                     /EC_number="5.99.1.3"
                     /note="COGs: COG0187 Type IIA topoisomerase (DNA
                     gyrase/topo II topoisomerase IV) B subunit;
                     InterProIPR018522:IPR003594:IPR013506:IPR006171:IPR
                     002288:IPR001241:IPR000565:IPR011557;
                     KEGG: mlo:mll5188 DNA gyrase subunit B;
                     PFAM: DNA topoisomerase type IIA subunit B region 2 domain
                     protein; ATP-binding region ATPase domain protein; TOPRIM
                     domain protein; DNA gyrase subunit B domain protein;
                     PRIAM: DNA topoisomerase (ATP-hydrolyzing);
                     SMART: DNA topoisomerase II; ATP-binding region ATPase
                     domain protein;
                     SPTR: DNA gyrase subunit B;
                     TIGRFAM: DNA gyrase, B subunit;
                     PFAM: Toprim domain; Histidine kinase-, DNA gyrase B-, and
                     HSP90-like ATPase; DNA gyrase B; DNA gyrase B subunit,
                     carboxyl terminus;
                     TIGRFAM: DNA gyrase, B subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_004608899.1"
                     /db_xref="GI:337264844"
                     /db_xref="GeneID:10824117"
                     /translation="MSDQIENTNGAEAEYGADSIKVLKGLDAVRKRPGMYIGDTDDGS
                     GLHHMVYEVVDNAIDEALAGHADLVTVTLNPDGSVTVIDNGRGIPTDIHTGEGISAAE
                     VIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSAWLKLKIRRNGQIFEMSFTHGNA
                     DAPLKVTGAYEQDKQPGTYEGRSGSEITFFPSSETFTMVEFDFGTLEHRLRELAFLNS
                     GVRIVLTDARHADVLRHELHYDGGLEEFVKYLDRVKKPLIDKPIAIKAERDGITVEVA
                     MWWNDSYHENVLAFTNNIPQRDGGTHLAGFRGALTRQITGYGDSSGLTKKEKVSLIGD
                     DCREGLTAVLSVKVPDPKFSSQTKDKLVSSEVRPVVEGLVNEALGTWLEEHPTEGKVV
                     IDKVIQAAAAREAARKARDITRKSSLGVTSLPGKLADCQERDPAKSEIFIVEGDSAGG
                     SAKGGRSRQNQAILPLRGKILNVERARFDRMLGSDMIGTLITALGTSIGKDEFNADKL
                     RYHKIILMTDADVDGAHIRTLLLTFFFRQMPELIERGHLYIAQPPLYKVTRGKSSQYI
                     KNESAFEEFLIGSGLEEASLALGSGEVRAGQDLRSAIDDALAVRQLINGLHTRYNRGV
                     VEQAAIAGGLNPDVFADLGRANAMAERVAQRLDIIAEDTERGWTGRMSTSNEGIGGYV
                     FERTVRSVKEYAHLDMALINSADARQLDRYAQRLSEVYGTPPVLRRKDISETVSGPLA
                     LLNAVFATGRKGLTMQRYKGLGEMNAEQLWETTLDPNVRSLLQVKVNDATDADSLFSR
                     LMGDEVEPRREFIQDNALSVANLDI"
     misc_feature    341191..343629
                     /locus_tag="Mesop_0310"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     misc_feature    341296..341595
                     /locus_tag="Mesop_0310"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(341314..341316,341326..341328,341335..341337,
                     341401..341403,341407..341409,341413..341415,
                     341419..341424,341539..341550)
                     /locus_tag="Mesop_0310"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    341326..341328
                     /locus_tag="Mesop_0310"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(341413..341415,341419..341421,341539..341541,
                     341545..341547)
                     /locus_tag="Mesop_0310"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    341881..342354
                     /locus_tag="Mesop_0310"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    342034..342036
                     /locus_tag="Mesop_0310"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(342208..342210,342217..342222,342226..342228)
                     /locus_tag="Mesop_0310"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(342226..342228,342232..342234)
                     /locus_tag="Mesop_0310"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    342472..342816
                     /locus_tag="Mesop_0310"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(342490..342495,342502..342504,342712..342714,
                     342718..342720,342724..342726)
                     /locus_tag="Mesop_0310"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(342490..342492,342712..342714)
                     /locus_tag="Mesop_0310"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    343402..343596
                     /locus_tag="Mesop_0310"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            343869..344795
                     /locus_tag="Mesop_0311"
                     /db_xref="GeneID:10824118"
     CDS             343869..344795
                     /locus_tag="Mesop_0311"
                     /note="KEGG: mlo:mll5186 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608900.1"
                     /db_xref="GI:337264845"
                     /db_xref="GeneID:10824118"
                     /translation="MQSSTLSAVGVSTATESSSTAVSWGPIIAGAFAASTLTFILMLL
                     GSGLGLTMVSPWSGSGLSATSFAVSTAIWLVVVQWLSSGVGGYLAGRLRTKWVGIHTD
                     EVYFRDTAHGFLAWALATLLVVGVLGSALSAAIGTGVQAASNVASGAATGASAGASAN
                     ASNASASADNATSYLVDSLFRPADPAKLATGNPGDQAAAAGQASRILIAGTVAGEVSA
                     EDKTYLSQLVAARTGLSEADAKTRVDAVLAKAQDAKVKAQQAADTARKASATFALLGA
                     LSLVIGAFIASAAAALGGRQRDDEEAVFLANP"
     sig_peptide     343869..343967
                     /locus_tag="Mesop_0311"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    344529..>344645
                     /locus_tag="Mesop_0311"
                     /note="DNA sequence specific (IHF) and non-specific (HU)
                     domains; Region: HU_IHF; cl00257"
                     /db_xref="CDD:260305"
     gene            complement(344888..346285)
                     /locus_tag="Mesop_0312"
                     /db_xref="GeneID:10824119"
     CDS             complement(344888..346285)
                     /locus_tag="Mesop_0312"
                     /EC_number="1.6.1.2"
                     /note="COGs: COG1282 NAD/NADP transhydrogenase beta
                     subunit;
                     InterPro IPR004003:IPR012136;
                     KEGG: mlo:mlr5184 nicotinamide nucleotide
                     transhydrogenase, subunit beta;
                     PFAM: NAD(P) transhydrogenase beta subunit;
                     PRIAM: NAD(P)(+) transhydrogenase (AB-specific);
                     SPTR: NAD(P) transhydrogenase subunit beta;
                     PFAM: NAD(P) transhydrogenase beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)(+) transhydrogenase"
                     /protein_id="YP_004608901.1"
                     /db_xref="GI:337264846"
                     /db_xref="GeneID:10824119"
                     /translation="MNANFASFLYLVSGVLFIMALRGLSHPTTSRQGNLYGMIGMGIA
                     IATTLALATPSAPRFGLIVLGLAIGGGVGAVTARRIAMTSMPQLVAAFHSLVGLAAVM
                     VAAAAIYAPESFGIGTAGDIHAQALIEMSLGVAIGAITFTGSVIAFLKLDGRMSGKPI
                     MIGGRHFINAALGVALIVLIILLVTTESKLVFWLIVAASLVLGILLIIPIGGADMPVV
                     VSMLNSYSGWAAAALGFTLGNLALIITGALVGSSGAILSYIMCKGMNRSFISVILGGF
                     GGETTAAADDGIERTVKQGSADDAAYLMMNAQKVIIVPGYGMAVAQAQHALREMADKL
                     KANGVDVKYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEDINSEFAQADVAYVIGAN
                     DVTNPSARDDKSSPIYGMPILDVDKARTCLFVKRSLGSGYAGIDNTLFYKDGTMMLLG
                     DAKKMTEEIVKAMDH"
     misc_feature    complement(344897..346285)
                     /locus_tag="Mesop_0312"
                     /note="NAD/NADP transhydrogenase beta subunit [Energy
                     production and conversion]; Region: PntB; COG1282"
                     /db_xref="CDD:224201"
     sig_peptide     complement(346211..346285)
                     /locus_tag="Mesop_0312"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            complement(346292..346717)
                     /locus_tag="Mesop_0313"
                     /db_xref="GeneID:10824120"
     CDS             complement(346292..346717)
                     /locus_tag="Mesop_0313"
                     /note="COGs: COG3288 NAD/NADP transhydrogenase alpha
                     subunit;
                     KEGG: mlo:mlr5183 nicotinamide nucleotide
                     transhydrogenase, subunit alpha2;
                     SPTR: Nicotinamide nucleotide transhydrogenase, subunit
                     alpha2"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinamide nucleotide transhydrogenase subunit
                     alpha2"
                     /protein_id="YP_004608902.1"
                     /db_xref="GI:337264847"
                     /db_xref="GeneID:10824120"
                     /translation="MDQTLQKALDQLDQASAAVRLAVQNLANAPGGTDAAGDAAHALS
                     GGAIDPFVFRFAIFVLAIFVGYYVVWSVTPALHTPLMAVTNAISSVIVVGALLAVGIA
                     ASGVAAGFGFVALMLVSVNIFGGFLVTQRMLAMYKKKDK"
     misc_feature    complement(346304..346564)
                     /locus_tag="Mesop_0313"
                     /note="Domain of unknown function (DUF3814); Region:
                     DUF3814; pfam12769"
                     /db_xref="CDD:257285"
     gene            complement(346717..347997)
                     /locus_tag="Mesop_0314"
                     /db_xref="GeneID:10824121"
     CDS             complement(346717..347997)
                     /locus_tag="Mesop_0314"
                     /EC_number="1.6.1.2"
                     /note="COGs: COG3288 NAD/NADP transhydrogenase alpha
                     subunit;
                     InterPro IPR008143:IPR007886:IPR007698;
                     KEGG: mlo:mlr5181 nicotinamide nucleotide
                     transhydrogenase, subunit alpha1;
                     PFAM: alanine dehydrogenase/PNT domain protein;
                     PRIAM: NAD(P)(+) transhydrogenase (AB-specific);
                     SPTR: Alanine dehydrogenase/PNT domain protein;
                     PFAM: Alanine dehydrogenase/PNT, C-terminal domain;
                     Alanine dehydrogenase/PNT, N-terminal domain;
                     TIGRFAM: NAD(P) transhydrogenase, alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)(+) transhydrogenase"
                     /protein_id="YP_004608903.1"
                     /db_xref="GI:337264848"
                     /db_xref="GeneID:10824121"
                     /translation="MGQTVFIPRELDANEPRVAASPDTVKRLAGLGFDVVVETGAGTR
                     SRIPDEEFAKAGAAIGKAADVGKADVVLKVRRPSEAELKGYKSGAAVIAIMDPYGNDA
                     AVAALAKAGVTAFSMEFMPRITRAQSMDVLSSQANLAGYQAVIDGASEYDRALPMMMT
                     AAGTVPAAKVFIMGVGVAGLQAIATARRLGAVVTATDVRPAAKEQVASLGAKFLAVED
                     DEFKAAETAGGYAKEMSREYQAKQAALTAEHIAKQDIVITTALIPGRPAPKLVSAAMV
                     ASMKPGSVLVDLAVERGGNVEGAVPGQVVNTANGVKIVGHLNVPGRVAASASLLYARN
                     LFAFLETLVDKTTKTLAINRDDDLVKATMLTDGGKVVHPAFAKADQQPPKGQYVEPAA
                     IPAKTMVADASPKKSAPRKTAASKSPSSKSKGTA"
     misc_feature    complement(346891..347988)
                     /locus_tag="Mesop_0314"
                     /note="NAD/NADP transhydrogenase alpha subunit [Energy
                     production and conversion]; Region: PntA; COG3288"
                     /db_xref="CDD:225826"
     misc_feature    complement(346894..347988)
                     /locus_tag="Mesop_0314"
                     /note="Rubrum transdehydrogenase NAD-binding and catalytic
                     domains; Region: Rubrum_tdh; cd05304"
                     /db_xref="CDD:240629"
     misc_feature    complement(order(347038..347040,347044..347046,
                     347125..347127,347716..347718,347773..347775,
                     347947..347949))
                     /locus_tag="Mesop_0314"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    complement(order(346996..347001,347008..347010,
                     347020..347025,347152..347157,347431..347436,
                     347503..347505,347512..347520,347524..347526,
                     347530..347547,347551..347556,347560..347565,
                     347572..347577,347584..347589,347614..347619,
                     347860..347862))
                     /locus_tag="Mesop_0314"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    complement(order(347188..347190,347194..347196,
                     347215..347223,347272..347274,347305..347307,
                     347401..347409,347467..347478,347599..347601,
                     347608..347610,347617..347619,347629..347634))
                     /locus_tag="Mesop_0314"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    complement(order(347368..347379,347383..347388,
                     347434..347436,347455..347460,347587..347589,
                     347617..347619,347623..347628))
                     /locus_tag="Mesop_0314"
                     /note="trimer interface B [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    complement(order(347422..347424,347428..347430,
                     347497..347499,347506..347508,347515..347529))
                     /locus_tag="Mesop_0314"
                     /note="trimer interface A [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     gene            complement(348084..348308)
                     /locus_tag="Mesop_0315"
                     /db_xref="GeneID:10824122"
     CDS             complement(348084..348308)
                     /locus_tag="Mesop_0315"
                     /note="InterPro IPR012422;
                     KEGG: bmi:BMEA_B0960 aa3 type cytochrome c oxidase subunit
                     IV;
                     PFAM: aa3 type cytochrome c oxidase subunit IV;
                     SPTR: Aa3 type cytochrome c oxidase subunit IV;
                     PFAM: Bacterial aa3 type cytochrome c oxidase subunit IV"
                     /codon_start=1
                     /transl_table=11
                     /product="aa3 type cytochrome c oxidase subunit IV"
                     /protein_id="YP_004608904.1"
                     /db_xref="GI:337264849"
                     /db_xref="GeneID:10824122"
                     /translation="MADHTPSGPVELGAKMDYAEHDRTYAGFLMLAKYGSLFCGAILL
                     AMAFGFFAGGFFSATILFILIMAVGAFILR"
     misc_feature    complement(348177..348278)
                     /locus_tag="Mesop_0315"
                     /note="Bacterial aa3 type cytochrome c oxidase subunit IV;
                     Region: COX4_pro_2; pfam07835"
                     /db_xref="CDD:254461"
     gene            348519..349334
                     /locus_tag="Mesop_0316"
                     /db_xref="GeneID:10824123"
     CDS             348519..349334
                     /locus_tag="Mesop_0316"
                     /note="COGs: COG0596 hydrolase or acyltransferase
                     (alpha/beta hydrolase superfamily);
                     InterPro IPR000073;
                     KEGG: mlo:mll5179 hypothetical protein;
                     PFAM: alpha/beta hydrolase fold;
                     SPTR: Alpha/beta hydrolase fold protein;
                     PFAM: alpha/beta hydrolase fold"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold protein"
                     /protein_id="YP_004608905.1"
                     /db_xref="GI:337264850"
                     /db_xref="GeneID:10824123"
                     /translation="MTTPIQTFDWNETAIAWGTAGSGPPIVLVHGTPFSSHVWHRVAP
                     ELAREHTLYFYDLPGYGRSTKREGQDVSLGIQNEALAAMLAFWKLDRPKIIAHDFGGA
                     TALRAHLIDGRDYDRLLLIDPVAVRPWGSPFVQHVRRHEAAFAGVPDYIQVAILKAYV
                     SGAAARPLSDSELEPYIAPWTGPIGQPAFYRQIAQMDPRFTDEVEPLYGELRCPVALL
                     WGEDDRWISPQSGQKLAAMLPDCALTLVPGSGHLMQEDRPEAIVAAALRFFAG"
     misc_feature    348582..349328
                     /locus_tag="Mesop_0316"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    348594..349310
                     /locus_tag="Mesop_0316"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     gene            complement(349423..349572)
                     /locus_tag="Mesop_0317"
                     /db_xref="GeneID:10824124"
     CDS             complement(349423..349572)
                     /locus_tag="Mesop_0317"
                     /note="KEGG: mes:Meso_2808 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF3096)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608906.1"
                     /db_xref="GI:337264851"
                     /db_xref="GeneID:10824124"
                     /translation="MTVSTLALTPLISLIAGVLILVMPRLLNYIVAIYLIIAGLLGLF
                     PHLAG"
     misc_feature    complement(349429..349545)
                     /locus_tag="Mesop_0317"
                     /note="Protein of unknown function (DUF3096); Region:
                     DUF3096; pfam11295"
                     /db_xref="CDD:151736"
     gene            complement(349744..350523)
                     /locus_tag="Mesop_0318"
                     /db_xref="GeneID:10824125"
     CDS             complement(349744..350523)
                     /locus_tag="Mesop_0318"
                     /note="KEGG: mes:Meso_2809 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608907.1"
                     /db_xref="GI:337264852"
                     /db_xref="GeneID:10824125"
                     /translation="MDAHLTALRQVAGVSEENSPDNMSSFARNISAMLERTEYRRCDK
                     GEDLEDIYRLRYKSYRLSDMVPENPDHIIHDELDEAENCSKFGIYIDGDLVSTLRIHH
                     ACHETPQSPSTTVYGDILRPMLAAGAHFADPSRFAADPDWSRVYPQIPYLTLRLAGMA
                     CFYFDAPYCLSTIRPEHAGFYRRIYCSEQIGELRDYPGLNYKVVLYRANVNAIRERSF
                     SRFPFFRSTPLEQRMLFETPGAGELAPLTILPTAKYFREAA"
     gene            complement(350671..352983)
                     /locus_tag="Mesop_0319"
                     /db_xref="GeneID:10824126"
     CDS             complement(350671..352983)
                     /locus_tag="Mesop_0319"
                     /note="COGs: COG5001 signal transduction protein
                     containing a membrane domain an EAL and a GGDEF domain;
                     InterProIPR000215:IPR000169:IPR001633:IPR000160:IPR
                     013656;
                     KEGG: mlo:mlr5176 hypothetical protein;
                     PFAM: EAL domain protein; GGDEF domain containing protein;
                     PAS fold-4 domain protein;
                     SMART: EAL domain protein; GGDEF domain containing
                     protein;
                     SPTR: Diguanylate cyclase/phosphodiesterase;
                     TIGRFAM: diguanylate cyclase;
                     PFAM: EAL domain; GGDEF domain; PAS fold;
                     TIGRFAM: diguanylate cyclase (GGDEF) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="YP_004608908.1"
                     /db_xref="GI:337264853"
                     /db_xref="GeneID:10824126"
                     /translation="MNLRKKNEIPVDVYIPFVETLFRDGLTLSIGFFAQTLLVVLVYW
                     KTRDPAYLAVTFGFLAVAFLRLRNIRKYRHAPTPKSWEEARRRENDYIFYGSMHGFML
                     GTFCFVGIYLAYDGFAEIAAVCVTLASATSIAGRNYGSPRMVMIFIMTMTWPISLGFI
                     LRGDPYHFILGLLSAPFLFAIKRFADLVREVLFAALSEEKKANRLAQRFNRALNTMSH
                     GLVMLGPDGRVAVANAEAAHLMSLKSADALLGRSIHGLLMRGVAGGMLAPKDCRYIEA
                     QLTRALREGRDRKVLVSLANGQHYEFSAREGSQELGVITFEDVTARVEAEDKIRFMAR
                     YDNLTGLPNRAYFHELIGEAMASGDRDRLCGLAVLDLDDFKSVNDTLGHPIGDGLIYA
                     VAERLAAVAGQGITVSRFGGDEFMVFFDRIEDESHLTIQIDEIFAALQGEVDVAGHGL
                     RIQASGGAVLSRVRDSDVDAMIVKADLALYKAKELGKNGWRLFEAAMDAAFRNRQLMK
                     ADLRSAVESKGLRVVYQPIVAMSTMRIASCEALCRWDHPDLGPVSPGIFIPLAEEMGI
                     ISEISTFVLHAACTECAKWPDQTSVSVNLSAKDFRSRDVIQKVRDALASSGLAAGRLE
                     IEVTETALLDDKSLTRQYIEELKQIGVRIALDDFGTGYSSLSYLHKLPLDKIKIDRSF
                     LMDVTQNSRSLELLKGIVNLSRPLGLSVTVEGVETFEQLKILALEVKPDLVQGFLFGS
                     ALSASGIETMSTTVWPFAKEIKSAKRASRG"
     misc_feature    complement(<352213..352365)
                     /locus_tag="Mesop_0319"
                     /note="PAS domain; Region: PAS; smart00091"
                     /db_xref="CDD:214512"
     misc_feature    complement(352003..352347)
                     /locus_tag="Mesop_0319"
                     /note="PAS fold; Region: PAS_7; pfam12860"
                     /db_xref="CDD:257355"
     misc_feature    complement(351511..351984)
                     /locus_tag="Mesop_0319"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(351745..351747,351874..351876))
                     /locus_tag="Mesop_0319"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(351742..351753,351757..351759,
                     351823..351825,351835..351837,351847..351852,
                     351859..351861))
                     /locus_tag="Mesop_0319"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(351682..351684,351769..351771))
                     /locus_tag="Mesop_0319"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    complement(350749..351459)
                     /locus_tag="Mesop_0319"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(353127..356606)
                     /locus_tag="Mesop_0320"
                     /db_xref="GeneID:10824127"
     CDS             complement(353127..356606)
                     /locus_tag="Mesop_0320"
                     /note="COGs: COG4231 Indolepyruvate ferredoxin
                     oxidoreductase alpha and beta subunits;
                     InterPro IPR019752;
                     KEGG: mlo:mlr5175 indolepyruvate ferredoxin
                     oxidoreductase;
                     PFAM: Pyruvate/ketoisovalerate oxidoreductase;
                     SPTR: Pyruvate ferredoxin/flavodoxin oxidoreductase;
                     PFAM: Pyruvate ferredoxin/flavodoxin oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyruvate/ketoisovalerate oxidoreductase"
                     /protein_id="YP_004608909.1"
                     /db_xref="GI:337264854"
                     /db_xref="GeneID:10824127"
                     /translation="MTLHDVALDDKFDLGKERIFLSGAQAVIRMLLMQRERDRRAGLN
                     TAGFVSGYRGSPLGGLDMQLWKAKKQLAGADIVFQPGLNEELAATACWGSQQTELLGE
                     GTHDGVFSVWYGKGPGVDRSGDVFRHANLAGSSKHGGVLALMGDDHMAESSTNAHATE
                     FLFVDTMVPILNPAGVQEIIDYGLYGFAMSRFAGTWAAIKCVKDNIESTASVDASLER
                     LNIVVPEFDMPPGGLNIRHEIDMLGQEERLHEHKRAAASAFIHANGLNRIVYSGGRSP
                     KIGIITLGKSYLDVRQALEDIGIDEAAANRIGVRLFKVGCPWPLDLHHIADFARGLDT
                     IVVVEEKRSLIEVQLRESLYGTASQPVIVGKKDERGDWLFPAKGALDPNEIAIALGEK
                     IVKTIGPSEEISARVGKLRQFQAMLADATDIGSRTPFFCSGCPHNSSTKVPDGSIAAA
                     GIGCHFMALWMDRNTLGFTAMGGEGAQWVGQAPFSKRDHIFQNLGDGTYNHSGTLAIR
                     FALSSEANITYKILYNDAVAMTGGQPHEGGLTVEMIARQVRAEGVDRIAIVTDEPDKY
                     AGKVEFPAGASIHHRDDLDLVQRELRDVKGVSILIYDQTCAAEKRRRRKRGTFPDPDK
                     RVFINELVCEGCGDCGVQSNCVSIQPVETEFGRKRKIDQSSCNKDFSCINGFCPSFVT
                     VHGAKIRKAEGLAGKADPLDGVPTPAEFPLGAEGWAAIIDGVGGTGVVTVGAVLGMAA
                     HLEDKGCGMIDMAGLAQKGGSVFTHVRIARTPDDIHAIRVSAGKADLVLGCDLVVSGA
                     KKVLTAVREGHTIFLANTAEIMPGEFARSADFSLPIERLKKAIRSAAGDDKAHFFDAT
                     RTATALFGNSLGANMFMLGFAFQHGGLPLSAEAVERAIELNGEAVAMNIAAFRWGRRA
                     AHQPDFVRGLVAQPGKAGQAAPVAQTLDEIIGRRVAFLTAYQNAAYGKRYADSLARLR
                     AAETKAVPGSTAVTEAAARNLFKLMAIKDEYEVARLYTDGSFAAELGKQFQSYEKLEF
                     HLAPPIMGRRGNDGKPRKSSFGPWMMKGFRLLAALKGLRGTAFDLFGYTGERRMERQL
                     LAQYEGDLELVAKSLAPGKIEAATALMSVPALIRGYGHVRQASAEKAAGERQRLLERL
                     SAASKRPELQAAE"
     misc_feature    complement(353133..356606)
                     /locus_tag="Mesop_0320"
                     /note="indolepyruvate ferredoxin oxidoreductase;
                     Validated; Region: PRK09193"
                     /db_xref="CDD:236404"
     misc_feature    complement(356001..356540)
                     /locus_tag="Mesop_0320"
                     /note="Pyrimidine (PYR) binding domain of pyruvate
                     ferredoxin oxidoreductase (PFOR), indolepyruvate
                     ferredoxin oxidoreductase alpha subunit (IOR-alpha), and
                     related proteins; Region: TPP_PYR_PFOR_IOR-alpha_like;
                     cd07034"
                     /db_xref="CDD:132917"
     misc_feature    complement(order(356109..356114,356160..356165,
                     356211..356213,356223..356225,356232..356234,
                     356283..356285,356316..356318,356325..356333,
                     356337..356342,356364..356375,356421..356423,
                     356430..356432,356442..356444,356460..356465))
                     /locus_tag="Mesop_0320"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    complement(order(356223..356225,356232..356234,
                     356283..356285,356316..356318,356325..356333,
                     356337..356342,356364..356375,356421..356426,
                     356442..356444,356448..356453,356460..356465))
                     /locus_tag="Mesop_0320"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    complement(order(356355..356357,356448..356450))
                     /locus_tag="Mesop_0320"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    complement(order(356169..356171,356442..356444))
                     /locus_tag="Mesop_0320"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:132917"
     misc_feature    complement(354789..355331)
                     /locus_tag="Mesop_0320"
                     /note="Thiamine pyrophosphate (TPP) family, IOR-alpha
                     subfamily, TPP-binding module; composed of proteins
                     similar to indolepyruvate ferredoxin oxidoreductase (IOR)
                     alpha subunit. IOR catalyzes the oxidative decarboxylation
                     of arylpyruvates, such as...; Region: TPP_IOR_alpha;
                     cd02008"
                     /db_xref="CDD:238966"
     misc_feature    complement(order(355029..355031,355035..355037,
                     355113..355124,355194..355196))
                     /locus_tag="Mesop_0320"
                     /note="TPP-binding site; other site"
                     /db_xref="CDD:238966"
     misc_feature    complement(353859..354401)
                     /locus_tag="Mesop_0320"
                     /note="Pyruvate:ferredoxin oxidoreductase and related
                     2-oxoacid:ferredoxin oxidoreductases, gamma subunit
                     [Energy production and conversion]; Region: PorG; COG1014"
                     /db_xref="CDD:223946"
     gene            complement(356824..357363)
                     /locus_tag="Mesop_0321"
                     /db_xref="GeneID:10824128"
     CDS             complement(356824..357363)
                     /locus_tag="Mesop_0321"
                     /note="KEGG: mlo:mlr5174 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608910.1"
                     /db_xref="GI:337264855"
                     /db_xref="GeneID:10824128"
                     /translation="MLRRISRSVVVGAMLIAAAALGACRDTGKDGEGKLFEVSGKIFV
                     FNYRLARATYVVTLRPLRPMGEGQVAVASFQNPAGGAPIVVEQKVWPKLGKVSLESPA
                     LTCIVKNKPYAIAISIKGADGAVLQKIDTTLMSTEDQSILPDRPLVIDQLYTANPDLA
                     GHPDGKLPGEPKPDCSKAG"
     sig_peptide     complement(357295..357363)
                     /locus_tag="Mesop_0321"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            complement(357356..357967)
                     /locus_tag="Mesop_0322"
                     /db_xref="GeneID:10824129"
     CDS             complement(357356..357967)
                     /locus_tag="Mesop_0322"
                     /note="COGs: COG5516 Conserved protein containing a
                     Zn-ribbon-like motif possibly RNA-binding;
                     InterPro IPR010852;
                     KEGG: mlo:mlr5173 hypothetical protein;
                     PFAM: protein of unknown function DUF1470;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF1470); CGNR zinc
                     finger"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608911.1"
                     /db_xref="GI:337264856"
                     /db_xref="GeneID:10824129"
                     /translation="MTVAWTPHRFTGGLLALDTANTVVLRGDPQRTFDRFDDPAEIAR
                     FAEAASGFRADELGDRRLAVSSPAAIAPVVLSIREATDRLFRGAVSKGVLATADMPGF
                     LTACAEGLAGSRTEIGAPGRPFGDPVTPIAFEAALAVSALSLLRDDTVARLRICPNCT
                     WLFVDRSRNSSRLWCDMAVCGNRQKASRHYRRRRMAAHEVKDA"
     misc_feature    complement(357371..357967)
                     /locus_tag="Mesop_0322"
                     /note="Conserved protein containing a Zn-ribbon-like
                     motif, possibly RNA-binding [General function prediction
                     only]; Region: COG5516"
                     /db_xref="CDD:227803"
     misc_feature    complement(357518..357934)
                     /locus_tag="Mesop_0322"
                     /note="Protein of unknown function (DUF1470); Region:
                     DUF1470; pfam07336"
                     /db_xref="CDD:254162"
     misc_feature    complement(357389..357514)
                     /locus_tag="Mesop_0322"
                     /note="CGNR zinc finger; Region: zf-CGNR; pfam11706"
                     /db_xref="CDD:256560"
     gene            358114..359019
                     /locus_tag="Mesop_0323"
                     /db_xref="GeneID:10824130"
     CDS             358114..359019
                     /locus_tag="Mesop_0323"
                     /note="COGs: COG0559 Branched-chain amino acid ABC-type
                     transport system permease components;
                     InterPro IPR001851;
                     KEGG: mlo:mll5172 ABC transporter, permease protein;
                     PFAM: inner-membrane translocator;
                     SPTR: Inner-membrane translocator;
                     PFAM: Branched-chain amino acid transport system /
                     permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_004608912.1"
                     /db_xref="GI:337264857"
                     /db_xref="GeneID:10824130"
                     /translation="MLYFFQQVLNGLHSGALYALLAFGYVLTNGILHRTNLAYGALFA
                     FCGQAMILTVAFGYQVLWLTLLASVLLGVVAALLYAALISHVLSRSVFEPLADRTPNA
                     IVVTTLGILLVLSEASRIAADTHDLWLPPMLAQPIVFAEGAGFKATLTLIQVLDCAAV
                     LAAVLLATWVFARSSFGRSWRAVSDDPGAAALCGVDVRTVFRRAVLYGGLCAALAGVM
                     ASLYYGNVSFGSGLVYGLKILFVTAVGGYLSPPRAALGAAAFGMAESLWAGYFPIEWR
                     DAWMYLFLVAMLVLIGAGRDTSKVV"
     misc_feature    358144..358983
                     /locus_tag="Mesop_0323"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    358675..358731
                     /locus_tag="Mesop_0323"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            359204..359788
                     /locus_tag="Mesop_0324"
                     /db_xref="GeneID:10824131"
     CDS             359204..359788
                     /locus_tag="Mesop_0324"
                     /note="COGs: COG4665 TRAP-type mannitol/chloroaromatic
                     compound transport system small permease component;
                     InterPro IPR007387;
                     KEGG: mlo:mll5171 hypothetical protein;
                     PFAM: Tripartite ATP-independent periplasmic transporter
                     DctQ component;
                     SPTR: Tripartite ATP-independent periplasmic transporter
                     DctQ component;
                     PFAM: Tripartite ATP-independent periplasmic transporters,
                     DctQ component"
                     /codon_start=1
                     /transl_table=11
                     /product="Tripartite ATP-independent periplasmic
                     transporter subunit DctQ"
                     /protein_id="YP_004608913.1"
                     /db_xref="GI:337264858"
                     /db_xref="GeneID:10824131"
                     /translation="MAGLLALSRAIDRLNEFIGKSVSWLILLAILVSAVNAVIRKVFD
                     ISSNAWLELQWYLFGAAFMLAAAYTLKQNEHIRIDIVYGLFSRRVQHWIDLLGHLLFL
                     MPFVTLMVFYFVPYVRLSFHSGEMSNNSGGLIVWPAKAILLVGFFLLALQGISEIIKK
                     IAIIRGDMDDPTPFISVHEQAELEAKALADEVRS"
     misc_feature    359204..359749
                     /locus_tag="Mesop_0324"
                     /note="TRAP-type mannitol/chloroaromatic compound
                     transport system, small permease component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: FcbT2; COG4665"
                     /db_xref="CDD:227011"
     gene            359788..361575
                     /locus_tag="Mesop_0325"
                     /db_xref="GeneID:10824132"
     CDS             359788..361575
                     /locus_tag="Mesop_0325"
                     /note="COGs: COG4664 TRAP-type mannitol/chloroaromatic
                     compound transport system large permease component;
                     InterPro IPR010656:IPR004681;
                     KEGG: mlo:mll5170 hypothetical protein;
                     PFAM: TRAP C4-dicarboxylate transport system permease DctM
                     subunit;
                     SPTR: TRAP dicarboxylate transporter, DctM subunit;
                     TIGRFAM: TRAP dicarboxylate transporter, DctM subunit;
                     PFAM: DctM-like transporters;
                     TIGRFAM: TRAP transporter, DctM subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP dicarboxylate transporter subunit DctM"
                     /protein_id="YP_004608914.1"
                     /db_xref="GI:337264859"
                     /db_xref="GeneID:10824132"
                     /translation="MEFIAQNMAPIMFASLILFMLIGYPVAFSLAANGLMFFFIGVLL
                     TPYSGGAINLAWPLLYALPDNFYGSRVMSNDTLLAIPFFTFMGIVLERSGMAEDLLDT
                     IGQLFGPIRGGLAYAVIFVGALLAATTGVVAASVIAMGLISLPIMLRYGYDRRLASGV
                     IAASGTLAQIIPPSLVLIVLADQLGRSVGDMYAGALIPGLVLTGLYAFYILIVSIFRP
                     KMMPALPLEARTLGHGVMSLLVALVATVAISYAAYRYLAPAHGDNADILGATAGVIVI
                     YIVAITDRRLNIHMMSRLAQQVVIVLIPPLALIFLVLGTIFLGIATPTEGGAMGAVGA
                     LAMAAAKGRLSLDVIKQALASTTRLSSFVLFILIGARVFSLTFYGVNGQIWVEHLLTS
                     LPGGEVGFLIGVNILVFFLAFFLDFFELAFIIVPLLAPAADKLGIDLIWFGVLLGVNM
                     QTSFMHPPFGFALFYLRSVAARVPYLDRLTGKQVAPVTTGQIYWGAVPFVLIQVIMIG
                     LTISFPQMVMRYKGTATDAGTIDYKVPEMPSLSPLSAPQGGSAPANGGNGPAAPGTPD
                     LSQPPSFGDAPPAKPATPTPDLSQPPSFN"
     sig_peptide     359788..359880
                     /locus_tag="Mesop_0325"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    359794..361365
                     /locus_tag="Mesop_0325"
                     /note="TRAP-type mannitol/chloroaromatic compound
                     transport system, large permease component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: FcbT3; COG4664"
                     /db_xref="CDD:227010"
     misc_feature    359824..361335
                     /locus_tag="Mesop_0325"
                     /note="DctM-like transporters; Region: DctM; pfam06808"
                     /db_xref="CDD:253922"
     gene            361589..362617
                     /locus_tag="Mesop_0326"
                     /db_xref="GeneID:10824133"
     CDS             361589..362617
                     /locus_tag="Mesop_0326"
                     /note="COGs: COG1063 Threonine dehydrogenase and related
                     Zn-dependent dehydrogenase;
                     InterPro IPR002328:IPR013154:IPR013149;
                     KEGG: mlo:mll5168 2,3-butanediol dehydrogenase;
                     PFAM: Alcohol dehydrogenase GroES domain protein; Alcohol
                     dehydrogenase zinc-binding domain protein;
                     SPTR: Alcohol dehydrogenase GroES domain protein;
                     PFAM: Alcohol dehydrogenase GroES-like domain;
                     Zinc-binding dehydrogenase;
                     TIGRFAM: 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide
                     A dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase GroES domain-containing
                     protein"
                     /protein_id="YP_004608915.1"
                     /db_xref="GI:337264860"
                     /db_xref="GeneID:10824133"
                     /translation="MRAVRLEAVGSISLREVDRPVPGPNDLLVRVEACGVCGTDRHLF
                     HGEFPCRPPVTPGHEFSGIIEAVGAEVSGFAVGDRVTGDPNIACGRCPHCHAGRVNLC
                     RNLNAIGIHRDGGFADYVVLPQKQAFILPAALKPTHGAFCEPLGCCLHGVDLAEIKPG
                     SSVVVLGGGVIGLLTVQLARLAGATTIILSTRQASRRTLAEELGATATVDPTAGDVID
                     AIAGPAGLMPGGVDVVFECAGVRETVEQSMRLARAGGTVVIVGVTPQGMKVEFEPFDL
                     LFRELKVLGSFLNPYTHRRAAELIASGAIEIDRLISRQVTLEEAPAVIANPPAPGEVK
                     VLVVPGLG"
     misc_feature    361589..362605
                     /locus_tag="Mesop_0326"
                     /note="Threonine dehydrogenase and related Zn-dependent
                     dehydrogenases [Amino acid transport and metabolism /
                     General function prediction only]; Region: Tdh; COG1063"
                     /db_xref="CDD:223991"
     misc_feature    361589..362602
                     /locus_tag="Mesop_0326"
                     /note="L-threonine dehydrogenase; Region:
                     threonine_DH_like; cd08234"
                     /db_xref="CDD:176196"
     misc_feature    order(361697..361705,361712..361714,362015..362017,
                     362027..362029,362087..362104,362159..362164,
                     362174..362176,362219..362221,362297..362302,
                     362306..362308,362366..362371,362444..362452)
                     /locus_tag="Mesop_0326"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176196"
     misc_feature    order(361697..361699,361703..361705,361760..361762,
                     362015..362017)
                     /locus_tag="Mesop_0326"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176196"
     gene            complement(362696..363805)
                     /locus_tag="Mesop_0327"
                     /db_xref="GeneID:10824134"
     CDS             complement(362696..363805)
                     /locus_tag="Mesop_0327"
                     /note="COGs: COG4663 TRAP-type mannitol/chloroaromatic
                     compound transport system periplasmic component;
                     InterPro IPR017909:IPR018389:IPR006311;
                     KEGG: mlo:mlr5166 periplasmic mannitol-binding protein;
                     SmoM;
                     PFAM: Extracellular solute-binding protein, family 7;
                     SPTR: TRAP dicarboxylate transporter-DctP subunit;
                     PFAM: Bacterial extracellular solute-binding protein,
                     family 7;
                     TIGRFAM: Tat (twin-arginine translocation) pathway signal
                     sequence"
                     /codon_start=1
                     /transl_table=11
                     /product="family 7 extracellular solute-binding protein"
                     /protein_id="YP_004608916.1"
                     /db_xref="GI:337264861"
                     /db_xref="GeneID:10824134"
                     /translation="MDRRSFIRKAGVTGVGAAAAAATLAAPAIAQSNPKVTWRLASSF
                     PKSLDTIYGGAEVFSKMLSEATDGNFQIQVFAAGELVPGLQAADAATAGTVEACHTVA
                     YYYWGKDPTWALGAAVPFSLNARGMNAWHYHGGGIDLFNEFLATQGLFGLPGGNTGVQ
                     MGGWFRKEINTVADLSGLKMRIGGFAGKVVQKLGVVPQQIAGGDIYPALEKGTIDAAE
                     WVGPYDDEKLGFYKVAPYYYYPGWWEGGPTVHLMFNKAKYEELSPTYKSLLRTCAQAA
                     DANMLQKYDYLNPPAVKRLVAGGAKLRPFSQDIMAACFEKANEVYAEMEASNAPFKKI
                     WDSIKGFRKEHYLWAQVAEYNYDTFMMVQQRNGKL"
     misc_feature    complement(362720..363805)
                     /locus_tag="Mesop_0327"
                     /note="TRAP-type mannitol/chloroaromatic compound
                     transport system, periplasmic component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: FcbT1; COG4663"
                     /db_xref="CDD:227009"
     sig_peptide     complement(363716..363805)
                     /locus_tag="Mesop_0327"
                     /note="Signal predicted by SignalP 3.0 HMM"
     STS             363586..364094
                     /standard_name="ha2356"
                     /db_xref="UniSTS:515533"
     gene            363997..364842
                     /locus_tag="Mesop_0328"
                     /db_xref="GeneID:10824135"
     CDS             363997..364842
                     /locus_tag="Mesop_0328"
                     /EC_number="3.5.1.94"
                     /note="COGs: COG2071 glutamine amidotransferase;
                     InterPro IPR017926:IPR011697;
                     KEGG: mlo:mll5165 hypothetical protein;
                     PFAM: peptidase C26;
                     PRIAM: Gamma-glutamyl-gamma-aminobutyrate hydrolase;
                     SPTR: Peptidase C26;
                     PFAM: Peptidase C26"
                     /codon_start=1
                     /transl_table=11
                     /product="Gamma-glutamyl-gamma-aminobutyrate hydrolase"
                     /protein_id="YP_004608917.1"
                     /db_xref="GI:337264862"
                     /db_xref="GeneID:10824135"
                     /translation="MEKCPEIAYFEGRTFLAQMENRAKMQQPLVAISTDVRRFDNYTW
                     HAAPQQYLEAAITGAGVFPLLVPSFGDRLDFDELLSSVDGVMVTGSKSNVHPSLYGGD
                     ASEANGPYDPARDATTLPLIRKAIERGVPLLAICRGIQELNVALGGTLGTEIQEREGS
                     LDHRAPVSDKQDERFAIHQTISIKPGSCLAGVFGAGDMKVNSLHRQAIDRLGSKLEVE
                     AVATDGTVEAVSVRGARAFAVGVQWHPEYWVKSDSNSVKIFRAFGDAVRLHAAAKAGA
                     RAAAE"
     misc_feature    364069..364803
                     /locus_tag="Mesop_0328"
                     /note="Predicted glutamine amidotransferases [General
                     function prediction only]; Region: COG2071"
                     /db_xref="CDD:224982"
     misc_feature    364084..364785
                     /locus_tag="Mesop_0328"
                     /note="Subgroup of proteins having the Type 1 glutamine
                     amidotransferase (GATase1) domain; Region: GATase1_2;
                     cd01745"
                     /db_xref="CDD:153216"
     misc_feature    order(364402..364404,364726..364728,364732..364734)
                     /locus_tag="Mesop_0328"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153216"
     gene            complement(364843..365247)
                     /locus_tag="Mesop_0329"
                     /db_xref="GeneID:10824136"
     CDS             complement(364843..365247)
                     /locus_tag="Mesop_0329"
                     /note="KEGG: mlo:mlr5164 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608918.1"
                     /db_xref="GI:337264863"
                     /db_xref="GeneID:10824136"
                     /translation="MKTLSALIAAAALFGGIQLYHGGTWESAANEPAPSNTYRLVANG
                     DEAACAVSRGAEISDGLSLLSVAPACRRLLPGIEQAKFWREQTDGSVAFSANGIDPIV
                     TFSIADGNGYESYAPATPLLSLAATGGLKSED"
     sig_peptide     complement(365182..365247)
                     /locus_tag="Mesop_0329"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            complement(365333..366316)
                     /locus_tag="Mesop_0330"
                     /db_xref="GeneID:10824137"
     CDS             complement(365333..366316)
                     /locus_tag="Mesop_0330"
                     /note="COGs: COG1052 Lactate dehydrogenase and related
                     dehydrogenase;
                     InterPro IPR006139:IPR006140;
                     KEGG: mlo:mlr5162 glycerate dehydrogenase;
                     PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
                     catalytic region;
                     SPTR: D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding;
                     PFAM: D-isomer specific 2-hydroxyacid dehydrogenase, NAD
                     binding domain; D-isomer specific 2-hydroxyacid
                     dehydrogenase, catalytic domain"
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding protein"
                     /protein_id="YP_004608919.1"
                     /db_xref="GI:337264864"
                     /db_xref="GeneID:10824137"
                     /translation="MTKAEELQAVAILVPAGFSDHAVERIERTFRRIGIERADAALVT
                     DEMRSTVRGIASFAGINAAMMDALPNLELIASFGVGYDSVDVGHAAAKNIMVTNTPDV
                     LTEEVADTAIGLLINTIRDLPRAETWLRDGSWAKKGEYPLSRLTLRARRVGIFGMGRI
                     GRAIARRLEAFGLPVAYHNRHRVEGLAYQYHPTLKGLAEAVDTLISVAPGGASTQKAV
                     NAEILVALGANGVFVNIGRGSTVDEAALAAALANGTIAAAGLDVFAAEPNVPKALLDA
                     PNASLLPHVGSASQHTRRAMADLCVDNLVSWFGERRPLTPVPETANVRARG"
     misc_feature    complement(365357..366289)
                     /locus_tag="Mesop_0330"
                     /note="Lactate dehydrogenase and related dehydrogenases
                     [Energy production and conversion / Coenzyme metabolism /
                     General function prediction only]; Region: LdhA; COG1052"
                     /db_xref="CDD:223980"
     misc_feature    complement(365390..366289)
                     /locus_tag="Mesop_0330"
                     /note="Hydroxy(phenyl)pyruvate Reductase,
                     D-isomer-specific 2-hydroxyacid-related dehydrogenase;
                     Region: HPPR; cd12156"
                     /db_xref="CDD:240633"
     misc_feature    complement(order(365465..365467,365606..365608,
                     366008..366010,366077..366085))
                     /locus_tag="Mesop_0330"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240633"
     misc_feature    complement(order(365456..365461,365465..365467,
                     365534..365536,365606..365614,365675..365677,
                     365690..365698,365774..365785,365837..365851,
                     365996..365998,366077..366082))
                     /locus_tag="Mesop_0330"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240633"
     misc_feature    complement(order(365465..365467,365519..365521,
                     365606..365608))
                     /locus_tag="Mesop_0330"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240633"
     gene            complement(366313..367290)
                     /locus_tag="Mesop_0331"
                     /db_xref="GeneID:10824138"
     CDS             complement(366313..367290)
                     /locus_tag="Mesop_0331"
                     /note="COGs: COG1609 Transcriptional regulators;
                     InterPro IPR000843:IPR001761;
                     KEGG: mlo:mlr5161 transcriptional regulator;
                     PFAM: periplasmic binding protein/LacI transcriptional
                     regulator;
                     SMART: regulatory protein LacI;
                     SPTR: Transcriptional regulator, LacI family;
                     PFAM: family"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_004608920.1"
                     /db_xref="GI:337264865"
                     /db_xref="GeneID:10824138"
                     /translation="MSTATVSLALRDSPLVAGSTRDRIKEHARAIGYIYNRRAASLRT
                     SRSGIVGVVVHDIMNPFFAEILRSIESELDRSRQTFILSNHYDQLEKQRTFIDTLLQL
                     GADGVIMSPAIGTPASDILMAEENGLPAVLIARTVEGADVPVFRGDDAYGTGLATNHL
                     ISLGHKRIAMIGGTDQTSTGRDRYQGYVNAMEAAGLEVRPSWRIAGPRTKQAGFEAAG
                     QFLALKDRPTAACCWNDLVAIGLMNGIARAGLVPGVDISVTGYDDLEEAAIATPALTT
                     VWNGQREVGRRAASALLDKLNGQTVRPSQELIKPELHVRQSTGKPVERA"
     misc_feature    complement(366328..367287)
                     /locus_tag="Mesop_0331"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(367159..367287)
                     /locus_tag="Mesop_0331"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(367162..367167,367171..367176,
                     367183..367185,367192..367194,367231..367233,
                     367240..367245,367258..367260,367267..367272,
                     367276..367287))
                     /locus_tag="Mesop_0331"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(367165..367194)
                     /locus_tag="Mesop_0331"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(366343..367146)
                     /locus_tag="Mesop_0331"
                     /note="Ligand-binding domain of MalI, a transcription
                     regulator of the maltose system of Escherichia coli and
                     its close homologs from other bacteria; Region:
                     PBP1_MalI_like; cd06289"
                     /db_xref="CDD:107284"
     misc_feature    complement(order(366550..366555,366562..366564,
                     366574..366576,366658..366660,366982..366990,
                     366997..366999,367006..367008,367039..367041,
                     367045..367059,367078..367083,367087..367092,
                     367099..367107,367144..367146))
                     /locus_tag="Mesop_0331"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107284"
     misc_feature    complement(order(366454..366456,366505..366507,
                     366667..366669,366742..366744,366850..366852,
                     366889..366891,366961..366963,367096..367098,
                     367105..367110))
                     /locus_tag="Mesop_0331"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107284"
     gene            complement(367414..368355)
                     /locus_tag="Mesop_0332"
                     /db_xref="GeneID:10824139"
     CDS             complement(367414..368355)
                     /locus_tag="Mesop_0332"
                     /note="InterPro IPR000620;
                     KEGG: mlo:mlr5160 hypothetical protein;
                     PFAM: protein of unknown function DUF6 transmembrane;
                     SPTR: Mlr5160 protein;
                     manually curated;
                     PFAM: EamA-like transporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608921.1"
                     /db_xref="GI:337264866"
                     /db_xref="GeneID:10824139"
                     /translation="MNAPQRHPESATPPVAILCMLSTYVFFTFLDTSSKYLVLAGVSV
                     LIVAWVRFAVHVVLVGALLRGWRQPVRFRPVNLPAHVLRGLFLFGSTIFNVLALRSLQ
                     LAETTSIYFFGPMVITALAGPLLGEWAGWRRWLAIVAAFAGVLIITRPGVGVFGIGHL
                     FALGSMLSNCFYVIMTRRMSATETSESLILFSALAPAVLLLPLLPFSFSLPHDGWHWF
                     ILLMLGVFGGVGHWLLVQAYRLATTTALAPYPYSQMVWMIISGWIVFKQFPDRWTLLG
                     AAIIVASGLYIVHREHRLRLQSRAASDVEAEALAKKL"
     misc_feature    complement(367474..368316)
                     /locus_tag="Mesop_0332"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    complement(367909..368283)
                     /locus_tag="Mesop_0332"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            complement(368497..368904)
                     /locus_tag="Mesop_0333"
                     /db_xref="GeneID:10824140"
     CDS             complement(368497..368904)
                     /locus_tag="Mesop_0333"
                     /note="COGs: COG4954 conserved hypothetical protein;
                     InterPro IPR018988;
                     KEGG: mlo:mlr5159 hypothetical protein;
                     PFAM: Protein of unknown function DUF2000;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF2000)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608922.1"
                     /db_xref="GI:337264867"
                     /db_xref="GeneID:10824140"
                     /translation="MFDTKFAIVLREDLPVWQKLNVTAFLTSGIVAQFPGIIGEPYRD
                     RSGNLYNPLSIQPVIVLSADQATLAAIHRRTLERGVTTSLYVEEMFSTGFDAANRAVF
                     AEFAPEDAKVVGIALRADKKVVDKITKGARMHA"
     misc_feature    complement(368500..368904)
                     /locus_tag="Mesop_0333"
                     /note="Protein of unknown function (DUF2000); Region:
                     DUF2000; cl02074"
                     /db_xref="CDD:242867"
     gene            368952..369827
                     /locus_tag="Mesop_0334"
                     /db_xref="GeneID:10824141"
     CDS             368952..369827
                     /locus_tag="Mesop_0334"
                     /note="COGs: COG2207 AraC-type DNA-binding
                     domain-containing protein;
                     InterProIPR018062:IPR018060:IPR003313:IPR000005:IPR
                     020449;
                     KEGG: mlo:mll5158 transcriptional regulator;
                     PFAM: AraC protein arabinose-binding/dimerisation;
                     helix-turn-helix- domain containing protein AraC type;
                     SMART: Helix-turn-helix, AraC domain;
                     SPTR: Transcriptional regulator, AraC family;
                     PFAM: Bacterial regulatory helix-turn-helix proteins, AraC
                     family; AraC-like ligand binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_004608923.1"
                     /db_xref="GI:337264868"
                     /db_xref="GeneID:10824141"
                     /translation="MSHDLGSQAFEGLGRLCADAAENCIISAPDPAGMERIEARFHGS
                     AFDLHRHDTYAIGVTLQGVQTFRYRGETRVSLPGQIIVLHPDELHDGGAGTEDGLRYR
                     MLYLEPSLMLDCLGGASLPFVRDAVVTDDAFCATLLSALGPLEQELDELFVDDFLAQL
                     MQRLSRHAGQPGKPIARTAWQAAAAARDYLTENLNRPVGSGELEAITGLDRYALSRHF
                     RAAFSTSPHRFLVMRRLQHARRMIIAGEPLAQIAVEAGFSDQSHFNRQFKKAFGMTPG
                     RWSSLIRGPAAMAAA"
     misc_feature    369042..369434
                     /locus_tag="Mesop_0334"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:145456"
     misc_feature    369558..369785
                     /locus_tag="Mesop_0334"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     misc_feature    <369690..369785
                     /locus_tag="Mesop_0334"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(369844..370314)
                     /locus_tag="Mesop_0335"
                     /db_xref="GeneID:10824142"
     CDS             complement(369844..370314)
                     /locus_tag="Mesop_0335"
                     /note="COGs: COG1846 Transcriptional regulators;
                     InterPro IPR000835;
                     KEGG: mlo:mlr5157 hypothetical protein;
                     PFAM: regulatory protein MarR;
                     SMART: regulatory protein MarR;
                     SPTR: Transcriptional regulator, MarR family;
                     PFAM: MarR family"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_004608924.1"
                     /db_xref="GI:337264869"
                     /db_xref="GeneID:10824142"
                     /translation="MAKADKTATMSRLHSAARLARTALAARLLAHGFYAGQDQIMLAL
                     DREDGQTPGNLAGRLGVRPPTITKTINRLQAQGFLEKRASEADARQAHIFLTDTGRET
                     IRAIEKSVKKTEKQALKGLDKKDQKALFKLLARIEANLSNEELVLMDDDAESDD"
     sig_peptide     complement(370240..370314)
                     /locus_tag="Mesop_0335"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    complement(369901..370224)
                     /locus_tag="Mesop_0335"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(369937..370224)
                     /locus_tag="Mesop_0335"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     misc_feature    complement(order(370069..370074,370090..370095,
                     370099..370104,370111..370116,370120..370131,
                     370156..370164))
                     /locus_tag="Mesop_0335"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(370153..370155,370162..370164))
                     /locus_tag="Mesop_0335"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            370735..371787
                     /locus_tag="Mesop_0336"
                     /db_xref="GeneID:10824143"
     CDS             370735..371787
                     /locus_tag="Mesop_0336"
                     /note="COGs: COG0523 Putative GTPase (G3E family);
                     InterPro IPR002227:IPR003495:IPR011629;
                     KEGG: mlo:mll5156 hypothetical protein;
                     PFAM: cobalamin synthesis protein P47K; cobalamin
                     synthesis CobW domain protein;
                     SPTR: Cobalamin synthesis protein P47K;
                     PFAM: Cobalamin synthesis protein cobW C-terminal domain;
                     CobW/HypB/UreG, nucleotide-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin synthesis protein P47K"
                     /protein_id="YP_004608925.1"
                     /db_xref="GI:337264870"
                     /db_xref="GeneID:10824143"
                     /translation="MSDAQTQIPVTVLTGYLGAGKTTLLNRILSESHGKRYAVIVNEF
                     GEIGIDNDLIVESDEEIYEMNNGCVCCTVRGDLIRVVEGLMRRPGRFDAIVVETTGLA
                     DPVPVAQTFFMDDDVRSKTKLDAVVALVDAKHLPLRLKDSREAEDQIAFADVVVLNKT
                     DLVTPEELAKVEATIRAINPAARIHRTTRAGVALSEVLDRGAFDLSKALENDPHFLEA
                     HDDHDHHHHDHDGHDHHDHDRHDHHHHAHPSDIHDVTVQSVSLRGGEMDPKKFFPWIE
                     KITQMEGPNILRLKGIIALKSDDERYVIQGVHMIIEGDHQRAWKDGEKHESRLVFIGR
                     ELDAERLKKSFDACQA"
     misc_feature    370756..371784
                     /locus_tag="Mesop_0336"
                     /note="Putative GTPases (G3E family) [General function
                     prediction only]; Region: COG0523"
                     /db_xref="CDD:223597"
     misc_feature    370759..371220
                     /locus_tag="Mesop_0336"
                     /note="The function of this protein family is unkown. The
                     amino acid sequence of YjiA protein in E. coli contains
                     several conserved motifs that characterizes it as a P-loop
                     GTPase. YijA gene is among the genes significantly induced
                     in response to DNA-damage...; Region: CobW_like; cd03112"
                     /db_xref="CDD:239386"
     misc_feature    370777..370800
                     /locus_tag="Mesop_0336"
                     /note="P-loop, Walker A motif; other site"
                     /db_xref="CDD:239386"
     misc_feature    371206..371217
                     /locus_tag="Mesop_0336"
                     /note="Base recognition motif; other site"
                     /db_xref="CDD:239386"
     misc_feature    371500..371778
                     /locus_tag="Mesop_0336"
                     /note="Cobalamin synthesis protein cobW C-terminal domain;
                     Region: CobW_C; pfam07683"
                     /db_xref="CDD:254355"
     gene            371847..372125
                     /locus_tag="Mesop_0337"
                     /db_xref="GeneID:10824144"
     CDS             371847..372125
                     /locus_tag="Mesop_0337"
                     /note="COGs: COG4453 conserved hypothetical protein;
                     InterPro IPR014795;
                     KEGG: rlt:Rleg2_4306 protein of unknown function DUF1778;
                     PFAM: Protein of unknown function DUF1778;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Protein of unknown function (DUF1778)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608926.1"
                     /db_xref="GI:337264871"
                     /db_xref="GeneID:10824144"
                     /translation="MPRTADNKTERYQIRIAPAQKAMIARAAALSHQDVADFILNKVV
                     PEAQAVIEAAEVTKVSDRDFTRILDLLEHPPKPNAKLRAAIAALPDTL"
     misc_feature    371877..372116
                     /locus_tag="Mesop_0337"
                     /note="Protein of unknown function (DUF1778); Region:
                     DUF1778; pfam08681"
                     /db_xref="CDD:254971"
     gene            372122..372649
                     /locus_tag="Mesop_0338"
                     /db_xref="GeneID:10824145"
     CDS             372122..372649
                     /locus_tag="Mesop_0338"
                     /note="KEGG: rlt:Rleg2_4307 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     manually curated"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608927.1"
                     /db_xref="GI:337264872"
                     /db_xref="GeneID:10824145"
                     /translation="MTLPSWHEEAIAKRHNRTSFDCGDAQMNDFMRRFARQSHEQNAA
                     KTFCAIDDAAPERILGFYTIAPSAVVHGNVPAAMTKGLARHEVSGFKLARLATDRTAA
                     GQGLGGQLLAAAALRCLRLASEGGGILLIIDAKSERAAKWYASYGAERLQGSDLTLAM
                     PLATFATDLRLKGLL"
     gene            372757..373731
                     /locus_tag="Mesop_0339"
                     /db_xref="GeneID:10824146"
     CDS             372757..373731
                     /locus_tag="Mesop_0339"
                     /note="COGs: COG2319 FOG: WD40 repeat;
                     KEGG: mlo:mll5154 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     PFAM: WD domain, G-beta repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608928.1"
                     /db_xref="GI:337264873"
                     /db_xref="GeneID:10824146"
                     /translation="MPTVAPLDLEGHCLAAVFLGDVPHFVLADGAVHRLDNGHKTVQA
                     NDGLLAAFHDAANDRLITGGEDGKVFAVKAGGEAQELASAGKKWITSVAAGPQGAIAY
                     ATGKTAFVRFADGKTREFVHPRSVEGLAFSPKGMRFGVARYNGATLHFPAAEGKPVEL
                     EWAGAHTGITFSPDGAFLVTTMQENALHGWKLADGKHMRMTGYPGKVKSLSWSVKGKW
                     LASSGAPAAIVWPFSGKDGPMGKAPLELGTRGNAMVTAVACHPSQDVVAVGYDDGMVM
                     AVRFSDAKEVLLRRPGKGAITSMMWDKEERRIAFGSAAGDCGVIDITA"
     misc_feature    372760..373722
                     /locus_tag="Mesop_0339"
                     /note="FOG: WD40 repeat [General function prediction
                     only]; Region: COG2319"
                     /db_xref="CDD:225201"
     misc_feature    372835..373581
                     /locus_tag="Mesop_0339"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cd00200"
                     /db_xref="CDD:238121"
     misc_feature    order(372868..372873,372940..372942,372952..372954,
                     372964..372969,373003..373008,373060..373062,
                     373075..373077,373093..373098,373120..373122,
                     373171..373173,373186..373188,373204..373209,
                     373249..373254,373294..373296,373306..373308,
                     373324..373329,373360..373365,373414..373416,
                     373444..373446,373462..373464,373501..373506,
                     373558..373560,373570..373572)
                     /locus_tag="Mesop_0339"
                     /note="structural tetrad; other site"
                     /db_xref="CDD:238121"
     gene            complement(373747..374199)
                     /locus_tag="Mesop_0340"
                     /db_xref="GeneID:10824147"
     CDS             complement(373747..374199)
                     /locus_tag="Mesop_0340"
                     /note="KEGG: mlo:mlr5151 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608929.1"
                     /db_xref="GI:337264874"
                     /db_xref="GeneID:10824147"
                     /translation="MRTIICVTALLLSVGTAFATGGIWCSVDDTAVKFQVDAGVTTGM
                     GGPIFNFRGDLEIKARPVGDQSRKTTFEDSNLTQYWLDNKELRLNIYHEQEMAKTFSS
                     VELTILTRASDEGVYDGDYKLAVYDSTADKDSDGKPVDLTGKVSCSAE"
     sig_peptide     complement(374143..374199)
                     /locus_tag="Mesop_0340"
                     /note="Signal predicted by SignalP 3.0 HMM"
     gene            374358..375737
                     /locus_tag="Mesop_0341"
                     /db_xref="GeneID:10824148"
     CDS             374358..375737
                     /locus_tag="Mesop_0341"
                     /note="COGs: COG0001 Glutamate-1-semialdehyde
                     aminotransferase;
                     InterPro IPR005814;
                     KEGG: mlo:mll5149 aminotransferase;
                     PFAM: aminotransferase class-III;
                     SPTR: Aminotransferase class-III;
                     PFAM: Aminotransferase class-III"
                     /codon_start=1
                     /transl_table=11
                     /product="class III aminotransferase"
                     /protein_id="YP_004608930.1"
                     /db_xref="GI:337264875"
                     /db_xref="GeneID:10824148"
                     /translation="MHSDMSKTAIGGISRDRIANLRETEGEVFRKARPKSQAKVGNGL
                     PGFFGGVPMHWMNDWPTPFPILVDSARGATITDIDGNRLDDFCLGDTGSMFGHSPPAV
                     ARAIRRQAGRGLTYMLPSEDALAIGPLLQQRFGLPFWQIATTATDANRFALRVARAVT
                     GREKILVFNGCYHGSVDETMVRLIDGKPINRPGLAGEFRDLTRTAKVIEFNDIPALEA
                     ALKDKDVACVIAEPVLTNSCMVLADPGFHDALRRLTRATGTLLLIDETHTISTGPGGY
                     TRKYGLDPDLFVLGKPIAGGVPASVWGMSDEVASRYADYNRTKEPGYSGMGTTLSANP
                     LQFATMRATLEEVMTEDNYDRMDHLARRLDAGLTGVIDRYNLPWHVARVGARVEFICA
                     PGPLRNGAEAEGAHAPELEAAIHVALVNRGVLIAPFHNMMLISPATSGAQVNRLIAAF
                     GAVAAKLAA"
     misc_feature    374445..375734
                     /locus_tag="Mesop_0341"
                     /note="Glutamate-1-semialdehyde aminotransferase [Coenzyme
                     metabolism]; Region: HemL; COG0001"
                     /db_xref="CDD:223080"
     misc_feature    374517..375716
                     /locus_tag="Mesop_0341"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(374787..374795,374871..374876,374880..374882,
                     375048..375050,375147..375149,375153..375158,
                     375228..375230)
                     /locus_tag="Mesop_0341"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(374790..374795,374871..374876,375048..375050,
                     375147..375149,375156..375158,375228..375230)
                     /locus_tag="Mesop_0341"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    375228..375230
                     /locus_tag="Mesop_0341"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            375749..377149
                     /locus_tag="Mesop_0342"
                     /db_xref="GeneID:10824149"
     CDS             375749..377149
                     /locus_tag="Mesop_0342"
                     /note="COGs: COG0174 Glutamine synthetase;
                     InterPro IPR008146;
                     KEGG: mlo:mll5148 glutamine synthetase;
                     PFAM: glutamine synthetase catalytic region;
                     SPTR: Glutamine synthetase catalytic region;
                     PFAM: Glutamine synthetase, catalytic domain"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase catalytic subunit"
                     /protein_id="YP_004608931.1"
                     /db_xref="GI:337264876"
                     /db_xref="GeneID:10824149"
                     /translation="MDNAIVTSPSGSSPTEAQAFLDAHPEIEAFDIVLTDANGVGRGK
                     IVRRHELKSIFEGGRHMPISILGLDITGEDVHETGLIWTTGDGDLRAWPIPGTLVPLH
                     GTNPPRGQVLMAMYHLEGQPMSSDPRLALARQVDILAAKGLYPAGAFELEFFLLANER
                     DADGKVQPARAVLDGRVSGKTEVYSVDHLHGMEPLFSDIYAAAKVQGIPAETVISEYA
                     PGQYELTLNYRKDVMRAADDLVMLKRLVRAQARRHGVTACFMAKPIEKYAGSGMHFHV
                     SLQDKVGRNVFSEAGGENWSLPLLRGLGGLIQTMAESMLVFAPHANSWRRFVSQSYAP
                     VAPTWGVNNRSVALRVPAGDAKNRRIEHRPSGVDANPYLIAATVLAGIIKGLDEGLDP
                     GPETTGNGYEAAVTRTTMPADWRAAIEAARTSSFLKGALGEDLHRTFVAIKQSEYLRV
                     ARTVSELDYHLYLHEV"
     misc_feature    375785..377140
                     /locus_tag="Mesop_0342"
                     /note="Glutamine synthetase [Amino acid transport and
                     metabolism]; Region: GlnA; COG0174"
                     /db_xref="CDD:223252"
     misc_feature    376121..376888
                     /locus_tag="Mesop_0342"
                     /note="Glutamine synthetase, catalytic domain; Region:
                     Gln-synt_C; pfam00120"
                     /db_xref="CDD:249604"
     gene            377207..377887
                     /locus_tag="Mesop_0343"
                     /db_xref="GeneID:10824150"
     CDS             377207..377887
                     /locus_tag="Mesop_0343"
                     /note="COGs: COG1573 Uracil-DNA glycosylase;
                     InterPro IPR005122:IPR005273;
                     KEGG: mlo:mll5147 hypothetical protein;
                     PFAM: Uracil-DNA glycosylase superfamily;
                     SPTR: Phage SPO1 DNA polymerase-related protein;
                     TIGRFAM: phage SPO1 DNA polymerase-related protein;
                     PFAM: Uracil DNA glycosylase superfamily;
                     TIGRFAM: uracil-DNA glycosylase, family 4"
                     /codon_start=1
                     /transl_table=11
                     /product="phage SPO1 DNA polymerase-like protein"
                     /protein_id="YP_004608932.1"
                     /db_xref="GI:337264877"
                     /db_xref="GeneID:10824150"
                     /translation="MATTGLPRNAKMPARRVSVPRAELISDETDANSIPELRDAAEGC
                     RRCPLWRNATQTVFGEGPDNAKVIFVGEQPGDQEDLAGKPFVGPAGRVFDAILVDADV
                     DRQKVYVTNAVKHFKFEPRGKRRIHSKPNAGEVQACRWWLDQEFDLIKPNLAVALGAT
                     AALSLLGKATPVMKMRGQVIEREDGLRVFITIHPSFILRIREPADKEAERERFLKDMR
                     EVKRLMAA"
     misc_feature    377336..377869
                     /locus_tag="Mesop_0343"
                     /note="Family 4 Uracil-DNA glycosylase (UDG), found
                     exclusively in thermophilic organisms; Region:
                     UDG_F4_TTUDGA_like; cd10030"
                     /db_xref="CDD:198428"
     misc_feature    order(377336..377338,377342..377347,377351..377356,
                     377363..377365,377543..377551,377615..377620,
                     377627..377629)
                     /locus_tag="Mesop_0343"
                     /note="Fe-S cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:198428"
     misc_feature    order(377417..377425,377438..377440,377456..377461,
                     377537..377539,377783..377785)
                     /locus_tag="Mesop_0343"
                     /note="active site"
                     /db_xref="CDD:198428"
     gene            complement(377897..379162)
                     /locus_tag="Mesop_0344"
                     /db_xref="GeneID:10824151"
     CDS             complement(377897..379162)
                     /locus_tag="Mesop_0344"
                     /EC_number="1.1.1.81"
                     /note="COGs: COG2379 Putative glycerate kinase;
                     InterPro IPR007835;
                     KEGG: mlo:mlr5146 hypothetical protein;
                     PFAM: MOFRL domain protein;
                     PRIAM: Hydroxypyruvate reductase;
                     SPTR: Hydroxypyruvate reductase;
                     PFAM: MOFRL family"
                     /codon_start=1
                     /transl_table=11
                     /product="Hydroxypyruvate reductase"
                     /protein_id="YP_004608933.1"
                     /db_xref="GI:337264878"
                     /db_xref="GeneID:10824151"
                     /translation="MTELDPKAFLISIFDAAVAAADPERTIRDHLPARPKGRTIVIGA
                     GKGSAQMAAAFEKVWDGPIEGLVVTRYGYGAKCERIEIIEAAHPVPDAAGLEASRRLL
                     EKVRGLTADDLVVALISGGGSALLPSPAAGLTLADEIAVNEALLASGAPIAAMNTIRK
                     HLSTIKGGRLAAAAWPAKVVSLVVSDIPGDNPALVASGPTVPDVGSREDALASISAYG
                     MKVPAAVMAHINSPAADAPDPDDQRFSRNEVHLIASAGVSLEAAAAEASRQGIEAVIL
                     SDAIEGEAREVGGVHAAIAREVATRNRPFQKPALILSGGETTVTLRAKGKGGRNSEFL
                     LAFAIGINGVEGIHALAADTDGIDGSEDNAGAFADGSTVSRMRAAGVDAKAMLAGNNA
                     WTAFNAVGDLFVPGPTGTNVNDLRAILIR"
     misc_feature    complement(377900..379162)
                     /locus_tag="Mesop_0344"
                     /note="Putative glycerate kinase [Carbohydrate transport
                     and metabolism]; Region: GckA; COG2379"
                     /db_xref="CDD:225254"
     misc_feature    complement(378476..379141)
                     /locus_tag="Mesop_0344"
                     /note="Domain of unknown function (DUF4147); Region:
                     DUF4147; pfam13660"
                     /db_xref="CDD:257967"
     misc_feature    complement(377921..378241)
                     /locus_tag="Mesop_0344"
                     /note="MOFRL family; Region: MOFRL; pfam05161"
                     /db_xref="CDD:253053"
     gene            complement(379159..379662)
                     /locus_tag="Mesop_0345"
                     /db_xref="GeneID:10824152"
     CDS             complement(379159..379662)
                     /locus_tag="Mesop_0345"
                     /note="COGs: COG4702 conserved hypothetical protein;
                     InterPro IPR005624:IPR010371;
                     KEGG: mlo:mlr5144 hypothetical protein;
                     PFAM: protein of unknown function DUF336;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Domain of unknown function (DUF336)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608934.1"
                     /db_xref="GI:337264879"
                     /db_xref="GeneID:10824152"
                     /translation="MAVAEDIALIKRQEEALVFPAFDEAVAFKIGSAIRDRALAENMP
                     VIVDIRTFDRPLFYAAMPGSNASNPDWARRKINVVRRYLRSTYRLVLEQQRPDRTFKV
                     GEGLDISDYVLAGGGFPVTVKGSGVIGVIAVSGLPEREDHGVVVDALCAHLGIDRQEL
                     ALPPEAK"
     misc_feature    complement(379174..379662)
                     /locus_tag="Mesop_0345"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG4702"
                     /db_xref="CDD:227046"
     gene            complement(380018..381334)
                     /locus_tag="Mesop_0346"
                     /db_xref="GeneID:10824153"
     CDS             complement(380018..381334)
                     /locus_tag="Mesop_0346"
                     /note="COGs: COG0402 Cytosine deaminase and related
                     metal-dependent hydrolase;
                     InterPro IPR006680:IPR017594:IPR014311;
                     KEGG: mlo:mlr5142 guanine deaminase;
                     PFAM: amidohydrolase;
                     SPTR: Guanine deaminase;
                     TIGRFAM: guanine deaminase;
                     PFAM: Amidohydrolase family;
                     TIGRFAM: guanine deaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="guanine deaminase"
                     /protein_id="YP_004608935.1"
                     /db_xref="GI:337264880"
                     /db_xref="GeneID:10824153"
                     /translation="MISILLRGRTLSFERWPQTIDDHSAWRYEEDGGLLIGDGRIVAA
                     GAYADVEKQAGEAVKKIDHRPHLLLPGFIDAHAHFPQMQVIASYGAELLDWLNTYTFP
                     EETKFANAQHGRRIARLFLDEMVRHGTTTVVAYCSVHKASTEAFFAESHDRNMLNIAG
                     KVMMDRNAPDGVLDTPQSGYDDTKALIKEWHGKGRQLYAITPRFAITSTPQQMEMAGA
                     LCREHPDLHMQTHLSENHAEIAFTQELYPWSRDYTDVYEHYGLLGKKSLFGHCVHLSE
                     READALSDSGSVAVFCPTSNLFLGSGLFDYQRYRKRDKALRIAAATDVGGGTNYSMLR
                     TMDEGYKVIALNGEKLNPFQSFWQITRGNAEALSAVERIGTLTEGTDADIVVLDANAT
                     PAMRLRMETVETLAQELFLLQTLGDDRAVREVYVAGRAAKTDMVAG"
     misc_feature    complement(380036..381334)
                     /locus_tag="Mesop_0346"
                     /note="guanine deaminase; Provisional; Region: PRK09228"
                     /db_xref="CDD:236419"
     misc_feature    complement(380051..381319)
                     /locus_tag="Mesop_0346"
                     /note="Guanine deaminase (GDEase). Guanine deaminase is an
                     aminohydrolase responsible for the conversion of guanine
                     to xanthine and ammonia, the first step to utilize guanine
                     as a nitrogen source. This reaction also removes the
                     guanine base from the pool and...; Region: GDEase;
                     cd01303"
                     /db_xref="CDD:238628"
     misc_feature    complement(order(380366..380368,380525..380527,
                     380633..380635,380642..380644,381101..381103,
                     381107..381109))
                     /locus_tag="Mesop_0346"
                     /note="active site"
                     /db_xref="CDD:238628"
     gene            complement(381337..382554)
                     /locus_tag="Mesop_0347"
                     /db_xref="GeneID:10824154"
     CDS             complement(381337..382554)
                     /locus_tag="Mesop_0347"
                     /note="COGs: COG3748 membrane protein;
                     InterPro IPR010389;
                     KEGG: mlo:mlr5140 hypothetical protein;
                     PFAM: protein of unknown function DUF989;
                     SPTR: Putative uncharacterized protein;
                     PFAM: Cytochrome c; Protein of unknown function (DUF989)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608936.1"
                     /db_xref="GI:337264881"
                     /db_xref="GeneID:10824154"
                     /translation="MMDFAIFWDWLSFAVRWLHVITGIAWIGSSFYFVALDLGLRQRP
                     GMPVGAFGEEWQVHGGGFYHIQKYLVAPAEMPEHLTWFKWESYATWLSGFAMLCVVYY
                     AGADLFLIDPNVLPMSVPVGILLSMATIGVGWVVYDLLCRSPLGKSDTGLMLVLYCVL
                     VFIAWGLTHLFTGRAAFLHLGAITATIMSANVFMVIIPNQKIVVADLIAGRKPDPKYG
                     KIAKQRSLHNNYLTLPVLFLMLSNHYPLAFGTEFNWIIASLVFIIGVLIRHYFNSVHA
                     RKGNPHWTWLGALVLFIIIIWLSTVPRVLTGEPKPSASAELYIASAHFPAVRDTVLGR
                     CSMCHAAEPVYEGIYHAPKGVMLDTDAGIAEHAREIYLQAGRSHAMPPANVSQISDKE
                     RALLVTWFEGAGK"
     misc_feature    complement(381340..382548)
                     /locus_tag="Mesop_0347"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG3748"
                     /db_xref="CDD:226271"
     misc_feature    complement(381652..382548)
                     /locus_tag="Mesop_0347"
                     /note="Protein of unknown function (DUF989); Region:
                     DUF989; pfam06181"
                     /db_xref="CDD:253604"
     misc_feature    complement(381355..381585)
                     /locus_tag="Mesop_0347"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            382791..383711
                     /locus_tag="Mesop_0348"
                     /db_xref="GeneID:10824155"
     CDS             382791..383711
                     /locus_tag="Mesop_0348"
                     /note="COGs: COG0583 Transcriptional regulator;
                     InterPro IPR000847:IPR005119;
                     KEGG: mlo:mll5139 transcriptional regulator;
                     PFAM: LysR substrate-binding; regulatory protein LysR;
                     SPTR: Transcriptional regulator, LysR family;
                     PFAM: Bacterial regulatory helix-turn-helix protein, lysR
                     family; LysR substrate binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_004608937.1"
                     /db_xref="GI:337264882"
                     /db_xref="GeneID:10824155"
                     /translation="MAYLDNIAVFVRVVELGNLSAAGRDMRISPAVASNRIKELEKHL
                     GVRLFNRTTRQLMPTEHGTVFYAGAKQVLEAITEAEAAVSALSGQPRGTIRVTAPLGL
                     GRRLVASGIPDFHDKYPDIEVRLRLSDHNVDIMKEGIDVAFRLGIIEDSSLRMRGIME
                     CERVLVAAPKYLEARGEPVEPQELIGKKHDCLMLRYSGAREYVWTLQTPTGPQKFEVH
                     GPYDTDDGDVLTGWALSGRGIINKPRFEVEPFIRDRRLKVILSNTPPTPVQFAAVYPH
                     KKLQDPKVRLLLDFMAERCQRLIKDLLAGK"
     misc_feature    382800..383684
                     /locus_tag="Mesop_0348"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    382800..382976
                     /locus_tag="Mesop_0348"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    383064..383663
                     /locus_tag="Mesop_0348"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    order(383094..383096,383106..383108,383223..383225,
                     383265..383267,383271..383273,383466..383468,
                     383517..383519,383598..383600)
                     /locus_tag="Mesop_0348"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    order(383097..383102,383112..383117,383121..383126,
                     383133..383135,383145..383147,383151..383171,
                     383358..383360,383448..383462,383481..383486,
                     383493..383495)
                     /locus_tag="Mesop_0348"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            383840..384793
                     /locus_tag="Mesop_0349"
                     /db_xref="GeneID:10824156"
     CDS             383840..384793
                     /locus_tag="Mesop_0349"
                     /note="COGs: COG2141 Coenzyme F420-dependent N5
                     N10-methylene tetrahydromethanopterin reductase;
                     KEGG: mlo:mll5138 nitrilotriacetate monooxygenase
                     component A;
                     SPTR: Nitrilotriacetate monooxygenase component A;
                     PFAM: Luciferase-like monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrilotriacetate monooxygenase component A"
                     /protein_id="YP_004608938.1"
                     /db_xref="GI:337264883"
                     /db_xref="GeneID:10824156"
                     /translation="MHLTVSLNIASMAGQTSALTFRDVAGFVRQAEAVGLDMIILEDS
                     APDAPVSSSPFEATTLLAALATVTSRIGLVAAASTVAHQPYNLARRFASLDIISHGRA
                     GWHATMAQAPREAANFSRPDGFSNDDFRRRTEEYIGIVHGLWQGWDADALLFDKTGGR
                     FHDPDKMHLLDHKGEFFSVRGPLNVARSLQDKPVLLLSVLSEADMDIAARTADVILLD
                     GSAQDAKARHDDLKRHVAACGREPGSVKVLLNVGVDIDRLDTSFRSQDCDGFNIAMPP
                     PALDGFVGRVLPELRRRGLLRESYRGTTLRSHLGLAGGGDQ"
     misc_feature    383900..384763
                     /locus_tag="Mesop_0349"
                     /note="Flavin-utilizing monoxygenases; Region:
                     Flavin_utilizing_monoxygenases; cl19096"
                     /db_xref="CDD:267449"
     gene            384790..386043
                     /locus_tag="Mesop_0350"
                     /db_xref="GeneID:10824157"
     CDS             384790..386043
                     /locus_tag="Mesop_0350"
                     /note="COGs: COG2141 Coenzyme F420-dependent N5
                     N10-methylene tetrahydromethanopterin reductase;
                     InterPro IPR016215;
                     KEGG: mlo:mll5137 nitrilotriacetate monooxygenase
                     component A;
                     SPTR: Nitrilotriacetate monooxygenase component A;
                     PFAM: Luciferase-like monooxygenase;
                     TIGRFAM: FMN-dependent oxidoreductase, nitrilotriacetate
                     monooxygenase family"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrilotriacetate monooxygenase component A"
                     /protein_id="YP_004608939.1"
                     /db_xref="GI:337264884"
                     /db_xref="GeneID:10824157"
                     /translation="MTAQMKLGAFLWATGHHIAAWRHPKAHVTAGIDIDHYIQLARTA
                     EAAKFDMIFCEDAAGLREANVGIASQTSRSIGFEPISLLSALAVQTSRIGLVSTASTS
                     YNEPYGLARMFLSLDHLSDGRAGWNLVTSASPIEAANFGSTGLKPHADRYERAREFAE
                     VVTRLWHGKLGASGHDGQSFSVRDPLDLPRSPQGAPVMVQAGASDVGRDLAAGTADVV
                     FTAAQTFEEAKAFYDDLKGRMATYGREPDDIKIMPGVAPVVAETEAEAREKFEALQEL
                     IPDDVGVALLSSYLSISDLWRYPIDGPLPELPESEGMKSRQALVIEQSRRDGLSIRQL
                     ARHFAGARGHWRIVGTAAQIADELQARFEGGAADGFNVMPSYFPGELDAFCELVVPEL
                     QRRGLFRRDYEGRTLRDHLGLKRPA"
     misc_feature    384802..385983
                     /locus_tag="Mesop_0350"
                     /note="nitrilotriacetate monoxygenase oxidizes
                     nitrilotriacetate utilizing reduced flavin mononucleotide
                     (FMNH2) and oxygen. The FMNH2 is provided by an
                     NADH:flavin mononucleotide (FMN) oxidorductase that uses
                     NADH to reduce FMN to FMNH2; Region:
                     Nitrilotriacetate_monoxgenase; cd01095"
                     /db_xref="CDD:238528"
     misc_feature    order(384817..384819,384829..384831,385015..385017,
                     385174..385176,385240..385242,385402..385407)
                     /locus_tag="Mesop_0350"
                     /note="active site"
                     /db_xref="CDD:238528"
     misc_feature    385081..385086
                     /locus_tag="Mesop_0350"
                     /note="non-prolyl cis peptide bond; other site"
                     /db_xref="CDD:238528"
     gene            complement(386055..387146)
                     /locus_tag="Mesop_0351"
                     /db_xref="GeneID:10824158"
     CDS             complement(386055..387146)
                     /locus_tag="Mesop_0351"
                     /note="COGs: COG1975 Xanthine and CO dehydrogenase
                     maturation factor XdhC/CoxF family;
                     InterPro IPR003777:IPR014308;
                     KEGG: mlo:mlr5136 hypothetical protein;
                     PFAM: protein of unknown function DUF182;
                     SPTR: Xanthine dehydrogenase accessory protein XdhC;
                     TIGRFAM: xanthine dehydrogenase accessory protein XdhC;
                     PFAM: XdhC and CoxI family;
                     TIGRFAM: xanthine dehydrogenase accessory protein XdhC"
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine dehydrogenase accessory protein XdhC"
                     /protein_id="YP_004608940.1"
                     /db_xref="GI:337264885"
                     /db_xref="GeneID:10824158"
                     /translation="MNSKVQSLKAFLASAHRVALVEVADTKGSTPREKGAFMLVSASA
                     TFGTIGGGQLEYMAIDKARQMLFSPLEGGEERSAVGREKANDLAFSATSARSHSEGQA
                     AKRPEGVLSKGTARTSRPVDPTPPGGFAATLPSRGRGTRIAADEVRATLDVPLGPEIG
                     QCCGGRVEVLIRLVDAALAADLIAGAEAEQAHLPHVYIFGGGHVGQALASTVALLPVH
                     GVIIETRAEALEGMPETVETRLTPMPEAEVRNAPAGTAFAILTHDHALDFLIVAEALR
                     RGDTAYVGMIGSKTKKATFRSWFLKSADGTEAEFARLVSPIGGDAVKDKRPQVIAALA
                     AAEIMTALVIHNTALNAGHPAPRGKVMAG"
     misc_feature    complement(386949..387119)
                     /locus_tag="Mesop_0351"
                     /note="XdhC and CoxI family; Region: XdhC_CoxI; pfam02625"
                     /db_xref="CDD:251428"
     misc_feature    complement(386133..387092)
                     /locus_tag="Mesop_0351"
                     /note="xanthine dehydrogenase accessory protein XdhC;
                     Region: xanthine_xdhC; TIGR02964"
                     /db_xref="CDD:234073"
     misc_feature    complement(386133..386561)
                     /locus_tag="Mesop_0351"
                     /note="XdhC Rossmann domain; Region: XdhC_C; pfam13478"
                     /db_xref="CDD:257802"
     gene            complement(387208..389574)
                     /locus_tag="Mesop_0352"
                     /db_xref="GeneID:10824159"
     CDS             complement(387208..389574)
                     /locus_tag="Mesop_0352"
                     /EC_number="1.17.1.4"
                     /note="COGs: COG4631 Xanthine dehydrogenase
                     molybdopterin-binding subunit B;
                     InterPro IPR000674:IPR008274:IPR014309;
                     KEGG: mlo:mlr5135 xanthine dehydrogenase, XdhB;
                     PFAM: aldehyde oxidase and xanthine dehydrogenase
                     molybdopterin binding; aldehyde oxidase and xanthine
                     dehydrogenase a/b hammerhead;
                     PRIAM: Xanthine dehydrogenase;
                     SPTR: Xanthine dehydrogenase, molybdopterin binding
                     subunit;
                     TIGRFAM: xanthine dehydrogenase, molybdopterin binding
                     subunit;
                     PFAM: Molybdopterin-binding domain of aldehyde
                     dehydrogenase; Aldehyde oxidase and xanthine
                     dehydrogenase, a/b hammerhead domain;
                     TIGRFAM: xanthine dehydrogenase, molybdopterin binding
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine dehydrogenase, molybdopterin binding
                     subunit"
                     /protein_id="YP_004608941.1"
                     /db_xref="GI:337264886"
                     /db_xref="GeneID:10824159"
                     /translation="MNKHATASLKAEKIVGGVATDQRHDSAHKHVSGTAVYIDDMPEP
                     AGTLHGCLGLSAATHATIVEMDLSAVRTAPGVVDVLTAKDVPGENDISPTGRHDEPVL
                     ADGKVEFYGQPIFCVIAETREQARRATRLAKVEYKALPFVTDIGDLDPRKDKLVTPPL
                     TLRRGDAAAAIRQAPRRLKGKMRVGGQEHFYLEGHIAMAVPGEDQDVTIYSSTQHPSE
                     VQHMVSHALGVPSNAITVEIRRMGGGFGGKETQGNQFAALAAIAAKKHHRAVKIRPDR
                     DDDMIATGKRHDFLVDYEVGFDDEGNILGVDFMFAARCGFSSDLSGPVTDRALFHCDN
                     TYFWPTVHAQSAPLYTNTVSNTAFRGFGGPQGMVGAERVIDEVAFAVGQDPLEIRKRN
                     FYGTSGDSEGGRNITPYHQTVEDNIIQRIVGELEESASYARRRREISAFNANSRFIKR
                     GLALTPVKFGISFTATHYNQAGALVHVYTDGSVHLNHGGTEMGQGLYLKVAQVVAEEF
                     QIDLDQVKITATTTGKVPNTSATAASSGSDLNGMAAQNGARQIKDRLIDFAAEKYQVP
                     HDQVVFLPNRVRVGNQEIAFADLVKQAYMARIQLSAAGFYKTPKIHWNRDKGQGRPFY
                     YFAYGASCSEVSVDTLTGEYVVERTDILHETGRSLNRAIDLGQIEGGFIQGMGWLTTE
                     ELWWDDKGRLRTHAPSTYKIPLASDRPKIFNVTLADWPEASEPTIHRSKAVGEPPFPL
                     GMSVLHALSDAVASVADHKICPRLDAPATPERVLMTIERLKREARAGA"
     misc_feature    complement(387211..389574)
                     /locus_tag="Mesop_0352"
                     /note="Xanthine dehydrogenase, molybdopterin-binding
                     subunit B [Nucleotide transport and metabolism]; Region:
                     XdhB; COG4631"
                     /db_xref="CDD:226978"
     misc_feature    complement(389155..389481)
                     /locus_tag="Mesop_0352"
                     /note="Aldehyde oxidase and xanthine dehydrogenase, a/b
                     hammerhead domain; Region: Ald_Xan_dh_C; smart01008"
                     /db_xref="CDD:214971"
     misc_feature    complement(387448..389109)
                     /locus_tag="Mesop_0352"
                     /note="Molybdopterin-binding domain of aldehyde
                     dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
                     /db_xref="CDD:251506"
     gene            complement(389574..391055)
                     /locus_tag="Mesop_0353"
                     /db_xref="GeneID:10824160"
     CDS             complement(389574..391055)
                     /locus_tag="Mesop_0353"
                     /note="COGs: COG4630 Xanthine dehydrogenase iron-sulfur
                     cluster and FAD-binding subunit A;
                     InterProIPR006058:IPR001041:IPR016166:IPR002888:IPR
                     002346:IPR005107:IPR012175:IPR014307;
                     KEGG: mlo:mlr5134 xanthine dehydrogenase, XdhA;
                     PFAM: molybdopterin dehydrogenase FAD-binding;
                     [2Fe-2S]-binding domain protein; ferredoxin; CO
                     dehydrogenase flavoprotein domain protein;
                     SPTR: Xanthine dehydrogenase, small subunit;
                     TIGRFAM: xanthine dehydrogenase, small subunit;
                     PFAM: 2Fe-2S iron-sulfur cluster binding domain; FAD
                     binding domain in molybdopterin dehydrogenase; [2Fe-2S]
                     binding domain; CO dehydrogenase flavoprotein C-terminal
                     domain;
                     TIGRFAM: xanthine dehydrogenase, small subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine dehydrogenase, small subunit"
                     /protein_id="YP_004608942.1"
                     /db_xref="GI:337264887"
                     /db_xref="GeneID:10824160"
                     /translation="MAKVNIRNEIRFILNGRDVVLSSVAPDTTLLDWLRLDRSLRGTK
                     EGCAEGDCGACTVLVGKLSAGGLVYESVNACIRFLGSLDGTHVVTVEHLRGLPGQLHP
                     VQQAMVDFHGSQCGFCTPGFIMSLYGLWMRSSAPSNTTIEKALQGNLCRCTGYEAIMR
                     AAHAISSYGKAAKDPLAAEREAITARLDAMHDGARVEIGAGKARLVVPANVDDLAAIL
                     DKEPTATIVAGATDVGLWVTKHMRDISPVIFIGNLDGLCTISEDKGVISIGAGVTYTE
                     AFSTLSKRIPALGPLFDRIGGEQVRNMGTIGGNIANGSPIGDTPPPLIALGARLTLRR
                     GKKRRTIPLQDFFIAYGKQDRQPGEFVEAVHVPVPAKGAKFAVYKITKRRDEDITAAL
                     GAFFLTLAKDGTVADIRIAYGGMAATPKRATAVEKALLGKPWTEATVEAAMTEYARDF
                     TPLTDMRASAEYRALAAKNLLLRFFVETTGTRAPFQVSRNEAA"
     misc_feature    complement(389577..391055)
                     /locus_tag="Mesop_0353"
                     /note="Xanthine dehydrogenase, iron-sulfur cluster and
                     FAD-binding subunit A [Nucleotide transport and
                     metabolism]; Region: XdhA; COG4630"
                     /db_xref="CDD:226977"
     misc_feature    complement(390828..391028)
                     /locus_tag="Mesop_0353"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(390831..390836,390891..390902,
                     390906..390908,390915..390917,390924..390929))
                     /locus_tag="Mesop_0353"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(390831..390833,390891..390893,
                     390900..390902,390915..390917))
                     /locus_tag="Mesop_0353"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     misc_feature    complement(390564..390791)
                     /locus_tag="Mesop_0353"
                     /note="[2Fe-2S] binding domain; Region: Fer2_2; pfam01799"
                     /db_xref="CDD:250876"
     misc_feature    complement(389949..390455)
                     /locus_tag="Mesop_0353"
                     /note="FAD binding domain in molybdopterin dehydrogenase;
                     Region: FAD_binding_5; pfam00941"
                     /db_xref="CDD:250245"
     misc_feature    complement(389622..389930)
                     /locus_tag="Mesop_0353"
                     /note="CO dehydrogenase flavoprotein C-terminal domain;
                     Region: CO_deh_flav_C; pfam03450"
                     /db_xref="CDD:251962"
     gene            complement(391059..391433)
                     /locus_tag="Mesop_0354"
                     /db_xref="GeneID:10824161"
     CDS             complement(391059..391433)
                     /locus_tag="Mesop_0354"
                     /EC_number="3.5.2.17"
                     /note="COGs: COG2351 Transthyretin-like protein;
                     InterPro IPR000895:IPR014306;
                     KEGG: mlo:mlr5133 hypothetical protein;
                     PFAM: Transthyretin;
                     PRIAM: Hydroxyisourate hydrolase;
                     SPTR: 5-hydroxyisourate hydrolase;
                     TIGRFAM: hydroxyisourate hydrolase;
                     PFAM: HIUase/Transthyretin family;
                     TIGRFAM: hydroxyisourate hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyisourate hydrolase"
                     /protein_id="YP_004608943.1"
                     /db_xref="GI:337264888"
                     /db_xref="GeneID:10824161"
                     /translation="MAETSKADGGRLTTHVLDTATGKPAAGLSIALYRLDGAARTLLK
                     TVATNADGRCDAPLLVGGDFRTGEYELIFAAGDYLRGQGTKLPEPAFLDRVPIRFGMA
                     EAVHYHVPLLISPYGYSTYRGS"
     misc_feature    complement(391062..391406)
                     /locus_tag="Mesop_0354"
                     /note="HIUase (5-hydroxyisourate hydrolase) catalyzes the
                     second step in a three-step ureide pathway in which
                     5-hydroxyisourate (HIU), a product of the uricase (urate
                     oxidase) reaction, is hydrolyzed to
                     2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU);
                     Region: TLP_HIUase; cd05822"
                     /db_xref="CDD:100114"
     misc_feature    complement(order(391071..391073,391098..391100,
                     391104..391106,391110..391112,391275..391277,
                     391383..391385,391389..391391))
                     /locus_tag="Mesop_0354"
                     /note="active site"
                     /db_xref="CDD:100114"
     misc_feature    complement(order(391068..391088,391092..391094,
                     391134..391142,391152..391154,391158..391163,
                     391368..391379))
                     /locus_tag="Mesop_0354"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100114"
     gene            391635..393053
                     /locus_tag="Mesop_0355"
                     /db_xref="GeneID:10824162"
     CDS             391635..393053
                     /locus_tag="Mesop_0355"
                     /EC_number="3.5.1.41"
                     /note="COGs: COG3195 conserved hypothetical protein;
                     InterPro IPR002509:IPR018020:IPR017625:IPR017580;
                     KEGG: mlo:mll5132 hypothetical protein;
                     PFAM: Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline
                     decarboxylase; polysaccharide deacetylase;
                     PRIAM: Chitin deacetylase;
                     SPTR: Urate catabolism protein;
                     TIGRFAM: urate catabolism protein; OHCU decarboxylase;
                     PFAM: OHCU decarboxylase; Polysaccharide deacetylase;
                     TIGRFAM: OHCU decarboxylase; putative urate catabolism
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="urate catabolism protein"
                     /protein_id="YP_004608944.1"
                     /db_xref="GI:337264889"
                     /db_xref="GeneID:10824162"
                     /translation="MRYERDMRGYGANPPDPKWPGGAHVAVQFVVNYEEGGENCVLHG
                     DKASEAFLSEIVGAAAWVGQRHWNMESIYEYGARAGFWRLLRLFSESQVPVTCYGVAT
                     ALARSPDQVTAMQEVGWEIASHGLRWIDYRDHSAEDERHDLEAAIKLHYEVTGQRPTG
                     WYTGRTSVNTVRLVAEEGGFDYVSDTYDDELPYWFEHAGGTQLIIPYTLDANDMRFAT
                     PQGFNSGDQFFAYLKDSFDTLYAEGKAGRPRMMNIGLHCRLVGRPGRVAALKRFVDYV
                     KSHDKVWLARRIDIARHWQENHPYRQAALRPSKMEFETFVHSFGGVFEHSPWIAERAY
                     ELELGTAHDTAGGLHNALCRIFRSASETERLGVLNAHPDLAGKLAKARRLTAESTREQ
                     ASAGLDALTDKERELFSKLNAAYVTTFGFPFIIAVKGKTKEEILAEFEARIGNGRGVE
                     FETACKQVERIALLRLRDMLPQ"
     misc_feature    391641..392534
                     /locus_tag="Mesop_0355"
                     /note="putative urate catabolism protein; Region:
                     uraD_N-term-dom; TIGR03212"
                     /db_xref="CDD:211797"
     misc_feature    391689..392513
                     /locus_tag="Mesop_0355"
                     /note="Catalytic domain of bacterial PuuE allantoinases,
                     Schizosaccharomyces pombe chitin deacetylase 1 (SpCDA1),
                     and similar proteins; Region: CE4_PuuE_SpCDA1; cd10977"
                     /db_xref="CDD:200599"
     misc_feature    order(391728..391730,391734..391736,391785..391787,
                     392004..392006,392016..392018,392121..392129,
                     392400..392402)
                     /locus_tag="Mesop_0355"
                     /note="active site"
                     /db_xref="CDD:200599"
     misc_feature    order(391734..391736,392400..392402)
                     /locus_tag="Mesop_0355"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200599"
     misc_feature    order(391740..391742,391746..391748,391758..391763,
                     391794..391802,391824..391829,391833..391838,
                     391842..391859,391863..391871,391878..391883,
                     391890..391892,391950..391955,392028..392033,
                     392124..392126,392130..392138,392190..392204,
                     392211..392213,392259..392264,392277..392282,
                     392292..392306,392313..392315,392322..392327,
                     392334..392339,392346..392351,392358..392360,
                     392421..392429,392433..392435)
                     /locus_tag="Mesop_0355"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:200599"
     misc_feature    392547..393050
                     /locus_tag="Mesop_0355"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3195"
                     /db_xref="CDD:225736"
     gene            393064..393927
                     /locus_tag="Mesop_0356"
                     /db_xref="GeneID:10824163"
     CDS             393064..393927
                     /locus_tag="Mesop_0356"
                     /note="COGs: COG3257 Uncharacterized protein possibly
                     involved in glyoxylate utilization;
                     InterPro IPR008579:IPR013096:IPR017627;
                     KEGG: mlo:mll5131 hypothetical protein;
                     PFAM: protein of unknown function DUF861 cupin_3; Cupin 2
                     conserved barrel domain protein;
                     SPTR: Allantoin catabolism protein;
                     TIGRFAM: allantoin catabolism protein;
                     PFAM: Cupin domain;
                     TIGRFAM: putative allantoin catabolism protein"
                     /codon_start=1
                     /transl_table=11
                     /product="allantoin catabolism protein"
                     /protein_id="YP_004608945.1"
                     /db_xref="GI:337264890"
                     /db_xref="GeneID:10824163"
                     /translation="MDTIRMPDRTYYAPHGGHSGQTELLTGRAVFTEAYAVIPKGVMQ
                     DIVTSALPFWDETRVWILSRPLSGFAETFSQYIVEIAPGGGSERPEPDAGAEGALFVV
                     EGELTVLLAGKKHMLRPGGFAFLPPASGWTVRNESKAAVRFHWIRKAYEAVDGLDVPE
                     AFFTNEQEIAPTPMPGTDGRWATTRFVDPADLRHDMHMTIVTLEPGAVIPFAETHVME
                     HGLYVLEGKAVYRLNQDWVEVEAGDYMWLRAFCPQACYAGGPGKFRYLLYKDVNRHAK
                     LGGADIGGRTR"
     misc_feature    393088..393897
                     /locus_tag="Mesop_0356"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11171"
                     /db_xref="CDD:183011"
     misc_feature    393265..393498
                     /locus_tag="Mesop_0356"
                     /note="Protein of unknown function (DUF861); Region:
                     Cupin_3; pfam05899"
                     /db_xref="CDD:147835"
     misc_feature    393535..393864
                     /locus_tag="Mesop_0356"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            393924..394430
                     /locus_tag="Mesop_0357"
                     /db_xref="GeneID:10824164"
     CDS             393924..394430
                     /locus_tag="Mesop_0357"
                     /EC_number="3.5.3.19"
                     /note="COGs: COG3194 Ureidoglycolate hydrolase;
                     InterPro IPR007247;
                     KEGG: mlo:mll5130 ureidoglycolate hydrolase;
                     PFAM: Ureidoglycolate hydrolase;
                     PRIAM: Ureidoglycolate hydrolase;
                     SPTR: Ureidoglycolate hydrolase;
                     PFAM: Ureidoglycolate hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="Ureidoglycolate hydrolase"
                     /protein_id="YP_004608946.1"
                     /db_xref="GI:337264891"
                     /db_xref="GeneID:10824164"
                     /translation="MTRPILAHIVARPLTREAFAEFGDVIDMGGDNHYPINGGKAERY
                     HDLATAEATGPNARVLISMVRGMPYELPLKLTMVERHPFGSQAFIPLSPRPFLVVVCH
                     DGKEGPGEPYAFITAPGQGINYSRNLWHGVLTPLGEAQDFLIVDRGGDGSNLEEFHFS
                     HAYEIHLP"
     misc_feature    393948..394427
                     /locus_tag="Mesop_0357"
                     /note="Ureidoglycolate hydrolase [Nucleotide transport and
                     metabolism]; Region: DAL3; COG3194"
                     /db_xref="CDD:225735"
     gene            394497..395090
                     /locus_tag="Mesop_0358"
                     /db_xref="GeneID:10824165"
     CDS             394497..395090
                     /locus_tag="Mesop_0358"
                     /note="COGs: COG0590 Cytosine/adenosine deaminase;
                     InterPro IPR002125;
                     KEGG: mlo:mll5129 hypothetical protein;
                     PFAM: CMP/dCMP deaminase zinc-binding;
                     SPTR: CMP/dCMP deaminase zinc-binding;
                     PFAM: Cytidine and deoxycytidylate deaminase zinc-binding
                     region"
                     /codon_start=1
                     /transl_table=11
                     /product="CMP/dCMP deaminase zinc-binding protein"
                     /protein_id="YP_004608947.1"
                     /db_xref="GI:337264892"
                     /db_xref="GeneID:10824165"
                     /translation="MTDISLIDRLLDVIEHDIVPKTEEGVAHGNKLFGAAILRKHDRS
                     LVLAETNNEIENPLWHGEVHCLKRFYEMPRAERVDTKDAIFLATHEPCSLCLSAITWT
                     GFDNFYYLFSHEDSRDSFAIPHDLKILKEVFTLDPGGYNAENAYWKSFSIRRLVRALP
                     EAERQRLETRIGKISARYDELSGAYQANKDENDIPLN"
     misc_feature    394563..394841
                     /locus_tag="Mesop_0358"
                     /note="Nucleoside deaminases include adenosine, guanine
                     and cytosine deaminases. These enzymes are Zn dependent
                     and catalyze the deamination of nucleosides. The zinc ion
                     in the active site plays a central role in the proposed
                     catalytic mechanism, activating a...; Region:
                     nucleoside_deaminase; cd01285"
                     /db_xref="CDD:238612"
     misc_feature    order(394593..394595,394650..394652,394674..394682,
                     394770..394772,394779..394781)
                     /locus_tag="Mesop_0358"
                     /note="nucleoside/Zn binding site; other site"
                     /db_xref="CDD:238612"
     misc_feature    order(394668..394670,394683..394685,394695..394697,
                     394773..394778,394785..394790,394797..394802)
                     /locus_tag="Mesop_0358"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238612"
     misc_feature    order(394674..394682,394767..394772,394779..394781)
                     /locus_tag="Mesop_0358"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238612"
     gene            complement(395101..395412)
                     /locus_tag="Mesop_0359"
                     /db_xref="GeneID:10824166"
     CDS             complement(395101..395412)
                     /locus_tag="Mesop_0359"
                     /note="COGs: COG3514 conserved hypothetical protein;
                     KEGG: btr:Btr_0514 hypothetical protein;
                     SPTR: Putative uncharacterized protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608948.1"
                     /db_xref="GI:337264893"
                     /db_xref="GeneID:10824166"
                     /translation="MNNPKSRIRPLTDEEEAEIQRQIAADSDDAEATDEQLARAKPFA
                     EAFPELFESIRRARGRPPVEKPKQVVSIRLDQDVVRKFKATGKGWQAKINEVLKNAKV
                     S"
     misc_feature    complement(395113..395355)
                     /locus_tag="Mesop_0359"
                     /note="Domain of unknown function (DUF4415); Region:
                     DUF4415; cl01401"
                     /db_xref="CDD:260918"
     gene            complement(395399..395653)
                     /locus_tag="Mesop_0360"
                     /db_xref="GeneID:10824167"
     CDS             complement(395399..395653)
                     /locus_tag="Mesop_0360"
                     /note="COGs: COG2929 conserved hypothetical protein;
                     InterPro IPR007460;
                     KEGG: bmc:BAbS19_I09230 hypothetical protein;
                     PFAM: protein of unknown function DUF497;
                     SPTR: Putative uncharacterized protein;
                     manually curated;
                     PFAM: Protein of unknown function (DUF497)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004608949.1"
                     /db_xref="GI:337264894"
                     /db_xref="GeneID:10824167"
                     /translation="MKIVWDEPKRVTNLKNRGLDFAKLDIEFFATSTVLPAKAGRLKA
                     IGEFGEIILAVIFKPLGSEAISVISMRRASRKERSVYEQP"
     misc_feature    complement(395405..395653)
                     /locus_tag="Mesop_0360"
                     /note="Protein of unknown function (DUF497); Region:
                     DUF497; cl01108"
                     /db_xref="CDD:260791"
     gene            395833..397818
                     /locus_tag="Mesop_0361"
                     /db_xref="GeneID:10824168"
     CDS             395833..397818
                     /locus_tag="Mesop_0361"
                     /note="COGs: COG2936 acyl esterase;
                     InterPro IPR000383:IPR013736:IPR005674;
                     KEGG: mlo:mll5128 glutaryl 7-ACA acylase;
                     PFAM: peptidase S15; X-Pro dipeptidyl-peptidase domain
                     protein;
                     SPTR: Peptidase S15;
                     TIGRFAM: hydrolase CocE/NonD family protein;
                     PFAM: X-Pro dipeptidyl-peptidase C-terminal non-catalytic
                     domain; X-Pro dipeptidyl-peptidase (S15 family);
                     TIGRFAM: putative hydrolase, CocE/NonD family"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase CocE/NonD family protein"
                     /protein_id="YP_004608950.1"
                     /db_xref="GI:337264895"
                     /db_xref="GeneID:10824168"
                     /translation="MKTVTEFPRKVVEFPDMGIVMPDGCRLSARVWMPEDAGDDPVPA
                     ILEHLPYRKRDGTIFRDQLTHPYFAGHGYASIRVDMRGNGDSEGLMDDEYSEQELQDA
                     CDVIAWAAAQPWCNGNVGMMGISWGGFNCLQVAAKQPPALKAVISLCSTVDRYADDIH
                     YKGGCLLIENFGWASTMLSYSSRPPDPLISGDNRWRDLWLTRLENQSFLLPLWLSHQH
                     RDAYWKRGSICEDFSAVKAAVLSIGGWHDGYRNTISNLVSNIEAPVKGIVGPWIHKYP
                     HYAGPQPAIGFLQEALRWWDRWLKGIDTGVEADPAYRAYVMDSVRPARWHPERPGRWV
                     AEQQWPSPAIKTQAIELISKGTKPAIVASPQSCGLAGGEYFPFTFGPELPGDQRPDDT
                     LSVCFDQPELAEALDIVGAPEVQVTLSSDRPQANIAIRLCDVHPDGASELISYGVLNL
                     THRDSHEFPQALVPGEAISARVVLDQCAYRVPAGHRLRVAVSNAYWPMIWPSPEPVQL
                     TLSAATLALPLRPLAKGSEVTFAEPEGAAPWATQTVRPANSERHVDRDEKTGIVTLSI
                     ADDFGEVRDLAHGLANGSIAREIWSIHPDNPLSASGKTHWTQTLSRNGWSVRTETWAE
                     MRSDAQNFIVSARIEAYEGEILVFERNFEEKIPRALV"
     misc_feature    395842..397497
                     /locus_tag="Mesop_0361"
                     /note="Predicted acyl esterases [General function
                     prediction only]; Region: COG2936"
                     /db_xref="CDD:225487"
     misc_feature    396031..>396291
                     /locus_tag="Mesop_0361"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     misc_feature    396760..397395
                     /locus_tag="Mesop_0361"
                     /note="X-Pro dipeptidyl-peptidase C-terminal non-catalytic
                     domain; Region: PepX_C; smart00939"
                     /db_xref="CDD:214924"
     gene            397973..399559
                     /locus_tag="Mesop_0362"
                     /db_xref="GeneID:10824169"
     CDS             397973..399559
                     /locus_tag="Mesop_0362"
                     /note="COGs: COG0747 ABC-type dipeptide transport system
                     periplasmic component;
                     InterPro IPR017909:IPR000914:IPR006311;
                     KEGG: mlo:mll5127 ABC transporter, binding protein;
                     PFAM: extracellular solute-binding protein family 5;
                     SPTR: Extracellular solute-binding protein family 5;
                     PFAM: Bacterial extracellular solute-binding proteins,
                     family 5 Middle;
                     TIGRFAM: Tat (twin-arginine translocation) pathway signal
                     sequence"
                     /codon_start=1
                     /transl_table=11
                     /product="family 5 extracellular solute-binding protein"
                     /protein_id="YP_004608951.1"
                     /db_xref="GI:337264896"
                     /db_xref="GeneID:10824169"
                     /translation="MSNELEFLSRRVAAGKLSRRDFLGRAAALGIAAPFANSLLSSAA
                     RAAGPVKGGTLKAGLVGGESTNSLDPALFMTQVPFAFGKCWGEMIVELSPDGKLENRI
                     AEEIGSSKDAKTWTLKIRDGVEFHNGKKVTAEDVAATLERHSDEKSKSGALGYMKGIE
                     TIKANGKEVVLTLKEANADLPYLLSDYHLIVQPNGGKDKADAGISAGPYKVTTNEPGV
                     RHAGERFANYWQSDKMGHADQIEIIVINDATARTAALQGGQVNMINRVEPKIVDLIKR
                     VPGVTIRNHAGPGHYVFIMHCNTAPFDNNDLRMALKLAIDREEMLTKVLRGYGSLGND
                     FPINSAYPLFTEIEQRKYDPDKAKFHYKKSGHDGTVLLRTSDVAFPGAVDASQLFQQS
                     AAKAGIKIELKREPGDGYWNEVWNKQPFCASYWGGRSTQDQMYSTAYLSTADWNDTRF
                     KRPDFDKMVLAARAELDEAKRKQMYHDMAVLVRDEGGLILPMFNQFIDATGAKVDGWV
                     DDPHQELMNGYALAKCWLQA"
     sig_peptide     397973..398110
                     /locus_tag="Mesop_0362"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    398006..399550
                     /locus_tag="Mesop_0362"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    398021..398110
                     /locus_tag="Mesop_0362"
                     /note="Tat (twin-arginine translocation) pathway signal
                     sequence; Region: TAT_signal_seq; TIGR01409"
                     /db_xref="CDD:233399"
     misc_feature    398117..399493
                     /locus_tag="Mesop_0362"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_17; cd08503"
                     /db_xref="CDD:173868"
     gene            399576..400535
                     /locus_tag="Mesop_0363"
                     /db_xref="GeneID:10824170"
     CDS             399576..400535
                     /locus_tag="Mesop_0363"
                     /note="COGs: COG0601 ABC-type
                     dipeptide/oligopeptide/nickel transport systems permease
                     components;
                     InterPro IPR000515;
                     KEGG: mlo:mll5126 ABC transporter, permease protein;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     SPTR: Binding-protein-dependent transport systems inner
                     membrane component;
                     PFAM: Binding-protein-dependent transport system inner
                     membrane component"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="YP_004608952.1"
                     /db_xref="GI:337264897"
                     /db_xref="GeneID:10824170"
                     /translation="MSSPILKLIAQRIALGILLLLAISVLIFAGTQILPGDVAQAILG
                     QSATPESLANLREQLGLNDPAYVRYFHWLGGVLTGDLGTAMSSGQDIATSIKGRLWNT
                     LFLAFWAAIVAVPLAIILGLIAVRYRNGWVDKLISGLALASTSFPEFFIGYLLVYFFA
                     VKWQIFPAISTVYDGMPFGERMQAIALPATALTLVVLAHMMRMTRAAILNVMQSAYVE
                     TAELKGLSAFAVIRRHAFPNAIAPIINVVMLNLAYLIVGVVVVEVIFVYPGMGQYLVD
                     HVTKRDVPVVQAVGLIFAAVYISLNIIADIAAIIANPRLRHPK"
     sig_peptide     399576..399662
                     /locus_tag="Mesop_0363"
                     /note="Signal predicted by SignalP 3.0 HMM"
     misc_feature    399591..400532
                     /locus_tag="Mesop_0363"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    399870..>400340
                     /locus_tag="Mesop_0363"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(399918..399923,399930..399935,399948..399950,
                     399981..399992,399996..400025,400032..400037,
                     400041..400043,400158..400163,400167..400169,
                     400173..400175,400182..400187,400191..400193,
                     400203..400208,400215..400217,400266..400268,
                     400308..400313,400320..400322)
                     /locus_tag="Mesop_0363"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    399999..400043
                     /locus_tag="Mesop_0363"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(400218..400256,400272..400277,400287..400289)
                     /locus_tag="Mesop_0363"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            400545..401369
                     /locus_tag="Mesop_0364"
                     /db_xref="GeneID:10824171"
     CDS             400545..