GenomeNet

Database: RefSeq
Entry: NC_015675
LinkDB: NC_015675
Original site: NC_015675 
LOCUS       NC_015675            6884444 bp    DNA     circular CON 31-JUL-2015
DEFINITION  Mesorhizobium opportunistum WSM2075, complete genome.
ACCESSION   NC_015675 NZ_ACZA01000000-NZ_ACZA01000089
VERSION     NC_015675.1  GI:337264537
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02232036
            Assembly: GCF_000176035.2
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Mesorhizobium opportunistum WSM2075
  ORGANISM  Mesorhizobium opportunistum WSM2075
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Phyllobacteriaceae; Mesorhizobium.
REFERENCE   1  (bases 1 to 6884444)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D.,
            Goodwin,L., Pitluck,S., Chertkov,O., Misra,M., Detter,J.C., Han,C.,
            Tapia,R., Land,M., Hauser,L., Kyrpides,N., Ovchinnikova,G.,
            Mavrommatis,K.M., Tiwari,R.P., Howieson,J.G., O'Hara,G.W.,
            Nandasena,K.G. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Mesorhizobium opportunistum WSM2075
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6884444)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D.,
            Goodwin,L., Pitluck,S., Chertkov,O., Misra,M., Detter,J.C., Han,C.,
            Tapia,R., Land,M., Hauser,L., Kyrpides,N., Ovchinnikova,G.,
            Mavrommatis,K.M., Tiwari,R.P., Howieson,J.G., O'Hara,G.W.,
            Nandasena,K.G. and Woyke,T.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP002279.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4086182
            Source DNA and organism available from Kemanthi G. Nandasena
            (K.Nandasena@murdoch.edu.au)
            Contacts: Kemanthi G. Nandasena (K.Nandasena@murdoch.edu.au)
                      Tanja Woyke (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##MIGS-Data-START##
            investigation_type     :: bacteria_archaea
            project_name           :: Mesorhizobium opportunistum WSM2075
            collection_date        :: August 2000
            lat_lon                :: -31.530408 116.947875
            depth                  :: Missing
            alt_elev               :: Missing
            country                :: Australia
            environment            :: Host, Rhizosphere, Root nodule
            num_replicons          :: Missing
            ref_biomaterial        :: LMG 24607
            biotic_relationship    :: Symbiotic
            trophic_level          :: Missing
            rel_to_oxygen          :: Aerobe
            isol_growth_condt      :: Missing
            sequencing_meth        :: WGS
            assembly               :: Newbler v. 2.3 (pre-release)
            finishing_strategy     :: Finished
            GOLD Stamp ID          :: Gi03279
            Type Strain            :: Yes
            Greengenes ID          :: 101371
            Isolation Site         :: Antonio's farm, Antonio Rd, Northam,
                                      Western Australia
            Source of Isolate      :: Nandasena
            Isolation Comments     :: has symbiosis island from WSM1271, but
                                      ineffective for N fixation
            Host Name              :: Biserrula pelecinus L
            Cell Shape             :: Rod-shaped
            Motility               :: Motile
            Temperature Range      :: Mesophile
            Gram Staining          :: Gram-
            Symbiotic Relationship :: Parasitic
            Diseases               :: None
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 07/30/2015 22:31:52
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 6,576
            CDS                                       6,418
            Pseudo Genes                           :: 97
            rRNAs                                  :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                         :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                                  :: 53
            ncRNA                                  :: 2
            Frameshifted Genes                     :: 61
            Frameshifted Genes On Monomer Runs     :: 2
            Frameshifted Genes Not On Monomer Runs :: 0
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..6884444
                     /organism="Mesorhizobium opportunistum WSM2075"
                     /mol_type="genomic DNA"
                     /strain="WSM2075"
                     /isolation_source="Nandasena; Antonio's farm, Antonio Rd."
                     /host="Biserrula pelecinus L"
                     /db_xref="taxon:536019"
                     /country="Australia"
                     /lat_lon="31.530408 S 116.947875 E"
     gene            675..2219
                     /locus_tag="MESOP_RS00005"
                     /old_locus_tag="Mesop_0001"
     CDS             675..2219
                     /locus_tag="MESOP_RS00005"
                     /old_locus_tag="Mesop_0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019863089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_013891250.1"
                     /db_xref="GI:503657174"
                     /translation="MQSGVERELTGDLPFPGTLIGANGMAVSSDAEQKFDRVKAQLKA
                     RLGAEVYSSWFGRMKVAEASKGIVRISVPTAFLRSWINGHYLDLISELWKQEDADLLK
                     IEIIVRTATRQGRSHAEPELAPVRKMTRQTQTALAAGTVSPGRIERSPVPRPGAAIES
                     EFRHNVLGSPLDPRYTFGSFIEGPSNRVAFAAAKAVAESQSSAVRFNPLFLHATVGLG
                     KTHLLQAIAAESLKQNPKSRVVYLTAEYFMWRFATAIRDNNALTLKEQLRDIDLLIID
                     DMQFLQGKSIQHEFCHLINMLLDSAKQVVVAADRPPSELESLEPRVRSRLNGGVALEM
                     SAPDFAMRLGMLKLRLATARVDDASLDISEEILNHVARTVTGSGRELEGAFNQLLFRQ
                     SFEPQITIDRIDEILGHIYRTGEPKRVRIEDIQRIVARHYNVSKTELLSNRRTRTIVK
                     PRQVAMYLSKVMTPRSLPEIGRRFGGRDHTTVLHAVRKIEDLSGNDNTLAQELELLRR
                     LINDQA"
     gene            2525..3643
                     /locus_tag="MESOP_RS00010"
                     /old_locus_tag="Mesop_0002"
     CDS             2525..3643
                     /locus_tag="MESOP_RS00010"
                     /old_locus_tag="Mesop_0002"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015313988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_010913340.1"
                     /db_xref="GI:499215800"
                     /translation="MRVILERSNLLKSLNHVHRVVERRNTIPILSNVLLSAEGASLEM
                     KATDLDLEVTEATPAKVERGGATTVPAHLLYDIVRKLSDGAEVMLKTDEDGNAMTVTS
                     GRSSFRLQCLPQSDFPELSAGSFSHIFRLDSVALKGLIEKTQFAISTEETRYYLNGIY
                     LHTHEVGGKLKLRSVATDGHRLARAEIDAPAGSEGMPGIIIPRKTVSELQKLVDDPDV
                     AVTTELSDTKIRFTIGSVVLTSKLIDGTFPDYQRVIPTGNDKKLILDRQSFAAAVDRV
                     STISSERGRAVKLSISEGQVTLAVNNPDSGSATEELAADYSSDPIEIGFNAKYLLDVA
                     AQLTGTEAKFMLADAGSPTLIHDMADETALYVLMPMRV"
     gene            3719..4852
                     /locus_tag="MESOP_RS00015"
                     /old_locus_tag="Mesop_0003"
     CDS             3719..4852
                     /locus_tag="MESOP_RS00015"
                     /old_locus_tag="Mesop_0003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein RecF"
                     /protein_id="WP_013891251.1"
                     /db_xref="GI:503657175"
                     /translation="MPGQTHISKLTLTNFRNYAALAIDLAPGAVVFSGDNGAGKTNLL
                     EAISFLTPGRGLRRAPYADVARAGGDGGFALHARLDGPDGQVEIGTGISGGDSEGGRR
                     VRINGATARSAEDMLEWLRVVWLTPAMDTLFTGPAADRRRFLDRLVLAIDPGHGQRAL
                     DYEKAMRGRNRLLTENSRDDRWFEAIEIQMAETGVAIAAARAEMVRLLAAMIDRLPDS
                     GPFPQADIGLAGDLEAEIAGTPAVDVEERFRRALADGRDRDRAAGRTLEGPHRSDLLV
                     RHRPKAMPAELCSTGEQKALLVGIVLSHARLTGEVSGMTPILLLDEIAAHLDGGRRAA
                     LFSILEELNCQAFMTGTDAALFSSLQGRAQFLTVDHGIVGPTV"
     gene            4906..5658
                     /locus_tag="MESOP_RS00020"
                     /old_locus_tag="Mesop_0004"
     CDS             4906..5658
                     /locus_tag="MESOP_RS00020"
                     /old_locus_tag="Mesop_0004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiF"
                     /protein_id="WP_041164449.1"
                     /db_xref="GI:752465740"
                     /translation="MTNALTADEIERYARHIVLPEVGGSGQQKLKQARVLVIGAGGLG
                     APVLEYLAAAGVGTLGIVDDDTVSLSNLQRQVIHGTDTVGLLKTHSAEAAIARINPNT
                     NVETHTFRLTADNAPALVARYDMVVDGSDNFETRYVVADACASEHKPLVHAAVGRFDG
                     SVTVLKPFEDGKDGKPNPGYRDLFPEAPPPGLVPSCAEAGVLGALTGVVGTLQAMEAI
                     KLITGIGEPLVGRLLLYDALAARFETIRYKRG"
     gene            5661..6149
                     /locus_tag="MESOP_RS00025"
                     /old_locus_tag="Mesop_0005"
     CDS             5661..6149
                     /locus_tag="MESOP_RS00025"
                     /old_locus_tag="Mesop_0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_013891253.1"
                     /db_xref="GI:503657177"
                     /translation="MARTSAPSITRIPADFDRWDDVLALIMRAFAFMDGVIDPPSSAH
                     RLTVDSLRDKARLESGFVALDSDRIVGCVFAIERADDFYVGKLAVEPDCQGQGIGRRL
                     MRAVEILALDRGKAALELQTRIELTANHAAFARLGFHETERTAHEGYSRPTSITMRKA
                     LS"
     gene            complement(6170..7171)
                     /locus_tag="MESOP_RS00030"
                     /old_locus_tag="Mesop_0006"
     CDS             complement(6170..7171)
                     /locus_tag="MESOP_RS00030"
                     /old_locus_tag="Mesop_0006"
                     /EC_number="1.1.1.26"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyacid dehydrogenase"
                     /protein_id="WP_013891254.1"
                     /db_xref="GI:503657178"
                     /translation="MAGKKKPLVVITRKLPDPVETRMRELFDARLNVEDRPMTQPELV
                     AAVKEADVLVPTVTDQIDAALIAQAGDNLKLIANFGNGVDKIDVAAAAKKGITVTNTP
                     NVLTEDTADMTMALMLAVPRRLAEGANVLTGDKKWVGWSPTWMLGRRIWGKRLGIVGM
                     GRIGTAVARRAKAFGLSIHYHNRHRVLPAVEDGLEATYWESLDQMLARMDIISVNCPS
                     TPATFHLLSARRLALLQPTAYIVNTARGDIIDEEALVKLIQDGKIAGAGLDVYEHEPA
                     LNGKLLKLAARNKVVLLPHMGSATLEGRIDMGEKVIINIRAFVDGHRPPDRVLPLRT"
     gene            7320..7880
                     /locus_tag="MESOP_RS00035"
                     /old_locus_tag="Mesop_0007"
     CDS             7320..7880
                     /locus_tag="MESOP_RS00035"
                     /old_locus_tag="Mesop_0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891255.1"
                     /db_xref="GI:503657179"
                     /translation="MSGFASLRLVLSAAFLGTLLYSPLAAAQGAAAPAQGAVTLGPSG
                     LPLPRFVSLKSGRVNSRVGPGANYSVDWMYMKAGLPMEIIQEFDTWRRVRDADGSEGW
                     INQSLLSGRRTAIIAPWQRGKGAQINLLNSPDKDARVIAIVEPGVMGMIKSCDGQWCE
                     MTLGGHTGWLAQSTVWGAYPGERVKD"
     gene            complement(7870..8250)
                     /locus_tag="MESOP_RS00040"
                     /old_locus_tag="Mesop_0008"
     CDS             complement(7870..8250)
                     /locus_tag="MESOP_RS00040"
                     /old_locus_tag="Mesop_0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891256.1"
                     /db_xref="GI:503657180"
                     /translation="MKPLDLIIRLEWVVVAVAAIVFYASSGISWWLFAVLILAPDLSM
                     LGYLGGPRLGAIAYNALHMLIAPVLLLLAGHLLGNAAAITVALIWIAHIAIDRSLGYG
                     LKLSTGFQDTHLGRIGRKPGAFSP"
     gene            complement(8273..8740)
                     /locus_tag="MESOP_RS00045"
                     /old_locus_tag="Mesop_0009"
     CDS             complement(8273..8740)
                     /locus_tag="MESOP_RS00045"
                     /old_locus_tag="Mesop_0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_013891257.1"
                     /db_xref="GI:503657181"
                     /translation="MDRGCRKENVAVDKRVREAGLRPTRQRIALADLLFAKGDRHLSA
                     EELHEEALAAGVPVSLATVYNALHQFTQAGLLRILAVEGAKTYFDTNTSDHHHFYIEG
                     ENRIFDIANGPVTVTNLPDPPEGMEIANVDIVVRLRPKRQESPAGPEQSAKPE"
     gene            8982..9497
                     /locus_tag="MESOP_RS00050"
                     /old_locus_tag="Mesop_0010"
     CDS             8982..9497
                     /locus_tag="MESOP_RS00050"
                     /old_locus_tag="Mesop_0010"
                     /EC_number="4.2.1.60"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98BH8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxydecanoyl-ACP dehydratase"
                     /protein_id="WP_013891258.1"
                     /db_xref="GI:503657182"
                     /translation="MAGKPSYDYDELLACARGELFGEGNAQLPYPPMLMFDRITEISE
                     TGGAFDKGFIRAEFDIKPDLWFFACHFIGNPIMPGCLGLDALWQLTGFYLGWLGEPGK
                     GMALSTGEVKFKGMVTPSVKKVEYGVDFKRVMRGRLVLGIADGWMKADGEPIYAATDL
                     KVGLSKQSAVA"
     gene            9547..10767
                     /locus_tag="MESOP_RS00055"
                     /old_locus_tag="Mesop_0011"
     CDS             9547..10767
                     /locus_tag="MESOP_RS00055"
                     /old_locus_tag="Mesop_0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013527886.1"
                     /note="FabB, beta-Ketoacyl-ACP synthase I, KASI; catalyzes
                     a condensation reaction in fatty acid biosynthesis:
                     addition of an acyl acceptor of two carbons from
                     malonyl-ACP; required for the elongation of short-chain
                     unsaturated acyl-ACP; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_013891259.1"
                     /db_xref="GI:503657183"
                     /translation="MRRVVVTGIGIVSSIGNNANEVQTSLHDARSGISFSDSFAEHGF
                     RCQVWGAPTLDPSAMIDRRAMRFLSQGAAWNHVAMDQAIADAGLGEDDVTNERTGIVM
                     GSGGPSTRTIVEAAETTLKNGSPKRIGPFAVPKAMSSTASATLATWFKIHGVNYSISS
                     ACSTSAHCIGNGYELIQWGKQDMVFAGGHEDLDWTMSDLFDAMGAMSSKFNDKASTAS
                     RAYDVNRDGFVIAGGAGVLVLEELEHAKARGAKIYAEIVGYGATSDGYDMVAPSGEGA
                     IRCMRQAMSTISTPVDYINTHGTSTPVGDSKEMGAIREVFGEKMPFITSTKSLTGHSL
                     GAAGVQESIYSILMMQGGFIGESAHIETLDPEFEGMPIVRKRIDNAKIDTVLSNSFGF
                     GGTNATLVFQRYSA"
     gene            10819..11631
                     /locus_tag="MESOP_RS00060"
                     /old_locus_tag="Mesop_0012"
     CDS             10819..11631
                     /locus_tag="MESOP_RS00060"
                     /old_locus_tag="Mesop_0012"
                     /EC_number="1.3.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891260.1"
                     /note="Catalyzes a key regulatory step in fatty acid
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-ACP reductase"
                     /protein_id="WP_013891260.1"
                     /db_xref="GI:503657184"
                     /translation="MNGLMKGKRGLVMGVANDHSIAWGIAKKLSEHGAELAFTYQGEA
                     FGRRVKPLADKLGAALVVPCDVEDSASVAATFETLNKEWGGLDFVVHAIGFSDKNELK
                     GLYADTSRDNFVRTMVISCYSFTEIARHAAALMNDGGSMITLTYAGSVRVMPNYNVMG
                     VAKAGLEASVRYLANDYGPRGIRVNGISAGPVRTLAGAGISDARHMFSYQQRNSPLRR
                     TVTIDEVGGSALYLLSDLSSGVTGEIHYVDSGYHIVSMPTLDELKQTDSTRD"
     gene            11768..13312
                     /locus_tag="MESOP_RS00065"
                     /old_locus_tag="Mesop_0013"
     CDS             11768..13312
                     /locus_tag="MESOP_RS00065"
                     /old_locus_tag="Mesop_0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019863080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="WP_013891261.1"
                     /db_xref="GI:503657185"
                     /translation="MPAVSNPKRTPVFRLLTIASSGIGSFVLGIWGLKYGLGGGFAGI
                     SADMMVAIMAALCALAASVAAMSFFAGVDESADFVFNETHFDKLTGLLGRPAMVGKIA
                     EAACTTSRTGEPVFLIDIDIDRFKQINDAIGYTQGDELIRAFTKRLQSCVPARALIGR
                     IGAGEFAVLLPDHQIPGTMESMVERLIDEMMEPYELSSHQQSVSLSVGIVAMPKDGVD
                     PVLILRRSNLALQNARASGVGNWSVFDSEMGRVADYRQWVESELHTAFERGDFDLHYQ
                     PQLDLPTGRIVGYEALIRWNHPERGMIPPMEFIQIAEETGMINPIGEWVLRKACSDAR
                     HLPDDCFVAVNISPVQFMTKDFVGIVRDAMRATGIKPSRLELEVTETAMMQDRDRAAA
                     ILKELAEMGISVAVDDFGTGYSNLSYLIDFSFGKLKIDRSFVSRIDTDSSSGAVVSTI
                     VGLSRALGVSIIAEGVETESQATLLRAAGCEVVQGYLFGRPAPLKFSVTDAHATDEVR
                     RVANLH"
     gene            complement(13323..14336)
                     /locus_tag="MESOP_RS00070"
                     /old_locus_tag="Mesop_0014"
     CDS             complement(13323..14336)
                     /locus_tag="MESOP_RS00070"
                     /old_locus_tag="Mesop_0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_013891262.1"
                     /db_xref="GI:503657186"
                     /translation="MSTEALKTLFHPFEVEALPLPRKDERMLFLGAEPGLRLPQGFEA
                     ALHVVQGFRPHFRALQAAKFTVTPQPEGDGFDAALVLAGRHRGQNELRIAEALERVVP
                     GGLIVVAGGKDDGIASLRKRIDELVPLDGHMPKYHGVAFWLRRPADPAAAQELRAANP
                     VLLVEGRFHTAPGMFSFDRIDAGSKLLVDNLPGDLRGNIADFCAGWGYVAAEVASRSP
                     GITALDLYEADFAALEAAKRNLGAAALVPGFFWLDLLAEPVERRYDAVVMNPPFHRAR
                     AAEPEIGAGMIHAAGKALKPGGRLFMVANRQLPYEPVLKAAFSSHAELARDGMFKVLS
                     ARR"
     gene            complement(14406..16553)
                     /locus_tag="MESOP_RS00075"
                     /old_locus_tag="Mesop_0015"
     CDS             complement(14406..16553)
                     /locus_tag="MESOP_RS00075"
                     /old_locus_tag="Mesop_0015"
                     /EC_number="2.7.7.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019863078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide phosphorylase"
                     /protein_id="WP_013891263.1"
                     /db_xref="GI:503657187"
                     /translation="MFNHHKVEIEWGGRPLILETGKIARQADGAVLATYGETKVLATV
                     VSMKEPKPGLDFFPLTVNYQEKTYAAGKIPGGYFKREGRPSEKETLVSRLIDRPIRPL
                     FADGYKNDTQIVVTVVQHDLENDPDILSIVATSAALTLSGVPFMGPVGGARVGYINGE
                     YVLNPHIDEMQESKLDLVVAGTADAVLMVESEAKELGEELMLGAVMFGHRGFQPVIDA
                     IIKLAEVAAKEPRDFTAPDYSVLEAEMLKIVGDELSNAYKNVDKQKRYAAVDAVKAKV
                     KAAFAPAEGDEAKYTSEQIGSVFKELQAKVVRWNILDTGSRIDGRDLKTVRKIVSEVG
                     VLPRTHGSALFTRGETQALVVATLGTGEDEQYVDSLTGMYKEKFLLHYNFPPYSVGET
                     GRMGSPGRREIGHGKLAWRAIRPMLPSADQFPYTLRVVSEITESNGSSSMATVCGTSL
                     ALMDAGVPLAKPVAGIAMGLIKEGERFAVLSDILGDEDHLGDMDFKVAGTTSGITSLQ
                     MDIKIEGITEEIMKIALDQAKDGRQHILGEMAHALTGARPELGEFAPRIEVMHIPTDK
                     IRDVIGSGGKVIREIVEKTGAKINIEDDGTVKIASSNAKEIEAAKKWIHTIVAEPEVG
                     EIYEGTVVKTADFGAFVNFFGPRDGLVHISQLANERVAKTSDVVKEGDKVWVKLMGFD
                     ERGKVRLSMKVVDQASGKEIVRDKKSEGEEDAA"
     gene            complement(16831..17100)
                     /locus_tag="MESOP_RS00080"
                     /old_locus_tag="Mesop_0016"
     CDS             complement(16831..17100)
                     /locus_tag="MESOP_RS00080"
                     /old_locus_tag="Mesop_0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019172607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_006202929.1"
                     /db_xref="GI:493223745"
                     /translation="MSITAERKQELMGEFATAKGDTGSPEVQVAILSERIKNLTDHFK
                     DHKKDNHSRRGLLALVSQRRSLLDYLKRKDDARYQTLIEKLGLRR"
     gene            complement(17282..18376)
                     /locus_tag="MESOP_RS00085"
                     /old_locus_tag="Mesop_0017"
     CDS             complement(17282..18376)
                     /locus_tag="MESOP_RS00085"
                     /old_locus_tag="Mesop_0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006202928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="divalent cation transporter"
                     /protein_id="WP_013891264.1"
                     /db_xref="GI:503657188"
                     /translation="MAKAEAVKKRTPVKTRRPPVGASPGTLIADPAARRSELRLTMIS
                     PQKYKTIENASIDDVEANCHKWPVIWLDCTGLANIQLIEEIGRIFNLHPLALEDVVNT
                     GQRPKVDFFEDHAFVVVRMIDDVTSHRYEQIGLFVGENFVVTFQEREGDPFDPVRKRI
                     ESSAPNRLRARGADYLAYALIDAIVDSYFPPIEAAGDLVDSIEDEMLHSPHKHQMRQL
                     HELRRDANVLKGVLWPMRDALATLIRNDVPYVKAETKVFLNDTLDHSLRLIELVETQR
                     DMLTGLIEMHLSLSQARTNDVISYLTIVSVIFMPLTFLVGVWGMNFDPESSPWNMPEL
                     KSYYGYPVSLLFMAVVAVGLIAFFKWKKWL"
     gene            complement(18421..19428)
                     /gene="truB"
                     /locus_tag="MESOP_RS00090"
                     /old_locus_tag="Mesop_0018"
     CDS             complement(18421..19428)
                     /gene="truB"
                     /locus_tag="MESOP_RS00090"
                     /old_locus_tag="Mesop_0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891265.1"
                     /note="catalyzes isomerization of specific uridines in RNA
                     to pseudouridine; responsible for residues in T loops of
                     many tRNAs; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="WP_013891265.1"
                     /db_xref="GI:503657189"
                     /translation="MARRGKKKGRPVSGWVVLDKPVGMGSTEAVSKIKWLFQAEKAGH
                     AGTLDPLASGMLPIALGEATKTVPYVQDGAKVYRFTVAWGQERSTDDLEGPVTKEADQ
                     RPSEAEVRALLPKYTGVIMQTPPQFSAIKIAGERAYDLAREGETVDIPAREIEIGRLD
                     IVEHGTDQTVFEVECGKGTYVRSLARDMGRDLGCFGHISELRRVEVEPFTPEDFVTVA
                     ELEAARFGAPGEDVVGEDIEGEGKSEAADAVDVVEAPVDFGAIDALLVDTSAALDCLP
                     QIAISDDAATKIRLGNPVIIRGRDAPVEAEEACATARGKLVAIGAIEQGMFKPKRVFA
                     G"
     gene            complement(19428..19898)
                     /locus_tag="MESOP_RS00095"
                     /old_locus_tag="Mesop_0019"
     CDS             complement(19428..19898)
                     /locus_tag="MESOP_RS00095"
                     /old_locus_tag="Mesop_0019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="WP_013891266.1"
                     /db_xref="GI:503657190"
                     /translation="MPRSTTSGPSQRMLRVGEQVRHALSETLQRGDIIDPLIENSVVS
                     VSEVRMSPDLKIATAFVSPLGAKDAEAVIEALNKHAKFVRGRVSGALRQMKYMPEFRF
                     RLDTSFDNFARINDLLKSPEVARDLDADDDKAQEDKAQEDRAKDDKAKEGKDSE"
     gene            complement(20038..22620)
                     /locus_tag="MESOP_RS00100"
                     /old_locus_tag="Mesop_0020"
     CDS             complement(20038..22620)
                     /locus_tag="MESOP_RS00100"
                     /old_locus_tag="Mesop_0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_013891267.1"
                     /db_xref="GI:503657191"
                     /translation="MSDTKSGDDKTLSVTPKKTLTLKRPGMEQGTVRQNFSHGRTKSV
                     VVETKKRKFSLPGDKPEPVAAAPAPVFTPKPAAVVAAPPVVQEAPKAPPPPPPPVERS
                     GMVLNELSRSEMEARRRALEGSKVREVEDRQRAAEEAKRRAEDEERRKREREESARRQ
                     AEEEARLQTEAESRRRAEEEARRRAPLAAELATADEEEEVKPKRTGAGAPVRRPVTPE
                     VARPAKPTKGEEDRRRGKLTLNSALTDEDARARSLSSMRRRQEKFKRAMHNEPREKVM
                     REVILPETITIQELAQRMSERAVDVVKFFMKQGQILKPGDVIDADTAELVATEFGHTV
                     RRVAESDIEEGLFNIADNAEDLVSRPPVVTIMGHVDHGKTSLLDAIRNANVVSGEAGG
                     ITQHIGAYQVEKNGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAADDSVMPQTIE
                     SISHAKAAGVPIIVAINKIDKHDADPQKVRSELLRHEVFVESMGGEVLDVEVSATKGT
                     NLDKLLEAILLQAEILDLKANPDRTAEGVVIEAQLDKGRGPVATVLVQTGTLMPGDIL
                     VAGNEWGRVRALVNDRGEQIKEAPPAMPVEVLGLQGTPQAGDRFAVVNNEARAREITE
                     YRQRLAREKAVARHAGQRGSLEQMMSQLQTSGLKEFPLVIKGDVQGSIEAINAALDKL
                     GTDEVRARIVHAGAGAITESDVSLAETSGAAIIGFNVRANVQARAAAAAAGIEIRYYS
                     IIYNLVDDVKAALSGLLSPERRETFIGNAEILEIFDITKVGKIAGCRVTEGKVERGAG
                     VRLIRDNVVIHEGTLKTLKRFKDEVSEVPGGQECGMAFQNYEDMRVGDVIECFRVEMV
                     TRTL"
     gene            complement(22617..23267)
                     /locus_tag="MESOP_RS00105"
                     /old_locus_tag="Mesop_0021"
     CDS             complement(22617..23267)
                     /locus_tag="MESOP_RS00105"
                     /old_locus_tag="Mesop_0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019863073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891268.1"
                     /db_xref="GI:503657192"
                     /translation="MNDRTCIVTRKQAEPDELIRFVVGPDSAVVPDLKRNLPGRGCWV
                     SADRLHIEKAAAKNLFARAFKAQVVVPPDLGGMVDGLLSRSALGMLGLARKAGAISLG
                     ATKVESAVRGGLALFVLHATEASDDGVRKISQARRATVHIGGPSILAYKLFSEAELSL
                     ALGGTNVIHAAVLAGDAGKAVQKRMVALDRYRGGTPDDLAMLAAVADEDDAAEDME"
     gene            complement(23306..24901)
                     /locus_tag="MESOP_RS00110"
                     /old_locus_tag="Mesop_0022"
     CDS             complement(23306..24901)
                     /locus_tag="MESOP_RS00110"
                     /old_locus_tag="Mesop_0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008872230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor NusA"
                     /protein_id="WP_013891269.1"
                     /db_xref="GI:503657193"
                     /translation="MVVSANRLELLQIADAVAREKSIDKSIVIAAMADAIQKAARSRY
                     GQETNIRADINPNTGEMKLQRLMEVVEKVDDYATQIAISSARERNPDAQLGDFIAEQL
                     PPMDFGRIAAQSAKQVIVQKVREAERDRQYDEYKDRIGEIVNGTVKRVEYGNVIVDLG
                     RGEAIIRRDELIPRENYKYGDRVRAYVYDVRREQRGPQIFLSRTHPQFMAKLFTMEVP
                     EIYDGIIEIKSVARDPGSRAKIAVISRDSSIDPVGACVGMRGSRVQAVVGELQGEKID
                     IIPWSPSAASFIVNALQPAEVAKVVLDEDAERIEVVVPDDQLSLAIGRRGQNVRLASQ
                     LTGWDIDILTEAEESERRQKEFVERSALFMEALDVDEMVGQVLASEGFTSVEEVAYVD
                     AGEIASIDGFDEDTASEIQTRAREYLEKIEAEHDDKRKALGVSDELREIPGITTAMMV
                     TLGEDGVKTIEDFAGYAADDLTGWKERKDGETKVYPGVLANHGVSRADAEQMVLNARL
                     KAGWITEDELAAEEAPADEAVGA"
     gene            complement(24951..25598)
                     /locus_tag="MESOP_RS00115"
                     /old_locus_tag="Mesop_0023"
     CDS             complement(24951..25598)
                     /locus_tag="MESOP_RS00115"
                     /old_locus_tag="Mesop_0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98BJ1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation factor RimP"
                     /protein_id="WP_013891270.1"
                     /db_xref="GI:503657194"
                     /translation="MTAMTSEGDDRIIRESGIDARIALIIQPVLRGIGFRLVRVHLSG
                     QNGLTLQIMAEREDGTMTVEDCEEVSRAVSPALDVDDPIEKAYHLEVSSPGIDRPLVR
                     KSDFVTWTGHLVKMETSVVVADRKRFKGKIAEAGENDVLIERDKAAYGEEPTVRVPYD
                     AISETRLILTDDLIRDALSKDNRARKEAKKRRGEPDDDVPEGTEADATEEHEQES"
     gene            complement(26153..26854)
                     /locus_tag="MESOP_RS00120"
                     /old_locus_tag="Mesop_0025"
     CDS             complement(26153..26854)
                     /locus_tag="MESOP_RS00120"
                     /old_locus_tag="Mesop_0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N(7)-)-methyltransferase"
                     /protein_id="WP_013891272.1"
                     /db_xref="GI:503657196"
                     /translation="MSPDDRPSRATEAFFGRRRGKPVRPQQAAALESGLGTYRLDLTA
                     EAPSELRTLFEADVSAVRLEIGFGGGEHLLHRAIEAPTTGFVGVEPFVNGMAKMMMAV
                     RQRPLANLRVFDDDATRLLDWLPPASLDGIDLLYPDPWPKKKHWKRRFVSAVNLDRFA
                     RVLKPGSKFRFASDIDTYVNWTLLHCRAHGAFAWQAADAGDWNSPYAGWPGTRYEAKA
                     IREGRRPAYLTFVRT"
     gene            complement(26881..28146)
                     /locus_tag="MESOP_RS00125"
                     /old_locus_tag="Mesop_0026"
     CDS             complement(26881..28146)
                     /locus_tag="MESOP_RS00125"
                     /old_locus_tag="Mesop_0026"
                     /EC_number="2.5.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006202919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="WP_013891273.1"
                     /db_xref="GI:503657197"
                     /translation="MTRQNYFFTSESVAEGHPDKVCDRISDEIVDLVYREAKKTGMDP
                     WKVRVACETLATTNRVVIAGEVRVPETLLKKDKAGNVLMDAAGHPVVNPAKFKSVARK
                     AIREIGYEQAGFHWKTAKIEVLLHGQSPDIGQGVDNAADRQGEEGAGDQGIMFGYACR
                     ETPDLMPAPIYYSHKILELLAAARHQNNGEAGKLGPDAKSQVTVRYVDGKAAEATQIV
                     LSTQHLDSSWDSKKVRKVVEPYIREALGDLKIADDCMWYINPTGKFVIGGPDGDAGLT
                     GRKIIVDTYGGAAPHGGGAFSGKDTTKVDRSAAYAARYLAKNVVAAKLADRCTIQLSY
                     AIGVAQPLSVYVDLHGTGKVDEAKLEDALRTVMDLSPSGIRRHLDLNKPIYAKTSSYG
                     HFGRKAGRDGSFSWEKTDLAKALKDAVAA"
     gene            complement(28316..28735)
                     /locus_tag="MESOP_RS00130"
                     /old_locus_tag="Mesop_0027"
     CDS             complement(28316..28735)
                     /locus_tag="MESOP_RS00130"
                     /old_locus_tag="Mesop_0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="WP_013891274.1"
                     /db_xref="GI:503657198"
                     /translation="MTEENKKKPNPIDIHVGSRIRLRRNMLGMSQEKLGENLGITFQQ
                     IQKYEKGTNRVGASRLQAIASILGVPVAFFFEDAPGQESSANRGFAEDASMAFAVEFC
                     GSPEGLQLNRAFVKIADVKVRRRIIDLVKSLAADDLD"
     gene            complement(28874..30466)
                     /locus_tag="MESOP_RS00135"
                     /old_locus_tag="Mesop_0028"
     CDS             complement(28874..30466)
                     /locus_tag="MESOP_RS00135"
                     /old_locus_tag="Mesop_0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="WP_013891275.1"
                     /db_xref="GI:503657199"
                     /translation="MVRLAGRIILLWGWRRALVAFLAGALAVLGQAPYDFFAACFISF
                     PVLVWLLDGATGEASGSLFRRLRPAFAVGWWFGFGYFLAGLWWIGSALLVEADSFAWA
                     LPFAVIGIPFALAFFYGFATVIARLLWSSDIGRIAALAFGFALAEWLRGFLFTGFPWN
                     AIGYAAMPVPLLMQSVSVTGMVGMNALAVFLFALPALLAARRHLRLGAALFVVLAAAH
                     VGFGYVRLAAPEKPAERSLNVRIVQPAVDLSEKWDASVRDRIFATLLGLSAKAPDPSH
                     DRPQLILWPETSVPFLFTERPDALTALGDMLGDGQMLIAGVVREEGGSAAGADSRYYN
                     SVVAIDDKGEIADAVDKVHLVPFGEYLPFADLLSRFGIEQLVAGPMTFTAGNERHAIT
                     LPGGLRALPFICYEVIFPDLVAVDATSAQLIVNVTNDAWFGDTPGPYQHFRQAQIRAV
                     ENGLPLLRAANNGISAVVDPRGRIVDALAIDARGAIDVKVPIAEQAVVSEGQRRINGM
                     LIMLLFALGGALLNVRQRLRVN"
     gene            complement(30566..31036)
                     /locus_tag="MESOP_RS00140"
                     /old_locus_tag="Mesop_0029"
     CDS             complement(30566..31036)
                     /locus_tag="MESOP_RS00140"
                     /old_locus_tag="Mesop_0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_013891276.1"
                     /db_xref="GI:503657200"
                     /translation="MTIDDPFKHASLGSGVFYRDPRAALDWLEAAFGFERSMVVSDAE
                     GKLVHAEMRFGDCTIIVDSEWSDYVASPASVSGKNTQSVYVRLKDGLDGHCEQARAAG
                     AVIIQEPADQFYGERQYRARDPEGHVWTFSQTIRVVSREEAERLGGMRIEGWHR"
     gene            complement(31053..32147)
                     /locus_tag="MESOP_RS00145"
                     /old_locus_tag="Mesop_0030"
     CDS             complement(31053..32147)
                     /locus_tag="MESOP_RS00145"
                     /old_locus_tag="Mesop_0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019863065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891277.1"
                     /db_xref="GI:503657201"
                     /translation="MNDKPETAARPDAGSAPKASDTSEEGSSPSTVTPGATSTGSVAS
                     ETSPAGPSLFERVLGLFRQRNGTSLREEIAGALAETASDAGAFSPGERAMLNNILRLR
                     EVRVEDVMVPRADIQGVEITTTLGDLLGTFEQSGHSRMPVYSETLDDPRGMVHIRDVL
                     AHITKLARVKKGRTTRKTPVATQLDLAQVDLSRTIGELNLIRQVLFVPPSMLASDLMG
                     RMQTTRTQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDDEPMITQAGDGVFVVD
                     GKAEIDEVAKMIGEGFAAGEHGEYVDTIGGMIFNTLGRVPARGEVVQAIPGFEFHVLD
                     ADPRRVKRVRIVQSQKGERRRRATARTEQA"
     gene            complement(32176..32676)
                     /locus_tag="MESOP_RS00150"
                     /old_locus_tag="Mesop_0031"
     CDS             complement(32176..32676)
                     /locus_tag="MESOP_RS00150"
                     /old_locus_tag="Mesop_0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA maturation RNase YbeY"
                     /protein_id="WP_013891278.1"
                     /db_xref="GI:503657202"
                     /translation="MPEDSTSVDGSLPVEIDISIEAGDWPAEASLARLVDRAVAVAFA
                     ETGAAGQSELSIVFSDDAHIRTLNADWRGKDKPTNVLSFPAFPHVKDGPLPPMLGDIV
                     LAAETVAREAALEDKPLENHITHLVIHGLLHLMGYDHETDTEAEAMEAVERAALARLA
                     IPDPYA"
     gene            complement(32694..33743)
                     /locus_tag="MESOP_RS00155"
                     /old_locus_tag="Mesop_0032"
     CDS             complement(32694..33743)
                     /locus_tag="MESOP_RS00155"
                     /old_locus_tag="Mesop_0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate starvation protein PhoH"
                     /protein_id="WP_013891279.1"
                     /db_xref="GI:503657203"
                     /translation="MSAAELKNLPPVPASGASDMAHIVLTFDNNKLASALYGQFDENL
                     ARLEQKLGVDIRSRGNQLTIKGSASAAEQARRALDNLYGILQKGVDIGQSDVDGAVRM
                     AVAADDQLTLPTLERKGKVSAAQIATRKKTIYARSLNQDAYMRALERSELVFGIGPAG
                     TGKTYLAVAHAAMLLERGMVERIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDAL
                     YDMMPADKVERAIAAEVIEIAPLAFMRGRTLAHAAVILDEAQNTTPMQMKMFLTRLGE
                     NSRMIVTGDPTQIDLPPSTKSGLVEALRVLDGVAGAVTVRFNDIDVVRHPLVAEIVRA
                     YDRDAKLARGLGAEN"
     gene            complement(33770..35191)
                     /locus_tag="MESOP_RS00160"
                     /old_locus_tag="Mesop_0033"
     CDS             complement(33770..35191)
                     /locus_tag="MESOP_RS00160"
                     /old_locus_tag="Mesop_0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylallyladenosine tRNA
                     methylthiotransferase"
                     /protein_id="WP_013891280.1"
                     /db_xref="GI:503657204"
                     /translation="MDLNTIESDDIGTLAGHPAVHAVAAKKVFIKTYGCQMNVYDSQR
                     MADALAADGYTATGAIGEADLVLLNTCHIREKAAEKVYSELGRIRDMKAERASVGREL
                     LIGVAGCVAQAEGAEIIRRSPAVDLVIGPQTYHRLPDVLARVRGGEKIVETDYAIEDK
                     FEHLPQPKRAEVIKRGVTAFLTVQEGCDKFCTFCVVPYTRGSEVSRPVAQIVAEAERL
                     AEAGVREVTLLGQNVNAWHGQGDTKGGRTEEWGLGRLLHRLAQIPGLARLRYTTSHPR
                     DMDDELIAAHRDLPSLMPYLHLPVQSGSDRILKAMNRRHTARDYLALLDRIRAARPDI
                     ALSGDFIVGFPGETEADFEATMELVRQVNYASAFSFKYSPRPGTPGAEMADHVPETVK
                     DERLQRLQALLLKQQQDFGLSLIGSTIDTLIEKPGRQSGQKVGRSPWLQPVIVDEKAG
                     EIGDIIQVRITKTGYNSLFAELA"
     gene            complement(35267..36067)
                     /locus_tag="MESOP_RS00165"
                     /old_locus_tag="Mesop_0034"
     CDS             complement(35267..36067)
                     /locus_tag="MESOP_RS00165"
                     /old_locus_tag="Mesop_0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_013891281.1"
                     /db_xref="GI:503657205"
                     /translation="MIKKIRIFLALGLVVAGSLILVPLQMLSMKTGWWPETFILKIWH
                     RLILRALGMRVHVKGTLSDKRPLLVASNHISWTDIMVLGSFADVKFIARADMEGWPLI
                     GMLSKLQRTVFIERERKRSSGDQASEIANRMAKGDAMVLFAEGSTGDGNAILPFKSTL
                     FGAASMAISEGAAEQVFIQPVAIAYTRLHGVPLGRRHRPISAWIGDEDLMPHLKVLMA
                     EGALDVEVHFGDPIAFSKGSNRKETAKLMESQVRDMMMAALADPRPSR"
     gene            complement(36088..36582)
                     /locus_tag="MESOP_RS00170"
                     /old_locus_tag="Mesop_0035"
     CDS             complement(36088..36582)
                     /locus_tag="MESOP_RS00170"
                     /old_locus_tag="Mesop_0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine acetyltransferase"
                     /protein_id="WP_013891282.1"
                     /db_xref="GI:503657206"
                     /translation="MRIPFLQPRRRDYALEPLRITDSPAVSLLHREDFVRPWTDGEFA
                     ALLEQDTVFGYAARETGQGAKPPVGVVLARLAAGEGEILTVAVGRSHRRQGLGWQLMD
                     AVLRELHAQRAEALFLEVDETNVAAIALYRRLGFREVGKRPDYYKSPDRGPTGALVMR
                     RDLR"
     gene            complement(36582..37259)
                     /locus_tag="MESOP_RS00175"
                     /old_locus_tag="Mesop_0036"
     CDS             complement(36582..37259)
                     /locus_tag="MESOP_RS00175"
                     /old_locus_tag="Mesop_0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M22"
                     /protein_id="WP_041164451.1"
                     /db_xref="GI:752465742"
                     /translation="MKVLAIDCAASLCAACVYDAAVGLELGRSVLDLGKGHAEHLMAV
                     IAEALKAGATDYAGLGAIAVSVGPGSFTGLRVGVSTARGLALALKIPAIGVTTLEALA
                     AEAAAAFPGRAVLAALDAGREEIHAALYDQMSVLTYGPAVATLAEATGMAIESSAVLA
                     GTAAAQIAASAGRGFDIGPRTATADILTYARLAAVKGAGERPKPLYLRGADAKPQAGF
                     ILSRQQN"
     gene            complement(37353..38459)
                     /locus_tag="MESOP_RS00180"
                     /old_locus_tag="Mesop_0037"
     CDS             complement(37353..38459)
                     /locus_tag="MESOP_RS00180"
                     /old_locus_tag="Mesop_0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891284.1"
                     /db_xref="GI:503657208"
                     /translation="MKTPLIDRRDFLRAAGIGFAAAMAPSAWAMTLAADAVFATAFVK
                     RDGSFGAAVLSEAGKVLHTIDLPDRGHDVTFDPMSKRSVVFARQPGTFAVVFDHTGRD
                     APLTIASIPGRHFFGHGVFSPDGALLYATENDFDNAAGVVGVYDARAKFSRVGEFPTY
                     GMGPHELLLLGDGRTIAVANGGIETHPDYGRAELNIATMKPSYVLVDRVTGDLIEKHE
                     LPAPLHQLSIRHMDTDQAGTVWFGCQYRGPGTDRPLLVGRAARGKDLQLLDMQGDVLA
                     GFRNYIGSVAANPGSGTVAVSSPEGNSLVVIDAASGQVLSNSALVEVCGVAPDGTGFM
                     ATTGAGEIIEGSGAMRSEPDYVWDNHMLRIEQVA"
     gene            complement(38463..39536)
                     /locus_tag="MESOP_RS00185"
                     /old_locus_tag="Mesop_0038"
     CDS             complement(38463..39536)
                     /locus_tag="MESOP_RS00185"
                     /old_locus_tag="Mesop_0038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M75"
                     /protein_id="WP_013891285.1"
                     /db_xref="GI:503657209"
                     /translation="MLKRSALFLVLPLALLGALPASAAVKASDVIQRAIDGFVRPAYA
                     GLHEHTQALAKAMHELCEAPSPGELDAARTEFSATVYAWSSAEIIGLGPIKENNRLER
                     MLFWPDRKSIGLKQVQAALSAKDPTATDPAQLAGKSVAMQGALEFVLFGDGADALAGK
                     DDPYRCAYGAAVAGNIGTMAKDVNDAWNKPDGFAALWANPGPQNPLYRDGNEAVTELV
                     GVFINELEMVRDVRLKGFLGGKPEADKPKQAIYWRSQNTGNSLAGNLDGIDRLFQVSK
                     LGNALPEDARWMAESIHIQLVNGVATAKSVQGPIDKALADQALRGKLEHFALITSSLS
                     TLIGTRLTAEFGLTAGFSSLDGD"
     gene            complement(39536..41134)
                     /locus_tag="MESOP_RS00190"
                     /old_locus_tag="Mesop_0039"
     CDS             complement(39536..41134)
                     /locus_tag="MESOP_RS00190"
                     /old_locus_tag="Mesop_0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol oxidoreductase"
                     /protein_id="WP_013891286.1"
                     /db_xref="GI:503657210"
                     /translation="MRRPLEFLRRLRRAESSPPLRKPAGSTGRRCAILVLALTSSALA
                     GDLQPAGLATTRTDLDAKDQARVTAITRPTADFSKPERFELMQGGAGTSEKDVNRDAF
                     SQSSANITFEEEGTFKLGNALFRKNWVSSPSSTQASDGLGPLFNERACQNCHLKDGRG
                     RPPQGDLGSTSMFLRLARDASSAEEKAALADHQVLNFPDPVYGTQLQELAVPGLRGEG
                     RMHVDYQERKVELTDGTVVSLRKPSYSVTDPAYGPLDPRTTLSPRLTPPMIGLGLIEQ
                     IAPADILAHADPQDHDGDGISGRPNIVRDGQGGELTLGRFGWKAQTASIRQQAADAFA
                     GDIGISTPEESKHWGDCTIAQAKCLAMPNGVQQRLGSAEAPPPVMDLVTFYSRNLAVP
                     ARRDRDAPDVLAGKKVFYDIGCVSCHAPKFVTRRDAPDKAQAFQLIWPYSDFLLHDMG
                     PDLADGQAVGEATGNEWRTPPLWGIGLTGTVNGNSFFLHDGRARSLTEAILWHGGEGQ
                     KARDRFAAANAAERSALLEFLESL"
     gene            complement(41147..41632)
                     /locus_tag="MESOP_RS00195"
                     /old_locus_tag="Mesop_0040"
     CDS             complement(41147..41632)
                     /locus_tag="MESOP_RS00195"
                     /old_locus_tag="Mesop_0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="WP_013891287.1"
                     /db_xref="GI:503657211"
                     /translation="MKGEPQVIERLNEALFLELGAVNQYWVHFRLLEDWGYAKLAKKE
                     RAESIEEMHHADKLVARIIFLEGHPNLQSVAPLRIGQNVKEVLESDLAGEYDARTAYK
                     RSREICNEAGDYVSMKLFEQLLADEEGHIDFLETQLDLLASIGEEKYGQLNAASADDA
                     E"
     gene            complement(41598..41909)
                     /locus_tag="MESOP_RS00200"
                     /old_locus_tag="Mesop_0041"
     CDS             complement(41598..41909)
                     /locus_tag="MESOP_RS00200"
                     /old_locus_tag="Mesop_0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013527915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891288.1"
                     /db_xref="GI:503657212"
                     /translation="MLICHCNIITEKEIEQTIIDLLDQDPWQLIVPAKVYHTMQKRGR
                     CCGCFPNVVETIIRVTENYHTRSEASGVDIVSHLDRVRGLRVQYGSRIHERRTAGHRA
                     A"
     gene            complement(42019..43308)
                     /locus_tag="MESOP_RS00205"
                     /old_locus_tag="Mesop_0042"
     CDS             complement(42019..43308)
                     /locus_tag="MESOP_RS00205"
                     /old_locus_tag="Mesop_0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006201121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_013891289.1"
                     /db_xref="GI:503657213"
                     /translation="MTARYGGRLAAMGATALLTAAVFVLPAKAQTDAKAVVTTYSDIA
                     LAKYEDSLTTAQALDKAVDALLANPSADTLNAARDAWKASRVPYQQTEVYRFGNKIVD
                     DWEGKVNSWPLDEGLIDYVAKSYGTESDANSLYTANVIANKEIEINGKKVDASKLSPE
                     FLSGTLQEAGGVEANVATGYHAIEFLLWGQDLHGTGPGAGERPYTDYDLKNCTGGNCD
                     RRAEYLKSASTLLVSDLQEMVDDWKADGAARKALADGEPNTAISTIFTGMGSLSYGEL
                     AGERMKLGLLLHDPEEEHDCFSDNTYNSHLNDAIGIRAAYLASYTRLDGTVVSGPSVH
                     EMVKTADPAIDKELSDKLDVTVAKMEAIKARAEAGEAYDQQIAEGNTEGNATVQAAID
                     ALIDQTKSIERAVGSLKLNAIAFEGSDSLDAPDKVFK"
     gene            43753..45006
                     /locus_tag="MESOP_RS00210"
                     /old_locus_tag="Mesop_0043"
     CDS             43753..45006
                     /locus_tag="MESOP_RS00210"
                     /old_locus_tag="Mesop_0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="WP_013891290.1"
                     /db_xref="GI:503657214"
                     /translation="MKNGVVIVGAGHAGVQAAASLREDSYDGPVILIGDENELPYHKP
                     PLSKTFIKDAEAKPQPLRGEAFYTGNAIDYRPGIRIERIDAGRRSLEISGGGALAFDH
                     LILATGSRPRLLPLPGADLSGVLSLRSLSDARLIRELSARSDDVVILGGGFIGLEIAA
                     TLRAAGRTVTVVEAVDRLLGRAVAPVVASHVRQRLEATGVRILTGTSIAKLEGENGHV
                     AAAITLSGERLPARMVIVGIGAVPNVELAQDAGLAIANGIRVDHQMRSSVPEILAIGD
                     AASYRHWFTGGDVRLESVQNATDQARLAARTITGHADAYCAVPWFWSDIGDMKLQMVG
                     LTAGGNSHVLLGDLPDNKFSIYHYAGDRLLGIESVNRPGDHMLGRKMLGAGFSPTPET
                     VAAGPDGLKAALAAFQAVEPAKAVG"
     gene            complement(45383..46660)
                     /locus_tag="MESOP_RS00215"
                     /old_locus_tag="Mesop_0044"
     CDS             complement(45383..46660)
                     /locus_tag="MESOP_RS00215"
                     /old_locus_tag="Mesop_0044"
                     /EC_number="2.6.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019863052.1"
                     /note="catalyzes the formation of succinate semialdehyde
                     and glutamate from 4-aminobutanoate and 2-oxoglutarate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="WP_013891291.1"
                     /db_xref="GI:503657215"
                     /translation="MKNSAISERKNQSISRGVGMTTQIYADRAENSEIWDVEGRRYID
                     FSSGIAVVNTGHRHPRVIEAVKAQLDRFTHTCHQVVPYESYVRLAERLNAMLPGKFEK
                     KTIFVTTGAEAVENAIKIARNATGRPAVIAFSGGFHGRTFMGMALTGKVVPYKVGFGA
                     MPGDVYHAPFPVPLHGVSTADSLAALDRLFKADVDPARVAAIIVEPVQGEGGFYEAPR
                     EFLTALRKLCDQHGMLLIADEVQTGFARTGKMFAMDHHEVAADITTMAKSLAGGFPLS
                     AVTGRAEIMDAPGPGGLGGTYGGSPIGVAAAHAVLDVIEDEKLCDRANTLGARLKQRL
                     QSIRDDVPEIVDIRGLGFMNAVEFNDVKKGLPSAEIANAIRLKALDKGLILLTCGVYG
                     NVIRFLAPITIQDEVMNEALDILESSIREVCAA"
     gene            46898..48037
                     /locus_tag="MESOP_RS00220"
                     /old_locus_tag="Mesop_0045"
     CDS             46898..48037
                     /locus_tag="MESOP_RS00220"
                     /old_locus_tag="Mesop_0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="WP_013891292.1"
                     /db_xref="GI:503657216"
                     /translation="MSRNATSSVSPPSAQAPRLLSFTAASTIFACTTVLLLAGCQKQE
                     AAAKKLPIMVRTETVAMADYAPRTSLTGVIAARTLNNLSFRVGGRVAERLVDVGQHVD
                     QGTVLARIDPQEQESDLRSAQADLDAAQAQLTQSAAAFERQKTLLAQGFTTRRDYDAA
                     DQAQKVAQGSVDAARSAFANAQQNLSFTELKAGAAGVITARQVETGQVVQAAQTVFTV
                     AEDGDRDAVFNVQETLVARTPASPAVTITLLSDPQVRATGKVREISPAVDPASGSIRV
                     KVGIPDTPAGMPLGAAVIGSVGAKQAKAILLPWQALTSSAGKPAVWIVDPSTKAVTMA
                     PVEVLAFGSGTVAIAKGLNEGQSVVTAGGQLLSPGQTVEISGAGQ"
     gene            48034..49110
                     /locus_tag="MESOP_RS00225"
                     /old_locus_tag="Mesop_0046"
     CDS             48034..49110
                     /locus_tag="MESOP_RS00225"
                     /old_locus_tag="Mesop_0046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="WP_013891293.1"
                     /db_xref="GI:503657217"
                     /translation="MSRLPSILLGLFMLGALASCSKSDEKPPEIIRPVLSVVVEPRTT
                     QIFGFAGSVEPQVSADLAFRLLGRVVSRDVKVGDIVSKGTTIATLDPTALELAVQAAK
                     AELSNAEAQFANAAASEERQRQLLAAANTTQAVFDAAQQARKAAEANVERAKASLAKS
                     QEQLGYARLFSDFDGVVTAVGAEVGQTVSPGQTVVTVARSDLREAVVDIPDQLTGDLA
                     AGTPFQVILQSLPTIQTEAKLREIAPQSEGSTRTRRVKLTLTDPPQAFRLGSTVTATR
                     MTKVTPTIELPLSALLEKDGADKVWIVDPQTSSVSAKEIKLAAKGAATFIVAEGLEAG
                     MRVVTAGVHSLSEGQKVKVPEGGV"
     gene            49107..52208
                     /locus_tag="MESOP_RS00230"
                     /old_locus_tag="Mesop_0047"
     CDS             49107..52208
                     /locus_tag="MESOP_RS00230"
                     /old_locus_tag="Mesop_0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ACR family transporter"
                     /protein_id="WP_049802331.1"
                     /db_xref="GI:908670533"
                     /translation="MMKGFNLSDWALSHRSMVWYFMLVFVVAGIFSYLHLGREEDPNF
                     TIKTMIIQANWPGASVKETVQQVTDRIEKKLEELDSLDYTKSVTTAGQTVIFVNLKDT
                     TKARDVVPNWIQVRNMVNDIAAQFPQGVQGPFFNDRFGDVYGNIYAFTSDGLTPRQLR
                     DYVEDARTKILTVPNAGKVDLVGAQDEAIYLEFSTRQIAALGLNQQAIVASLQAQNAI
                     TPSGVIQSGPERISVRVGGQFTSEDSLRAINLRVNDRFFRLSDVATITRGYADPPTAL
                     FRFNGQDAIGLAIGMKPNANLLEFGEALHKEMNKVLADLPVGVGVHLVADQPVIVEEA
                     VSGFTRALFEAVAIVLAVSFISLGMRAGFVVALSIPLVLAITFTVMAYLGISLQRISL
                     GALIIALGLLVDDAMIAVEMMVARLEVGDNLRKAATYVYTSTAFPMLTGTLVTVAGFI
                     PIGLNNSAAGEYTFTLFVVIAVSLLVSWIVAVLFAPLLGVTILPATMKTKHHDQPGRF
                     TSLFRRVLVGSVRHHWLTIIATVLLFAGSIAGFGLVQQQFFPPSDRPELIVDWNLPQN
                     SSIADTRDQMERFEQRALVGNPDIDHFSSYIGQGAVRFVLAYDVQPANPYFGQTVIVT
                     KSIEARNRVKPALEKLLREEFVGTDAFVKLLELGPPVGRPVQYRVGGPDIQTVRELAQ
                     QFAGVISANPKLAASTFDWNEPQRVLRVDVLQDKARQLGITSSDIASALNSTVGGATI
                     TQVRDATYLINVVARSRDAERGSIGTLQNMQLPTSSGEAIPLAAVANFRYDLEQPTVW
                     RRDRIPTITVRAGLVGDVLPATVVNELKPSVDAFIAKLPPGYSVETAGSVEESAKSQG
                     PIAAVVPLMLFVMATILMVQLQSFQRLFLVVAVAPLGLIGVVAALVPSGAPLGFVAIL
                     GVLALIGILIRNSVILIVQIEDLVREGKDRWAAVIEATEHRMRPIALTAAAASLALIP
                     IAREVFWGPMAYAMMGGIIAGTAITLLFLPALYVTWFRIKEPKARDEPPVPDIGEPVQ
                     TPA"
     gene            52296..52499
                     /locus_tag="MESOP_RS00235"
     CDS             52296..52499
                     /locus_tag="MESOP_RS00235"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163946.1"
                     /db_xref="GI:752465237"
                     /translation="MPALWQIGQFQDAFIPPHDHNVAFVNRSSFAVVELPAATFIAVA
                     IVVISFMHNVCDPIATFKYASVR"
     gene            complement(52584..53333)
                     /locus_tag="MESOP_RS00240"
                     /old_locus_tag="Mesop_0049"
     CDS             complement(52584..53333)
                     /locus_tag="MESOP_RS00240"
                     /old_locus_tag="Mesop_0049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_013891296.1"
                     /db_xref="GI:503657220"
                     /translation="MTSAIAVDGLEVIFDRFRALKGVSLDVQPGESFGLVGESGSGKS
                     TLLRAIAGLAPVASGSIAVNGKTLGTRRDKAFYREVQMVFQDPYGSLHPRQTVDRLLQ
                     EPLAIHGFSDGEKRIQRALDEVGLGNGFRFRYSHQLSGGQRQRVAIARALILEPSILL
                     LDEPTSALDASVQAEVLNLLEEVRRRRKLTFLMVSHDLAIITHMCERLMVMQSGEAVE
                     NLTASDLVERHVTKDYTRNLLRASEGFVRTV"
     gene            complement(53330..54175)
                     /locus_tag="MESOP_RS00245"
                     /old_locus_tag="Mesop_0050"
     CDS             complement(53330..54175)
                     /locus_tag="MESOP_RS00245"
                     /old_locus_tag="Mesop_0050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_013891297.1"
                     /db_xref="GI:503657221"
                     /translation="MSRETKTLLEVDDLRVTFPTRTGLIEAVRGVSFSLGRERLGIVG
                     ESGSGKSQTGRAIMGLTPPQARISANKLAFDGIDLLDISPRQRRALRGNRIAMILQDP
                     KYSLDPVMSIGRQIVETLRTHEKVSKAEARERALAMLEAVQIRDPKRVFDLHPHEVSG
                     GMGQRAMIAMMLIAGPEMMIADEPTSALDVTVQLDVLGILDRLVSERGMGLIFISHDL
                     RLVSSFCDRVIVMYAGKVVEQLKASELGRAQHPYTRGLLNCMPKIGADRHPLPVLDRK
                     PEWAA"
     gene            complement(54200..55126)
                     /locus_tag="MESOP_RS00250"
                     /old_locus_tag="Mesop_0051"
     CDS             complement(54200..55126)
                     /locus_tag="MESOP_RS00250"
                     /old_locus_tag="Mesop_0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C550"
                     /protein_id="WP_013891298.1"
                     /db_xref="GI:503657222"
                     /translation="MTASDVRPLSRRDWLLSERPASRMQARLGRAYVAWRRFSANRLA
                     FVGLLIIIALLVIAALAGVLAPYSPTFGDLKNARLLAPSAEHWFGTDDLGRDILSRIL
                     YGSRWTLYVVILVAIIAAPIGLLVGTVAGYAGGWTDAILMRITDIFLAFPKLVLALAF
                     VAALGPGIENAVLAIAITSWPPYARIARAETLTVRNSDYIKAVQLMGASPFRIVLRHI
                     MPLCISSLIVRVTLDMAGIILTAAGLGFLGLGAQPPLPEWGTMIASGRRFILDQWWVA
                     GAPGFAILIVSLGFNLLGDGLRDALDPRSGDQ"
     gene            complement(55323..56384)
                     /locus_tag="MESOP_RS00255"
                     /old_locus_tag="Mesop_0052"
     CDS             complement(55323..56384)
                     /locus_tag="MESOP_RS00255"
                     /old_locus_tag="Mesop_0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_013891299.1"
                     /db_xref="GI:503657223"
                     /translation="MSAVENEGGRGGARAYALASSLGRFLVIAVTTYLGLLAVTFFIG
                     RVIPIDPVLAVLGDRAPANVVERTRREMGLDLPLIEQFYIYVKHALSGDFGTSVLTTN
                     PVMTDIRRALPATTELATLGTLIGALLGVPLGVLAAVRRGSLIDQIVRVIGLIGYSVP
                     IFWLGLLGLVLFYAKLQWVAFPARLDVVYEYTFTPITGFYLLDSAMQGQWDVFYDAFR
                     HIILPASLLGYFSLAYISRMTRSFMLNELAQEYIVAARAKGLSETRIIWGHALRNAAV
                     PMVTVIALSYAGLLEGSVLTETVFSWPGIGLYITNSLQNADMNAVLGGTIVIGSVFIA
                     INLLSDLLYRVLDPRTKVQ"
     gene            complement(56403..58046)
                     /locus_tag="MESOP_RS00260"
                     /old_locus_tag="Mesop_0053"
     CDS             complement(56403..58046)
                     /locus_tag="MESOP_RS00260"
                     /old_locus_tag="Mesop_0053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013527926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_041163947.1"
                     /db_xref="GI:752465238"
                     /translation="MMMEKFALRSRILLAGAAMSALLLAGAPAGAVTPADTLVEGFAI
                     DDIISMDPGEAFELSTAEVTGNTYDLLVRLDLSDTSKVKPDLAESWTVSDDGLTYTFK
                     LKPGLKFASGNPITAADVAYSFERAVKLDKSPAFIIDQFGISGDNVTEKAKAVDDTTF
                     QFTVDKAYAPSFVLNCLSATVASVVDAKLVKEHVAAVTPSADYKWDNDFGNAWLKTGY
                     AGSGAYKLREWRANEAVVMERNDNYYGEKAKLARVIYRNMKESSAQRLALEAGDIDVA
                     RNLEPNDLDAIAKNADLTTTSAPKGTVYYISLNQKNPNLAKPEVRQAFKYLVDYDALS
                     STILKGIGEIHQTFLPKGVLGELDENPFKLDVAKAKELLAKAGLPDGFSVTMDVRTGQ
                     PTTGMAESIQQTLGQAGIKLEIIPGDGKQTLTKYRARNHDIYIGQWGQDYFDPNSNAQ
                     TFASNPDNSDAGKSKTLAWRNAWDIPDLTKQTEAALLEKDSGKRADMYKDLEKKILDT
                     SPFVVIHQQLEVAGLRKNLKGFALGPSFDTNFVGPVSKE"
     gene            complement(58300..59577)
                     /locus_tag="MESOP_RS00265"
                     /old_locus_tag="Mesop_0054"
     CDS             complement(58300..59577)
                     /locus_tag="MESOP_RS00265"
                     /old_locus_tag="Mesop_0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013891301.1"
                     /db_xref="GI:503657225"
                     /translation="MAGRPEGGATERGLRQFCLAFFLAALAFLVFSTPASAAKIDDQF
                     RAWLQNDLWPQAKAQGISKSTFDAAFDGIKPNLKLPDLVMPGEKPKTPQKQHQAEFGS
                     PGAYFAEKTIGAVTAGGRARETANAKTIAAIEKRYGVPGEILLAIWGRETGFGAAKMP
                     YDAFEVLGTKAFMSTKKDFFRTELLAALEIVERGLAPVGAMKSSWAGALGQPQFMPTS
                     FLKHAVDFDGDGRVDIWNSTPDVLASIANYLVHYGWVKGRGWGFEVTVPETVSCSLEG
                     PDQGKKISQWVALGIKRVGEKPFPASELKAEGFLLMPAGRSGPAFIATPNFYVLKEYN
                     TSDLYALFIGHGADRIAHGDSNFSGAWGPVGDLHRSDIAALQRTLEAKGYDVGSADGL
                     PGFKTRRSIGKWQAKNGQASTCFPDAGLVTALK"
     gene            complement(59744..60349)
                     /locus_tag="MESOP_RS00270"
                     /old_locus_tag="Mesop_0055"
     CDS             complement(59744..60349)
                     /locus_tag="MESOP_RS00270"
                     /old_locus_tag="Mesop_0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98BM4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecR"
                     /protein_id="WP_013891302.1"
                     /db_xref="GI:503657226"
                     /translation="MSKRIAGPEIERLIQLLAKVPGLGPRSARRAALHLIKKKEQLLS
                     PLAAAMGEAADKVRICSTCGNVDTSDPCMICTDPRRDATTLIVVEDVSDLWALERAAA
                     MNVRYHVLGGTLSPLDGVGPDQLNIRSLIDRVAGGEVKEIILAVNATVEGQTTAHYLT
                     DQLSGFDIKVTRLAHGVPVGGELDYLDEGTLAAALRSRTAF"
     gene            complement(60431..61447)
                     /locus_tag="MESOP_RS00275"
                     /old_locus_tag="Mesop_0056"
     CDS             complement(60431..61447)
                     /locus_tag="MESOP_RS00275"
                     /old_locus_tag="Mesop_0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013891303.1"
                     /db_xref="GI:503657227"
                     /translation="MIVTRWKAPLLLGVVTSPLFLAACSQTTSHGMSVASLTDAITPS
                     FLSSRAYSHTPKDRECLERAMFFESNRSSRDGMIAVGTVVMNRLRSGNHGSTICQVVG
                     EPGQFAPGVMTRPMNSRAMPDVEEAADAVLKGERKAKLKNTMYFHTAGLRFPYKNMHY
                     TMVAGGNAFYEKRGRNWQPLPDEPMVASVETEKPAVPVTMVASAEPVRSDRKLVRNAP
                     AQQQAPTQQAPTQQAYVTAAVEPARPFKMATAPAQQTYVTAAAAPSAKSARVASKPVA
                     VAMQEPMEEPDAARFGGTLNKKIISSVQGEPQEASMGFQSTPENTDAIGAMIVSQGRP
                     LETN"
     gene            complement(61683..62090)
                     /locus_tag="MESOP_RS00280"
                     /old_locus_tag="Mesop_0057"
     CDS             complement(61683..62090)
                     /locus_tag="MESOP_RS00280"
                     /old_locus_tag="Mesop_0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891304.1"
                     /db_xref="GI:503657228"
                     /translation="MTDEPSERLIEQRIRNRIYEILEILADCDAGVDLVGIKGYFYLF
                     EDFVHRPSIEAGTSALSREERAVVLEIAEFLEAASETNPDFTKAEFIHSDWPGRIAPA
                     ARNARRLFLARGLFSEKVEELEPGQPAVAAAGR"
     gene            complement(62110..62433)
                     /locus_tag="MESOP_RS00285"
                     /old_locus_tag="Mesop_0058"
     CDS             complement(62110..62433)
                     /locus_tag="MESOP_RS00285"
                     /old_locus_tag="Mesop_0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98BM7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891305.1"
                     /db_xref="GI:503657229"
                     /translation="MKDLLGLMGKAKEMQAKFQAMQDEIATVEAAGQSGGGLVSVTLT
                     GKFEMKSLKIDPSLFKEDDVEVLEDLLLAAHNDARVKVEQIMQEKTKALTAGLPIPPG
                     MKLPF"
     gene            complement(62475..64268)
                     /locus_tag="MESOP_RS00290"
                     /old_locus_tag="Mesop_0059"
     CDS             complement(62475..64268)
                     /locus_tag="MESOP_RS00290"
                     /old_locus_tag="Mesop_0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891306.1"
                     /note="catalyzes the DNA-template-directed extension of
                     the 3'-end of a DNA strand; the tau chain serves as a
                     scaffold to help in the dimerizaton of the alpha,epsilon
                     and theta core complex; the gamma chain seems to interact
                     with the delta and delta' subunits to transfer the beta
                     subunit on the DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="WP_013891306.1"
                     /db_xref="GI:503657230"
                     /translation="MSEAGNEKAAAYRVLARKYRPSNFSELVGQEPMVRTLTNAFATG
                     RIAQAWMLTGVRGVGKTTTARILARALNYKTATVDQPSVDLAVLGEHCQAIMEGRHVD
                     VIEMDAASHTGIDDIRDIIERVRYAPVSARYKVYIIDEVHMLSTQAFNGLLKTLEEPP
                     PHVKFIFATTEIRKVPITVLSRCQRFDLRRIDAGALVAHLSSIAGKEGISVDDDALAM
                     IARAAEGSARDSLSILDQAIAHGAGSVSAEAVRAMLGLADRARIVDLFEHVMKGDVAA
                     VLAEFRAQYDTGADPAAVLTDLAEFNHLVTRLRFVPTAMDDASLSQDERQRGADFARA
                     LSVRVLSRTWQMLLKGIPEVQSSNRPVSAAEMVLIRLAHAADLPTLDEALRSLEGASP
                     VQNGAPRPNGVPAGPGNGGGASAVAQTRMPSGQGGAQTMRLVEATPAPVAFVAPPPPA
                     PEAQPVPLKSLADIVALADAQRDIAFKVLVKRCIRLVRIEPGRIDVSLTDDAPKMLLN
                     DLTMKLRAWTGRNWLVSLSKEEGGQTLAEMESTRRENAFLDAKSDPAVAAILARFPGA
                     KIIDVRIPDAPEADADQAEVPVEPPADDDDA"
     gene            complement(64369..64471)
                     /locus_tag="MESOP_RS32920"
     ncRNA           complement(64369..64471)
                     /ncRNA_class="SRP_RNA"
                     /locus_tag="MESOP_RS32920"
                     /product="RNA component of signal recognition particle"
     gene            64619..65038
                     /locus_tag="MESOP_RS00295"
                     /old_locus_tag="Mesop_0060"
     CDS             64619..65038
                     /locus_tag="MESOP_RS00295"
                     /old_locus_tag="Mesop_0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad (HIT) protein"
                     /protein_id="WP_013891307.1"
                     /db_xref="GI:503657231"
                     /translation="MLPGLKAGFTLDARLEADSEQLMWLGLCELRVMNDRRWPWLLLV
                     PQRPGAEEIHDMTPLDQAMLTFETNMVAQALKKVTGCTKINTGALGNIVRQLHIHIVA
                     RSEGDAGWPGPVWGHGLREPYQRSELRRFAETIRAAL"
     gene            65092..66036
                     /locus_tag="MESOP_RS00300"
                     /old_locus_tag="Mesop_0061"
     CDS             65092..66036
                     /locus_tag="MESOP_RS00300"
                     /old_locus_tag="Mesop_0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="WP_013891308.1"
                     /db_xref="GI:503657232"
                     /translation="MSFSLFDAPLREPSQFVGFAGNTIDRQSENRADDSVDKALADPT
                     TRLLLMNGGRLHLKLREGGSLDPWFGLTESEPFKPAFDRGVLLGFSEQGPVVAVLAGV
                     DPEQLPETVKAIDYRSVYMQGLIDEAAAGAMAQGAALLAWHASHRFCSKCGTQSEMRA
                     GGYKRHCPNCGTEHFPRTDPVAIMLTATREKCLLGRGAHFAPGMYSALAGFIEPGETI
                     EAAVRRETLEEAGIRLGRVVYHASQPWPFPYSLMIGCFGEPLNEDIQADLNELEDCRW
                     FGRDEVRLMLAREHPGNLVTPPKGAIAHHLIRAWVDSE"
     gene            66068..66367
                     /locus_tag="MESOP_RS00305"
                     /old_locus_tag="Mesop_0062"
     CDS             66068..66367
                     /locus_tag="MESOP_RS00305"
                     /old_locus_tag="Mesop_0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stress responsive protein"
                     /protein_id="WP_013891309.1"
                     /db_xref="GI:503657233"
                     /translation="MIRHTVVFTLKHQPHSLEEKRFLVDARKILTAIRGVTHFEQLRQ
                     VSPKNDYQFGFSMEFADQAAYTRYNDHPDHVAFVRDRWVPEVEKFLEIDYVPLGW"
     gene            complement(66369..67232)
                     /locus_tag="MESOP_RS00310"
                     /old_locus_tag="Mesop_0063"
     CDS             complement(66369..67232)
                     /locus_tag="MESOP_RS00310"
                     /old_locus_tag="Mesop_0063"
                     /EC_number="4.2.1.51"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891310.1"
                     /note="catalyzes the formation of phenylpyruvate from
                     prephenate in phenylalanine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="WP_013891310.1"
                     /db_xref="GI:503657234"
                     /translation="MPEKTNRISFQGEPGANSDTACRNVFPSMEPLPCPTFEDAFNAV
                     ETGKADLAMIPIENTIAGRVADIHHLLPESKLHIVGEYFLPIHFQLMVLPGVKRDEIK
                     TVHSHIHALGQCRKYVRKNGWKAIVAGDTAGAAKMVSEVKDRTMAALSPALAATLYGL
                     DLIEENVEDTDSNVTRFVVLTKNKQWAERPSPDVKMMTTFIFRVRNVPAALYKAMGGF
                     ATNGINMTKLESYQLGAFTATLFYADIEGHPDDPLVKLALEELRFFSREVRILGVYPA
                     SESREQWKVAD"
     gene            complement(67296..68024)
                     /locus_tag="MESOP_RS00315"
                     /old_locus_tag="Mesop_0064"
     CDS             complement(67296..68024)
                     /locus_tag="MESOP_RS00315"
                     /old_locus_tag="Mesop_0064"
                     /EC_number="2.7.7.38"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-manno-octulosonate cytidylyltransferase"
                     /protein_id="WP_013891311.1"
                     /db_xref="GI:503657235"
                     /translation="MSTLILIPARMASTRLPGKPLADIAGAPMIVHVARRAAEAGLGR
                     VVVATDTQSVAEAVRAHGFEAVMTRIDHESGSDRIHEALVALDPGRKVETIVNVQGDL
                     PTIDPGIIAASLRPFEDRAVDIATLGVEIVRDEEKTNPNVVKIVGSPLSATRLRALYF
                     TRATAPWGEGALYHHVGLYAYRRAALERFVALKPSPLERRERLEQLRALEAGMRIDAE
                     IVQSLPLGVDTPEDLERARTILVN"
     gene            68218..68898
                     /locus_tag="MESOP_RS00320"
                     /old_locus_tag="Mesop_0065"
     CDS             68218..68898
                     /locus_tag="MESOP_RS00320"
                     /old_locus_tag="Mesop_0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_013891312.1"
                     /db_xref="GI:503657236"
                     /translation="MDSNEVNKLLAGLLGTVFVVFSVGIVSDALFASPAPEKPGFAIE
                     AAEPAEGGPAAPAAAAKPIADLLATANVEQGAAVFKKCQACHSGEKGGPNKVGPDLWD
                     LVDRPVAEHEGFAYSAGMKEFSKGGTEKWTYDNINHFITSPKKFVKGTAMGFAGLPKD
                     EDRANVIAYLRTLSDNPKPLPAPGAAADAGAPAKPADGAAPAKPADGAAPAKPAAPAA
                     PAPAAPAK"
     gene            69102..70979
                     /locus_tag="MESOP_RS00325"
                     /old_locus_tag="Mesop_0066"
     CDS             69102..70979
                     /locus_tag="MESOP_RS00325"
                     /old_locus_tag="Mesop_0066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891313.1"
                     /db_xref="GI:503657237"
                     /translation="MTVGRTLLKSLLAAALLTAGLQTTRADEWRTTSSLIGQSKYGDN
                     FQHYDYVNPNAPKGGTLNSVVLGTFDSFNPYIVQGSPAAGLVGFGGGLLYDTLMEQAT
                     DEGSVSHPLIADAYKYPDDYSSATYRLDPRAKWHDGQPITVDDVIWSFQVLKANSPQY
                     SRYFENVTDAVAISDREVEFHFSQKGNRELPKILGDLAVLPKHWWEGTDANGKKRDVT
                     KPTLEIPLGSAAYKIVSFKPGSEIVWQRVPDYWAAKLPVKIGRENFDTQRFTYILDDN
                     AAWQAFTKGGLDDIKPENSSKRWKTFYDFPAIKAGDVIKKEFKTTSPEPMQAFMLNQR
                     RPLFADRLVRAALTYPFDFETMNRTLFYGFNTRTSSYFQGTELASSGLPQGKELEILE
                     KYRDKLPPELFTQEFKLPVYDSPQAERKYLKQAVDLFAKAGWVIKGGKMVNAKTGEPF
                     KFEILGWNDTDQVIASPYIANLRKIGVDATLRLIDQTQYINRVNNFDYDVIIGQLGQS
                     ESPGNEQRDFWSSKAADRRGSRNYAGIKNPVVDALVDRIIFATDRDDLVAATHALDRV
                     LLWNYYVVPQYYRAVVWLAYWNKFGIPAKQPSYIGADQNSWWIDLDKEKALAAKYRSG
                     N"
     gene            70979..72847
                     /locus_tag="MESOP_RS00330"
                     /old_locus_tag="Mesop_0067"
     CDS             70979..72847
                     /locus_tag="MESOP_RS00330"
                     /old_locus_tag="Mesop_0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891314.1"
                     /db_xref="GI:503657238"
                     /translation="MAVLPRRDFLALGTAAAAAAMLPGKAFADIATGVKLHGLSAFGD
                     LKYKPDFTHFDYVNPDAPKGGQMNFAPPNATLNQSFLTFNTLNSLVLRGDSPPRTELC
                     FDALMASALDEPDAVYGLLAESVTLSQDRNGFRFNLRPQARFNDGSPLTAEDVAFALK
                     LYKEQGHPNLSKALRHMTEAVAIDPVTLDLNFNGEQSAQNILAIVAMPIVSKAFYADN
                     VFDASTMTPPLGSGPYKIGRVAAGQTVEYERVADYWGRDLPVNRGLYNFDRIRIDFYL
                     DRQAAFEAFKKGDTHFREEFTARVWATGYDFPALKDGKVVKREFPGEKAPDMQGAALN
                     QRRPQFRDERVRRAIARCFDFEWMKRALFYGSYDRSQSNFERSDYKAEGLPSPGELAL
                     LEPFRAELPPEVFGEAVTQPLSDGSGHDRKLLGEASRLLAQAGWKRADNFVVNDKGER
                     LRVEMLAEDDGIVRIFTPWSENMKAIGIDASIRQIDSAQYEQRHSDFDFDLTVLHWSI
                     GATPTDDSLEMLYDSRMAKTPGQRNYPGTESKAIDALIVAAGKAHSRSELVTALRALD
                     RVLRARLDWIPTYYLANHRVAYWDMFGFVEQKPDFGFPAETLWWFDKGKAAKIGKG"
     gene            72834..73127
                     /locus_tag="MESOP_RS00335"
     CDS             72834..73127
                     /locus_tag="MESOP_RS00335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015318918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049802332.1"
                     /db_xref="GI:908670534"
                     /translation="MAKAEFLAGVGAAPHLPAGILSPYSDGERGALIGGFANHKRCNK
                     STETAASPFLPGTIRGEMSGRTMRGGASVDNWSEATALGVPQDTLVLLEEHHV"
     gene            73127..74221
                     /locus_tag="MESOP_RS00340"
                     /old_locus_tag="Mesop_0068"
     CDS             73127..74221
                     /locus_tag="MESOP_RS00340"
                     /old_locus_tag="Mesop_0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006202912.1"
                     /note="with YejAEF is involved in resistance to microcin
                     C; Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891315.1"
                     /db_xref="GI:503657239"
                     /translation="MGAYILRRILLMIPTLFGIMAISFAVIQFAPGGPVEQVIAKLTN
                     QGGSDRLGGGGGDAGGSNLDVAGDVSSKYRGAQGLDPEFIKKLEKQFGFDKPPLERFG
                     MMLWNYARFDFGNSYFRDISVLDLILEKMPVSISIGLWITLLSYLISIPLGIRKAVKD
                     GTPFDIWTSGVVIVGYAIPGFLFGIMLMVLFAGGSFWDWFPLRGLTSDNWDQLSWWGK
                     IVDYFWHMTLPLTALVLSAFATTTLLTKNSFLEEIRKQYVVTARAKGLSERQVLYGHV
                     FRNAMLIVIAGFPGAFISAFFTGSLLIENIFSLDGLGLLGFRSVVERDYPVVFANLYI
                     FSLLGLFIGLLSDLIYTWVDPRIDFERRDV"
     gene            74221..75366
                     /locus_tag="MESOP_RS00345"
                     /old_locus_tag="Mesop_0069"
     CDS             74221..75366
                     /locus_tag="MESOP_RS00345"
                     /old_locus_tag="Mesop_0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891316.1"
                     /db_xref="GI:503657240"
                     /translation="MSEASVTAGVVPERMPRPFLSPLNKRRLQNFKANKRGYWSLWIF
                     LVLFVLSLFAEFIANDKPIIASYKGEILFPVLVAYPEEKFGGFYAVTDYRDPVIQDEI
                     NAHGWMIWPPVRYSYQTVNNAIPEAAPAKPSWEYDAKTRCNQYPQGAADPACNVGNWN
                     WLGTDDQARDVLARVIYGFRISVLFGLILTAGSALIGVGAGALQGYFGGWTDLLFQRF
                     IEIWSAIPVLYLLLIVAAILPPGFFILLGLMLLFSWVALVGVVRAEFLRARNFEYVNA
                     ARALGVPNRTIMFRHLLPNAMVATLTFLPFLLSGSISTLTSLDYLGFGLPPGSASLGE
                     LLKQAQRNLNAPWLGISGFVVISLMLSLLVFVGEATRDAFDPRKTFR"
     gene            75363..76994
                     /locus_tag="MESOP_RS00350"
                     /old_locus_tag="Mesop_0070"
     CDS             75363..76994
                     /locus_tag="MESOP_RS00350"
                     /old_locus_tag="Mesop_0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891317.1"
                     /note="with YejAEF is involved in resistance to microcin
                     C; Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="microcin C ABC transporter ATP-binding protein
                     YejF"
                     /protein_id="WP_013891317.1"
                     /db_xref="GI:503657241"
                     /translation="MSEAPLLRVQDLSVAFSQGGGQSVAVDHISFDIAKGETVALVGE
                     SGSGKSVSALSVLKLLPYPSASHPSGKILFQGTDLLAMNEKQLRQVRGNKITMIFQEP
                     MTSLNPLHTIEQQIVEILKLHQGMADRPAKARTLALLNEVGIRDPQKRLDAYPHQLSG
                     GQRQRVMIAMALANEPELLIADEPTTALDVTVQAQILELLAGLKSRKGMSMLFITHDL
                     GIVRKIADRVCVMTKGKIVETGPTKDIFANPQHPYTRHLLAAEPKGKPPAANADAKPV
                     MTGKDIKVWFPIKQGFFRRTVDHVKAVDGIDVTVRAGQTLGVVGESGSGKTTLGLALA
                     RMISSTGTIQFNGRDINQLTFNAMRPLRRELQIVFQDPFGSLSPRMSIAEIIEEGLKI
                     HEPKLSPDERDDKVAAVLKEVGLDPATRNRYPHEFSGGQRQRVAIARAMVLNPRFVML
                     DEPTSALDMSVQAQVVDLLRSLQAKHDLAYLFISHDLKVIRALANDVIVMRNGQIVEA
                     GPSEQIFGNPQTDYTRALIAAAFKIETAPVGIVSQ"
     gene            77023..77964
                     /locus_tag="MESOP_RS00355"
                     /old_locus_tag="Mesop_0071"
     CDS             77023..77964
                     /locus_tag="MESOP_RS00355"
                     /old_locus_tag="Mesop_0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019863025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyacid dehydrogenase"
                     /protein_id="WP_013891318.1"
                     /db_xref="GI:503657242"
                     /translation="MEKGRILLAVTGFHPQRWRDLLSAEREVVLEPDGAKDPSITYAV
                     VWKQRPNLLSSLPNLRAIFSIGAGVDHVFADPGLPDVPVVRVVADNLTQHMTEYVVWR
                     VLDHHRQGMLYRSQQQKKIWHEPQQRAASDISVGIMGLGNLGRAAASVLLSLGFAVNG
                     WSRTDRPMAGVATYCGEAGLIPFLKATDILVVLLPLTPDTQGIINYGVLKELRKRNGL
                     GGSVLINAGRGRLQKDADIARALDDGTLKEASLDVFEVEPLPKTSPLWKHPKVFVTPH
                     AAATSDPVHLAPIMLRQMDAFERGEKLDNLVDRKAGY"
     gene            complement(77978..78505)
                     /locus_tag="MESOP_RS00360"
                     /old_locus_tag="Mesop_0072"
     CDS             complement(77978..78505)
                     /locus_tag="MESOP_RS00360"
                     /old_locus_tag="Mesop_0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_013891319.1"
                     /db_xref="GI:503657243"
                     /translation="MKLSDLGDRICVLGPSNSGKSTLADAIARKRGLEPVHLDLLHHL
                     PDTDWEPRPKAEFIALHDAAIAGERWVMDGNYSICMPQRFQRATGLILLDISTPASLL
                     RYFRRTLFEKERRGALQGGRDSVKWDMIRHIAVTTPKNRERYQALFEQADLPKLQLSS
                     IKAIKQCFRKWDLAR"
     gene            complement(78546..78905)
                     /locus_tag="MESOP_RS00365"
                     /old_locus_tag="Mesop_0073"
     CDS             complement(78546..78905)
                     /locus_tag="MESOP_RS00365"
                     /old_locus_tag="Mesop_0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891320.1"
                     /db_xref="GI:503657244"
                     /translation="MRWNMMILASCLATAGCVGNSMSERQDANIESSLQYDSVPCDQL
                     LARRNGLAQQYNLPTTAKPTFYNPAMGFGPFTPDMRSKAKRDSDKASGEIDAMNRSIE
                     RRDCGKPDKQKKFALPS"
     gene            complement(79031..79948)
                     /locus_tag="MESOP_RS00370"
                     /old_locus_tag="Mesop_0074"
     CDS             complement(79031..79948)
                     /locus_tag="MESOP_RS00370"
                     /old_locus_tag="Mesop_0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_013891321.1"
                     /db_xref="GI:503657245"
                     /translation="MKPLQTSSGDLNADRRADYAEMLFASGDHAQAAELLLGALELAP
                     RWAMGWFRLGEMQQTSGRADLAAQAWATSLKLDPADRQGASLKLQLIGKGPAAPAPPS
                     AFVETLFDHYAETFDTALVDRLGYRLPEFLDRQIRKARPGRFRLALDLGCGTGLMGER
                     VRPIVDRLEGFDISAAMLRKARAKGIYDALVKADLQGFSYSGDKADLVTSADVLIYVG
                     RLEALVETVAGLLAGGGLFAFSVETMAEAGDFALQTSRRYAHSQAYVRRTLEANGLSV
                     LALEPTTIRLDRHEPVKGLAVVAGKAYAA"
     gene            80098..81105
                     /locus_tag="MESOP_RS00375"
                     /old_locus_tag="Mesop_0075"
     CDS             80098..81105
                     /locus_tag="MESOP_RS00375"
                     /old_locus_tag="Mesop_0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold nuclease"
                     /protein_id="WP_013891322.1"
                     /db_xref="GI:503657246"
                     /translation="MRASDLLHPRPEGLYCPPGDFFIDPVRPVNRALITHGHSDHARS
                     GHRSVLATRQTLDIMGLRYGEDFAGTTQAARVGETIVLNGVDVSFHPAGHVLGSAQIC
                     VDHQGTRIVASGDYKRQKDATCAPFEPIRCDVFITEATFGLPVFRHPPDTEEIARLLK
                     SAAQFPERTHLVGAYALGKAQRVMRLLRDAGYDKPLYIHGALAKLSDYYQSQGIELGM
                     LEPATVEDGKGDFAGAIVVGPPAAFADRWARRFPDPISCFASGWMRIRQRAKQGGVEL
                     PLIISDHADWDELTATIKETGAGEIWVTHGREEALVRWCELEGIAARPLHLVGYEDEG
                     D"
     gene            81338..82939
                     /locus_tag="MESOP_RS00380"
                     /old_locus_tag="Mesop_0077"
     CDS             81338..82939
                     /locus_tag="MESOP_RS00380"
                     /old_locus_tag="Mesop_0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA ligase"
                     /protein_id="WP_013891323.1"
                     /db_xref="GI:503657247"
                     /translation="MNRFAELLDRLVLTPSRNGKLTLLTDYFRSVEDPDRGLALAAIT
                     GDLNIAAIKPAMLRTLVTERMDPVLFGYSYDYVGDLAETVSLVWPQTSGHIPNREPTL
                     GEVVAKLQAASRSDGPKILAGLLDSAGISSRFAIIKLVTGGLRIGVSARLAKQALADF
                     GKVDVAEIEELWHGLSPPYTALFAWLEGKADKPHNTALALFRPVMLSNPIGDGDLEKL
                     DPADYAAEWKWDGIRVQAVAEGGVRRLYSRTGDDVSGAFPDLADAMNFSATLDGELLV
                     GDPREATGTFSDLQQRLNRKTVTPKMQQQYPAFMRCYDLLQIGGEDLRGLSFRERRTR
                     LEAFMGTLDPSRFDLSPFVDFTDWQALEDLRRAPPHPIIEGVMLKRWDSAYVAGRPKG
                     PWFKWKRDPHTVDAVLMYAQRGHGKRSSFYSDYTFGVWSGAEGEEELVPVGKAYFGFT
                     DEELRQIDKYVRDNTVERFGPVRSVRADRDNGLVLEVAFEGLNRSTRHKSGVAMRFPR
                     ISRLRWDKPANEADRIETLQALLDR"
     gene            complement(82965..84110)
                     /locus_tag="MESOP_RS00385"
                     /old_locus_tag="Mesop_0078"
     CDS             complement(82965..84110)
                     /locus_tag="MESOP_RS00385"
                     /old_locus_tag="Mesop_0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891324.1"
                     /db_xref="GI:503657248"
                     /translation="MDAIEKAIRNALEKGNAEDRAFRERVYRSAFAALDRALQANPGV
                     TVEMAIKRRKSIQATITEIESEFLPAVPDVGLEVDAPAAEPAPGAAPAIEIGDKSPSP
                     AAAVDSPAQPASDAPRSRVLPVVPDIMPDATLPGAPAIDMSAPATSGAATEVAPDRDE
                     RRIRGRRLPLTAIFLTVTVLAAVGIGLFFAMQTGVFKTAAQLDTAPPEAPPTVEDDDF
                     TPADGANAPAKPGSADQSRDWINVFSPTDPTHVAAPSDAKAEVMKDDSGPFLRIQSGA
                     SGSAVAFDVGQGVLEKLAGKHAVFDILARAEDGKDTQISVDCNFGELGDCGRKRYAVG
                     QQRNEYLFDVKFPDKRPGSAGTIAINSDFDKQGKAVDIYEIRVSIEP"
     gene            84399..84474
                     /locus_tag="MESOP_RS00390"
                     /old_locus_tag="Mesop_R0002"
     tRNA            84399..84474
                     /locus_tag="MESOP_RS00390"
                     /old_locus_tag="Mesop_R0002"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:84432..84434,aa:Thr,seq:cgt)
     gene            84628..84816
                     /locus_tag="MESOP_RS00395"
                     /old_locus_tag="Mesop_0079"
     CDS             84628..84816
                     /locus_tag="MESOP_RS00395"
                     /old_locus_tag="Mesop_0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891325.1"
                     /db_xref="GI:503657249"
                     /translation="MPNTFKTGDVVKLKSGGPKMTVSDGAASGVYLCHWFNKEGDVWT
                     PQHAGFKSDQLVAADQST"
     gene            85002..85460
                     /locus_tag="MESOP_RS00400"
                     /old_locus_tag="Mesop_0080"
     CDS             85002..85460
                     /locus_tag="MESOP_RS00400"
                     /old_locus_tag="Mesop_0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid-shock protein"
                     /protein_id="WP_013891326.1"
                     /db_xref="GI:503657250"
                     /translation="MIRSSILVAALSLLTVAAFAQTATQPPADAPPTTTPPAATPPAA
                     APAAPKAKPDLTLAKFQKRREKAIMAADTDGDGKISQPEWGAFQAKHNGKGDPAKSFA
                     RIDSNHDGFIDRAELDAFFAKRFAKLDKNGDGVLTADERPGHKSAPKPEQ"
     gene            85485..86048
                     /locus_tag="MESOP_RS00405"
                     /old_locus_tag="Mesop_0081"
     CDS             85485..86048
                     /locus_tag="MESOP_RS00405"
                     /old_locus_tag="Mesop_0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891327.1"
                     /note="Member of the extracytoplasmic function sigma
                     factors which are active under specific conditions; binds
                     with the catalytic core of RNA polymerase to produce the
                     holoenzyme and directs bacterial core RNA polymerase to
                     specific promoter elements to initiate transcription;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_041163948.1"
                     /db_xref="GI:752465239"
                     /translation="MSGARQPMSADPDEELVRRVGAGDPAAVQTLVARKLPRILSLAA
                     RMLGDAAEAEDVAQETFVRIWRHASSWRRGNARFDTWIHRVTLNLCYDRLRRRREWVT
                     DDVPDVADPAPLPDAHPREDAFRVEQALQAIAPRQREAIVLVYYQEMSNMEAAATLEI
                     SVDALESLLSRGRRALQMILARDGVHD"
     gene            86178..86621
                     /locus_tag="MESOP_RS00410"
                     /old_locus_tag="Mesop_0083"
     CDS             86178..86621
                     /locus_tag="MESOP_RS00410"
                     /old_locus_tag="Mesop_0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891329.1"
                     /db_xref="GI:503657253"
                     /translation="MTEENSRAMDAKRFAALAAAYGSDLRRWPQTEREAATAFASSEA
                     GQAISGHAGRLDALLDRYSVPHPGKALHDAILRTAGQHLTRRRRQRFWWVGMGLAGIG
                     LAGAVAGLALVTVVTPEVQPDHYVLDANATAFGDAGPDDTIEEDL"
     gene            86618..87073
                     /locus_tag="MESOP_RS00415"
                     /old_locus_tag="Mesop_0084"
     CDS             86618..87073
                     /locus_tag="MESOP_RS00415"
                     /old_locus_tag="Mesop_0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891330.1"
                     /db_xref="GI:503657254"
                     /translation="MSTGRNFLIASVVLNVFLAGALAGGAVWIRSGKPAQGYSLEAAG
                     GRLPDQERMLFRKALREVRRESRDIILDGQQARREAADLLRQPVLDTAALSAALERAR
                     NADITVRTRLEQRIIEFAAAGSADERSVLAEGLTRRAGQQPSATPKKSP"
     gene            87184..87465
                     /locus_tag="MESOP_RS00420"
                     /old_locus_tag="Mesop_0085"
     CDS             87184..87465
                     /locus_tag="MESOP_RS00420"
                     /old_locus_tag="Mesop_0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891331.1"
                     /db_xref="GI:503657255"
                     /translation="MNQLRKYAITAALAVTGTVATVAASSAMPIVSLAQPAALVEHVA
                     WGCGPGWHPNPWGRCVPNRVVVYPRYRYWHGPAYYGWHPHRHWHRWHRW"
     gene            87571..89091
                     /locus_tag="MESOP_RS00425"
                     /old_locus_tag="Mesop_0086"
     CDS             87571..89091
                     /locus_tag="MESOP_RS00425"
                     /old_locus_tag="Mesop_0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891332.1"
                     /db_xref="GI:503657256"
                     /translation="MAIPASNSPPDPVPDPVLVVFNRFGLGARPGDRDRIAGDPRGYL
                     KAELRQPDIAMISLDDPAYPNLPGSTSAIQASMAANFQRKLDRERMAAAVGQPATANA
                     QNMPAQNMRAQTTPAPIMPAPPVPPPAAPTKPVPPVEATLFRAEAQARFDKALRAQGG
                     FVERLVYFWSNHFCVSVAKDNIVRASAGAFEREAIRPFVLGRFADMLMAVERHPAMLF
                     YLDNQQSIGPDSRAGKNRKRGLNENLARETLELHTLGVGSGYTQADVTSFARILTGWT
                     MAGREGRLGEPGSSVFNANAHEPGDAVLLGKTYPAGGMGQAEAALDDIARHPATARHI
                     ATKFARHFISDDPPAAAVARLAKVFAKSDGNLRALAAALIDMPEAWSTPLAKMRSPVD
                     YVAAIRRAAGPGPNDPGQSLAWLNALGEPLWQPPGPNGFSDLTASWASAEGMKVRLDI
                     AWQAARQARDIGNPSDMLDAVIGPSASPETRQAVARAESKQQGLALLMMASEFQRR"
     gene            89141..90379
                     /locus_tag="MESOP_RS00430"
                     /old_locus_tag="Mesop_0087"
     CDS             89141..90379
                     /locus_tag="MESOP_RS00430"
                     /old_locus_tag="Mesop_0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891333.1"
                     /db_xref="GI:503657257"
                     /translation="MSLLCEVPNPSRRAMLMTGGALFAWAYLPRFARAADNRDPRLIV
                     IVLRGALDGLSAVGPVGDPDYAGLHGDIALSLAGPHAALPLDGFFAVNPAMPVFARLF
                     KDGQAAVVHAAATGYRERSHFDGQDVLESGFAGPGHVATGWLNRALESLPAGDRVATL
                     GGLAVGPSTPLVIRGAAPVLGWAPQSLPAPAGDLAARVLDLYQHRDPVLAVALRNGLD
                     TDKMALDDQMGAKAMKPKGGLDSAAGMRQAAQGSARLIAADDGPRVAALAFDGWDTHV
                     NEGGATGRLATLLGGLDGAFEEFEKGLGERWKDTAIVAITEFGRTAQINGTVGTDHGT
                     GTVVLLAGGAIKGGRVIADWPGLKPAQLFEQRDLAPTSDVRAVLKGLLADQFGLSAAI
                     LGDKVFPESAAVKPMRDLIA"
     gene            90494..92242
                     /locus_tag="MESOP_RS00435"
                     /old_locus_tag="Mesop_0088"
     CDS             90494..92242
                     /locus_tag="MESOP_RS00435"
                     /old_locus_tag="Mesop_0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="WP_013891334.1"
                     /db_xref="GI:503657258"
                     /translation="MGKSVVQLQRLVRLFCHPLALVLVSLAGIFAAGRAEHEWLSVPF
                     SLALVAALAGLLLLACGRLAFSVYLAWMSVAFITAVSAIKFRMKGFSLHFYDAVFVSR
                     DAEVYRFLLGSYLHLIVPVVIALALGIAAAIVLFRFDRKIGWPVSVRVLIMAALVVLV
                     PLTFPAEASKDRYFYYMQGRHMSAFFVSLLDLRNLVAEPAFEKRLQAVAPQTPFADTV
                     DCGDRAHLPDVFFVLSESQSDPGNFPQVGNGAGFLQRFAPGAGTPHPMQVETFGGGTW
                     ITNLSLMTGLSATDFGWRSPYLTITLQDKVAGALPEVLARCGYRTAVMTPMDFTFVNE
                     GPFLKSIGFETVLDIKAIAAPFYHLRDNFYYHAAEAFIARHRKEDGRPLFLEIQTMFP
                     HSPYEGRLEPELKVAGEPFSDDVQVSEYLRRMAVARGDFQDFLAGREADVGERGAVVL
                     EFGDHQSSATKPFVDAIAGGDALARPDSIAYRTFYTLTTFNHPLKRPMPGMAPLDVGF
                     LGASLLDAAGLPMSPVMADLVRLRDHCGGSFHGCSDRAAVDAHLRRRVDSGLLHLFPQ
                     AAPLHSLVPLQSAEAR"
     gene            complement(92279..95674)
                     /locus_tag="MESOP_RS00440"
                     /old_locus_tag="Mesop_0089"
     CDS             complement(92279..95674)
                     /locus_tag="MESOP_RS00440"
                     /old_locus_tag="Mesop_0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891335.1"
                     /note="Synthesizes thioester adducts of fatty acids
                     enzymatically to the phosphopantetheine group of acyl
                     carrier protein; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acylglycerophosphoethanolamine acyltransferase"
                     /protein_id="WP_013891335.1"
                     /db_xref="GI:503657259"
                     /translation="MNTHLMLSRRFAPLFWTQFLSAFNDNFLKNTLVFLILFTLAADQ
                     AASLVTLAGAVFMAPFLLLSALGGEIADRFDKALIARRLKFAEIAAAGVSVAGIALSS
                     IPVLMTALLMFGIISALFGPIKYGILPDHLERKELPKANAWIESATFAAILGGTIAGG
                     VVSADGIGVMVFGPIMMALAVGCWFVSRYIPATGSAAPDLVIDKNIFRSTWRQVSELR
                     TDKRIWRAGLMTSWFWLIGAIVLSILPTLIKDSLGGNEIAVTAYLAVFAVSIAIGSAI
                     AAWMSQGRIVLLPAPVGTALLALFGLHLAWTIWSMQPSPKAETLSAFFAGPNTIRVAI
                     DLAGMAIASAFLVVPTFAAVQAWSPEARRARVVAAVSIVNAGFMTVGGVVVALIQTKV
                     STGGILFGLAAANAVAAWLMLKYLPTNAFRDFVSILFRAFLRLEIEGMENLKAAGKAP
                     ILALNHVSFLDGPLALTLTDEEPVFAIDYTIAQAWWMKPFMKLARALPLNPAKPMSTR
                     TLIKIVQGGDPLVIFPEGRITVTGGLMKVYDGAAMVADKTGSMVVPIRIDGLEKSPFS
                     RLTSQHVRRRLFPKVKVTILEPVKLEVAPELRGRQRRAAAGAALYQVMSDLVFRTQDI
                     DKTVLEKVILTANERGMKRLAVQDPVTGSLSYGKLLTAAAVLGEKFETLYAGQQTLGI
                     MLPNANGSCATLLGVMSAGKVPAMINFTAGAANILSACKAADVRTVLTSRAFVEQAKL
                     GAVVEEMRSVDIVWLDDLRATIGLKDKLLGLLRKSTPRVARKATDPAVILFTSGSEGT
                     PKGVVLTHRNILANAAQAASRIDFHSGDKVFNVLPIFHSFGLTAGTVLPLISGVPVFF
                     YPSPLHYRIVPELIYASNATIIFGTDTFLSGYARSAHPYDFRSIRYCFAGAEPVKPST
                     RMTYMEKFGVRILEGYGVTETAPVISINTPMYNRSGSVGKIMPGMEYRLDPVPGVDDG
                     GRLHVRGPNVMAGYLRAEKPGVLEPLPDGWHDTGDVVSVDEGFITICGRAKRFAKIGG
                     EMISLAAVEALAGELWKGSLSAVAAVADARKGEKLILITEAPGATRADLLAFAKANGA
                     MDLMVPAEVRVVPKVPVLGSGKLDFAGVTRLVQGEPVAKVEAA"
     gene            complement(95920..97509)
                     /locus_tag="MESOP_RS00445"
                     /old_locus_tag="Mesop_0090"
     CDS             complement(95920..97509)
                     /locus_tag="MESOP_RS00445"
                     /old_locus_tag="Mesop_0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891336.1"
                     /note="Involved in the incorporation of exogenous aryl
                     acids in the biosynthesis of aromatic amino acids:
                     catalysis of the ferredoxin-dependent oxidative
                     decarboxylation of arylpyruvates; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="indolepyruvate oxidoreductase"
                     /protein_id="WP_013891336.1"
                     /db_xref="GI:503657260"
                     /translation="MLDAVPPFRARPGAQDDERVIKLAVLAVGGQGGGVLADWITDVA
                     ERNGYVAQSTSVAGVAQRTGATIYYVEMARDTGRLPVFALSPSQGDVDILIAAELMEA
                     GRAIIRGFVTPERTTLIASSHRIAAVSEKIEPGDGRASSSKVHGTAEAASKRFIAFDM
                     EKIAADNGSMISASLLGALAGSDALPFTRETYEQAIGAGGRGVKASLAAFGAAFDRAR
                     GAAAPAPKPSEPAIVESALGAGRVSGPQSLLQGWQALAARIDLMPVAMRDMALRGLRK
                     VVDYQDIAYGREYLDRLDKAIALDGAGHGHALSIAAAKHLANAMCYDDMIRVADLKTR
                     STRDKRVRREVGVKDGSILQVTEYFHPRIEEFCGTLPAGLGSYIENRPKLAAFLDRRI
                     NHGRRIRTDSFAGFAALWFIGGLRRWRRRLLRHQVELAHLERWYALALSHVPADYALA
                     VEILNCRRLIKGYSDTHARAQSKFDRVLSALDLLKGRHDAADWIRRLREVALKDEKGD
                     MLDGALKTVATLGPDPAPGTP"
     gene            complement(97502..99655)
                     /locus_tag="MESOP_RS00450"
                     /old_locus_tag="Mesop_0091"
     CDS             complement(97502..99655)
                     /locus_tag="MESOP_RS00450"
                     /old_locus_tag="Mesop_0091"
                     /EC_number="1.2.7.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="indolepyruvate ferredoxin subunit alpha"
                     /protein_id="WP_013891337.1"
                     /db_xref="GI:503657261"
                     /translation="MAERSFAKEVEKLRLGAGEEFAGEGILAITKALLQCGVGYVGGY
                     QGAPISHLMDVLADAQDILGELGVHFEASASEATATAMLAASVHYPIRGAATFKSTVG
                     TNVASDALANLASGGVTGGALIIVGEDYGEGSSIMQERSHAFAMKSQVWLLDPRPNLP
                     SIVKAVEDGFELSEISNTPVMLQVRIRCCHVHGHFIAKDNKRPPMTVADALEAPRRDT
                     GRIVLPPASFLHEKEKIAKRWPAAVDFIARNRINEFFGSDHGSVGIVMQGGMYNSVIR
                     ALQRLGLSDTYGDADVPLYVLNAVYPLIDDEFLSFCEGKQAVLVVEEGQPNYIEQAFA
                     AMLHKAGRGTRLVGKEHLPMAGEYTGQVMLDGIGAFLRAEAPHLLPGEVRAPNKVGDG
                     VDTADLINVVPGRPPGFCIGCPERPIFAATKLVEQELGKHHIASDIGCHLFSIMPPFE
                     LGATTMGYGLGPASASAFNSPDAKRRSISFVGDGGFWHNGLTSSIGNAVFNKNDGVIV
                     IVDNFYSAATGGQDILSSRAGNKTKSTKHPITEAVKGMGVKWLRHVDRTYDVGKMQDT
                     LREALTTEEKGPKVIVASSECMLNRQRREKPLVDKAIKGGERVIKPKFGVDEDICTGD
                     HACMRLSGCPSLSVKSLDDPLRDDPVASIDQNCVGCGNCGEVADAAVLCPSFYRADVV
                     HNPSRWDRFLEASRRATIGLLQRRRESRRLTFADA"
     gene            complement(99758..100240)
                     /locus_tag="MESOP_RS00455"
                     /old_locus_tag="Mesop_0092"
     CDS             complement(99758..100240)
                     /locus_tag="MESOP_RS00455"
                     /old_locus_tag="Mesop_0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013527967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013891338.1"
                     /db_xref="GI:503657262"
                     /translation="MEQKVAEKRQRISTLGQIGLQQFAPYLMNRIMGRYNATLRDDFR
                     KQGLTIPQVRTLAVLSVTDGITVNDLSVYTVIEQSTLSRTLDTLEGQGLVRREQGVTD
                     SRIRHVFLTDEGRAEFARAWPAMHDAFEAMFDDVDDAEYAALIATLQKMLKNIRKHDI
                     "
     gene            complement(100240..101811)
                     /locus_tag="MESOP_RS00460"
                     /old_locus_tag="Mesop_0093"
     CDS             complement(100240..101811)
                     /locus_tag="MESOP_RS00460"
                     /old_locus_tag="Mesop_0093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_013891339.1"
                     /db_xref="GI:503657263"
                     /translation="MKAPDHIIVGSGINALVCAAMLGGKGAKVLVLERNDRIGGCMRT
                     EEITAPGFVHDVMATTFVLFITSPAFAALGADLARHGLEFCSTGTPTGVLRPDGSHAV
                     LGTDRAANVAALNAIAAGDGDRHADDVGGIERNAGLLFGLLGGSLWSYPTAKLLAGDA
                     WRRGPRGLGAFLGEALVPARGWLESTYQSETIRALWAPWVLHAGLGPEDAFSGQIAKV
                     IAFALEAAGAPIVKGGAKNLLSAFEALITERGGVISTEADVASIILAGGRATGVRLAS
                     GETVHASKSVICSVTPTQLYGRLLGAEAPKVDIEATQKYRYGKGNFQIHYALDKPPAW
                     RGNGLDKVALLHLTPGLDGVSKACNEAARGMLPEVPTICVGQPHALDPSRCPEGKAIL
                     WLQLPEAPRFIKGDAAGKLQAPADGQWTDALREAYADRAEAILASHIDGFKDSIIARR
                     AYSPADLEAMNINLVGGDPYGGSSALDQSFLWRPFKTSRNHQTGIKNLYHIGASTHPG
                     AGLGGGSGFLLAGRL"
     gene            complement(102123..102914)
                     /locus_tag="MESOP_RS00465"
                     /old_locus_tag="Mesop_0095"
     CDS             complement(102123..102914)
                     /locus_tag="MESOP_RS00465"
                     /old_locus_tag="Mesop_0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclase"
                     /protein_id="WP_013891340.1"
                     /db_xref="GI:503657264"
                     /translation="MDTQKLLGEVAGQLLSGAIRVVDLSAPLGPDTPLIKLPPELAVD
                     TPKIEIHNISRYDKNGPWWAWNWLKLGEHSGTHFDAPQHWISGKDYPDGATDTIPAQN
                     FVGPVNVIDCSKEAAADHDFLLTVDHIKAWEAEHGAINAGEWVVMRTDWYKRNGSEAE
                     FLNANETGPHTPGPTAEAIQFLIGKNIKGWGSETIGTDAGKAGGMETPFPAHTLMHKA
                     NRYGLASLCNLDQLPPKGAILIAAPLKIEHGTGSPIRALALVSGK"
     gene            103033..104607
                     /locus_tag="MESOP_RS00470"
                     /old_locus_tag="Mesop_0096"
     CDS             103033..104607
                     /locus_tag="MESOP_RS00470"
                     /old_locus_tag="Mesop_0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_013891341.1"
                     /db_xref="GI:503657265"
                     /translation="MSEFDAIFVGAGHNSLACAAHLALKGWKTGIFERSAAIGGAVQT
                     REYTLPGFRHDFGAMNLSLFAGSAFHRKYANELKAQRLEFAPVADCFASAFPDGRWFG
                     VSNDLEKTASRMAAFSAADAAAWRRLVAAFPAEAEHLFRLLGSPMSARALAGTAWTLW
                     RKKGIAGALDTGRLLLSSPRAWLEENFESPHVRATLATWGMHLDFAPDIAGGAVFPYL
                     ESMANQSFGMVLGKGGADTIIRALSGMVTSAGGRIVTGAEVAEITVSAGKATGVRLAS
                     GETHAATKAVIAGVAPKALTGKLLANGSGDSGFDTAMQKFRHAPGTMMIHLALDDLPD
                     WRAGSELRQFAYVHLSPSLDAMSRTYQQAMAGMLPDEPVLVVGQPTAIDSSRAPQGKH
                     VLWVQVRMLPAEILGDAAGKIAPAHWDQIKDVYADRVLDIIETYAPGLRSKILGRAVF
                     SPIDLERENPNLVGGDQVCGSHHLAQNFLFRPAHGYAGWNTPVANLHLTGAATWPGAG
                     TGAASGFMLAQQLGGR"
     gene            104719..106248
                     /locus_tag="MESOP_RS00475"
                     /old_locus_tag="Mesop_0097"
     CDS             104719..106248
                     /locus_tag="MESOP_RS00475"
                     /old_locus_tag="Mesop_0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013527971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013891342.1"
                     /db_xref="GI:503657266"
                     /translation="MTINRRELLGYSAAALGVAAVGLPQIAKAAAGELTIAYNVNLPS
                     WDPTTGPSAVNPTIQGLYQSVFDQFIPQKPDLSFAPGLLTEWGWNDDRTKVMMTVREG
                     VKWHDGSPFTPEDVVWSLQRAGDEKTGNPIQFVWKNVNNFKIDGNKITGDVVQFDPVY
                     FKWMSFLTGYILPKAYYEKVGAEGFEKAPIGTGPYMVEKFERNAFLRLKANPTYWGGK
                     PAFENVTIKFVADAASRVAEIESGSSQVTLEIPYEEYDRLIAKEGLAGSCKPVSDIGM
                     IFFNDIEAMLDKNVRQAAVMAVDKELLVKRLLRGYGQPIATLETPEYTAFDASIKVEH
                     NSEKAKELLAASGYSPEKPVKFTIQTTKGFKPKDYEMIQAIVGMWRKVGIEATIEVYE
                     IAKHYELRAADKLAPAAFYNWGNAIGDPTTSTGFAMYGPSPHSVWDSQDLIDMINPLW
                     GEKDEAKRIAGWKAVDKYIAEQAYVLPLMQYAQPIVHAKGVNVVQHVSGALLPALMTP
                     A"
     gene            106461..107468
                     /locus_tag="MESOP_RS00480"
                     /old_locus_tag="Mesop_0098"
     CDS             106461..107468
                     /locus_tag="MESOP_RS00480"
                     /old_locus_tag="Mesop_0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019863001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891343.1"
                     /db_xref="GI:503657267"
                     /translation="MLLQRFLIRLLTMLITLFGVAVVVFVVIRVAPGDPIAMMLPPGA
                     TDADIARLRALYGLDKTIVQQFFIWLSGVARGDFGTSISLRQDVLGLVFNRLPATLEL
                     AIVALVMAVALGGTTAVLGARERGTAVEAGIDIASGAALSIPDFLWGLVLILLFGVLV
                     PIFDISGRVSPQLDLPFVTQFYLFESILRLRFDLTWDLLKHMLMPAVALALPLAAIIS
                     QLLKQSLKEVLDLDYVVLARVKGFSETQVILREALKNAALPTLTLVGVQFTFLIGGTV
                     IVERLFSYEGLGNMAIDAVINRDLPLIQGIVLVFALLFVLINLSVDMMYALLNPRLRH
                     G"
     gene            107461..108309
                     /locus_tag="MESOP_RS00485"
                     /old_locus_tag="Mesop_0099"
     CDS             107461..108309
                     /locus_tag="MESOP_RS00485"
                     /old_locus_tag="Mesop_0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891344.1"
                     /db_xref="GI:503657268"
                     /translation="MDEARTSRRGLSPRLWLAGGWLLLALLAAILAPLVAPQDPLAQD
                     LMLERLPPFWIDGAEPGYWLGTDSLGRDLLSRLIFGGRIAFIVAFAAAIAACLVGSTL
                     GLIAGYFGGWADRIISRIVDVWMAFPPVLFAILLVAVLGTGLSSVIIAIAVIDWTRFC
                     RVIRAETMGQSRMDYVENARIAGYGRIGIMLREVLPNVVPSIVALLSLEMGIAVIVEA
                     ILSFVNLSISTDDPTWGGIIAEGRLSIHQAWWVLVFPLITLILTVLSFSQFGEALKTR
                     FDPVLR"
     gene            108306..109184
                     /locus_tag="MESOP_RS00490"
                     /old_locus_tag="Mesop_0100"
     CDS             108306..109184
                     /locus_tag="MESOP_RS00490"
                     /old_locus_tag="Mesop_0100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013891345.1"
                     /db_xref="GI:503657269"
                     /translation="MSACLDIANLSALLPNGQRVLRSVSLSVQPGEVRALVGESGAGK
                     TMIGKAVLGVLPSSVRIVEGDMRLEGEDLGKLAPKARRTLIGARTALIPQDPLTALNP
                     SRRIGSQMTDRLVRILGWSAEKADTRIRQLLDEVQIRDPDRVLRSYPHELSGGMRQRV
                     LIAAAFAAEPRLIVADEPTTALDVTVQKQILRLIAELQREHGTAILFVTHDLGVVAKI
                     SQKVSVLYAGKVVEEAETADLFASPRHPYTRALMAATPLYTDPLASLKPVDETVLAGL
                     AAEIAAADQAWRRPHG"
     gene            109177..110013
                     /locus_tag="MESOP_RS00495"
                     /old_locus_tag="Mesop_0101"
     CDS             109177..110013
                     /locus_tag="MESOP_RS00495"
                     /old_locus_tag="Mesop_0101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013891346.1"
                     /db_xref="GI:503657270"
                     /translation="MAEPLFCVRGLKVALPDMTRKPLIGRAPLAQILKGLDFDLPRGS
                     VTGIVGESGSGKSTLGRALVRLSEPSAGSIRFDGRDITHLPETELRPLRRDLQMIFQD
                     PMSSLNPRRTIASIIAAPLKQNGLGDNLKSRVAEALQRVGLPQSFASRYRHELSGGQR
                     QRVGIARALALSPKFVLADEIVSGLDVSTQAQILTLLEKLAAEMGLTVAFISHDLSVI
                     RRLCQQVIVMREGVIVEASATDALFDKPRQAYTRDLIAAIPLPEIDAGWLDIPSAAKA
                     PT"
     gene            110090..110689
                     /locus_tag="MESOP_RS00500"
                     /old_locus_tag="Mesop_0102"
     CDS             110090..110689
                     /locus_tag="MESOP_RS00500"
                     /old_locus_tag="Mesop_0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_013891347.1"
                     /db_xref="GI:503657271"
                     /translation="MKTTITIATLAAAMLGSAGMATAGSIPGMRGHDHTGITVPDMKQ
                     AVDFFTEVVGCKKAMSFGPFADDKGTFMQDLLGVDPKAVIEQVTMVRCGYGSNIELFK
                     YTAPDQKDLTPKNSDIGGFHIAFYVDDVAAAKAYLDGKGVKTRLGPLPVKEGPAAGQT
                     ILYFQAPWGLQLEAISYPEGMAYEKGAETVLWSPKNPEK"
     gene            110833..113127
                     /locus_tag="MESOP_RS00505"
                     /old_locus_tag="Mesop_0103"
     CDS             110833..113127
                     /locus_tag="MESOP_RS00505"
                     /old_locus_tag="Mesop_0103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006202876.1"
                     /note="catalyzes the conversion of salicylyl-CoA to
                     gentisyl-CoA; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavin oxidoreductase/NADH oxidase"
                     /protein_id="WP_013891348.1"
                     /db_xref="GI:503657272"
                     /translation="MKVAVLGGGPAGLYFAISMKLRDAAHDVTVYERNRADDTFGWGV
                     VLSAETLDNLSKNDPVSAVWIKKHFAYWDDIAVIHDGVRTVSSGHGFCGIGRKRLLIL
                     LQRRARELGVKLMFESDIADPKAYMETHDLVVAADGLNSRARNSFVDVFKPDIDTRKC
                     KFVWLGTNQKFDDAFTFIFEKTEHGWVWAHAYQFDSDTATFIVECSEQTWADFGFGAM
                     TQQESIAVCEKIFAKHLGGHSLMTNANHIRGSAWINFPRVLCERWSYKNLALMGDAAA
                     SAHFSIGSGTKLALESAVALAEYVETEPDLDAAFRKYEDARRTEVLKLQSAARNSLEW
                     FEEVERYLGLDPVQFNYSLLTRSQRISHENLRLRDAEWLGGAEEWFQRQAGAGGNSLR
                     RAPMFAPFKLRDMQLSNRVVVSPMAQYKAVDGCPTDWHFTHYAERAKGGAGLIYIEMT
                     CVSPEGRITPGCPGFYAPEHEVAWKRLVDFVHTETEAKICAQIGHSGAKGSTRLGWEG
                     TDVPLTSGNWPVMAASAVAWSPQNQVPKAMDRPDMDRVRDQFVASAEMADRCGFDMLE
                     IHAAHGYLLSSFITPVTNRRTDQYGGSLENRMRYPLEIFRAVRAAWPAGKPISMRISA
                     NDWVGIEGVTPADAVEIARLLHEAGVDICDVSAGQTSVLAKPVYGRMFQTPFSDRIRN
                     EVGMATMAVGNIYEPDHVNSILMAGRADLVALARPHLADPYWTLHAAVTLGDRGVKWP
                     DPYLPGRDQLYRLAERDAAAGLKV"
     gene            113124..113897
                     /locus_tag="MESOP_RS00510"
                     /old_locus_tag="Mesop_0104"
     CDS             113124..113897
                     /locus_tag="MESOP_RS00510"
                     /old_locus_tag="Mesop_0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="WP_013891349.1"
                     /db_xref="GI:503657273"
                     /translation="MTAPATIAGKHALVTGGGSGVGRAIALALAGAGIDVTICGRREA
                     ELAKVAGESDRIFGIVADVTDENSIASLYKTAEAARGAFDIVVANAGMAGSTPAHKTT
                     LADWQRTLDVNLTGAFLTVKPALAGMAARKAGRVVFIASTAGLKGYAYVAPYVAAKHG
                     VVGLMRALAAETAKSGVTVNAVCPGFVETDMLEQSIQRIIQKTGRSAGEARASLASTN
                     PQGRFIQPQEVAAAVLWLCGDAAQSITGQAISISGGETW"
     gene            113891..114361
                     /locus_tag="MESOP_RS00515"
                     /old_locus_tag="Mesop_0105"
     CDS             113891..114361
                     /locus_tag="MESOP_RS00515"
                     /old_locus_tag="Mesop_0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006202874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013891350.1"
                     /db_xref="GI:503657274"
                     /translation="MVAGPLPAPSGPGKDRLRLWIRLLRASRTIEAELRERLKKDFNT
                     TLPRFDVMAALYRAPEGMLMSDLSRFLLVSNGNVTGIVDRLVSEGLVARARRNGDRRT
                     SMVRLTDEGTKSFATIAAAHEGWIGELLGKVSEDDARRLTGMLTSFRSNWEGRE"
     gene            114358..115170
                     /locus_tag="MESOP_RS00520"
                     /old_locus_tag="Mesop_0106"
     CDS             114358..115170
                     /locus_tag="MESOP_RS00520"
                     /old_locus_tag="Mesop_0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891351.1"
                     /note="Catalyzes the reversible hydration of unsaturated
                     fatty acyl-CoA to beta-hydroxyacyl-CoA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_013891351.1"
                     /db_xref="GI:503657275"
                     /translation="MTGMAGLKPKHFLWEVEGRIAKVRLDRPERKNPLTFDSYAELRD
                     TFRDLVYADDVDAVVFLSNGGNFCSGGDVHDIIGPLVKMDMKELLAFTRMTGDFVKAM
                     LNCGKPIIAAVDGVAVGAGAIIAMSSDIRIATPEAKTAFLFTRVGLAGCDMGACAILP
                     RIIGQGRAAELLYTGRTMTAAEGERWGFYNRLVDAAALEADALDMAARIVSGPTFAHG
                     ITKTQLNQEWSMGLDQAIEAEAQAQAICMQTRDFERAYKAFVAKEKPVFEGD"
     gene            115249..116397
                     /locus_tag="MESOP_RS00525"
                     /old_locus_tag="Mesop_0107"
     CDS             115249..116397
                     /locus_tag="MESOP_RS00525"
                     /old_locus_tag="Mesop_0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013527981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013891352.1"
                     /db_xref="GI:503657276"
                     /translation="MPDRSFLNWPFFEDRHRELAENLESWCQQNLPVDHHDVDAACRE
                     LVTKLGRDGWLKPTALDTDNPGPLDVRTLCITRETLARHDGLADFAFAMQGLGTGALS
                     LFGTPEQQQWLSKTRAGKAISAFALSEPRSGSDVANTEMTATRDGDGYVLTGEKTWIS
                     NGGIADLYVVFARTGEAPGAKGLSAFLVPGDAKGLGIAERLEVIAPHPLARLSFDQVR
                     LPASALIGKPGDGFRIAMSVLDVFRSTVGAAALGFARRALDESIKRVAERKLFGAPMG
                     ELQMVQGHIADMALDVDAAALLIYRAAWTKDMGAARVTREAAMAKLFATDKAQEVIDK
                     AVQLHGGNGVRKGHIVESLYREIRALRIYEGASDVQKVVIARQVMGAA"
     gene            116454..116849
                     /locus_tag="MESOP_RS00530"
                     /old_locus_tag="Mesop_0108"
     CDS             116454..116849
                     /locus_tag="MESOP_RS00530"
                     /old_locus_tag="Mesop_0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013527982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="WP_013891353.1"
                     /db_xref="GI:503657277"
                     /translation="MHEILQPAGWAKPVGYANGVAARGRLVFVGGQVGWNGQCQFETD
                     DFVGQVKQTLANIVAVLAEAGATPQHITSMTWYFTDKAEYLANLRGIGEAYREVIGRH
                     FPAMAAMQVMALVEDRAKVEIQATAVIPE"
     gene            complement(116851..117939)
                     /locus_tag="MESOP_RS00535"
                     /old_locus_tag="Mesop_0109"
     CDS             complement(116851..117939)
                     /locus_tag="MESOP_RS00535"
                     /old_locus_tag="Mesop_0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkanesulfonate monooxygenase"
                     /protein_id="WP_013891354.1"
                     /db_xref="GI:503657278"
                     /translation="MKPHPLHGPNKLKLGVFSTNADGGLAITDVPERWTASWQDNLTA
                     AQIADRAGLEFMLPIARWRGFGGRNNVREWSFETFTWAAALAMATDRIGLFMTVHVPL
                     VHPLYAAKALATVDHISQGRAGLNIVCGWDPREFGMFGTPLVEKGYDQAAEWIEILER
                     LYASGEPLDYEGTYYRLKEAVSRPASLQVPRPVTMNAAFGGPGRDFAAARCDYLFTTF
                     SEMGDAGKHVADISERADRVGRNVGVYTVAHVVCRPTMEEAQAYYTRYAVDMADHDAV
                     DAHMAGKKEFSQSHDPHAYDRYRQRFAGGAGTYPLIGTPETIAADMAAIAGHGYQGIA
                     LSFVNYTQELPYFCDHVLPILRKAGLRA"
     gene            118061..118822
                     /locus_tag="MESOP_RS00540"
                     /old_locus_tag="Mesop_0110"
     CDS             118061..118822
                     /locus_tag="MESOP_RS00540"
                     /old_locus_tag="Mesop_0110"
                     /EC_number="4.1.3.39"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-2-oxovalerate aldolase"
                     /protein_id="WP_013891355.1"
                     /db_xref="GI:503657279"
                     /translation="MSEFRQKCIGRTNLVGSFAAIPHPVAVEVMAQSGLDFLCIDWEH
                     AQISRDMIETMVRAADVHRVPAMVRVPGHAPEAIQAALDSGAQGVLVPRVSTAAQAQA
                     AVKASRYPPKGERGVGPGRAAGYGYRIPEYLAGANDRIVVAVQVETAEGLANIEAITA
                     VDGVDVVFVGPGDLSVSIDAVGPNGAGRLADAIRTIIGATVAHGRTSGIFCASPQNVG
                     RWAAIGASFFVLASDTMFLGAGTAANCAAARDELA"
     gene            119223..120020
                     /locus_tag="MESOP_RS00545"
                     /old_locus_tag="Mesop_0111"
     CDS             119223..120020
                     /locus_tag="MESOP_RS00545"
                     /old_locus_tag="Mesop_0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013891356.1"
                     /db_xref="GI:503657280"
                     /translation="MKLTRRNLILLAATIGIAAGPATAYAADVLNVGAYPTNPPFEYK
                     NESGTFEGFEVDIVNEAAKRAGMTTDIADLGFQALFAATTSKRIDVAISSITITPERL
                     KSQSFTQPYYDSDMGIATKTDSAVNTEADLKGKIVGVLSGSTGETWVKGHQEADGFSD
                     VKGYDTQQNLLLDLSAGRVDAAVSDIPGMEYSFTKMKDLKVKQRIKTGEQYGLMMTKD
                     HPLLGKLNDALTAMKKDGTLAAIHKKWFGSDAPADSSTVKEMPLPKA"
     gene            120165..120839
                     /locus_tag="MESOP_RS00550"
                     /old_locus_tag="Mesop_0112"
     CDS             120165..120839
                     /locus_tag="MESOP_RS00550"
                     /old_locus_tag="Mesop_0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891357.1"
                     /db_xref="GI:503657281"
                     /translation="MSLIDTFFNADVIASSLPALLRGFLNTLLLGILSIGIGIPIGLV
                     ISLLRLYAPKPLRWLAVGYTDIFRALPVLVVLILIYYALPFLGIRLSSWASAVTAFAI
                     IMSAYSAEVFRSGIESIPRGQFEASQALGLPFLLTLRKVVLPQAIRVVIPPMTSNCVS
                     MFKDTSLASTVALPELLKEATNAQSLYANPSPLIGAALVYLIFLWPMVRLVSLLEDRF
                     KTEKTR"
     gene            120889..122178
                     /locus_tag="MESOP_RS00555"
                     /old_locus_tag="Mesop_0113"
     CDS             120889..122178
                     /locus_tag="MESOP_RS00555"
                     /old_locus_tag="Mesop_0113"
                     /EC_number="2.8.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_013891358.1"
                     /db_xref="GI:503657282"
                     /translation="MNKHQTDNASAAAFPVDAIRAMFPALQRAGDFIFLDNAAGAQIP
                     QSVLDAVTNHLVSHNVQRGGRYGRSVTVDQSVADARESVALLINAYSPAEICFGMNAT
                     SFIRLVSLGIGQMLARDTEGERDEIVITDMDHDANIATWLALEPAGAKFKWWRMREDG
                     NLHVDDLRPLVSERTRLVACTVTAHSIGSIVNVASVAKIAHAAGAEVFLDCVHYGPHG
                     LIDVQAWDCDYLVCSGYKNFSPHMGFLWGRFETLKRLPTFREDFIPDEPPYKVEAGTF
                     IYENVSGMDAAVQYLELIGRNLAPSNNRSRRENIVAGMGAIRDYELVLAREMLAVLKG
                     CGATIYGVADEARIHERVPTFCFNIGKLSPQRIVEEMAEMQIGIRDGHMYAPRLMKRL
                     NLSMDSGAIRASLVHYNTVEEIHRFGEALRAIVAKLS"
     gene            complement(122294..123124)
                     /locus_tag="MESOP_RS00560"
                     /old_locus_tag="Mesop_0114"
     CDS             complement(122294..123124)
                     /locus_tag="MESOP_RS00560"
                     /old_locus_tag="Mesop_0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013527989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013891359.1"
                     /db_xref="GI:503657283"
                     /translation="MSTTVLEGKNIVRDYHIGGGLFTGPRTVHAVKGVSFTVDKGKTL
                     AIVGESGCGKSTLARIITLIDPATSGDLFIDGNKVDIARGGLTREMRRKVQIVFQNPY
                     GSLNPRQKIGDVLGEPLLINTDKPAAERRDLAMKMLKKVGLGHEHYNRYPHMFSGGQR
                     QRIAIARALMLNPSLLVLDEPVSALDLSVQAQVLNLLADLQDEFQLTYVFISHDLSVV
                     RYIADDVMVMYFGEAVEYGSRDEVFSDPKHSYTKTLFAATPRADVASIKARLAKKKAA
                     "
     gene            complement(123121..123978)
                     /gene="dppD"
                     /locus_tag="MESOP_RS00565"
                     /old_locus_tag="Mesop_0115"
     CDS             complement(123121..123978)
                     /gene="dppD"
                     /locus_tag="MESOP_RS00565"
                     /old_locus_tag="Mesop_0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018698101.1"
                     /note="DppD and DppF are the ATP-binding components of the
                     ABC dipeptide transport system DppABCDF; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_013891360.1"
                     /db_xref="GI:503657284"
                     /translation="MSLLEIKNLTVSFDTAAGPFMAVQGIDLSIEPREVLAIVGESGS
                     GKSVSMLAVMGLLPNTATVKADRMAFDGVDLLKLSPSERRKIVGKDISMIFQEPIASL
                     NPCFTVGFQIEEVLRFHMGMDRAQRRARAIELMKLVGIADPEERLSSFPHQMSGGQCQ
                     RVMIAIAIACNPKLLIADEPTTALDVTIQKQILDLLVSLQAKYGMGLIMITHNMGVVA
                     ETADRVIVQYKGRKMEEADVLSLFESPKSNYTRALLSALPENAVGDRLPTVSDMLFEP
                     APSAAGASA"
     gene            complement(123981..124904)
                     /locus_tag="MESOP_RS00570"
                     /old_locus_tag="Mesop_0116"
     CDS             complement(123981..124904)
                     /locus_tag="MESOP_RS00570"
                     /old_locus_tag="Mesop_0116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter"
                     /protein_id="WP_013891361.1"
                     /db_xref="GI:503657285"
                     /translation="MTNEGPATIEAATVVKPQDARLQMFAEFWHYFSVNKGAVIGLFV
                     FALLILIAIFAPLLAPHSPDDQFRDFFLTPPAWQAGGNAQFLLGTDAVGRDMLSRLIY
                     GSRFSLAIGFVVVTTALISGVILGLLAGYCRGWVDTLIMRIMDIILAFPSLLLALVLV
                     AVLGPGLVNAMIAIAFVLQPHFARLTRAAVMAEKNREYVISAKVAGASHLRLMLVTIL
                     PNCIAPLIVQATLSFSNAILEAAALGFLGMGAQPPTPEWGTMLAEAREFILRAWWVVT
                     FPGLAILITVFAINLIGDGLRDALDPKLKRS"
     gene            complement(124906..125913)
                     /locus_tag="MESOP_RS00575"
                     /old_locus_tag="Mesop_0117"
     CDS             complement(124906..125913)
                     /locus_tag="MESOP_RS00575"
                     /old_locus_tag="Mesop_0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013527992.1"
                     /note="transports peptides consisting of two or three
                     amino acids; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_013891362.1"
                     /db_xref="GI:503657286"
                     /translation="MLRYILGKLALIIPTFIGITILAFGFVRILPGDPVLVLAGERGL
                     SPERHTALMHQFGFDLPIWQQYLTYLTNILSGDFGTSFSTKTPVLKDFLVRFPATVEL
                     AIFAMIFAVVLGVAAGIFAAIRRGSWFDQLTMGTALAGYSMPIFWWGLLLIIVFSGTL
                     HWTPVSGRIDLLYFFKPVTGFMTIDSLISGQKGAFRSALSHLVLPTIVLGTIPLAVIA
                     RQTRSAMLEVLGEDYVRTARAKGLAPRRVIGLHAFRNALIPVVTTIGLQVGTLLTGAI
                     LTESIFSWPGIGKWMIDAISKRDYFTVQGGLLLIALIVMSVNLIVDVLYAVINPRIRA
                     N"
     gene            complement(125965..127557)
                     /locus_tag="MESOP_RS00580"
                     /old_locus_tag="Mesop_0118"
     CDS             complement(125965..127557)
                     /locus_tag="MESOP_RS00580"
                     /old_locus_tag="Mesop_0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891363.1"
                     /note="DppABCDF is involved in the transport of
                     dipeptides; also binds heme and mediates chemotaxis to
                     dipeptides; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013891363.1"
                     /db_xref="GI:503657287"
                     /translation="MKKKLTFAAALLAASVLGGVANAKTLVYCAEASPEGFDPAPYTA
                     GQTFDASSRTVFNRLVEFDHGKTTTSPGLAESWTISDDGKEYTFKLRKGVKFAATDYF
                     TPTRDFNADDVVFSFQRQVDKTGPWFQYIPGIAYQYYNDQFGDNITKVEKVDDLTVKF
                     TLKEPAITFIPTLGMDFASVVSKEYADKLQADKTPELFNQKPIGTGPFIFVDYQTDAA
                     IRYKANPDYWGGKQKIDDLVFAITTDPAVRAQKLKAGECNIMSYPAPADIAGLQADAN
                     LKVDEQEGLNVGALMYNTQQKPFDDVRVRKALNMAINKKAIIDAVFQGAGQVAVNPIP
                     PTMWSYNKDVKDDPYDPDAAKKLLEEAGVKDLKMNVWAMPVSRPYMPNARRTAELIQA
                     DFAKVGVTVNIVSYDWGEYLKRASAVDHDGAVIVGWTGDNGDPDNFLGVLLSCASVGS
                     NNRAEWCNKDFDALINKAKTVSDQAERTKLYEQAQVIFKEQAPWATLAHSKVFMPMQK
                     TVSGFAMDPLGIHRFDGVDIAE"
     gene            128053..130107
                     /locus_tag="MESOP_RS00585"
                     /old_locus_tag="Mesop_0119"
     CDS             128053..130107
                     /locus_tag="MESOP_RS00585"
                     /old_locus_tag="Mesop_0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty acid--CoA ligase"
                     /protein_id="WP_013891364.1"
                     /db_xref="GI:503657288"
                     /translation="MAKASKTPVKASAKAVSKPAAGTDGKGKATAKTAAAKTAAKPAV
                     KAPAAKAAAATKSVTNPAAKAAPAKTSPTKAPAAKISPAKASPAKTGANKTGAAKAAL
                     PAKAVPAPKPAPAKRLPKALTELTAGLPEKLWLKSYPKNMPAEIGALPYNSIGDFLVG
                     ACKQFAGQPAFTCMGKSITYAELERLSAAFGAYLQSTGLQKGSRVALMMPNVLQYPVA
                     MMAVVRAGYTVVNINPLYTPRELEHQLKDSGAQAIVILENFANTLQAIVARTSVKHVV
                     VAAMGDMLGGLKGTIVNLVVRRVKKMVPTWSLPGHVKFNAALKAGGGMNFKPATVAAN
                     DVAFLQYTGGTTGISKGATLLHSNVLANVAQNSLWVEDAYTIKPKPAHLNLICALPLY
                     HIFALTVNALMGMQMGGQNILIPNPRDIPGFVKELGKYPIHIFPGLNTLFNALLNNED
                     FRKLDFKPLVLTLGGGMAVQKGVAERWKALTGCPVSEGYGLSETSPVATANKFSSGDF
                     TGTIGLPLPSTEIAIRDDDGNNVPLGEVGEICIRGPQVMAGYWNRPDETAKVMTKDGF
                     FKSGDMGFMDERGYTKIVDRKKDMILVSGFNVYPTELEEVVAMHPGVLEVAAIGVPDE
                     HSGEVPKLFIVKKDPALTVETITAFCRENLTGYKRPRYIEFRTELPKTPVGKILRRAL
                     RE"
     gene            130116..130868
                     /locus_tag="MESOP_RS00590"
                     /old_locus_tag="Mesop_0120"
     CDS             130116..130868
                     /locus_tag="MESOP_RS00590"
                     /old_locus_tag="Mesop_0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_013891365.1"
                     /db_xref="GI:503657289"
                     /translation="MDSDRAGDGGPDHGLRLDPAEFIKANMRLVPVPALPEIRFYTAH
                     PGSGLRRLVDPENEGDADDDGPEPQPPYWAYAWAGGAVLARYILDNPSTVTGRRVLDL
                     GAGSGIVGIAAAKAGARTVIAAEIDRNGVAALTLNAAANGVAITVVGDDVTKGAPPAV
                     DMVLAGDVFYGQDVARRVMPFLDRCLAAGIEVLVGDPGRAYLPRSRLRLVAEYKVPDF
                     GDAKGAATRPSSVFRFEGRRSLALGSQPNHSE"
     gene            complement(130907..131839)
                     /locus_tag="MESOP_RS00595"
                     /old_locus_tag="Mesop_0121"
     CDS             complement(130907..131839)
                     /locus_tag="MESOP_RS00595"
                     /old_locus_tag="Mesop_0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013891366.1"
                     /db_xref="GI:503657290"
                     /translation="MVEHIALDRLTGIIAFARAGSLGSYTAAARALSISPSAVSKSIQ
                     RLERHLGLSLFTRTTRSLTFTPEGRDLHERALRLLREAEEIEQAAMTARSEPSGTLRV
                     AASLPIGLHLIAPALPAFRRLHPNLVVDLRLGDQTVDMIEEGIDVAIRIGDLADTRLL
                     SRKLAPHRLCCFASPAYLEERGTPTHPDDLVGHDTVNLRYQSTGQTFRWPFRIGDHEI
                     EIVPNAGVVADASDAVLIMLAAGGGIGIGASFMAAPYVKRGDLVPVLSTFAVERNNVT
                     VLWPASRRANPAVRAFLTMLDAAFMRRMAVSSID"
     gene            131932..132945
                     /locus_tag="MESOP_RS00600"
                     /old_locus_tag="Mesop_0122"
     CDS             131932..132945
                     /locus_tag="MESOP_RS00600"
                     /old_locus_tag="Mesop_0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-quinone reductase"
                     /protein_id="WP_013891367.1"
                     /db_xref="GI:503657291"
                     /translation="MSDKMKAARLHAFGGPEVLVYEDAPRPDVKPGEVLVRVQAAGLN
                     PPDWYLRDGYRALPPEWRPNASFPLILGTDVSGVIEAVGADAGEFSIGDEVYAMVRFP
                     HELMTGSNAYAHYVSVPASQLALKPAGIDHIHAAGAPMSLLTAWQFLIELGHDEPNPF
                     QPFRHEPVPLDGKTVLINGAGGGVGHLAVQLAKWRGARVIAVASAKNEGLMRDLGVDQ
                     FVDYKTTATEEVVRDVDLVLDAVGGADMERFFHVLKPGGALFLINPLGFTGHEEAEKL
                     GITVSSTQVRSNGAQLAKIARLLEDGIVRVVIDSTFPLAEASRAHQRAADGSIQGKIV
                     LAV"
     gene            133017..133319
                     /locus_tag="MESOP_RS00605"
                     /old_locus_tag="Mesop_0123"
     CDS             133017..133319
                     /locus_tag="MESOP_RS00605"
                     /old_locus_tag="Mesop_0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_041164456.1"
                     /db_xref="GI:752465747"
                     /translation="MLIVTGYMYVEPSSVAEFIQDLQNLAIATRQRDGNLSYDAAVDD
                     PLAGRLLVAERWRDQAALTAHLHATDTMAFVGRWGDTIRGEILKYDVLRKRGLMDE"
     gene            134112..134510
                     /locus_tag="MESOP_RS00610"
     CDS             134112..134510
                     /locus_tag="MESOP_RS00610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006204036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163949.1"
                     /db_xref="GI:752465240"
                     /translation="MRVSRIAARTVGSFSRGIDAFGALFRLGAHASNVDVANGEKNDG
                     LGVGLSRHRAFAKGCTLNAITPRTEDRDPEQPLARCFADRLIGGSHVFLINPTGTSLS
                     IGSQVLLTTCDAMRPSSVDQVDQGGSKCRR"
     gene            134534..135688
                     /locus_tag="MESOP_RS00615"
                     /old_locus_tag="Mesop_0125"
     CDS             134534..135688
                     /locus_tag="MESOP_RS00615"
                     /old_locus_tag="Mesop_0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018902185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163950.1"
                     /db_xref="GI:752465241"
                     /translation="MDGLIIAKWLPHLPDIQAHLGLDVGQLGLALAALPLGIMSSLPL
                     IGTFVISRFSERAAIRVTFLWLALTSTLPGLAWDFPSFAIALFFYGSGIAGVEVAMNA
                     TADAVESRVGRRIMSSCHGLWSVGNLIGAALGSLALSLHLDAIVTLIVAAPILMALAY
                     ASTGRLGHSPISSEPGPALALPDFPLLVLCLLPFCACVLEGAMADWAAVYLRIEHGAQ
                     AALTGAGFGVFAAVMAATRLTGDRLVDRVGPVFIAHCCGVSGVLGLLVIWVAPGVWPA
                     LVGFALMGFAASLIFPISVTAAARQSGRSAAMNVASLSLICFSGYVIGPPVVGLIADL
                     VGLRNALACLIPFALGVLLLAPRLQPRAAVTGTATAQGSTHLDHWRASSS"
     gene            complement(135718..136440)
                     /locus_tag="MESOP_RS00620"
                     /old_locus_tag="Mesop_0126"
     CDS             complement(135718..136440)
                     /locus_tag="MESOP_RS00620"
                     /old_locus_tag="Mesop_0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_013891370.1"
                     /db_xref="GI:503657294"
                     /translation="MADIKGILFDKDGTLVDFNATWLGVADFMAMDAAEGDRWKADRL
                     LAAAGFDFANRRFKPDSIFASGTNMDVVELWFPRLSDEDQMLAVARFNEITSMQGSAM
                     AVALPGIVDTLAALHKRAYRLGVATNDSTSGAEKTLVTLGVAQLFDAAYGYDAVANPK
                     PAPDTIQAFCDLTGLKPAAIAMVGDNRHDLEMARAGGCGLAVGVLSGTGTRESLAEIA
                     DVILDSVADLPDFLSARVKETV"
     gene            complement(136446..138089)
                     /locus_tag="MESOP_RS00625"
                     /old_locus_tag="Mesop_0127"
     CDS             complement(136446..138089)
                     /locus_tag="MESOP_RS00625"
                     /old_locus_tag="Mesop_0127"
                     /EC_number="5.3.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="WP_013891371.1"
                     /db_xref="GI:503657295"
                     /translation="MDQTAFQKQLAALRDHRAGAPGDMRQAFAADPQRFATFSATDGD
                     MLLDWSKCAVDATTMDLLEGLAKAADLEGRRAAMFAGKKINITEDRAVLHTALRNLSG
                     KGVTVDGQDVKADVIAVLDAMGAFADAIRSGKAAGATGKKITDIVNIGIGGSDLGPAM
                     VTLALAPYHDGPRAHYVSNIDGAHIHDTLKSLSAETTLFIIASKTFTTVETMTNAQTA
                     RDWVQKALGKEAVGKHFAAVSTALDLVAKFGIAPDRVFGFWDWVGGRYSVWGAIGLPV
                     MIAVGPRNFRAFLDGAHEMDEHFRTAPLRKNLPALLGLVGWWHRVICKYPARAVIPYD
                     QRLSRLPAYLQQLDMESNGKSVTLEGTAVTTPTGPLVWGEPGTNGQHAFFQLLHQGTD
                     FIPVEFLAAAVGHEPDLKHQHDLLLANCLAQSEAFMKGRTLEEARAQMLAKGMKPADV
                     DRIAPHRVFSGNRPSLTILYRKLDPRTLGRVIALYEHRVFVEGTLFNINSFDQWGVEL
                     GKELATGLLPVVEGKESAAKRDASTAGLVGHIHQLRGSE"
     gene            138377..139870
                     /locus_tag="MESOP_RS00630"
                     /old_locus_tag="Mesop_0128"
     CDS             138377..139870
                     /locus_tag="MESOP_RS00630"
                     /old_locus_tag="Mesop_0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008840650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoadipate aminotransferase"
                     /protein_id="WP_013891372.1"
                     /db_xref="GI:503657296"
                     /translation="MPQRNDTAIWSGLFRISAESGQTLQAQIRQAIVAAILDRQIAAS
                     MPLPSCRILAEKLGVARGTVVLAFQQLVDQGFLVARERRGHFVNPDVLATPAKPHQKA
                     PDQANEIDWKARRQIAASDMPPPAKHENWIKSSYPFVYGQFDPALFPTAEWRECNRMA
                     LAVLEIRNWASDMVDRDDPLLIEQIQARLLPRRGIFANPDEIIVTLGAQNALYMLATL
                     LMTKGSKVAMEDPGYPDARSIFRLAGADIQPVPVDQSGIVTSSIPNDSGFVFVTPSHH
                     CPTMVPLSAERRQDLLARANRHNQIIIEDGYDSQLLDEAPQQALKSLDRSGRVVYVGS
                     MSKTLAPGLRLGYIVASAGLIAELRALRRFMLRHPPANNQRAVALFLSLGHHEALVRR
                     LSSAFDERRKRLVHAISAFLPEWRSTDSAGGTSLWLEGPRGTDSRGLAEAAASRSVII
                     EPGDRFFDRTEKPSRFMRLGISSIALQHIEPGIRELATAAGRRPAAA"
     gene            140063..141649
                     /locus_tag="MESOP_RS00635"
                     /old_locus_tag="Mesop_0129"
     CDS             140063..141649
                     /locus_tag="MESOP_RS00635"
                     /old_locus_tag="Mesop_0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_013891373.1"
                     /db_xref="GI:503657297"
                     /translation="MSVVVEKQEAADQRSRRSGGREARRAMRAAPLADDIKPVRAGLE
                     GGSYGPLAGNDQERIHEAVLTLLETVGFANAIPSCIEALTKVGATYGDDGRIRFPRAL
                     VLDTIKKAARNFTLHGQDPKHDMVIQGKRVHYGTAGAAVHLVDVEKREYRESLLQDIY
                     DAARIVEGLDNIHFFQRPMVPRDIPDPLEMDFNTLYACVMGTSKHVGTSFTVRENVQP
                     ALEMLYAIAGGEENFRARPFVSNSNCFVVPPMKFAEDACGVLEACVDGGIPILLLSAG
                     QAGATAPAAIAGAVVQAVAEVLAGLVYVNALKPGHPAIFGTWPFVSDLRTGAMSGGSA
                     EQAVLTAACAQMAQFYDLPGGSAAGMTDSKLPDIQSGYEKGITDVMAGLAGLNLVYES
                     AGMHASLLGFCLESLIIDNDMLGHCLRCVRGIEVTDEALSIDTIADVCLRGPGHYLGN
                     EQTLRLMQTEYFYPAVGDRFSPKEWNEKGRPDILQRAIIEKKRVLAERFPRHVPKPLD
                     DKLRARFGEMIKLPRANMGG"
     gene            complement(141811..142209)
                     /locus_tag="MESOP_RS00640"
                     /old_locus_tag="Mesop_0130"
     CDS             complement(141811..142209)
                     /locus_tag="MESOP_RS00640"
                     /old_locus_tag="Mesop_0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891374.1"
                     /db_xref="GI:503657298"
                     /translation="MAGRRSSLGFLGMFGRSGDLRQLDTALRGADLHPALVPEGVKLT
                     IVNLMKDHWPDEPPPQAYPQVARLFSYCIAGPETFERSQGLQQRQDAEQRIEAAVDAG
                     DSFDAKIVLMALHAKLINAEVVERYGLGTD"
     gene            complement(142350..143741)
                     /locus_tag="MESOP_RS00645"
                     /old_locus_tag="Mesop_0131"
     CDS             complement(142350..143741)
                     /locus_tag="MESOP_RS00645"
                     /old_locus_tag="Mesop_0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transporter"
                     /protein_id="WP_013891375.1"
                     /db_xref="GI:503657299"
                     /translation="MSALVPQDAAVNSEAPAAPTFAEALRLWTKIGLLSFGGPAGQIA
                     LMHKELVEERRWIGEQRFLHALNYCMLLPGPEAQQLAVYIGWLLHRTIGGLVAGMLFV
                     VPGALVMLILSVLYALYGDVPLVEALFFGVKAAVLAIVVQAVIRIGRRALKNPVMVSI
                     AVAAFIAIYALNVPFPLIVLFAGLTGWLGDRVVPGLFSGSAHGKGDIADIKGAVDLMF
                     ERGELTHVTPTKWHAPRTVAIWLPIWLGPVLAIWWLTGSASVWTEIGRFFSLMAVVTF
                     GGAYAVLAYVAQAAVQSFGWLAPGEMVDGLGLAETTPGPLILVLQFVGFIAAFRHPGG
                     LDPLLAGSLGALLTLWVTFTPCFFWIFLGAPYIEALRGNKALSAALGAITAAVVGVIM
                     NLALWFALHVVFREVHTIGPGMNVPVLSSIDWRAALLSLAAMIAILKLKIGMLPTLAG
                     SALAGVLLLAVSG"
     gene            complement(143738..144562)
                     /locus_tag="MESOP_RS00650"
                     /old_locus_tag="Mesop_0132"
     CDS             complement(143738..144562)
                     /locus_tag="MESOP_RS00650"
                     /old_locus_tag="Mesop_0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_013891376.1"
                     /db_xref="GI:503657300"
                     /translation="MPSTTAITVSQLSRLVGLPGAPMIIDVRIDEDFDADQRLLPASC
                     RRNFKTVSTWASEFAGSQVAVVCQKGQKLSQGVAAWLRHEGISAESLEGGFEAWRDAN
                     GLLVRTEKLPPRDEKGRTVWVTRSRPKVDRIACPWLIRRFVDPHAIFLFVEAAEVPAV
                     ADRFQAVPFDIDNVFWSHRGDRCTFDTMIEEFGLKSEALDRLALVVRAADTASLDLVP
                     QAAGFLAASLGLSRMFRDDLEQLEAGMLLYDAFFRWCRDATEETHNWPGAAGGKTA"
     gene            complement(144815..146620)
                     /locus_tag="MESOP_RS00655"
                     /old_locus_tag="Mesop_0133"
     CDS             complement(144815..146620)
                     /locus_tag="MESOP_RS00655"
                     /old_locus_tag="Mesop_0133"
                     /EC_number="4.2.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862970.1"
                     /note="catalyzes the formation of 3-methyl-2-oxobutanoate
                     from 2,3,-dihydroxy-3-methylbutanoate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="WP_013891377.1"
                     /db_xref="GI:503657301"
                     /translation="MAGAPTKKKKFRSQEWFDNPDNPGMTALYLERYLNYGLTRAELM
                     SGKPLIGIAQTGSDLSPCNRHHIELAKRVREGIVSMGGIPFEFPCHPIQETGKRPTAA
                     LDRNLAYLSLVEVLYGYPLDGVVLTIGCDKTTPALLMAAATVNIPAIALSVGPMLNGW
                     HKGKRTGSGTIVWESRQRLSAGEIGYDEFMDIVASSAPSTGYCNTMGTATTMNSLAEA
                     LGMQLPGSAAIPAPYRERGQISYETGKRIVEMVHEDLKPSDIMTRKAFENAIVVNSAI
                     GGSTNAPIHLNAIARHLGVPLDNDDWQKIGLKVPLIVNLQPTGEYLGEDYHHAGGVPA
                     VVAELMKGGLLPHPDALTVNGKSIGDNCKGVANENAEVIRSVDKPLKANAGFINLRGN
                     LFDSAIMKTSGISPEFRERYLSNPKDPEAFEGNAMVFDGPEDYHARIDDPAQGIDEHT
                     ILFMRGAGPVGYPGGAEVVNMQPPAYLIKKGIHALACIGDGRQSGTSGSPSILNASPE
                     AAIGGGLALLKTGDRVRIDLRKGTADILVTDDEITRRRAELQNNGGFHYPKHQTPWQE
                     IQRGMVDQFSEGMVLKPAVKYQDVAHTSGVPRDNH"
     gene            146772..147221
                     /locus_tag="MESOP_RS00660"
                     /old_locus_tag="Mesop_0134"
     CDS             146772..147221
                     /locus_tag="MESOP_RS00660"
                     /old_locus_tag="Mesop_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase"
                     /protein_id="WP_013891378.1"
                     /db_xref="GI:503657302"
                     /translation="MALVIEGEERIAAPIQKVWEALNDPAVLKESIPGCQSLEMKSPT
                     EMAATVVLKIGPIKATFNGEVTLKNLKPPHAYTIQGEGKGGIAGFAKGGADVTLTEDG
                     PDATVLKYAAKADVGGKIAQLGSRLIESTSKKLAGQFFSTFGEKVGG"
     gene            complement(147239..148414)
                     /locus_tag="MESOP_RS00665"
                     /old_locus_tag="Mesop_0135"
     CDS             complement(147239..148414)
                     /locus_tag="MESOP_RS00665"
                     /old_locus_tag="Mesop_0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_013891379.1"
                     /db_xref="GI:503657303"
                     /translation="MSVTKEIVTERLKTVNGPDFTSNIVDLGMVSEIFIADAKVFFSI
                     TVPAARAQEMEPLRAAAERVVKAIPGVAGAVVALTAEKKGGGMEAPVPARPAARPAPS
                     APPAAARAAPHAPASHSHGKRGVPGIEAIIAVASGKGGVGKSTTAVNIALGLAANGLR
                     VGVLDADIYGPSMPRLLNIHGRPQTVDGKILKPMENYGLKVMSMGFLVDEETPMIWRG
                     PMVMSALTQMLREVEWGRLDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALI
                     DARKGLNMFRKVDVPLLGIVENMSYFLAPDTGKRYDIFGHGGARREAERLGVTFLGEV
                     PLEMGIRESSDEGSPVVASKPDSAEAKIYRDIASKVWDRVNEERGAAEAAVPNIVFE"
     gene            148605..148982
                     /locus_tag="MESOP_RS00670"
                     /old_locus_tag="Mesop_0136"
     CDS             148605..148982
                     /locus_tag="MESOP_RS00670"
                     /old_locus_tag="Mesop_0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_013891380.1"
                     /db_xref="GI:503657304"
                     /translation="MLENSNATANIAVKDLARAKAFYAGTLGLKQVDDMGGELIVYKS
                     GDTFINVYHSQFAGTNKATAVTWTVGDQIETVVKSLKSKGVAFEHYEMPGLTIEGDVH
                     VGQSMKVAWFKDPDGNILNLVSQ"
     gene            complement(149027..150031)
                     /locus_tag="MESOP_RS00675"
                     /old_locus_tag="Mesop_0137"
     CDS             complement(149027..150031)
                     /locus_tag="MESOP_RS00675"
                     /old_locus_tag="Mesop_0137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic phosphate transporter"
                     /protein_id="WP_013891381.1"
                     /db_xref="GI:503657305"
                     /translation="MEATIAFPLLAGLVAVALFFDFLNGLHDAANSIATIVSTRVLRP
                     HYAVFWAAFFNFIAFMFFGLHVAETVGKGIVDVSIVTPAVIFSALVGAIVWNIVTWIA
                     GIPSSSSHALIGGLVGAGVAKAGVGAIVWSGLGKTVAAIVLSPATGFVLALVLILVVS
                     WLFVRQTPFAVDSTFRVLQFFSASLYSLGHGGNDAQKTMGIIAVLLYSQGMLGEKFYV
                     PLWVVLTCQSALALGTLFGGWRIVHTMGSKITRLNPMQGFCAETGGAITLFAATWLGI
                     PVSTTHTITGAIIGVGAARRVSAVRWGIAGNIVIAWIVTLPATAAISALTYLAVNLTG
                     "
     gene            complement(150035..150676)
                     /locus_tag="MESOP_RS00680"
                     /old_locus_tag="Mesop_0138"
     CDS             complement(150035..150676)
                     /locus_tag="MESOP_RS00680"
                     /old_locus_tag="Mesop_0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease PIN"
                     /protein_id="WP_013891382.1"
                     /db_xref="GI:503657306"
                     /translation="MLGWFRKLLPREDRFFDLFERHSRTVVGGAEALQLLLQGKDIDR
                     WCQKIVDLEDEADHITAEVLLAVRRSFITPFDRGDIKDLIQSMDDAIDMMHKTVKTVR
                     LFEKKEFDPLMQEMGGVIVAAAKLVAEAIPLLAKVGTHTVRLNAIAEEVMRVESRADD
                     LHEQGLKNLFRKHGSSDPMAYLIGSEIYGQLEKVVDRFEDVANEISGIVIENV"
     gene            150843..151742
                     /locus_tag="MESOP_RS00685"
                     /old_locus_tag="Mesop_0139"
     CDS             150843..151742
                     /locus_tag="MESOP_RS00685"
                     /old_locus_tag="Mesop_0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013891383.1"
                     /db_xref="GI:503657307"
                     /translation="MIDKLEFFIALAKEEHFGRAAEVCGVTQPTLSAGIKQLEGQLGV
                     MLVLRGSRFQGLTPEGKQVLVWARRIVGDSRTMREEMRAARHGLAGRIRIAAVPTALA
                     MVARLTTPFREKHPGVTFSVLSRTSIEVLTLLGNFDVDAGITYLDNEPLGRVTSVPLY
                     DERYQLITAVGNPYSDRDKVTWAEISHLPLCLLTPDMQNRRIIDQHLAEAGVQVRPTL
                     ESNSMIVLFSHIRTGKWSSIMPLNLAETFGFSEPIRAIPIVEPDASHTVGLVAAPREP
                     HTPLVQALLDEAMALADDFRTHR"
     gene            151936..152415
                     /locus_tag="MESOP_RS00690"
                     /old_locus_tag="Mesop_0140"
     CDS             151936..152415
                     /locus_tag="MESOP_RS00690"
                     /old_locus_tag="Mesop_0140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325044.1"
                     /note="catalyzes the oxidation of formate to carbon
                     dioxide and hydrogen using NAD or NADP as the acceptor;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit gamma"
                     /protein_id="WP_013891384.1"
                     /db_xref="GI:503657308"
                     /translation="MTMQPASTEIASRTAAIVQELKDVEGPLLPILHGIQEEFGHVPH
                     DVLPVIADGLNLSRAEVHGVVTFYHDFRARPAGRHVLKLCQAEACQSMGSDAVAAKVK
                     QLLGIDFHETTRDGSVTLEPVYCLGLCACSPSAMLDGEVIGRLDDDKIDEIVAEVRS"
     gene            152412..153968
                     /locus_tag="MESOP_RS00695"
                     /old_locus_tag="Mesop_0141"
     CDS             152412..153968
                     /locus_tag="MESOP_RS00695"
                     /old_locus_tag="Mesop_0141"
                     /EC_number="1.6.99.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit beta"
                     /protein_id="WP_013891385.1"
                     /db_xref="GI:503657309"
                     /translation="MIPRIYIPGDSGALALGAEKVAKAVRAELAERGIEAKIVRNGSR
                     GAYFLEPMVEVATANGRVAYGPVKASDVKSLFDSGFLTGGHHKRWLGAPDKIPFLAKQ
                     TRLTFARCGINDPLSLDAYKSLGGLKGLQNAVAMSPADIVKQVTESGLRGRGGAGFPT
                     GIKWKTVLDTTGDRKYIVCNADEGDSATFADRMIMEGDPFVLIEGMAIAGIATGATKG
                     FVYIRSEYPHAVAVMNKAVEVARKAGVLGTNVLGSPNAFDMEIRVGAGAYVCGEETSL
                     LNSLEGKRGVVRAKPPLPAIQGLFGKPTVINNVISLASVPVVMDKGAAFYKDFGMGRS
                     RGTIPIQIAGNVKHGGLFETAFGLTLGEIVDDIGGGTATGRPVKAVQVGGPLGAYFPR
                     ALFDTPFDYEEFAKRDGLIGHAGITVFDDTADMLKQARFAMEFCAIESCGKCTPCRIG
                     STRGVETIDRLAAGIEPEKNLALVTDLCNTMKFGSLCALGGFTPYPVMSSITHFPEDF
                     KPAPARVAAE"
     gene            153979..156891
                     /locus_tag="MESOP_RS00700"
                     /old_locus_tag="Mesop_0142"
     CDS             153979..156891
                     /locus_tag="MESOP_RS00700"
                     /old_locus_tag="Mesop_0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit alpha"
                     /protein_id="WP_013891386.1"
                     /db_xref="GI:503657310"
                     /translation="MNIKADFPTLIEELDYGTPESKAQKQVTLTVDGRSISVPEGTSI
                     MRAAMEAGVEIPKLCATDMLDSFGSCRVCLVEIEGRGGTPASCTTPVGEGMVVKTQSE
                     RLDAIRRGVMELYVSDHPTGWNEKAGTGASEFDAVAKSVGLAENRYGVEGRNHVKPED
                     GVAPGHGSLAVDYIARDESNPYFTYDPAQCIVCSRCVRACEEVQGTFALTIEGRGFES
                     RMVAGMHEDFIASECVSCGACVQACPTDALREKTVLAKGLPERSAVTTCAYCGVGCSF
                     KAEVKDDEVIRMMPYKEGKANHGHSCVKGRFAYGYATHKDRILSPMIREKVSDPWREV
                     SWEEAIAHTAKEFRRIQYQYGRTSIGGITSSRCTNEETYLVQKLVRQGFRNNNVDTCA
                     RVCHSPTGYGLGQTYGTSAGTQDFDSVDYTDVGVIIGANPASAHPVFASRLKKRLRQG
                     ARLIVLDPRRTEMVKSAHIEADYHLPLKPGTNVAVLTALAHVIVTEGLFNEAFIRERC
                     DWTEFQDWASFVALPENSPETVGKLSGVDPELIRGAARLYATGGNGAIYYGLGVTEHS
                     QGSTTVMAIANLAMATGNIGRPGVGVNPLRGQNNVQGSCDMGSFPHELPGYRHISGDA
                     VRDIYESLWGVKLDDEPGLRIPNMLDAAVDGSFKGIYIQGEDILQSDPDTKHVAAGLA
                     AMECVVVHDLFLNETANYAHVFLPGSTFLEKDGTFTNAERRINMVRKVLEPKARYADW
                     EATQELARAIGLDWNYQHPSEIMDEIAQTTPSFAGVSFELLDRVGSVQWPCNEKAPLG
                     TPIMHVDGFVRGKGKFIRTEYVATDERTGPRFPLLLTTGRILSQYNVGAQTRRTDNVM
                     WHSEDRLEIHPHDAENRGLRDGDWVRLTSRSGETTLRALITDRVSPGVVYTTFHHPDT
                     QANVITTDFSDWATNCPEYKVTAVQVGASNGPSDWQRDYDEQARNSRRIAPLEAAE"
     gene            157277..158107
                     /locus_tag="MESOP_RS00705"
                     /old_locus_tag="Mesop_0143"
     CDS             157277..158107
                     /locus_tag="MESOP_RS00705"
                     /old_locus_tag="Mesop_0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase accessory protein FdhD"
                     /protein_id="WP_013891387.1"
                     /db_xref="GI:503657311"
                     /translation="MTRKRQAITQISRLAHRASGTVAANRMVPEETPVAFSFAGTTHA
                     VMMASPADFEDFALGFSLTEGIIAVTGEIEAIEVEDHGAGIDIQIRLKDQANTRFEAR
                     RRRLAGPVGCGLCGIESIEEAMRSVDAVGASKLTLDANDIARSVKLLSKVQPLHAETG
                     AVHAAGFYVPGKGVVLAREDVGRHNALDKLAGALAKAGIDGSTGAVVVTSRVSVEMVQ
                     KTAAIGSAFIIAVSAPTALAIRTAQEAGMTLVALVRGDDFDVFTHPDRVVLGVAQHVA
                     "
     gene            158097..158408
                     /locus_tag="MESOP_RS00710"
                     /old_locus_tag="Mesop_0144"
     CDS             158097..158408
                     /locus_tag="MESOP_RS00710"
                     /old_locus_tag="Mesop_0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent formate dehydrogenase subunit
                     delta"
                     /protein_id="WP_013891388.1"
                     /db_xref="GI:503657312"
                     /translation="MSHDEDHITSTSEKLVRMANQIAAFFHSRPREEGVAGVAEHINK
                     FWEPRMRRQFFEMLDSGGEGFDELVVVASARIKRPISPAEADLKLGLKASPADIAASQ
                     K"
     gene            158522..160075
                     /locus_tag="MESOP_RS00715"
                     /old_locus_tag="Mesop_0145"
     CDS             158522..160075
                     /locus_tag="MESOP_RS00715"
                     /old_locus_tag="Mesop_0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013891389.1"
                     /db_xref="GI:503657313"
                     /translation="MRPIETRYALSGEVRIAYQVVGQGSFDLVFVPGFISNLDLHWDD
                     EGYSRLLKRLSAFSRLILFDKRGTGLSDRVDVHNLPSLETRMDDVRAVMDAAGSGRAA
                     LLGASEGAPMAMLFAATYPERTRALALYGGYAHFHKWVMPPERLDAFIEMAETAWGTG
                     ATLPHFAPGRVDDARFSTWWARFERLSASPTAAAALARMNAEIDIRGVLAAIGAPTLL
                     IHRRNDVRVDPDASRFLARKIPNARLVEIPGRDHPIWTGDVDRVADLIEEFLTGERAV
                     AEAERVLAALLVTRIYDTARLGDRMWSERSQHFHETWRTLVGRHGGRCVDIHGEMMIS
                     RFDGPGRALRCAAALRDAAQQIGVASAQGAHVGEIETRGPPIGLTGRVTIQLAAHAGR
                     GDILASRLVADLAVGSGLHFVEAGRVSIDELDEPLALVLAMSEQHLEPACRPKVKAAE
                     PASLTVRESEVVNLIADGKSNAAIAAELRLSEHTVKRHVANILLKLDLPSRAAAAAFS
                     VRHAGPDGP"
     gene            160184..160663
                     /locus_tag="MESOP_RS00720"
                     /old_locus_tag="Mesop_0146"
     CDS             160184..160663
                     /locus_tag="MESOP_RS00720"
                     /old_locus_tag="Mesop_0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkylhydroperoxidase"
                     /protein_id="WP_013891390.1"
                     /db_xref="GI:503657314"
                     /translation="MLKSNLNVRSLVIAAGIGALFTISPARAEDASAAAAYKDIEATL
                     GSVPDMFKTLPDVAIAGAWAEIKGVQLNPNTALDGKTKELMGLAVAAQIPCQYCIYFH
                     TEAAKLNGASDEEIKETIAMAAIVRHWSTILNGSQVDLATFKKQTDDVFAAVKAKSQ"
     gene            160747..161109
                     /locus_tag="MESOP_RS00725"
                     /old_locus_tag="Mesop_0147"
     CDS             160747..161109
                     /locus_tag="MESOP_RS00725"
                     /old_locus_tag="Mesop_0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891391.1"
                     /db_xref="GI:503657315"
                     /translation="MLTKTQTVDGAAIKKAIEGRDGKMLSSFYADDALVRVIDRNNPP
                     SKPREIRGRAAITTFWDDICSRAMTHKVDTTIANGDSLAFTQACSYPDGTKVFAAAML
                     ELKNGQIARQTVVQAWDE"
     gene            161141..161455
                     /locus_tag="MESOP_RS00730"
                     /old_locus_tag="Mesop_0148"
     CDS             161141..161455
                     /locus_tag="MESOP_RS00730"
                     /old_locus_tag="Mesop_0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891392.1"
                     /db_xref="GI:503657316"
                     /translation="MFSARWQIDAKFGHKQTVLELLKKWEREIGSQVGIADLQFQIMT
                     GSIGAREATVESHHQVESLAQLEAFFAKIGKIDAHAKWGKEMEPFVVSGTSLWNIYRI
                     VE"
     gene            complement(161639..163066)
                     /locus_tag="MESOP_RS00735"
                     /old_locus_tag="Mesop_0149"
     CDS             complement(161639..163066)
                     /locus_tag="MESOP_RS00735"
                     /old_locus_tag="Mesop_0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862951.1"
                     /note="catalyzes the formation of 4-aminobutanoate from
                     4-aminobutanal; involved in putrescine degradation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-aminobutyraldehyde dehydrogenase"
                     /protein_id="WP_013891393.1"
                     /db_xref="GI:503657317"
                     /translation="MDTQMLIGSKFEKGTDAEEPILNPKTGAAILNLPEASQAQIEAA
                     VAAAEQAFVLWSRTTPAQRSGYLLKIADRIEAEAKEFAALEALNCGKPINSVLNDEIP
                     AIVDCYRFFAGAVRSMPGVVAGEYLPGHTSMVRRDPIGIVASIAPWNYPLMMMAWKVA
                     PAIAGGNTVVFKPSEQTPLTALKLAKILAEILPEGVVNVVLGRGDSVGNTLINHPKVN
                     MISITGDVATGKKVLQAAAKSVKRTHLELGGKAPVIVFDDADLGSVVAGLRAFGYYNA
                     GQDCTAACRIYAGKKIYDKLVADLSSAVSTIKYNLSDDTENEIGPLISRRQRDRVSSF
                     VERASELKHIEITTGGKPGEGTGFYYQPTVVAGALQEDEIVRREVFGPVVSVTRFTEV
                     DEAVGWANDSDYGLASSVWTKDVSRAMATAARLQYGCTWINTHFMLTNEMPHGGLKQS
                     GYGKDMSLYALEDYTAVRHVMVAHG"
     gene            complement(163169..163984)
                     /locus_tag="MESOP_RS00740"
                     /old_locus_tag="Mesop_0150"
     CDS             complement(163169..163984)
                     /locus_tag="MESOP_RS00740"
                     /old_locus_tag="Mesop_0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008840637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter permease"
                     /protein_id="WP_013891394.1"
                     /db_xref="GI:503657318"
                     /translation="MRSDRGQSAPLGLKIAAACGLLFLHLPILLIFVYAFTTEEKSFV
                     WPPPGLTTQWFAVTWNRPDVWEALSLSVRVAAISTAIALILGTLCAAAVSRTKFFGRE
                     TISLLVILPIALPGIITGIALRSAFALADIPFSFWTIVLGHATFCVVVVYNNAVARFR
                     RTSGSMIEASMDLGADGFQTFRHVVLPNIATALLAGGMLAFALSFDEVIVTTFTAGQQ
                     QTVPIWMLEELIRPRQRPVTNVVAMVVVLVTLLPILFAYYLTRDGDQIAGGGK"
     gene            complement(163974..164939)
                     /locus_tag="MESOP_RS00745"
                     /old_locus_tag="Mesop_0151"
     CDS             complement(163974..164939)
                     /locus_tag="MESOP_RS00745"
                     /old_locus_tag="Mesop_0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter permease"
                     /protein_id="WP_013891395.1"
                     /db_xref="GI:503657319"
                     /translation="MTIAALNANPAPAILPGSGGLRGALSDLFWRRPQLLLLLMLLPP
                     VLWLGIVYIGSLFALLAQSFFSIDEFSGLINREFTLKTYGDLFQAANLDIILRTVTMA
                     ALVTLASAIVAFPIAYYAARYARGRWKALFYLGVMLPLWSSYLVKIYAWKLILAKEGI
                     LTWLLAKLHLLWLLDAWLSLPVVGGNSLSVSFTGTFIVFVYVWLPFMILPVQAALERV
                     PANLVEASSDLGASPGQTFRNVLFPLALPGIVAGSIFSFSLTLGDYIIPQIIGTSRLF
                     IGQAVYSQQGTAGNIPLAAAFTVVPIVIMGFYLWGAKRMGAFDAL"
     gene            complement(165163..166161)
                     /locus_tag="MESOP_RS00750"
                     /old_locus_tag="Mesop_0153"
     CDS             complement(165163..166161)
                     /locus_tag="MESOP_RS00750"
                     /old_locus_tag="Mesop_0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter ATP-binding protein"
                     /protein_id="WP_041163951.1"
                     /db_xref="GI:752465242"
                     /translation="MTSAVSFQKVSRHFGSVRAVDAVDLDIAPGEFFAMLGPSGSGKT
                     TCLRLIAGFEQPTAGSISIFGERAEGVPPYRRNVNTVFQDYALFPHLNVLDNVAYGLM
                     VKGVGKAGRHKAAEEALTLVRLPGYGARRPGQLSGGQRQRVALARALVNQPKVLLLDE
                     PLGALDLKLRENMQEELKSLQKALGITFVFVTHDQGEALSMADRVAVFNDGKIMQIGT
                     PEDIYQRPKTRFVADFVGSSNVLPPDFVQRYSGQHRWGSLRPESIRVGRAASGEGVAA
                     RLVSTNYLGATTRLAFDADGLKLHAIVPAGAALPAEGDAVVLTFNRESLHLMDEPA"
     gene            complement(166341..167495)
                     /locus_tag="MESOP_RS00755"
                     /old_locus_tag="Mesop_0154"
     CDS             complement(166341..167495)
                     /locus_tag="MESOP_RS00755"
                     /old_locus_tag="Mesop_0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_013891398.1"
                     /db_xref="GI:503657322"
                     /translation="MNSFLKSCTALTVALAFSGQAIAQVKELGKGEGEVNIVAWPGYI
                     ERGETDKGYDWVTAFEKESGCKVNVKTANTSDEMVSLMNEGGFDLVTASGDASLRLVA
                     GKRVQPINTDLIPSWKSVDDRLKDAPWFTVDKVHYGVPYQWGPNILMYNTEVFKEAPK
                     SWNVVFEEMKLPDGKSNKGRVQAYDGPIHIADAANYLMFHKPELGIKDPYELNEDQYK
                     AALDLLRVQRTLVGRYWHDAAIQVDDFQNEGVVASGSWPYQVNTLVAAKKPVASTVPE
                     EGVTGWADTTMMEADAAHPNCAYMWLEHSLSPKVQGDVSAWFGSLPVVPAACKGNELL
                     GEEGCKTNGYDNFDKIKFWKTPVSKCATQNNQCVPYYRWVSDYIGVIGGR"
     gene            complement(167634..168545)
                     /locus_tag="MESOP_RS00760"
                     /old_locus_tag="Mesop_0155"
     CDS             complement(167634..168545)
                     /locus_tag="MESOP_RS00760"
                     /old_locus_tag="Mesop_0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013891399.1"
                     /db_xref="GI:503657323"
                     /translation="MAFTIRQLQFFIAVAEQGTVSGAAQNLSISQSSVTEAIKELESD
                     LGVELFERHPRGLNITHKGHQFLRHATKILADVSDARRSFSGEQAATGGRLQLGVTSL
                     VAGYVLSDLLSRYRRAYPGVEVSAIEDNGDYLEHLLIGGKLDIAVMVTSNLRDRTALQ
                     SEILEVSAYRLWLPLGHPLAGADIIGIGDIASEPLIMLTVDEIEENTGKLLTAIGARP
                     HVAFRTRSVEAVRSLVATGAGVALLPDLVYRPWSLEGDRIESRDISGSLPVVQVGMVW
                     RRGSGLPQSARDFIGLAQSQRMVRQRL"
     gene            complement(168628..169404)
                     /locus_tag="MESOP_RS00765"
                     /old_locus_tag="Mesop_0156"
     CDS             complement(168628..169404)
                     /locus_tag="MESOP_RS00765"
                     /old_locus_tag="Mesop_0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_013891400.1"
                     /db_xref="GI:503657324"
                     /translation="MVHSKRHGEILRLLQEEGTVTIASLADRLGVSLETVRRDVKPLT
                     GDGSVLKMHGAIGLPSMVGEAPFERRMRENADAKRVIARMVAATIRDGESIMLDTGTT
                     TSFLARELLGHRRLTVVTNSSDIARTLATINGNKVYMAGGELRSDSGAAFGASAIEFV
                     SRFSVSHAVISTGAVDAVTGVMDYDLEEAEFARMVLSRGQRSLVITDHTKFGRQGLVQ
                     VCSFAGFSELATDRLPPRDIAAALAQAGARLSIAGDVAGF"
     gene            169825..170712
                     /locus_tag="MESOP_RS00770"
                     /old_locus_tag="Mesop_0157"
     CDS             169825..170712
                     /locus_tag="MESOP_RS00770"
                     /old_locus_tag="Mesop_0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline kinase"
                     /protein_id="WP_013891401.1"
                     /db_xref="GI:503657325"
                     /translation="MIAEDRIRALPCWTGAIEIAPLPGGLSNANYVVSDAAGRHVVRF
                     GQDYPFHHVFREREVMTARAAHAAGFAPAVHYAEPGIMVTAYLGARTYLADDVRANLG
                     RVAALMRGFHREMPNHISGAGFMFWVFHVIRDYARTLEEGGSRKRSELPHLLTLADEL
                     ERAQKLLPIVFGHNDLLPANILDDGNRLWLIDFEYAGFNTAMFDLSGVASNAGMSDEE
                     SFAFLTAYFMKEPDEAIRRSHAAMQCASLLREAMWSMVSELYLDAPGIDYVAYTEENL
                     VRLDAALENYRTKYGILKS"
     gene            170709..173162
                     /locus_tag="MESOP_RS00775"
                     /old_locus_tag="Mesop_0158"
     CDS             170709..173162
                     /locus_tag="MESOP_RS00775"
                     /old_locus_tag="Mesop_0158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006204417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_013891402.1"
                     /db_xref="GI:503657326"
                     /translation="MTLPGHAAIVVIGGGIIGCSTAYHLARDHKAEVVLLEQGKLTSG
                     STWHAAGLVGQLRSSASITRVLKYSVELYKGLEAETGLATGWKMTGCLRLATNADRWT
                     EYKRLATTAKSFGMDMQLLSPAEVKAMWPLMETGDLVGASWLPTDGQASPSDITQSLA
                     KGARMHGAKLYEDVRVTGFEMKDGRITAVKTNKGDIACDKVVNCAGQWARQVGAMAGI
                     NVPLQPVKHQYIITEKIAGLATDAPTIRDPDRRTYFKEEVGGLVMGGYEPNPQAWKTD
                     LPGGDVPDDWEFRLFDDDYDHFEQHMTQAIARVPALETVGVKQMINGPESFTPDGNFI
                     LGTAPECANMFVGAGFNAFGIASGGGAGWVLAQWVVDGEAPLDLWVVDIRRFSNLHRD
                     RQWVCDRTLEAYGKHYTIGFPHEEYVSGRPRIVSPLYERLKRQQAVFGSKLGWERPNW
                     FAPEGVEPRDIYSMGRQNWFAAVGDEHRHVREKVGIFDQSSFAKYELSGPDAAKALDW
                     ICANDVSKPAGRLTYTQLLNTRGGIEADLTVARLAEETFYIVTGTGFRTHDASWISDH
                     IGEGLDATLADVTEDFGTLSLMGPRARDVLADVTDADVSNAAFPFGHVREIAIAGHTV
                     RALRVTYVGELGWELHVPIAATGEVFDALMTAGKRHGIRPVGYRALESLRLEKGYRAW
                     GADITPNDTPQEAGLGWAVKLRKNTDFVGRRALEKANGTALKKRFAGFTVDDPDIVLL
                     GRETILRNGEPVGYLTSGGYGYTLGKNIGYGYVRNADGVSDDFLASGDYELVVAMERA
                     PAKIHLEPMYDPAAGRVKA"
     gene            complement(173244..173876)
                     /locus_tag="MESOP_RS00780"
                     /old_locus_tag="Mesop_0159"
     CDS             complement(173244..173876)
                     /locus_tag="MESOP_RS00780"
                     /old_locus_tag="Mesop_0159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase type 11"
                     /protein_id="WP_013891403.1"
                     /db_xref="GI:503657327"
                     /translation="MTDAKHLGALSAAYAATRPEEVAALYDRWSQTYDADMSAAGYRH
                     PTICLALLARHLPRGSVPLLDAGAGTGLIGEWLNIAGYPEVEALDISQGMLDQAARKG
                     VYSALHCLALGGKLPFADDAYAGIVSAGVFTSGHVGVEGLDELIRICRPGGIIVLTVK
                     NTLWDQGFAARIAELEAQSLVTRVEETRPYVSMPGEADTVPSRGLALRVN"
     gene            173975..174877
                     /locus_tag="MESOP_RS00785"
                     /old_locus_tag="Mesop_0160"
     CDS             173975..174877
                     /locus_tag="MESOP_RS00785"
                     /old_locus_tag="Mesop_0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891404.1"
                     /db_xref="GI:503657328"
                     /translation="MVTDEARAKLAAIPMLAGYTGPLDRLGGLTNLVFRAGEFCLRIP
                     GKGTEEYINRANEAVAAHEAAKAGVSPEVLHVDPGTGMMVTRFIAGAETMSPEKFRTR
                     PGSPARAGEAFRKLHASGAVFPFRFELFAMIDDYLKVLSTKNVALPAGYHDVVREAET
                     VRSALAAHPLPVVACHCDPLCENFLDTGERMWIVDWEYSGMNDPLWDLGDLSVEGRFD
                     AAQDEEMMRAYFGGEATPAERGRVVIYKAMCDLLWTLWGLIQLANDNPVDDFRAYADG
                     RFARCKALMETPEFSRHLAAVRRG"
     gene            complement(174874..175797)
                     /locus_tag="MESOP_RS00790"
                     /old_locus_tag="Mesop_0161"
     CDS             complement(174874..175797)
                     /locus_tag="MESOP_RS00790"
                     /old_locus_tag="Mesop_0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT transporter permease"
                     /protein_id="WP_013891405.1"
                     /db_xref="GI:503657329"
                     /translation="MTQPVAQNSTIRNVLLAGILLMLAGDFLFALNDAMGKWLVASFS
                     VGQVVLIRSIGAFFVLGPMIANQGAGRLFQMERPGLQILRVVATTLDTALFYAAVVYL
                     PLADVMSFYMAGPIYVAALSHFLLGEKVGWRRWAAILLGFCGVLIMLKPSSAAFSLSS
                     GFALVGSIAFAFAIILNRRLRGTSDTNLVTWQTIGTLVVGGVMTIGAWQTPSALDFGA
                     MLLLGIVSCGAHLMITRALKLAPASTLAPLHYTLLLWAVVFGLAFFGDVPGPRILIGS
                     GIVVLAGLFIFHRQKVVETTVPPENVPKGVN"
     gene            complement(175905..177185)
                     /locus_tag="MESOP_RS00795"
                     /old_locus_tag="Mesop_0162"
     CDS             complement(175905..177185)
                     /locus_tag="MESOP_RS00795"
                     /old_locus_tag="Mesop_0162"
                     /EC_number="3.5.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891406.1"
                     /note="Catalyzes the deamination of cytosine to uracil and
                     ammonia; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine deaminase"
                     /protein_id="WP_013891406.1"
                     /db_xref="GI:503657330"
                     /translation="MDFDLIVRGGTLPDGTIADIGIIGETIAAIEPELNVTAGVAIDA
                     YGNLVSPPFVDPHFHMDATLSYGIPRINASGTLLEGISLWGELKPLLTHEAVRDRALA
                     YCDWAVSMGLLAIRTHVDVCDDRLLAVEALLDVKKAIAPYIDLQLVAFPQDGFYRSPT
                     ARQNTIRALDMGVDVVGGIPHFERTMADGTRSVTELCEIAAKRGLMVDLHCDETDDPL
                     SRHIEQLAYETQRLGLQGKVAGSHLTSMHSMDNYYVSKLLPLIAEAGVSAIPNPLINI
                     MLQGRHDTFPKRRGLTRVKEMQALGIRVGWGQDCVLDPWYSLGTADMLDVAFMGLHVA
                     QMSSPADMARCFDMVTSVNAAIMGLDHLGLAVGKRASLVILDAGSPIEALRLRAERIC
                     VIARGKVVAERTRQDTRLSIPGRPATVNRRHQAG"
     gene            177336..179090
                     /locus_tag="MESOP_RS00800"
                     /old_locus_tag="Mesop_0163"
     CDS             177336..179090
                     /locus_tag="MESOP_RS00800"
                     /old_locus_tag="Mesop_0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013891407.1"
                     /db_xref="GI:503657331"
                     /translation="MFRFFRSTENQRLVARLLRESFRQHRVGYGAAILSMLVVAGMTA
                     ASAWILREITNEFVIDKRVDRVNMIALAVAGIFVVKGLANFVQAYFMSRVGNAIIAER
                     QRKIYDRILAQGIEFYHSTSSSDLITRMTNNAQAARNVLDLIVTSYVRDLVTLAALIG
                     VMVWQQPALSLICFVVGPVAIYGVNGILKRVRKFAAMEFRSVGQIVQVMQETAIGVRV
                     VKSFNLEGLMRKRMYKAVSDVEDRANNIAALEAVTSPVMETLAGLAIAGAVMVSGMLV
                     LQGGQMPGNIMAFIAALLLAYEPAKRLARVRISLESGIVGVRMMFQLADEPLTLAEKP
                     DARPLLAGPGEIRFDAVSFAYQNGPPVLDRFDLTLAPGKMTALVGPSGSGKSTILNLI
                     MRMYDPQGGKVLLDGQDISHATLASLREKIAYVSQDTFLFAGTIMHNIRLGRQDATDE
                     EVIAAARAANAHDFIIAQAKGYETDVGENGGLLSGGQRQRISIARAMLRNAEILLLDE
                     ATSALDAESEALFRDALQQLTEGRTTIVIAHRLSTVHQADTIVVLEGGKVVESGPHRT
                     LLKQGGLYQKLYEYQLMP"
     gene            complement(179259..181103)
                     /locus_tag="MESOP_RS00805"
                     /old_locus_tag="Mesop_0164"
     CDS             complement(179259..181103)
                     /locus_tag="MESOP_RS00805"
                     /old_locus_tag="Mesop_0164"
                     /EC_number="4.2.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891408.1"
                     /note="catalyzes the dehydration of
                     2,3-dihydroxy-3-methylbutanoate to 3-methyl-2-oxobutanoate
                     in valine and isoleucine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="WP_013891408.1"
                     /db_xref="GI:503657332"
                     /translation="MPAYRSRTTTHGRNMAGARGLWRATGMKDSDFGKPIIAVVNSFT
                     QFVPGHVHLKDLGQLVAREIEKAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRELIAD
                     SVEYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPTVFVSGGPMEAGKVVLAGKTQ
                     ALDLVDAMVAAADDKISDEDVKVIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGN
                     GSTLATHADRKRLFVEAGHLIVDLAQRYYEQDDETALPRSIASKGAFENAMTLDIAMG
                     GSTNTVLHILAAAHEGEVDFTMEDIDRLSRRVPVLCKVAPAKSDVHMEDVHRAGGIMA
                     ILGQLDNAGLINRDLPTVHTSSLGEALDHWDISRTTSQNVRDFFLAAPGGVPTQVAFS
                     QDRRWDDLDLDREKGVIRSAETPFSKDGGLAVLKGNLALDGCIVKTAGVDESILKFTG
                     PARVFESQDASVKAILSNEIKAGDVVVIRYEGPRGGPGMQEMLYPTSYLKSKGLGKAC
                     ALVTDGRFSGGTSGLSIGHASPEAAEGGTIGLVQEGDTIEIDIPNRTIRLAVSDEELD
                     ARRAAMEAKGALAWKPAEKRKRKVTTALRAYAAFATSADKGAVRHVPE"
     gene            181369..181836
                     /locus_tag="MESOP_RS00810"
                     /old_locus_tag="Mesop_0165"
     CDS             181369..181836
                     /locus_tag="MESOP_RS00810"
                     /old_locus_tag="Mesop_0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-demethylubiquinone-9 3-methyltransferase"
                     /protein_id="WP_013891409.1"
                     /db_xref="GI:503657333"
                     /translation="MQKITTCLWFDGQAEEAMNFYVSIFKNSKVLSVMRWPEGHADEG
                     KVLVTTFELDGVPFQALNGGPQFKFNEAMSQSIDCKTQEEVDYFWEKLTEDGEPGPCS
                     WLKDKFGVSWQVVPEQLPKLLLDPDRAKAGRVMSAMMKMGKIDIATIEAAARG"
     gene            complement(181919..183511)
                     /gene="prfC"
                     /locus_tag="MESOP_RS00815"
                     /old_locus_tag="Mesop_0166"
     CDS             complement(181919..183511)
                     /gene="prfC"
                     /locus_tag="MESOP_RS00815"
                     /old_locus_tag="Mesop_0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891410.1"
                     /note="stimulates the release of release factors 1 and 2
                     from the ribosome after hydrolysis of the ester bond in
                     peptidyl-tRNA has occurred; GDP/GTP-binding protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="WP_013891410.1"
                     /db_xref="GI:503657334"
                     /translation="MAEDIEQAVSRRRTFAIIAHPDAGKTTLTEKLLLFGGAIQLAGE
                     VKAKKDRIQTRSDWMKIERERGISVVTSVMTFEYEDNVFNLLDTPGHEDFADDTYRTL
                     SAVDSAVMVIDAAKGIEPRTLKLFEVCRLRDIPIITFVNKMDRESRDPFEILDEIEQK
                     LALDTAPVTWPIGRGKTFSGTYHLALNAVRKGDDEKERTPVNGPDSNRVAGLLPENER
                     EAFIEELELAREACRPLDIEAFREGHLTPVYFGSALRNYGVRDLIEALGAFGPPPRAQ
                     EADTRTIEATEEKMTSFVFKIQANMDPNHRDRIAFVRVCSGKLERGMKAKLVRTGKPM
                     SLSAPQFFFARTRVTADEAFAGDVVGIPNHGTLRIGDTLTEGEEILFRGVPNFAPEIL
                     RRVRLGDAMKAKKLKEALHQMAEEGVVQLFSPEDGSPAIVGVVGALQLDVLKERLNFE
                     YTLPVEFEMSRFSVCRWISADDKAETLRFIEAHRGDIARDLDNDPVFLAQHAFSLNYE
                     AERWKAIRFATIKDYQVRDKAA"
     gene            183653..184729
                     /locus_tag="MESOP_RS00820"
                     /old_locus_tag="Mesop_0167"
     CDS             183653..184729
                     /locus_tag="MESOP_RS00820"
                     /old_locus_tag="Mesop_0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid oxidase"
                     /protein_id="WP_013891411.1"
                     /db_xref="GI:503657335"
                     /translation="MGAAKQVIVIGAGIIGASMAWHLTRAGARVTVIAADSAAGGVAT
                     PNSFAWINATWGNPEPYFRLRTRAMAEWSRLARDLPGLPLSWCGGLCWDLSATDMETY
                     SAQHSTWGYGIERVDRAGAARIEPNLIELPDVALHVAEEGVVEPVAATKALLADAERR
                     GAGIISSTVTALVQTGGRISGVDTSHGLLATDEVVIAAGVGSADIAATAGINLPLETP
                     PGLIVHSRPHEKLLNGLVLAERLHMRQTAEGRIIAGSDFSGADPGMDAQVTASELFAV
                     LKASLRGGDGLTLDFHTVGYRPTPIDGFPIIGRAEGMDGVYVSVMHSGITLAPAVGLF
                     AAREILDGERDSLLAPYGLARFAQ"
     gene            complement(184723..186096)
                     /locus_tag="MESOP_RS00825"
                     /old_locus_tag="Mesop_0168"
     CDS             complement(184723..186096)
                     /locus_tag="MESOP_RS00825"
                     /old_locus_tag="Mesop_0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_013891412.1"
                     /db_xref="GI:503657336"
                     /translation="MDIAFSSTVDLAMAIAARKISAVEALDAHLAQIDSHNEAVNAVV
                     SLDREGARERAKKADAALVRGEALGPLHGVPFTLKDMHETAGMKTTVGFPPFADYVAK
                     EDGPVAGRLKAAGGVLMAKTNVASMLSDWQSNNPLFGRTSNPWNLERTSGGSSGGAAA
                     AIAAGMTPFDVGTDMQDSIRLPAAFCGVYGLKPTEHRVSLAGAFPNPGDAARSVRLMS
                     CVGPLARSVDDLSLIYRIIAGSDGRDTDLAPVPVEDMPKLELKTLRIAFAPTFPGFPV
                     TDAIGSAVENIARQLQSAGATVEKANLPKLDLHDDLAQGGALIGMMMEAAQPEPPDEP
                     TPVSRWFEALARRDRSILAWNQFLEKHDALLCPVAMTTAFSHCEPGTPIKVDGKDQSY
                     WMLPAYGAVFNYSGHPALSMPCGQNSDGLPIGLQLVGRRWSESRLLGIARAMTPLTGG
                     FSRPPGY"
     gene            complement(186457..186681)
                     /locus_tag="MESOP_RS00830"
                     /old_locus_tag="Mesop_0169"
     CDS             complement(186457..186681)
                     /locus_tag="MESOP_RS00830"
                     /old_locus_tag="Mesop_0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-associated lipoprotein"
                     /protein_id="WP_013891413.1"
                     /db_xref="GI:503657337"
                     /translation="MKLVLSALLVLLVLSQAAEAKKKVAVTQDNAATAQVTRPPLDDT
                     STGGIRSAAGATATATEGQQYPPALYFNFQ"
     gene            complement(186803..187045)
                     /locus_tag="MESOP_RS00835"
                     /old_locus_tag="Mesop_0170"
     CDS             complement(186803..187045)
                     /locus_tag="MESOP_RS00835"
                     /old_locus_tag="Mesop_0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006336816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891414.1"
                     /db_xref="GI:503657338"
                     /translation="MTANASSRLTFIVFTAGCIALVLLFRYAPAGDSHSRYLKGATAV
                     VAAKPTRIDVDNEAHAIRFYIDGKQVALLDESGFRQ"
     gene            187370..188314
                     /locus_tag="MESOP_RS00840"
                     /old_locus_tag="Mesop_0171"
     CDS             187370..188314
                     /locus_tag="MESOP_RS00840"
                     /old_locus_tag="Mesop_0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163952.1"
                     /db_xref="GI:752465243"
                     /translation="MAQHIAQKLRLTSALLGTVTRKDLAAAFRSVNPKTSFDLGRADK
                     WLQGRAQPREHSVYDDWAKLLGLEQSGAWIADCDLPNFTAAIATRHNIDSADLERRAG
                     SQFETSSNHEERSLALALAGTYACYSRAWSPYYRGQFIRGILSMEPGPGSHGLTASYR
                     EILPTGQLVIGGPVTPAKRALYMHLKEVGGDAQFFVSLFPRSQPGSVLGGYMCGTAII
                     GPEAQPSLTRILMVRLRDQARGATPWGGYLLPDESISADLASVGMSIEHPEQVDRQLT
                     RFLVGGSDGGVHQIPPAEFRAILDVFDRHWLKHARQSP"
     gene            complement(188345..189145)
                     /locus_tag="MESOP_RS00845"
                     /old_locus_tag="Mesop_0172"
     CDS             complement(188345..189145)
                     /locus_tag="MESOP_RS00845"
                     /old_locus_tag="Mesop_0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_013891416.1"
                     /db_xref="GI:503657340"
                     /translation="MCRWAAYLGEAVFLEDILTAPCHSLIAQSHCAQEAKSPTNGDGF
                     GLAWYGDRPEPGLYRDILPAWSDPNLKSLCRQIKSGLFLAHVRASTGGATSRMNCHPF
                     ISGRWSFMHNGQIGGFEKIRRALENTLCDAVFDQREGTTDSELFFLLMIDEGLADDPQ
                     GAVSRAASRVLDASRRAGLEPVLKLTAAFSDGQALHAVRYATDAHAPTLYTSALRKGG
                     GRCIVSEPFDREGGDWQAIPPSSFVTMTRDGIAIRPFAPASARLALAL"
     gene            complement(189158..189406)
                     /locus_tag="MESOP_RS00850"
                     /old_locus_tag="Mesop_0173"
     CDS             complement(189158..189406)
                     /locus_tag="MESOP_RS00850"
                     /old_locus_tag="Mesop_0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891417.1"
                     /db_xref="GI:503657341"
                     /translation="MSVARIFTSHPAKVGETYFSHMAFAGWFSSRLLMAASAALVHAF
                     LPFLFETTASRIVRELYERTHNRGTHATNEPTGLLDRA"
     gene            189520..189990
                     /locus_tag="MESOP_RS00855"
                     /old_locus_tag="Mesop_0174"
     CDS             189520..189990
                     /locus_tag="MESOP_RS00855"
                     /old_locus_tag="Mesop_0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_013891418.1"
                     /db_xref="GI:503657342"
                     /translation="MALNIDEIDRKLLTELQRDGTLSVDQLSERVALSRNACWRRVKR
                     LEEDGVITGRVALVDAEKLGLGLSVFILVRTSNHDPDWLQKFRAAVTGLSEITGVYRM
                     SGDLDYVLRARVADVKAYDRLYQRLIAKVALSDVSASFVMEEIKETTVVPMEVR"
     gene            190220..190705
                     /locus_tag="MESOP_RS00860"
                     /old_locus_tag="Mesop_0175"
     CDS             190220..190705
                     /locus_tag="MESOP_RS00860"
                     /old_locus_tag="Mesop_0175"
                     /EC_number="3.6.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="WP_013891419.1"
                     /db_xref="GI:503657343"
                     /translation="MRAALQNSSVIGPTVGVVRLPHAEGLPLPAYESAGAAGMDLRAA
                     VPDDRPLLILPGKRALVPTGLILEIPEGMEGQVRPRSGLAFKHGLTVLNSPGTVDSDY
                     RGEVKVLLINLGDEDFAVTRGMRIAQLVFAAVTQVGVEERSLAGGTARGSGGFGSTGT
                     A"
     gene            190705..191364
                     /locus_tag="MESOP_RS00865"
                     /old_locus_tag="Mesop_0176"
     CDS             190705..191364
                     /locus_tag="MESOP_RS00865"
                     /old_locus_tag="Mesop_0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_013891420.1"
                     /db_xref="GI:503657344"
                     /translation="MQIPKLVIFDCDGILVDTENLANRRLAEWLTAAGYPTTFEYCRK
                     NFSGRSMVSVQKEIEAQTEVRLGADFVDRWNAGLPDLFAHGVEAIPYVREFIEAVRAA
                     GIAYCVATSARISKMHITLGQTGLLPLFEHAMFSATMVSRGKPFPDLFLHAAKTMGFP
                     PADCIVIEDSVAGTQAGIAAGMRVFSYHGDPYSDRDGLIHAGGILFDDMRELAGLVPI
                     H"
     gene            191443..192291
                     /locus_tag="MESOP_RS00870"
                     /old_locus_tag="Mesop_0177"
     CDS             191443..192291
                     /locus_tag="MESOP_RS00870"
                     /old_locus_tag="Mesop_0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891421.1"
                     /db_xref="GI:503657345"
                     /translation="MPTNLFRFIIALVLLPFSWAVAGAQAVSFPDLGSALPGRADVTY
                     LDLARMVIPDLAADKDGFYKGGSPIDMRHIEGPDDGGSPPETSGFFNAAVLAIKAGGK
                     DRLAMLFDLGDSPDSAEGYAVLALYDITAKPKLLDAANVAVDRSTYFREPNKLSIGEG
                     DDALITMSAHFNSNQNYVATPLIMVAKDRFELVDMIYTFDEKLCAYSRKQDIGFQTIA
                     DGQPYAAIKATVTDATEPSGESCDEAAPKAASHEISVTYHWDKTHYVKDSDAFEKLAA
                     ENEKRF"
     gene            192372..193172
                     /locus_tag="MESOP_RS00875"
                     /old_locus_tag="Mesop_0178"
     CDS             192372..193172
                     /locus_tag="MESOP_RS00875"
                     /old_locus_tag="Mesop_0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-methylisocitrate lyase"
                     /protein_id="WP_013891422.1"
                     /db_xref="GI:503657346"
                     /translation="MDKGKIFRDLHASTFVMPNPWDVGTTKLLGSFGFKALATTSAGF
                     AFSRGLPDGAVTFDQMIHHCRDVTAATSLPVSADLEKGKGDSAEQAAETIFAAEAAGL
                     AGCSIEDHTGDPDKPIYDFAHAVERVAAAVEAARALKRDFVFTARAENFLWGKSDLDD
                     TIKRLQAFEKAGADVLYAPGIDDVEMVRTICSAVSKPVNVMARPGFTIADLAMAGVKR
                     ISLGPWLTNFAYGMLETAAREIQQDGTFGFTRAAMPFGKLQALFRESS"
     repeat_region   193271..193375
     gene            complement(193372..194082)
                     /locus_tag="MESOP_RS00880"
                     /old_locus_tag="Mesop_0179"
     CDS             complement(193372..194082)
                     /locus_tag="MESOP_RS00880"
                     /old_locus_tag="Mesop_0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891423.1"
                     /note="role in sulfur assimilation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine biosynthesis protein"
                     /protein_id="WP_013891423.1"
                     /db_xref="GI:503657347"
                     /translation="MIFDAARTAALELLSPPFRAVFLKTLGLTLLALVALWFGLTSLV
                     EWLALPWLQTLLPGIPSWAGWLGGIIAAIALAFGMALLVAPVTAAIAGLFLDDVAEVV
                     ERTDYPADPPGRAMPALRSLVLAIKFFGVVILGNIVALLLLLVPGINIAAFFIVNGYL
                     LGREFFEFAAMRFRPEEDARALRRHHAGTVFLAGLVIAAFLAVPLLNLVTPLFAAAMM
                     VHLHKAISAREAARRSRD"
     gene            complement(194170..195072)
                     /locus_tag="MESOP_RS00885"
                     /old_locus_tag="Mesop_0180"
     CDS             complement(194170..195072)
                     /locus_tag="MESOP_RS00885"
                     /old_locus_tag="Mesop_0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013891424.1"
                     /db_xref="GI:503657348"
                     /translation="MPTRNDTTTDLALLGVLAVLWGASYTFIKIGVETIPPITFIATR
                     TLIAGAILLAIIHWRGLAMPSDAASWRRFAFQACLNSVVPFTLIAAAERSVDAGLATI
                     LNATSPIFTFLLTALITRHEPVTLRKLVGVGAGIAGICLIIGTEALGGLGHELWAQVA
                     IVVATVCYAGAAIFGRGFKGLDPMLPAAGSMLCGAVMLVPLSLVVDQPWTLTPSLASI
                     LALLGLSIFSTALAFVIYFRLIHTLGSVGTTSQAYLRVPIGVGIGAVFLGETLGPTVW
                     LGMACVVAGVAAMTIPVRKPALAR"
     gene            195296..196288
                     /locus_tag="MESOP_RS00890"
                     /old_locus_tag="Mesop_0181"
     CDS             195296..196288
                     /locus_tag="MESOP_RS00890"
                     /old_locus_tag="Mesop_0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019863480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_013891425.1"
                     /db_xref="GI:503657349"
                     /translation="MPDYDVLCIGNAIVDIIAQCEEEFLETNGIIKGAMNLIDTQRAE
                     LLYSRMGPAIEASGGSAGNTAAGVASFGGRAAFFGKVSNDALGEIYAHDIHAQGVAFD
                     TKPLKGEPPTARSMIFVTPDGERSMNTYLGACVELGPEDVEADKASGAKVTYFEGYLW
                     DPPRAKEAIRQTARLAHAAGREVSMTLSDSFCVDRYRDEFLELMRSGTVDIVFANSHE
                     IKSLYQTSSFDDALAQIRKDCRIAAVTRSEKGSVIVRGDETVVIKATAIKELVDTTGA
                     GDLYAAGFLHGYTQGRDLKTCGDLGSLAAGLVIQQIGPRPRQNLRREAEQAGLL"
     gene            196679..197365
                     /locus_tag="MESOP_RS00895"
                     /old_locus_tag="Mesop_0182"
     CDS             196679..197365
                     /locus_tag="MESOP_RS00895"
                     /old_locus_tag="Mesop_0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891426.1"
                     /db_xref="GI:503657350"
                     /translation="MNRFQTTGLGQDDFAEMVAEDVERALAHYDEAINQSTVVSVGKI
                     AGSIASAVTSLSPRHQRAIDTIHADLPGLAQKFVRALAAEAARRSEAGTAGLPVPLSA
                     GEPPSPQSDDLESMLIEDWAGRVAGSTYLEENLRIARSTLHRWQRRGDVIALRKGGRK
                     HVFPLAQFVDGRPVAGISDVLKLIGNPRLAWLWLTRPAAQLDGRIPIDLLRADQVEDV
                     VEAARVFPPG"
     gene            complement(197428..199707)
                     /locus_tag="MESOP_RS00900"
                     /old_locus_tag="Mesop_0183"
     CDS             complement(197428..199707)
                     /locus_tag="MESOP_RS00900"
                     /old_locus_tag="Mesop_0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314164.1"
                     /note="NADP-dependent; catalyzes the oxidative
                     decarboxylation of malate to form pyruvate; decarboxylates
                     oxaloacetate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malic protein NAD-binding protein"
                     /protein_id="WP_013891427.1"
                     /db_xref="GI:503657351"
                     /translation="MARKTENSGPSVSAQEALEFHAMGRPGKLEIVATKPMTTQRDLS
                     LAYSPGVAVPVRAIAEDPSRAFDYTTRGNMVAVISNGTAILGLGNLGALASKPVMEGK
                     AVLFKRFADVDSIDLEVDTEDAEEFINCVRYLGPSFGGINLEDIKAPECFIIEQRLRE
                     LMDIPVFHDDQHGTAIISSAGLINALEVTGRDMKTTRLVCNGAGAAGIACIELMKAMG
                     FAPENIILCDTKGVVYQGRTEGMNQWKSAHAVKTDRRSLAEALDGADVFLGLSAKGAL
                     TTAMVQSMAKNPIIFAMANPDPEITPEEVAEIRTDAIMATGRSDYPNQVNNVLGFPYI
                     FRGALDVRATTINDDMKIAAARALAELARQDVPDDVAAAYQGNRPRFGPNYIIPVPFD
                     PRLISAIPLAVAKAAMDSGVARKPILDLDRYAQELSARRDPIASTLQRIYDRVRRQPK
                     RIVFAEGEEEQVMRAAVSYVNQKLGTAILLGRDDVIKENAKHAGIDLNKQGIEIINAR
                     LSRRNGIYTDYLYERMQRKGFLFRDCQRLINNDRNHFAACMVALGDADGIVTGVTRNY
                     STALDDIRRVIDAKPGHRVIGVSIVLARGKTVLVADTAVHDMPNAEQIADIAEEAAGF
                     ARRMGYEPRLAMLAYSTFGHPQGERSERVQEAVRILDKRRVDFEYDGEMAADVALNAR
                     AMAQYPFIRLTGPANVLVMPAFHSASISTKMLQELGGSTVIGPLLVGLNKPVQIVSLN
                     AKDSDIVNMAAIAAYTAGT"
     gene            199919..202642
                     /locus_tag="MESOP_RS00905"
                     /old_locus_tag="Mesop_0184"
     CDS             199919..202642
                     /locus_tag="MESOP_RS00905"
                     /old_locus_tag="Mesop_0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_013891428.1"
                     /db_xref="GI:503657352"
                     /translation="MNMHSPNEPDAPEAMTPLQPGAPAVTPMMEQFIEIKAANPDSLL
                     FYRMGDFYELFFDDAEKASRALGIVLTKRGKHQGHDIPMCGVPVHAADDYLQKLIGQG
                     FRVAVCEQIEDPAEAKKRGSKSVVRRDVVRLVTPGTITEDKLLAPSESSFLMALGRVK
                     GGADHSFALAWIDISTGAFRVAETTADRLLADIFRVDPRELIVAEPVFYDAELKPVFD
                     VLGRVANPQPPSLFDSASATGRIARFFDVATPDSFGTFSRAELSAISGAIAYVEKTQK
                     AERPPLSRPEREEQGSTLFIDPATRGNLELLRTLSGNREGSLFKAIDRTVTGGGARLL
                     ADRLMAPLTDPAAIGARLDSVSFFRSETRLCQAVRTSLKSVADMPRALSRLALNRGGP
                     RDLGALRAGFEAAGAIAEIFAETALPQELADALAAIHALPQALARHLTQALGEELPLL
                     KRDGGFLRGGYHGELDEMRALRDESRKVIAGLERSLIEETGIRSLKIRHNNVLGYYIE
                     VTANHHAVMTGSDGAKARFIHRQTMANAMRFTTTELAELETKIANAADRALGIELAAF
                     DALTAEAVGEADKIRAGADALAVLDVSAALALLSESEAWCRPVVDSSLAFEISGGRHP
                     VVEQALRRSGEGPFVANDCDLSPEGNAKNGAIWLLTGPNMGGKSTFLRQNALIAILAQ
                     TGSFVPAASAHIGVVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQAGERALVILD
                     EIGRGTATFDGLSIAWAAVEYLHEKNRCRAIFATHFHEMTSLAGKLARLHNVTMRVKE
                     WENDVVFLHEVGKGAADRSYGVQVARLAGLPEAVVDRAKQVLHQLEEGEVSGKTNRLV
                     DDLPLFSVAVKREAPKPVKSDALGAALGEINPDEMTPREALEALYRLKGLM"
     gene            complement(202845..203690)
                     /locus_tag="MESOP_RS00910"
                     /old_locus_tag="Mesop_0185"
     CDS             complement(202845..203690)
                     /locus_tag="MESOP_RS00910"
                     /old_locus_tag="Mesop_0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891429.1"
                     /db_xref="GI:503657353"
                     /translation="MPSTVRTTTLPSGEAIAVLGQGTWKMGEDIRRRGDEIAALKLGL
                     DLGVTLIDTAEMYASGGAEEVVAEAIAGRRAEVFLVSKVLPSNASRAGVQRACENSLK
                     RLATDRIDLYLLHWPGSVPLAETVEAFEALKKAGKIRHWGVSNFDIEEMEDLAGLPDG
                     GNVQTNQVLYNLVRRGLEFDLAPWSRKRGIPLMAYSPVEQGALARNARLDAVAARHGA
                     TAAQIALAWVMQQEGVIAIPKASSQEHVRQNFAALDIKLIGEDLADLDRAFPPPTRKR
                     GLEMI"
     gene            complement(203776..204168)
                     /locus_tag="MESOP_RS00915"
                     /old_locus_tag="Mesop_0186"
     CDS             complement(203776..204168)
                     /locus_tag="MESOP_RS00915"
                     /old_locus_tag="Mesop_0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891430.1"
                     /db_xref="GI:503657354"
                     /translation="MTLAKKLVLLLMAAGMLLAVFLESVPAQSEEMKHDMTGMAMGAE
                     SPSTEGYKAAMDKMHAGMMASQYTGNADVDFVRGMIPHHQGAIDMAKVELANGKDPEI
                     RKLAEAVIAAQETEIKQMQDWLAAHPVK"
     gene            complement(204212..206710)
                     /locus_tag="MESOP_RS00920"
                     /old_locus_tag="Mesop_0187"
     CDS             complement(204212..206710)
                     /locus_tag="MESOP_RS00920"
                     /old_locus_tag="Mesop_0187"
                     /EC_number="3.6.3.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="WP_013891431.1"
                     /db_xref="GI:503657355"
                     /translation="MAHSDHDHHTHGGCCAPKAVDAGAVLRDPVCGMTVDPAAGKPTA
                     EHGGRLYHFCSEGCRTKFQAEPEKYLTAIDPVCGISVDRATARHFVRHEGQGFYFCSA
                     GCKAKFEAAPQAYLGDKPVPAPMPKGTQYTCPMHPEIVRDKPGSCPICGMALEPMGVP
                     TGDEGPNPELVDFTRRFWVSAALSIPLLIVAMAPMVGLSFEGLVGDRTKVWIELALAS
                     PVVLWAAFPFFHRGWESILNRSPNMWTLISLGVGAAYLYSVVATLFPDIFPHQFRGHG
                     GAVPVYFEAAAVIVALVFLGQVLELRAREKTGSAIRALLDLAPKTARRIAEDGSESDV
                     PLDGVKAGDRLRVRPGEAVPVDGTVLEGRSSIDESMITGEPLPVEKTEGDALTGGTLN
                     RQGSLIMRAERIGSETTLARIVELVAKAQRSRAPIQGLADRVSFYFVPAVVLVAVAAF
                     IAWAVLGPEPSLVFAVVSAVSVLIIACPCALGLATPMSIMTATGRGALAGVLIKEAAA
                     LERFASVDTLIVDKTGTLTEGRPKLTDIVTASGFAEDDLLGLAASLEKGSEHPLAEAI
                     VEGAAARGVTVAHVGDFEATTGKGVSGTVSGKTVALGNAAMMRDLGVDVSAVAASAEA
                     LQGDGKTAMFVAVGGRLAGIVAVADPVKATTAEAIKALHDSGLRIIMATGDNERTAKA
                     IAGSLGIDEVRAGLLPEQKAALVDELRGTSAGVAMAGDGVNDAPALAAADVGIAMGTG
                     ADVAVESAGITLVKGDLNGIVRARALAQATIRNIRQNLFFAFLYNVLGVPVAAGVLYP
                     LTGTLLSPMLAAAAMSLSSVSVIANALRLRTLKL"
     gene            206900..207745
                     /locus_tag="MESOP_RS00925"
                     /old_locus_tag="Mesop_0188"
     CDS             206900..207745
                     /locus_tag="MESOP_RS00925"
                     /old_locus_tag="Mesop_0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_013891432.1"
                     /db_xref="GI:503657356"
                     /translation="MKCLVINLDRSPDRLAHITAEFARIGIAFARIVATDARDHPELV
                     LQPQFSIYAVRRLSSSEVACMHSHRACWSIIAQDDAPYGAVFEDDVVFSAKAGALLAD
                     SGWISADADAVKLETFFSKTMIQRKRIAVGNGFSLFRLRRSHMGTGGYIVSRQMARDL
                     LEATAQASAAADDLLFNPVFPTSASKTIYQLVPALCAQDQFVGDRLPSLLYEEREAEW
                     VASGLTIKRRKPLAEKIRVEIRRVVEWVVDHCKLRHYTVIALDPPAAEEPMSCLAAGG
                     NENAL"
     gene            207956..208753
                     /locus_tag="MESOP_RS00930"
                     /old_locus_tag="Mesop_0189"
     CDS             207956..208753
                     /locus_tag="MESOP_RS00930"
                     /old_locus_tag="Mesop_0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_013891433.1"
                     /db_xref="GI:503657357"
                     /translation="MKRLVINLDRSPDRLVHMTSEFARIGIGFERVAGIDAQEHPNLV
                     QQPQHAIHAIRPLAGSEIACLHSHRACWTIIAQDDAPYGAVFEDDMVFSGRAGALLGD
                     TSWVPEDADVVKLETFFSRTVIQRRRAPAGHGFSTVRLRKGHPGAGGYLLSRQMAREF
                     LEATAQVNIAVDDLIFNPAMSAGRNIYQLVPALCAQDQFVGYRLPSLLDQERDAARTA
                     SGLMTRQRKPTAVRISREAGRTMRWIADFCRLRRQIVVPFGPIEAID"
     gene            208843..211644
                     /locus_tag="MESOP_RS00935"
                     /old_locus_tag="Mesop_0190"
     CDS             208843..211644
                     /locus_tag="MESOP_RS00935"
                     /old_locus_tag="Mesop_0190"
                     /EC_number="2.7.7.59"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862894.1"
                     /note="catalyzes the uridylylation or deuridylylation of
                     the PII nitrogen regulatory protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(protein-PII) uridylyltransferase"
                     /protein_id="WP_013891434.1"
                     /db_xref="GI:503657358"
                     /translation="MAKISLKLDELIDGETLRREMTALTAASAGDGSSPVIRAAVLQL
                     LKGRLAEGRRKAEAMLRQDGGGNACAERLSHVMDELIRALYDFAATHVYRVKNPSSAE
                     RMVVVAVGGYGRGTLAPGSDIDLLFLLPYKQTPWGEQTVEYMLYMLWDLGLKVGHATR
                     NIDECLRLSRTDITIRTSILEARFLWGERKLYDELMLRFDHEVVRTTGPEYVQAKLAE
                     RDERHAKAGESRYLVEPNVKDGKGGLRDLQTLFWIGKYFYRVRTGEELVEKGVFTDAE
                     YREFQKAEDFLWAVRCHMHFLTGKAEERLHFDIQREIAERLGYTTHPGLSAVERFMKH
                     YFLVAKDVGDLTRIFCAALEEEQAKHVPGFNRIFLTFQRRKRKLAGTSDFIVDNHRIN
                     IADDQVFERDPVNLLRLFWFADKHGLEFHPDALKLLTRSLGLVNKSLRRDEEANRLFL
                     DILTSDRNAELNLRRMNEAGLLGRLIPDFGKIVAMMQFSMYHHYTVDEHLIRCIGVLA
                     EIERGDGEKVHPLSHSLMPGLKKSREALYVAVLLHDIAKGRPEDHSEAGARIARRICP
                     HMGLSPADTETVAWLVENHLVMSMTAQTRDLNDRKTIEDFAAIVQSVERLKMLLILTV
                     CDIRGVGPGVWNGWKGQLLRTLYYETELLLTGGFSEVSRAQRTAASRERLAEALADWP
                     DKARKRYVGQHYENYLLTVDLPDQLRHAEFIRDADAAGKKLATMVKTHQFEAVTEITV
                     LAQDHPRLLSVIAGACAGAGGNIVDAQIFTTSDGRALDTILISREFDRDEDERRRAER
                     VGRLIEDVLSGKSWLPEMIEKRTKPRRGSKVFKIPPRAEIRNALSNRFSVIEVEGLDR
                     PGLLSEITRTLSDLSLDIASAHITTFGEKVIDTFYVTDLTGQKIDSPARIATIRNRLI
                     ATLEGAAPERGGRAKAAAE"
     gene            211793..213391
                     /locus_tag="MESOP_RS00940"
                     /old_locus_tag="Mesop_0191"
     CDS             211793..213391
                     /locus_tag="MESOP_RS00940"
                     /old_locus_tag="Mesop_0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter MurJ"
                     /protein_id="WP_013891435.1"
                     /db_xref="GI:503657359"
                     /translation="MSLVKKFATVASGTLMSRALGFGREMLMAAALGTGPVADAFNAA
                     FQFPNTFRRLFAEGAFNAAFVPLFAKEIETHGTDGAKRFSEEVFGVLFTALLALTIVM
                     ELAMPLIVRYLVAPGFADTPGKFETTVALATIMFPYLICMSLAAMMAGMLNSLRRYFA
                     AAIAPAFLNIILISVLGYAWYHGLDARAVGFSLSWGVLAAGIVQLAIVWVAVRNAGIS
                     IGFRRPKMTPNVKRLLILALPAAITGGITQINQLIGTAIASAQDSAVSSLAYADRVYQ
                     LPLGVVGVAVAIVLLPELSRALKSGNLIEAANLQNRSVEFTLFMTLPAAAALWVMSEP
                     IVRLVYERGAFAANHSTPTVAAILAIFGLGLPAFVLIKAFTPGYFAREDTRTPMIFAA
                     ISVAVNVATALTLFPRMGAPGIAVASAVAGWVNALMLLGVLIRRGHWGRDVPLLKRIP
                     RLVLSAAVMAVALYFAEHWLAVRLGPGSPLVVKATTLLTLVAGGALLYFVTAFATGGA
                     DFGMIRRNVGRKETPQPKEQSSDP"
     gene            complement(213366..213770)
                     /locus_tag="MESOP_RS00945"
                     /old_locus_tag="Mesop_0192"
     CDS             complement(213366..213770)
                     /locus_tag="MESOP_RS00945"
                     /old_locus_tag="Mesop_0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="WP_013891436.1"
                     /db_xref="GI:503657360"
                     /translation="MFVDAAAIVAMLSHEAEAQRCARAVLEASAPFTSAIAVWEAAMA
                     LSRSEKLAVPVEVSLKIVSRFLEERAIAVRELPPAADATSLSVEAASRFRNKAIRLNL
                     ADCFHYACARYYAVPMLSTADEFRLTDLKTVP"
     gene            complement(213770..214015)
                     /locus_tag="MESOP_RS00950"
                     /old_locus_tag="Mesop_0193"
     CDS             complement(213770..214015)
                     /locus_tag="MESOP_RS00950"
                     /old_locus_tag="Mesop_0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein transcription factor"
                     /protein_id="WP_013891437.1"
                     /db_xref="GI:503657361"
                     /translation="MTININNKEADDLTRTFARIEGVGITEAIVIAMREALERRRNRE
                     TPLETAARLRAEFGIELSEQARKPLPRSVYDELSGED"
     gene            214256..215323
                     /locus_tag="MESOP_RS00955"
                     /old_locus_tag="Mesop_0194"
     CDS             214256..215323
                     /locus_tag="MESOP_RS00955"
                     /old_locus_tag="Mesop_0194"
                     /EC_number="6.1.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="WP_013891438.1"
                     /db_xref="GI:503657362"
                     /translation="MSAFKPLVFSGVQPTGNLHLGNYLGAIKKFVALQDTSDCIYCVV
                     DLHSLTAQLVYDDLADQTRSITAAFLASGIDPKKHIVFNQSRVMQHAELAWIFNCVAR
                     IGWMNKMTQFKDKAGKDRENASLGLLAYPSLMAADILLYRATHVPVGEDQKQHLELTR
                     DIAQKFNNDFSDRIASLGVGVEMQVGDETVNGFFPITEPVIGGPAARIMSLRDGSKKM
                     SKSDPSDLSRINLTDDADTISKKIRKAKTDPEALPSEVDGLETRPEAENLVGIYAGLA
                     ELSKAEVLKEFGGQQFSVFKPALADLAVEKLAPIASEMRRIQGDRAYVDAVLRDGGER
                     AGVLAETTMKTVRDIVGLLQG"
     gene            215414..215905
                     /locus_tag="MESOP_RS00960"
                     /old_locus_tag="Mesop_0195"
     CDS             215414..215905
                     /locus_tag="MESOP_RS00960"
                     /old_locus_tag="Mesop_0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein A"
                     /protein_id="WP_013891439.1"
                     /db_xref="GI:503657363"
                     /translation="MVSKRLIREAGHRRKFLTIIDDTPECERAVAYASKRAQSTSGTL
                     VLLYVIVPDDFQHWLGVEKIMREEANATARAALDGYANKVRQKLGIEPEMVVREGKPT
                     EEIHRLIEEDQDIAILVLAAGAGKEGPGPLVGAVAGKGAAFPIPVTVVPQNLSDEEID
                     SLA"
     gene            216053..216622
                     /locus_tag="MESOP_RS00965"
                     /old_locus_tag="Mesop_0196"
     CDS             216053..216622
                     /locus_tag="MESOP_RS00965"
                     /old_locus_tag="Mesop_0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_013891440.1"
                     /db_xref="GI:503657364"
                     /translation="MFIQTESTPNPATLKFLPGKEVLLEGTADFRDADSAAVASPLAG
                     RLFEIPGVTGVFFGYDFITVTKDGPDWQHLKPAILGAIMEHFMSGAPVMAKAGPAAET
                     SQTGEFYDKADEELVITIKELLDTRVRPAVAQDGGDITFRGFENGTVFLHMKGACAGC
                     PSSTATLKHGIQNLLRHFVPEVQQVEQVA"
     gene            complement(216757..217374)
                     /locus_tag="MESOP_RS00970"
                     /old_locus_tag="Mesop_0197"
     CDS             complement(216757..217374)
                     /locus_tag="MESOP_RS00970"
                     /old_locus_tag="Mesop_0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891441.1"
                     /db_xref="GI:503657365"
                     /translation="MRMKSLAIVAAMALSTALAGCSTIGGQIFSNDYGAVTDAGYQLP
                     RIPIEKVPSKYHRQEVNYDTKEKPGTIIVDTQNKFLYFVEGDGLAIRYGIGVGREGFE
                     WHGTAHIAIKREWPTWTPPSQMIKRQPELAKFASGMEPGLKNPLGARAMYLFNKGGDM
                     GYRLHGSPEWNSIGKAMSSGCIRLMNQDVIDLYDRASVGAKVIVL"
     gene            217601..218017
                     /locus_tag="MESOP_RS00975"
                     /old_locus_tag="Mesop_0198"
     CDS             217601..218017
                     /locus_tag="MESOP_RS00975"
                     /old_locus_tag="Mesop_0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013891442.1"
                     /db_xref="GI:503657366"
                     /translation="MNVGDAANRSGLPAKTIRYYEEIGLIAPARAANGYRDYSGDDIH
                     RLAFLRRARNLGFSIDDCHQLMALYQDRSRASHDVREIAAAHVKAIEEKVRELQSMRS
                     TLQTLIHACHGDNRPDCPILDDMAGAAGDGAVSARR"
     gene            218839..219066
                     /locus_tag="MESOP_RS00980"
                     /old_locus_tag="Mesop_0200"
     CDS             218839..219066
                     /locus_tag="MESOP_RS00980"
                     /old_locus_tag="Mesop_0200"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891444.1"
                     /db_xref="GI:503657368"
                     /translation="MVRSRKAGLYLVISLFFEEQLGVFAPFRNRGLVLLNVLAEGLAQ
                     SGKVKCPKMFALIVVQRHFTNPIESMVLPPN"
     gene            219180..219680
                     /locus_tag="MESOP_RS00985"
                     /old_locus_tag="Mesop_0201"
     CDS             219180..219680
                     /locus_tag="MESOP_RS00985"
                     /old_locus_tag="Mesop_0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049802431.1"
                     /db_xref="GI:908670633"
                     /translation="MPIISPIAINPLIDGRQSERAMLVRRGVQRLLMEMGAHVLPELS
                     LATGRRADLVALTRQGDVWIIEIKSSIEDFRVDRKWPDYRLHSDRFFFATHPGVPSEI
                     FPEECGFILSDGYGAEILRDAPEHRMAAATRKALMLRIARAGASRLLAAELAGVSVPA
                     LDGESE"
     gene            complement(219695..220885)
                     /gene="nhaA"
                     /locus_tag="MESOP_RS00990"
                     /old_locus_tag="Mesop_0202"
     CDS             complement(219695..220885)
                     /gene="nhaA"
                     /locus_tag="MESOP_RS00990"
                     /old_locus_tag="Mesop_0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891446.1"
                     /note="exports sodium by using the electrochemical proton
                     gradient to allow protons into the cell; functions in
                     adaptation to high salinity and alkaline pH; activity
                     increases at higher pH; downregulated at acidic pH;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_013891446.1"
                     /db_xref="GI:503657370"
                     /translation="MQDLKQRPVSVFREFLDSEAAGGVILMVAAALALIVANSPLSET
                     YFSVLHAYLGPLSVSHWVNDGLMAVFFLLVGLEIKREMLDGQLSTWPRRVLPGVAAAG
                     GMVVPALVYVFVNRGNSAALAGWAIPTATDIAFALGVLSLLGSRVPASLKVFLTALAI
                     IDDLGAVIIIAIFYTSGLSLAYLGAAFAVIAALVVLNRMRVMTLVPYLVLGAILWVLV
                     LKSGVHATLAGVALALTIPLERSAGIGHDLDRSPLHRLEHGLHKIVPFIVIPIFGFAN
                     AGVSFAGLSLGALIEPLTLGVAAGLVLGKLVGVFGSSALAIGLGLADLPAHAGWRHMI
                     GISLLCGIGFTMSLFIGLLAFASDVALQDAVKVGILAGSFIAAILGAAVLLMAPAAGE
                     ESEE"
     gene            complement(221183..221746)
                     /locus_tag="MESOP_RS00995"
                     /old_locus_tag="Mesop_0203"
     CDS             complement(221183..221746)
                     /locus_tag="MESOP_RS00995"
                     /old_locus_tag="Mesop_0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_013891447.1"
                     /db_xref="GI:503657371"
                     /translation="MTGDENIGAMVEGEDTSLLIVDDDKPFLTRLARAMETRGFVVET
                     AESVEEAVGKARANPPAYAVVDMRLGDGNGLDVVAAIREKREDSRTIILTGYGNIATA
                     VTAVKLGAVDYLSKPADADDIFAALTRTAGERAAPPENPMSADRVRWEHIQRVYEMCE
                     RNVSETARRLNMHRRTLQRILAKRAPR"
     gene            complement(221810..223141)
                     /locus_tag="MESOP_RS01000"
                     /old_locus_tag="Mesop_0204"
     CDS             complement(221810..223141)
                     /locus_tag="MESOP_RS01000"
                     /old_locus_tag="Mesop_0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_013891448.1"
                     /db_xref="GI:503657372"
                     /translation="MAMINVLRSPDFQQSQRLRLNTLIRLRWLAIVGQSVTVLVVAYG
                     LKFPLPVSLCFALIACSAWMNLYLAFRFPAAHRLTPFAAFGILIFDSLQLAGLLYMTG
                     GLTNPFSLLMTVPVVISATSLPLRLTALLGGLVMIAATLLVFIHLPLPWHEGAPLEMP
                     FIYVAGMWMAVLSSIAFTAMYAFRVAAEARLLANALAATELVLQREQHLSALDGLAAA
                     AAHELGTPLATITLVVKEMEKALGSDPKYGEDVKLLRSQSERCREILKRLTSLSTEGE
                     AHLSRLPLTSLVEEVTAPHRDFGISIKLRPGERTGPEPVGRRNPGVIYGLGNLVENAV
                     DFARKSVTVRWSWDEAIVTFSIIDDGPGFPPEIIDRIGEPYMSTRQGNEAGGGLGLGL
                     FIAKTLLERSGATLDFRNSSGLGEGAVVQISWPRNVFLNPESAPATMFDTA"
     gene            223140..223445
                     /locus_tag="MESOP_RS01005"
     CDS             223140..223445
                     /locus_tag="MESOP_RS01005"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163954.1"
                     /db_xref="GI:752465245"
                     /translation="MDYSRKRASASSGAQSAFAIGRSPPTSSSLGEAGAKLRRGDPRI
                     HAATLDVECSGAEFWTVVTLQSPGMDPRVCAASLRSLLRPRMTKWLMFAPNFQGNPS"
     gene            complement(223475..225937)
                     /locus_tag="MESOP_RS01010"
                     /old_locus_tag="Mesop_0205"
     CDS             complement(223475..225937)
                     /locus_tag="MESOP_RS01010"
                     /old_locus_tag="Mesop_0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_013891449.1"
                     /db_xref="GI:503657373"
                     /translation="MIAEPLPQLPVSAVLPALSEALGSGNSAVLVAPPGAGKTTLVPL
                     ALLDAPWLGAGKIVLLEPRRLAARAAARRMAELLDEEPGAAVGYAMRMENRTSAKTRI
                     LVVTEGVLARMILDDPELPGVSAVIFDEFHERSLDGDFGLALALDVQGALRPDLRLLV
                     MSATLDGARVAKLLSGAPVIESEGRAFPVDIRYDERPAGIPIEDAMAKAIRNALADES
                     GSVLAFLPGQREIERTAERLSGKIGADTDIVPLYGMLDGKAQDAAIKPAQPGRRKVVL
                     ATSIAETSITIDGVRVVIDSGLSRLPRYEPASGLTRLETVRVSKASADQRAGRAGRTQ
                     AGVAIRLWRAEQTAALPAFTPPEILEADLSGLLLDCAAFGVADPATLAFLDPPPAPAL
                     NEARVLLRALHAIDEAGRLTEAGASMRKLALPVRLAHMVAEAAKSGHAGEAAMLAVLL
                     TERGLGGDGADLERRLMRFRGERSPRATAARQLAERLARQVGGTKQSEAASAGPLLIH
                     AWPDRVAKARGERGRFVLANGSGAMLDAADPLAGEPFLVVADLQGKAQNARIAAAAAI
                     GEDDIRAALADRIETRRQTSFDRERSAVRVRETVRLGAITLAERMLPPPSGADADRAI
                     LDALREHGLSLLSWNKEAETLRQRLSWLHRGLGSPWPDMSDAALIERLDDWLLPFLSG
                     AASFAAIDSAAVSAGLASLVPHDLQRKIDTLAPTHFDAPSGSHLPIRYDGEWPVLAVR
                     VQELFGLDRHPSIANGTVPLTLELLSPAHRPIQTTRDLPGFWRGSWADVRADMRGRYP
                     KHVWPENPLQAAATARAKPRGT"
     gene            complement(225985..226875)
                     /locus_tag="MESOP_RS01015"
                     /old_locus_tag="Mesop_0206"
     CDS             complement(225985..226875)
                     /locus_tag="MESOP_RS01015"
                     /old_locus_tag="Mesop_0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013891450.1"
                     /db_xref="GI:503657374"
                     /translation="MTNGILLALIAYASYSGSDAVIKSLGGQFTVFEIGFFATLFAGC
                     FLFFTRPAGERWRDFWRMKRPWAVQARAWAGIPSGVLSVYAFTHIPLAEVYALIFLAP
                     LLVTILSTVILKEKVGPWRWLAVVAGFAGVMLVVRPGFRELNLGHLAAFVVAFLAATS
                     VILMRSLAQQEKRTSMLGVLVGYGLVFNGLGAATTSFTLPNAMQLVWLALAGAFTAGG
                     QLLQLLAAKYAPANRIAPTHYSQIVWAVILGALFFQEYPDWLSLVGLAVVGGSGLLTM
                     VREEARLGTVRWNPFSRTRL"
     gene            226903..227592
                     /locus_tag="MESOP_RS01020"
                     /old_locus_tag="Mesop_0207"
     CDS             226903..227592
                     /locus_tag="MESOP_RS01020"
                     /old_locus_tag="Mesop_0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE family protein"
                     /protein_id="WP_013891451.1"
                     /db_xref="GI:503657375"
                     /translation="MKILALGAHPDDIEIFMFGTMAAYAAQGAELTFAVATDGARGGK
                     SDPVILARVRREEATAAAALLGATPRFLDFPDGELVADAALIGALKGLIREIGPDLVI
                     THAPNDYHADHRALSDGVRIAASFSVPVLHADTMGGTGFSPTHYIDISNHAEIKAQAI
                     RMHQSQDPDRFADAARTQNLFRSGQCNGEQASQAEAFRFEPIFPFGDIRALLPPAPPI
                     RTVMVSTKKVD"
     gene            227879..229210
                     /locus_tag="MESOP_RS01025"
                     /old_locus_tag="Mesop_0208"
     CDS             227879..229210
                     /locus_tag="MESOP_RS01025"
                     /old_locus_tag="Mesop_0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013891452.1"
                     /db_xref="GI:503657376"
                     /translation="MKSSFKLALGLTSAISASTAVSNAAHAEDLTLCWAAWDPANALV
                     ELSKDFTKETGIGMKFEFVPWTNYADRFLNELNSHGKLCDLIIGDSQWIGGAAENGHY
                     VKLNDFFDKEKISMDDFVPATVVGYSEWPKNTPNYWALPAMGDVVGWTYRKDWFSKPE
                     LQKEFREKYGWDLGPPATFDQLKQIAEFFQKRQIDGKTVYGASIYTERGSEGITMGAM
                     DVLYSYGFQYENPKKPYEMEGFVNSDKSVKGLEFYKALYDCCTPPGASNSYMGEGVDA
                     FKSGQVAMHMNFAFTWPGLQKDENVGGDKIGYFVNPKGPDGEQFAQLGGQGISVVSYS
                     DKQESALKYIKWFANKDVQAKWWSLGGYSCLNAVVKDPKFPASQPYAQTFLDSMAIVK
                     DFWAEPSYAPLLQASQKRFHDYVVAGQGSAKDALDGLVKDWTQVFQDDGKM"
     gene            229320..230267
                     /locus_tag="MESOP_RS01030"
                     /old_locus_tag="Mesop_0209"
     CDS             229320..230267
                     /locus_tag="MESOP_RS01030"
                     /old_locus_tag="Mesop_0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891453.1"
                     /db_xref="GI:503657377"
                     /translation="MLNRTAENVARATPEPLARKVRGISDKGLAWLFISPTILLLLAI
                     NIFPLFWAIYLSFTNYRANRPNEMVKNLGFANYQRILGDKDIWIAMQTTAHFVFWTIL
                     LQTLIGFTLAWLIDRKFRGHAFWTTLILVPMMLSPAVVGNFWRFLYEPQIGLFSYVIS
                     FVSGIPPTSIQMLSNVSLAPWSIIIVDTWMWTPYVMLICLAGLRSIPEYIYEAAEVDR
                     ASNWRQFWSITLPMALPFIMLAVLFRGIENFKMFDMVNLLTGGGPGSTTEVASITLKR
                     QAFESWRTGYSSAFAIILFVAVFGLANIYVKALNKVKQR"
     gene            230264..231214
                     /locus_tag="MESOP_RS01035"
                     /old_locus_tag="Mesop_0210"
     CDS             230264..231214
                     /locus_tag="MESOP_RS01035"
                     /old_locus_tag="Mesop_0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_013891454.1"
                     /db_xref="GI:503657378"
                     /translation="MSLTTAHSVVAPSANSKRIAGAIIIAYALISIVPLLWIFATSFK
                     TPPDSIAYPPKVLFQPSIEGYCNLFTTRTRQTPEYINSLGPATGFCDETVRKRNMVIA
                     GPSNFLPRFANSLIIAFGSTFCAVFLGTLSAYGFSRFKVPLADDLLFFILSTRFMPPI
                     AVAIPIYLMYRELGLSDTALGMILLYTAVNVSLAVWLLKGFIDEIPREYEEAAMIDGY
                     TRLQAFWRTVLPQATTGIAATAIFCLIFAWNEYAFAALLTSGTAQTAPPFIPTIIGEG
                     GQDWPAVAAGTTIFLVPILVFTILLRKQLLRGITFGAVRK"
     gene            231429..231632
                     /locus_tag="MESOP_RS01040"
                     /old_locus_tag="Mesop_0211"
     CDS             231429..231632
                     /locus_tag="MESOP_RS01040"
                     /old_locus_tag="Mesop_0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891455.1"
                     /db_xref="GI:503657379"
                     /translation="MTRLAISRKSSWPRWARRGLMENIATALIAVGFLMLFQPFALSL
                     YTYSFITMLAGTVMFIIVSKFPE"
     gene            231635..232747
                     /locus_tag="MESOP_RS01045"
                     /old_locus_tag="Mesop_0212"
     CDS             231635..232747
                     /locus_tag="MESOP_RS01045"
                     /old_locus_tag="Mesop_0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013891456.1"
                     /db_xref="GI:503657380"
                     /translation="MAEIRVQHLRKAFGDFVAVQDSNFVVEDGEFFVMLGPSGCGKTT
                     TLRMIAGLELPTGGEILLGGDDVTMLRARERDIAFVFQLFALYPHMNVRKNIGFPLLA
                     QGMPAAEIRTRVEETARLLRIDHLLNKSVSGLAGGDRQRVALGRAIVRRPKCFLMDEP
                     LGTLDTEFRDLMVHELRELHNRIHATTVYVTHDQMEAMSMADKIAVMNHGVIEQFGTP
                     REIYDRPATMFVADFIGSPPMNFLGFGGGLTKGAKEIVVQGAKIAVPEVREDIAPAEM
                     ALGIRPEHIRFDDASKLRGAIYGTEYLGTTQIVAVETADGIIKARVPAEIRLSAGDHV
                     GLTLNSARLSLFDKGSGRAVRTAVHDTASERRVQHG"
     gene            232740..233753
                     /locus_tag="MESOP_RS01050"
                     /old_locus_tag="Mesop_0213"
     CDS             232740..233753
                     /locus_tag="MESOP_RS01050"
                     /old_locus_tag="Mesop_0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013891457.1"
                     /db_xref="GI:503657381"
                     /translation="MADVHIKNVTKSFGDHVAVDGLDLHISDGEFVVLLGPTGAGKTT
                     TLRLIAGLERPDAGTIEIGGHDATTLSPAERDTAFVFQQYSLYPHLSVFDNLAFPLRS
                     PARKMPEDQIRRRVEEVAKMVRIHHKLTNRSTKLSGGEMQRVAIGRALVRKPAIYLMD
                     EPLSSLDAKLRADLRLELKRIQSELGATMLYVTHDQIEAMTMADRIGILADGVLVQIG
                     SPRTIYSEPANLHVAARLGQPAINLLPTGLLPDGGAPAGTRTIGARTEHLTIEKAMNG
                     HADGVVDWVEHLGDQNHLHVTVGPKKLVTLTDPDTDLAQGDRVVIRYRSPLYFGADGQ
                     RLM"
     gene            233828..235471
                     /locus_tag="MESOP_RS01055"
                     /old_locus_tag="Mesop_0214"
     CDS             233828..235471
                     /locus_tag="MESOP_RS01055"
                     /old_locus_tag="Mesop_0214"
                     /EC_number="2.7.1.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase"
                     /protein_id="WP_013891458.1"
                     /db_xref="GI:503657382"
                     /translation="MKHFFNRRETIVTEALDGLLRTIGSGDLARLDGYPEIKVVLRAD
                     WDKSKVSVVSGGGAGHEPSHAGFVGKGMLTAAVSGEIFASPSVEAVLAAIRAVTGPAG
                     CLLIVKNYTGDRLNFGLAAEKARAEGFRVEMVIVADDIALPDIAQPRGVAGTLFVHKI
                     AGHLSESGQDLATVAEAARAAAKDIVSLGMSLSSCSIPGQPHEDRFGENDGELGLGIH
                     GEPGVERIAVQSADRLVAIMAERLAVRLDPKESYALLINNLGSVPPLEMSVIANAVLA
                     SPLGKAVKLTVGPGPLMTALNMNGFSLSLIRLDAARETALLAPVGPHAWMPAKPAAAP
                     AVVPMAKAAGQSAAYKASQDAGTRRVIVTVCERLISLEATLNGLDAKAGDGDTGSTVA
                     TGARSILERLDSLPLADPAATLGAIGDVLSASMGGSSGVLLSIFFTAAAQALDGGADV
                     AKALLAGLERMTFYGGAQLGDRTMVDALEPALKALDANGLEEAAAAARRGAETTAAMA
                     KAKAGRSAYVGSQLQGVADPGAHAVAEVFAAAATLLVAA"
     gene            235544..236146
                     /locus_tag="MESOP_RS01060"
                     /old_locus_tag="Mesop_0215"
     CDS             235544..236146
                     /locus_tag="MESOP_RS01060"
                     /old_locus_tag="Mesop_0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase"
                     /protein_id="WP_013891459.1"
                     /db_xref="GI:503657383"
                     /translation="MAALNLARLIAAAADTIAAHAEELTALDQAIGDGDHGLNMKRGF
                     EAVRAEADAFAAKPLPDALKAIGTKLVMTVGGASGPLFGTLFMALGKEISAEPDRANL
                     TAAFGRAIEAVAARGKSQVGQKTMLDVLQPVHDALAGGKTAAEITDIADAAAEATVPM
                     KAQRGRASFLGDRSIGHMDPGARSTALLVRTVGQAIGESA"
     gene            236143..236532
                     /locus_tag="MESOP_RS01065"
                     /old_locus_tag="Mesop_0216"
     CDS             236143..236532
                     /locus_tag="MESOP_RS01065"
                     /old_locus_tag="Mesop_0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006206912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS mannose transporter subunit IID"
                     /protein_id="WP_006325214.1"
                     /db_xref="GI:493368876"
                     /translation="MSNVGIVIVSHSPLVAEGTADMVRQMVGDEVPLAWCGGNGHGGL
                     GTNVEAIMGAIDKAWSEAGVAILVDLGGAETNSEMAVEMIGEPRAQKIIVCNAPIVEG
                     AVMAATEASGGASLREVVATAHELSPS"
     gene            236555..236857
                     /locus_tag="MESOP_RS01070"
                     /old_locus_tag="Mesop_0217"
     CDS             236555..236857
                     /locus_tag="MESOP_RS01070"
                     /old_locus_tag="Mesop_0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphocarrier protein HPr"
                     /protein_id="WP_013891460.1"
                     /db_xref="GI:503657384"
                     /translation="MSAAAEATVLITHDVGLHARPSVKFTKLAKTFAADVEIALAANG
                     PWFDAKSIVKVMAAKAPKGTVLHIRARGDGANDAVDALVELVRRDFDEGAGHVRSA"
     gene            236871..238472
                     /locus_tag="MESOP_RS01075"
                     /old_locus_tag="Mesop_0218"
     CDS             236871..238472
                     /locus_tag="MESOP_RS01075"
                     /old_locus_tag="Mesop_0218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate-protein phosphotransferase"
                     /protein_id="WP_041164460.1"
                     /db_xref="GI:752465751"
                     /translation="MRRPAGMRAMRIEGVPASAGYAEGPLFELDRPPAVYASKATPEE
                     EKTSLREAIGKAVSRLMAMVETADSDAAGVLEFHIAMLEDDALSGPAFASIDSGRTAD
                     AAWRQALDGEIAGYEASDQDYFRARAGDLRDIRDQVLHALTDDGGSAAPAGAILYGED
                     IAPTRFLETDWSSGGGIALRAGSTASHVAMLARSRGVPMVVSLREPPAGLAGMALLDA
                     EHGNIVLAPSPAEIGSFRQSSSSFAARQGKAQTFLARPALTKAGTAVRVQVNIADPSD
                     VDAIDIATCDGVGLMRTEFLFGKTLPDEETQYRVYRKVLEWAGDKPVTIRTVDAGGDK
                     PVPGFTVEEGNPFLGLRGIRLSLARLDIFRVQIRALLRAAPHGNLRVMFPMIATAEEY
                     ERAAALFTEEQAALTARGTAQRMPPLGIMVEVPSVAIAPEAFANAAFFSIGSNDLTQY
                     VMAAARDNAAVAHLNSVRHPAVLRLIGSVTAFGRDNGIPVSLCGDAGGDPTLIPALLE
                     AGLRDLSVAPAQLAMAKAAIADISV"
     gene            238484..238909
                     /locus_tag="MESOP_RS01080"
                     /old_locus_tag="Mesop_0219"
     CDS             238484..238909
                     /locus_tag="MESOP_RS01080"
                     /old_locus_tag="Mesop_0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891462.1"
                     /db_xref="GI:503657386"
                     /translation="MVDKTPEPGSEEAIRAYKTILSHVIDQRPSGMRQRLADALGKHR
                     SFVTQISSPTYSIPIPSKHLPAIFSVCHFSPAERDQFLAAYHQAHPGKMSVAAGMRKT
                     RHVSLVVPDFGDDKQNAALDRAVNDFIQKITSITGKGGG"
     gene            238941..239927
                     /locus_tag="MESOP_RS01085"
                     /old_locus_tag="Mesop_0220"
     CDS             238941..239927
                     /locus_tag="MESOP_RS01085"
                     /old_locus_tag="Mesop_0220"
                     /EC_number="2.7.1.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase"
                     /protein_id="WP_013891463.1"
                     /db_xref="GI:503657387"
                     /translation="MKKFMNSVDTVLTESLDGFVAAHADILTLGEEHKFIRRRTLRPG
                     KVALISGGGSGHEPLHGGFVGHGMLDAACPGQVFTSPTPDQMLAAAQAVDTGAGCLFI
                     VKNYEGDVMNFDMAAEMSDGILQVVTNDDVAVENSSYTTGRRGVAGTLVVEKIVGAAA
                     EHDMALPALKVLGERVNAATRSMGVALTSGTVPAAGKPTFDIGDGEMEFGVGIHGEPG
                     RRRDTLKSADAIAEEICAAILGDLGDKAKGPALLFVNGFGGTPLMELYLMYNSARRIF
                     EKHGVTITRSLVGTYVTSLDMAGCSVTLTMLDDEMTGWWDAPVHTAALRWGM"
     gene            239990..241012
                     /locus_tag="MESOP_RS01090"
                     /old_locus_tag="Mesop_0221"
     CDS             239990..241012
                     /locus_tag="MESOP_RS01090"
                     /old_locus_tag="Mesop_0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891464.1"
                     /db_xref="GI:503657388"
                     /translation="MLPFLNSAEEKLLLRFADPEAAAVEDDLSAKALSALLDNAEFHG
                     VLPIMLRKLHERGNAHLTSDANVQSKLHELRQKAPIATGQSMLLNYHGGRIMKVLAAE
                     GIPARIVKGPVFAGKLYRHVTDRPFTDIDILVEPANLARANRVIASCGFELGSNEAES
                     YQLQEFKWLEKGNSSLLVELHGDLVHDTGMRRRLSLGFRELQVIDGEAIDTPAALLTI
                     AIVHAAGGHKFHRLQLCVDVLQGVRALQSPDAEARLLDAARMTGIELELAIVLNVTGE
                     LFGERRALELAGRIKPDLSIRLAKRLITTNTLLRVNSREKIGSRLRRDAFRWIQRLAK
                     ARPYPA"
     gene            complement(241022..242002)
                     /locus_tag="MESOP_RS01095"
                     /old_locus_tag="Mesop_0222"
     CDS             complement(241022..242002)
                     /locus_tag="MESOP_RS01095"
                     /old_locus_tag="Mesop_0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HPr kinase"
                     /protein_id="WP_013891465.1"
                     /db_xref="GI:503657389"
                     /translation="MRSACYGLNGQILGISAERPDLWEDFDRMLGVLRITDPVEPGFR
                     LDITEADVLDETPGGSLVFDGEIPEDGHCRMIADGATIHLVFPGRQTVAINDEEAWAK
                     LRIRPGTKAAWTPSMLVLDAALDAGGQHMLHTAGLTLPGRDAVVLIHAPSGTGKTTTS
                     LALATQGFGLCSDDAMILDLTSGKPVAWGLPRHVKIHQITAEMIPQVAPCLGPSWDRN
                     GEQAVSLERLSEIVRIESPVARPVAALLHLARSADRQTRLVAMARTDAMVALAMDNVR
                     TGMTGLLPLQKRRLATIGKLVSSVPTFTLEVGARPADAAALINAILARQD"
     gene            complement(242005..242439)
                     /locus_tag="MESOP_RS01100"
                     /old_locus_tag="Mesop_0223"
     CDS             complement(242005..242439)
                     /locus_tag="MESOP_RS01100"
                     /old_locus_tag="Mesop_0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891466.1"
                     /db_xref="GI:503657390"
                     /translation="MAAGPLLRALFRCHLWASARLMPILIANRSFEQVLKWAPLASST
                     PYRGLPVAYIVARVSRTVRHPWLMRDRRCLREGLLGHRFLRLAGFDPELRFGVDPKSL
                     QAPHLSAHCWVCLDGRPVVSDRLPGMVEIYRHNADPTKVRVA"
     gene            complement(242473..242760)
                     /locus_tag="MESOP_RS01105"
                     /old_locus_tag="Mesop_0224"
     CDS             complement(242473..242760)
                     /locus_tag="MESOP_RS01105"
                     /old_locus_tag="Mesop_0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041164461.1"
                     /db_xref="GI:752465752"
                     /translation="MMEIASGTVLRLAEDASVQHVGDGAVVLLARSGQLYTCNGTTEA
                     FLDKVDGARSLDQIVGLLCEEFEVDKGTLDEDMAALATELVSEGILAAPAA"
     gene            complement(243199..244029)
                     /locus_tag="MESOP_RS01110"
                     /old_locus_tag="Mesop_0225"
     CDS             complement(243199..244029)
                     /locus_tag="MESOP_RS01110"
                     /old_locus_tag="Mesop_0225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891468.1"
                     /db_xref="GI:503657392"
                     /translation="MRHRWSIAAWPLITLAIGTAIMVSAGVARAGDAAARRIIGFSAD
                     GAYFAFEQYGTLDAGASDSGYSEIDIIDTRTDQFVGGKPILVVDETEESTLTLEQARA
                     QAAAKAAPILAKYAIASRGTQTASDQFTFPGEIVGYNDISRLEQVSQKWLSPLYDETE
                     VSTIRLDEILADSAIDCSASFNDTQHGDQALQGDKTGKALGFRLALQGQDGKPFKTLH
                     EDKAVPGSRNCPTSYSLSESYEFTPVGKPAVIVVLVQRFSQGFEGRDRRFIAVTGQPR
                     "
     gene            244185..246092
                     /gene="prpE"
                     /locus_tag="MESOP_RS01115"
                     /old_locus_tag="Mesop_0226"
                     /gene_synonym="yahU"
     CDS             244185..246092
                     /gene="prpE"
                     /locus_tag="MESOP_RS01115"
                     /old_locus_tag="Mesop_0226"
                     /gene_synonym="yahU"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862858.1"
                     /note="catalyzes the formation of propionyl-CoA using
                     propionate as a substrate; PrpE from Ralstonia
                     solanacearum can produce acetyl-, propionyl-, butyryl- and
                     acrylyl-coenzyme A, and Salmonella enterica produces
                     propionyl- and butyryl-coenzyme A; not expressed in
                     Escherichia coli when grown on propionate/minimal media;
                     ATP-dependent; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="WP_013891469.1"
                     /db_xref="GI:503657393"
                     /translation="MASRYHEVYDGWRRDPEKFWADAASAIDWYSPWDKVFDATAGVY
                     GRWFTGATCNTCYNAIDRHVAGGRADQIALIHDSAITGTVKKFTYAELKREVVALTSV
                     LKNRGVGKGDRVIIYMPMVAEAAIAMLACARIGAVHSVVFGGFASHELATRIDDARPK
                     LIISASCGLEPGRIVAYKPLLDKAIEMSRHKPEACLILKRDQLRCELRDHFDIDYADA
                     VARERAAGANVDCVPVLATDPLYIIYTSGTTGQPKGIVRDNGGHMVALKWTMENEFGV
                     KPGEVFWAASDVGWVVGHSYIVYGPLLHGCTSILFEGKPIGTPDAGTYWRVIAEHGVV
                     ALFTAPTAFRAIKGQDPKGEFVAKYDLSKFRTLFLAGERADPETIKWAEQKLNVPVVD
                     HWWQTETGSPMTINPAGLGLLPVKYGSPGVPMPGYDIRVLDDAGHEVARGTLGNVVVK
                     LPLPAGCLPTLWHADQRFRQAYLDEFPGFYKTADAGMIDEDGYLYVMARTDDIINVAG
                     HRLSTGAMEEVLAAHPDVAECAVVGIADAMKGQIPLGFVVLNAGVARDGGTIEKEVVA
                     LVRERIGPVAAFKTVVTIKRLPKTRSGKILRGTMQKIADKEEWTMPATIDDPVILDEI
                     AAAMKERGIGV"
     gene            246219..247301
                     /locus_tag="MESOP_RS01120"
                     /old_locus_tag="Mesop_0227"
     CDS             246219..247301
                     /locus_tag="MESOP_RS01120"
                     /old_locus_tag="Mesop_0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_013891470.1"
                     /db_xref="GI:503657394"
                     /translation="MAQQKITFGGVDILRFLAAVLVMVYHYGFWVWAYPDGISAQATG
                     GVPQQPAIGAWVESGWVGVEIFFVISGFVIAFSAENSTPLRFFEARVKRLAPAVWICA
                     PVAAVLLLAIGLSWPTDAVVRLVRTGLFAPYGPWVDSVYWTLGIEIAFYAIVWVLLRL
                     GRFHLMEAVAIAIGLVSTLFWCLYYPLGWSDFAETRWLQLVLVHHGCFFAVGVLLWLM
                     RFKALTPSRLGFCLLFLGGGVLQIASSVDVHSIKVGAVMPYAPPILIFLVAIALMALS
                     LRLQLSWTGWRRIGLMTYPLYLIHDVIGAAMLGSMVRAGLPYLLSMVTVAATMIAASW
                     LVATEAEPRVRQLLDYTVFRYRLKAA"
     gene            complement(247841..250231)
                     /locus_tag="MESOP_RS01125"
                     /old_locus_tag="Mesop_0229"
     CDS             complement(247841..250231)
                     /locus_tag="MESOP_RS01125"
                     /old_locus_tag="Mesop_0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chain-length determining protein"
                     /protein_id="WP_013891472.1"
                     /db_xref="GI:503657396"
                     /translation="MNYANFPLDKRMPLPNSDAGDGEDFIDIERLLGMAARQAKVVAV
                     CAVIGLFLGLLYIQTTPPKYVSVASVLIDEGLNKIVDDISAASTTMQTDSAILSQIEI
                     LTSTRLAAVVVDKLKLDQNDAFMNPPQSALAQGVGLIRGLIQYVRPSPVMPGVGDVSQ
                     LSPAARDALIATSRRDYAILKLQNEIQADRVGRSYVIALGYQATDPGLATAITKAYAD
                     AYLADQLDASFDATERAAVWLQGRLTELRESSQQASLAVEKFRAEHGLSANSDGQLMS
                     DKQLADLNAQLIVAQADTARASARYQQYKSIVDSGSENAFKDAAISSDQPSGALISAL
                     KTRYLAVSKRQQDVEANFGAQHPQAVALAKEKADISAQIFGELKQLTQNYRNEYEVAQ
                     ARETALRANVAAAQGKSSIDNQSQVKLRDLDQKATALSTLYQTFLGRYEEAAQQQSFP
                     VGKIRIISDASTPLSASSPRTIIVLGLSLVLGMLMGAGFGGLNEFNERFFRTGEEVRD
                     RVGLKFLGYLPTIGSKAVTKEDKAVDGQLDAKVARSPAAIERRARMRVSIDAPASMFS
                     ETLRSAKIAFDVVMEGQGSRVIGVISVLPGEGKSTVAANLAGLLAANGAKTLLIDGDL
                     RNPGLSRSLGMEAEQGLMEAVVNGQTWQSVGKIDRQTKLAIIPAVSRGHFSHTSELLS
                     SAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSM
                     LESEPYVANKIVGAVLNKVDLKRLAKYGSFGASEKFFDKYSNYYLDKSEVRTKATV"
     gene            complement(250464..251360)
                     /locus_tag="MESOP_RS01130"
                     /old_locus_tag="Mesop_0230"
     CDS             complement(250464..251360)
                     /locus_tag="MESOP_RS01130"
                     /old_locus_tag="Mesop_0230"
                     /EC_number="2.7.7.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006205242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="WP_013891473.1"
                     /db_xref="GI:503657397"
                     /translation="MKKIRKAVIPVAGLGTRFLPATKSMPKEMLPVVDRPVVQYAVDE
                     AFEAGIEHIVFVTGRNKAVIEDYFDLHPELIGTLEQTGKKTQLEALESMLPVAGATSF
                     IRQQSPQGLGHAVWCAREVIGNEPFALLLPDMVSFGRRGCLAETVDLYERTGGNVIAV
                     ERCDPSETNKYGIVGRGADIGGGFEVSAMVEKPAPANAPSNFYINGRYILQPEIFALL
                     GNQQRGAGNEIQLTDAMVRLSKDQPFFAQPFLGRMFDCGSKEGFIQANIAFALARDDM
                     KGPVFEMLQEFVQSHERQEEAA"
     gene            complement(251435..252400)
                     /locus_tag="MESOP_RS01135"
                     /old_locus_tag="Mesop_0231"
     CDS             complement(251435..252400)
                     /locus_tag="MESOP_RS01135"
                     /old_locus_tag="Mesop_0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_041164463.1"
                     /db_xref="GI:752465754"
                     /translation="MPNVSFVPDVSFIIAAYNAEATLDRAIASALAQRDVSVEIIVVD
                     DKSRDATLDVARAYPQDIVRVVALAQNRGPGGARNAGLDVARGRWVAVLDSDDAVFPG
                     RMAAMIGRAEKANAQIAVDNLQVVREDGVVEDAMFPRQYLERLGEISLATYIAGNVVF
                     ESKFNLGYLKPIFQRRFLDENRLRYDEKLRIGEDYILFADALAKGGRCVVEPDIGYAY
                     HILSGSISRVLELHHVEAMREADAKFAQTHRMDEAALAAFARRGRSLRKAASFLAMVQ
                     HIKARSPFKAIRMALSDPAAVRHMGMPIAVRLRRVAAQFAVGVGR"
     gene            complement(252411..253361)
                     /locus_tag="MESOP_RS01140"
                     /old_locus_tag="Mesop_0232"
     CDS             complement(252411..253361)
                     /locus_tag="MESOP_RS01140"
                     /old_locus_tag="Mesop_0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family A"
                     /protein_id="WP_013891475.1"
                     /db_xref="GI:503657399"
                     /translation="MAVQAKNRSIDIGVCTFRRPELADTLRSLAAMDMPRGFDVGIIV
                     ADNDDTPSARELVTALSRELSVPVRYRHCPARNISIARNACLDASEADFLAFIDDDET
                     ATARWLAELVATAETSGAAAILGPVRALYRPDAPDWMRRGDFHSTLPVWVQGEIRTGY
                     TCNVLLRVGADSLRGRRFSLARGQTGGEDTEYFDQMHKAGGRIAFSPDAWVNEVVPRT
                     RAAFDWLGRRRFRVGQTHGHLLGHNAGGIGLVKQVGLASVKALYCFAAALPVVASPVR
                     RNRSVLRGIMHVGVVSGLVGIREIRLYGQPSPREGGKRAA"
     gene            complement(253361..254350)
                     /locus_tag="MESOP_RS01145"
                     /old_locus_tag="Mesop_0233"
     CDS             complement(253361..254350)
                     /locus_tag="MESOP_RS01145"
                     /old_locus_tag="Mesop_0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinoglycan biosynthesis protein exoa"
                     /protein_id="WP_013891476.1"
                     /db_xref="GI:503657400"
                     /translation="MTQALPSSLIVIPCLNEAAHIGALLDQLRPSAERLGARIVVADG
                     GSTDGTLAIVEDVAARDARVILLHNQRRIQSAAINLAVGTYGEGAQYLIRIDAHGGYP
                     DDYCDRLVEEALATGADSVVVSMLTSGSGPVQKAAAAAQNSKLGTGGSKHRHLSAGEW
                     IDHGHHALMRISAFGAVGGYDETFSHNEDAELDYRLRQAGYRIWMSGKTQMVYYPRTS
                     LKGLYFQYLGYGRGRAKNVLKHRVIPKVRQMVPLAVFPVVLLAAFSFVHWIAAVPLLV
                     WASVCLGYGLVAAIRQRKADVALAGVSAMVMHLGWSVGFWLQLLGLGSRRGVA"
     gene            complement(254366..255538)
                     /locus_tag="MESOP_RS01150"
                     /old_locus_tag="Mesop_0234"
     CDS             complement(254366..255538)
                     /locus_tag="MESOP_RS01150"
                     /old_locus_tag="Mesop_0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_013891477.1"
                     /db_xref="GI:503657401"
                     /translation="MLHVLYLVHDVSDPAVRRRITMLRTGGARVTLAGFRRTTTPIAD
                     IEGLRPIDLGATRDGRFAQRLAAVAKAAVSLRAKLSGTPRPDLIIARNLEMLALAGRA
                     RSAFGATVPIVYECLDIHRLVLRNDVLGKALRATERHLARDVKLLVTSSPAFIANYFK
                     PFRQVAAPIELVENKYFETAAILPGARQVAETPAAPPWRIGWFGALRCRRSLELLADF
                     TRRMDGRFEVVLRGRPALSEFPDFHAFVEAEPHLSFRGPYRNPEDMASIYQDVHFSWA
                     IDFFEEGQNSEWLLPNRLYEGCRFGAVPISMGHTETGRFLSQQDIGILLPQATPDALE
                     SALGQMEEHRFDRLKARVLAQNPRMWSYDRSDCRVLVEKLRRLTIVREPLAAEALA"
     gene            255723..257219
                     /locus_tag="MESOP_RS01155"
                     /old_locus_tag="Mesop_0235"
     CDS             255723..257219
                     /locus_tag="MESOP_RS01155"
                     /old_locus_tag="Mesop_0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="WP_013891478.1"
                     /db_xref="GI:503657402"
                     /translation="MEANPFDPPEGSLRKSVGRGAVVTAMSQSVRVATQIISVIVLSR
                     LLSPQDFGVVAMCAPVLAFIALFQDFGLTQATIQKSCIRHEEVNYLFWINVAVSAILA
                     CVLAGAAPLVAAFYSEPRVAGLVAAFGLQIMAYGLGAQHLALLTRRMQFGRLAIIDVA
                     SAVAGLAVSIAWTFIDRSYWALFAGTLTGAVLPTLCYWASSRWRPGLPRKVAGIGELI
                     NFGAGITGFNFANFFARNLDNVLIGKYWGEAQLGLYDRAYKLLLFPLSQITNPLSKVM
                     VPALSRLKDEPDRYRSAYLRVMPLILLVALPGVAFATAMSDELIPFVLGEQWRASASI
                     FLALGFAGLLQPLNNPAGWLFVSQGRSGDFMRWGIITAVTSVLAFALGLPYGALGVAV
                     AYAVSEYLRTPFLWLYVGRSGPLRASHVLRAATPFVLGAHLALAAVWLAKPLLPQQHV
                     VALAGGAILAYAITIVVALAFAAGREALREAVKMLPARPPTAAPRQAQ"
     gene            257274..258296
                     /locus_tag="MESOP_RS01160"
                     /old_locus_tag="Mesop_0236"
     CDS             257274..258296
                     /locus_tag="MESOP_RS01160"
                     /old_locus_tag="Mesop_0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="WP_013891479.1"
                     /db_xref="GI:503657403"
                     /translation="MHYRSISDMNDAIVSNLHRLPRDIDLVVGVPRSGVLAATLVSLA
                     ANIPMTDLDSFLDGRVYTSGITKRRAALDRKVSDMRKVLVIDDSVSGGNAMRDARARI
                     QAAGIEADYTFAAVFGLQPQHQETDIVFEVVPHPRMFQWNFMHHKFLAQCCVDIDGVL
                     CLDPTEAENDDGPAYEKFLSEARPLHAPTHRIGWLVTSRLEKYRALTEAWLAKNGIQY
                     DQLVMLDLPSKAERQRLGAHGSFKADFYRKSDAMLFIESEHAQALKITELSGKPVLCV
                     ETHIVSFPDALSLPALGQAARNLPARLRQVNSQEGRKGVAKTLARALLGARGYETLKS
                     RVKRPA"
     gene            complement(258332..259411)
                     /locus_tag="MESOP_RS01165"
                     /old_locus_tag="Mesop_0237"
     CDS             complement(258332..259411)
                     /locus_tag="MESOP_RS01165"
                     /old_locus_tag="Mesop_0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_013891480.1"
                     /db_xref="GI:503657404"
                     /translation="MKVLFAGGNGYTPEFSGGVQSSTHHLAEQLIENGHEASVLAALF
                     GDGVFGFKARAKMKLLRQPAVVDSFPGYPVVRAWFPWEAASFAVDRVKPDVAVVQCHK
                     SVPIGKALQAKGVPLVVYLRNVEFHELGGDLRELRSALYIANSEFTARTYRREFGIET
                     TVIPPTINPTQYSTPTTGQFVTLINPYEEKGFELAVRLAGACPEIPFLFVESWKLDDD
                     HRASIEETIAPLGNVTLESRTSDMKTVYGRTRILLAPSKWEEAWGRVASEAHCSGIPV
                     VGSRRGGLPEAIGPGGVVLDYDSPLVDWVAAVRRLWNDNQEYDRVSSLARSFAARPEL
                     DPDRQFVTFFSILDKAIQQRALQAA"
     gene            complement(259478..259927)
                     /locus_tag="MESOP_RS01170"
                     /old_locus_tag="Mesop_0238"
     CDS             complement(259478..259927)
                     /locus_tag="MESOP_RS01170"
                     /old_locus_tag="Mesop_0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891481.1"
                     /db_xref="GI:503657405"
                     /translation="MIEVSRRSALAIVAGGVVSTGVAYAAVSSFSDEDLVRVTLEKYL
                     GRLNMRIEHLQQFALEFRNRNPWIFPSAKLSDAVTLVEELKLGAVRRLLPQEKREDLT
                     HFDRWVIAEFHMLTDYAWRSSPDDPIRFTGWQSCTNPFANLEPPKLA"
     gene            complement(259941..261383)
                     /locus_tag="MESOP_RS01175"
                     /old_locus_tag="Mesop_0239"
     CDS             complement(259941..261383)
                     /locus_tag="MESOP_RS01175"
                     /old_locus_tag="Mesop_0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-gluconate dehydrogenase subunit"
                     /protein_id="WP_013891482.1"
                     /db_xref="GI:503657406"
                     /translation="MVLDVKPEQITRDHFDLVAIGSGFGSAFFLHEFAKRRKARILVL
                     EWGRHNTHEWQLNQNANTDIEDETTYKTNSDKPWNYTIGLGGGTNCWFAQTPRFHPND
                     FRLKSTYGIGNDWPISYDDVEPFYCDAEDIMSISGDPDMATMLPRSKPFPQPPHRMST
                     PDKMMKAAQPGQHFVMPTARARVPTSQRTSCCANLRCWLCPVDAKFTANNGLMHVFEH
                     PDISVCLGSEVRRLDHVGGTVRSVTFVHDGKEYQVSGDLFILGANAIQSAAIMLRSGL
                     GDEFVGRGLHESYGWNFEVYLDGVDNFDGSTITTGLNFGLYDGPHRSEHAAALVYFEN
                     RWQHGMRAEKGRLRQALPLVVVTENLLDHENFVTLDEDDNAFVSFKAPSDYAVKGMAR
                     ALEKLPGLLAPLPVEGLFDRGIRPTESHVQGTLRMGTGPADSVVDSGMIHHRLRNLVV
                     VGTSTYPSCSCANPSLTAAALSLRAAGRIA"
     gene            complement(261460..262791)
                     /locus_tag="MESOP_RS01180"
                     /old_locus_tag="Mesop_0240"
     CDS             complement(261460..262791)
                     /locus_tag="MESOP_RS01180"
                     /old_locus_tag="Mesop_0240"
                     /EC_number="1.1.1.22"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006205252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 6-dehydrogenase"
                     /protein_id="WP_013891483.1"
                     /db_xref="GI:503657407"
                     /translation="MNLTVFGIGYVGLVQAAVLAEVGHQVVCVDVDANKVERLNQGLV
                     PIFEPGLESIVKENHAAGRIKFTTDAAAAVRHGEIQMIAVGTPPGEDGSADLKYVLAV
                     AETIGREMETPKIVVGKSTVPVGTCEKVKARIAETLKKRGREDLAFDVASNPEFLKEG
                     SAVADCMKPDRIIVGTNSEATEAVMRELYAPFNRNHEKMIVMDVRSAEFTKYAANCML
                     ATKISFMNEMANLAEQLGADIEEVRKGIGSDPRIGYHFIYPGLGYGGSCFPKDVRALI
                     KTAEGVKFDAKLLRAVEERNNEQKSVLFDKVNRYFKGNLKGKTFALWGLAFKPNTDDM
                     REAPARTLMEALWQAGARVQAYDPEAMQECQAIYGLRDDLLLCGTKEAALRGADALLI
                     ATEWKSFRAPSFDAVKDALTTPVIFDGRNLYDPKVIARHGIEYHSIGRMAA"
     gene            complement(262841..263713)
                     /locus_tag="MESOP_RS01185"
                     /old_locus_tag="Mesop_0241"
     CDS             complement(262841..263713)
                     /locus_tag="MESOP_RS01185"
                     /old_locus_tag="Mesop_0241"
                     /EC_number="3.2.1.73"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endo-1,3-beta-glucanase"
                     /protein_id="WP_013891484.1"
                     /db_xref="GI:503657408"
                     /translation="MNSDPKTTSKAAVGAHQAGQAGWRRLAWLGASLLLVALGSLSTI
                     PSHAQDIQSSPSFVDDFKSLDRSRWYVSDGWTNGSHQNCTWSKGQVSLSEGTLSLGFE
                     KQKTKDREFACGEIQTKQRFGYGTYEARMKTDAGPGLNAAFFSYIGPSDKQPWDEIDF
                     EILTKDTSKVQVNAYIAGKGKNEKLVEVPGGTDKAFNDYAFVWEKDSLRWYVNGQLVN
                     TITDPAKLPSHAQKIFFSLWGSDTMKGWMGAFADPGRKLSLQIERVAFTALGEPCQFP
                     ESLVCSVKELGKTN"
     gene            complement(263862..264263)
                     /locus_tag="MESOP_RS01190"
                     /old_locus_tag="Mesop_0242"
     CDS             complement(263862..264263)
                     /locus_tag="MESOP_RS01190"
                     /old_locus_tag="Mesop_0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891485.1"
                     /db_xref="GI:503657409"
                     /translation="MASIFGFRSRDPARDRQTDIARFDRLAKLFEQIAAEIEAERTGL
                     ESRYRKTSTNAAFLVEAMENDPASDRRSSEVSALTTSILNCERRIAALSRQDGKMKDL
                     RHALDMVFDENGAPDPAATVEFNKPAGAGRG"
     gene            complement(264552..265568)
                     /locus_tag="MESOP_RS01195"
                     /old_locus_tag="Mesop_0243"
     CDS             complement(264552..265568)
                     /locus_tag="MESOP_RS01195"
                     /old_locus_tag="Mesop_0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family A"
                     /protein_id="WP_041164465.1"
                     /db_xref="GI:752465756"
                     /translation="MTKSEVCVIIAAKNAARTIAVAIASALREPEVAEVVVVDDGSTD
                     NTAEVAVSADDGSGRLMVMRLDVNRGPSFARNAAIAGSKAPFISILDADDFFLEGRFR
                     NLFAGADWDFAADNIMLIRDDATKDATTIVAPDFAAEPEFLDFERFVEGNISRRRVQR
                     GELGFLKPVISRAFLDRHGLRYDENLRLGEDYELYARAVAHGARFKVIRSCGYGAIVR
                     ADSLSGRHKTQDLKRLADADLALLAIDSLPEGSKAVLRRHERHVRDKYRLRNFLDVKA
                     ERGLASAAAYAFASQSNLVPIVQGVASDKLEALFRRVGLMSGQRHMPPLRFLMAGTST
                     GKAR"
     gene            complement(265646..266770)
                     /locus_tag="MESOP_RS01200"
                     /old_locus_tag="Mesop_0244"
     CDS             complement(265646..266770)
                     /locus_tag="MESOP_RS01200"
                     /old_locus_tag="Mesop_0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891487.1"
                     /db_xref="GI:503657411"
                     /translation="MALPESSYERLRAADCADEVAYVQACLRLYFAGPTAGKVSTPGL
                     SNDAVADIARLNKVAIFVLKALSRAPVGERPADLFQWLDTYRRRTVSMNAACLMDSMT
                     IHEALRDRQIDFVFLKGPFQQHLLYDDHFMKPSGDVDILVSPAGFSRARDALRSIGYE
                     VSGKSRSVWWVRFLGEQHMIRGNGPKSSTVDLHYRLQQPGSPSPRDADGFLRRKRLVE
                     IAGTEVPFTSVADTLMLSCISVAKALFNREPCAGYVCDIRASANRLDEADQQRLLDAA
                     MSQGLDDTLLLGLRAADVLLGGTGTLLSERAKPILSRIGNEDLLSMVIAPWLSSLRWP
                     QRRTVLWELCGRAPVRYLAEAGWAASADISRRIFERPASP"
     gene            267596..267895
                     /locus_tag="MESOP_RS01205"
                     /old_locus_tag="Mesop_0246"
     CDS             267596..267895
                     /locus_tag="MESOP_RS01205"
                     /old_locus_tag="Mesop_0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase expression protein HypA"
                     /protein_id="WP_013891489.1"
                     /db_xref="GI:503657413"
                     /translation="MNWNPSDHDCISANKDAVACEFGDGLALLNLKSNIYYSLNGVGA
                     FIWELIQEPKSIADIRSAVLASYNVDAERCKADVDALLKGLAENGLARLQHEALV"
     gene            267879..268397
                     /locus_tag="MESOP_RS01210"
                     /old_locus_tag="Mesop_0247"
     CDS             267879..268397
                     /locus_tag="MESOP_RS01210"
                     /old_locus_tag="Mesop_0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891490.1"
                     /db_xref="GI:503657414"
                     /translation="MRHLSRQVSQKAMVSRQRPATEKSPRQAKSRSGRRSLTGILSLS
                     GSEALFLCQCLVVVAVVRLGLTLFSYNRVRAMVTRLNAHQCASMGELRLVAWGVAAAA
                     RFVPRATCLTQALSGQYMLARQGNASNIRIGVERGTGEQLKAHAWLISDNHIVLGGSV
                     DGFAHLVDHGSR"
     gene            268394..270313
                     /locus_tag="MESOP_RS01215"
                     /old_locus_tag="Mesop_0248"
     CDS             268394..270313
                     /locus_tag="MESOP_RS01215"
                     /old_locus_tag="Mesop_0248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthase"
                     /protein_id="WP_013891491.1"
                     /db_xref="GI:503657415"
                     /translation="MSGVAGIVLRQGPAPADAATDIQQMLARMRHRGPDGSSWWLDAG
                     IALGHAWLNTLDEAGPGPLTMAGGKLAITADCRLDNRDELLARLGIRDSSVADAVLLM
                     RAYLRWGEACPEHLQGDFAFAIWDAERQLLFCARDHFGVKPFYYHAADRRFAFASEIG
                     PMLGLDGVGARISEHRISGFLAGLPDDPQSTPYSDIFSLPARHSLTVSAQQVLLRRYW
                     QIEPSSRPPPSDAAEEFAHLFSQSVRNHMRGTSSIGAMLSGGLDSSSIACVAGLRNAA
                     ERKPRLPTFSLIFEKGSSMDERPFIDAVLDQQKVDPTLIAVGDYAPFAEFERVLEEQE
                     GTFLAPGLTLTRGIYRTAGAKGIKVLLDGHGGDEVVSQGHGHLHELANGGRWLDLWRE
                     IRSASNTYGDSTLALYFQFLTLYGPAWRIAKLRQLANRTLNKIRRPTPTRGRSWRDLV
                     NPDLARRTELIDRFHRAGYMPRGVQASDALSHRWILSNGYVPHSFEVLDKAAANFGVE
                     PRYPFWDKPLVEFCLGLPGEEKLSHGFGRSVLRRAMEGILPPPVQWRRDKIDFTANLV
                     NGMVRNHRDLLEQLLVSDTDRIAPYVNLPQVSAAYARLLRQPDRAAPLDVQYVWRSAS
                     LSLWLRQVQQGGSAA"
     gene            270310..271287
                     /locus_tag="MESOP_RS01220"
                     /old_locus_tag="Mesop_0249"
     CDS             270310..271287
                     /locus_tag="MESOP_RS01220"
                     /old_locus_tag="Mesop_0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HPr kinase"
                     /protein_id="WP_013891492.1"
                     /db_xref="GI:503657416"
                     /translation="MMPRNGPLPLAPHYPAVAGVPERQSHFYRAYGLTVASDVALPEL
                     EPVEPAAADITIAVGAIDMPKPSPQAATTFRFEPDRQYLAWHAVGAFLISGGRRIDVE
                     PAPGVDDALLAFPLLGPVMALLLHRRGLLVLHASAIAVAGKGAIFMGDKGAGKSTTAS
                     ALIRAGHELLTDDVVALDLSNPDRPMIVPGFPQIKLAADAAAAIPLGQAEVRPQVHPA
                     IDKMQHRLHGAFSGSVVPVARIYVLERGQRAAMTPLPAIAALPAIIKFSYVTRFGRAA
                     LSGDFAAMHLRQCSAIANHVGVCRLEVPAGLDRIGEAVALLERELAEDV"
     gene            271280..273124
                     /locus_tag="MESOP_RS01225"
                     /old_locus_tag="Mesop_0250"
     CDS             271280..273124
                     /locus_tag="MESOP_RS01225"
                     /old_locus_tag="Mesop_0250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_049802333.1"
                     /db_xref="GI:908670535"
                     /translation="MSRSSVLSLSLFRDVAAFGAVIAQIGGRRTWTALLFLVLGSLTE
                     GISILLLVPLLHLVGRADQDFAVRLPNIDFVRWLVPGGTLQLTTVLVALVGLVAAQAA
                     FNRFKSVYMARLLFDFINRLRMNLFESIGKARWGVFSRMRGSDLDHALTGDIDRVQGA
                     AFSLLMLVQIAVLLVGYLVISMFISPVMTAFAIIIGIVMFVALQPFRSRATAFGRVLT
                     SNRQDQYRTVSEFLGGIKVAKSLNVEASYFAQLQATLEKMKADNIDYVRNSSIGTAVF
                     QVASVVGLSLFIYVALVRFNLSLAEIVVLLLVFMRIAPRFMDMQTQAQQVLINLPAYT
                     AMRSLQARFDAEREPGHSEVEDASKLALDTGLNIRGVSFAYDDGAGKAVVSDITFGLP
                     AGKVTALIGPSGSGKSTIADMLLGLLEPTAGKILVDGVEIDAANRRRWRDQVAYVPQD
                     VFLLHDTIAANLRLAAPEASDDDLWTALRAAHAGEFVERLDHRLDTVVGDRGVRLSGG
                     ERQRIALARALLRKPSLLILDEATSALDWQNQSLIARSIEGLRGAMTILTIAHRPSMI
                     AFADWVVAMEDGRVVEVGQYQRLKAKPASRLSRMLSGEQSETEPAHVA"
     gene            complement(273150..273422)
                     /locus_tag="MESOP_RS01230"
                     /old_locus_tag="Mesop_0251"
     CDS             complement(273150..273422)
                     /locus_tag="MESOP_RS01230"
                     /old_locus_tag="Mesop_0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide production repressor exox"
                     /protein_id="WP_041163956.1"
                     /db_xref="GI:752465247"
                     /translation="MSLPKFIVGMIFALAIVVGWSWIDGVSLGTTLLRVVICAVVIQA
                     GYFAIIYVMVARSAPTPADRLREAERKLNSPEVEGEKLGSARRGLH"
     gene            274022..274699
                     /locus_tag="MESOP_RS01235"
                     /old_locus_tag="Mesop_0252"
     CDS             274022..274699
                     /locus_tag="MESOP_RS01235"
                     /old_locus_tag="Mesop_0252"
                     /EC_number="2.7.8.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006205264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide biosynthesis protein"
                     /protein_id="WP_013891495.1"
                     /db_xref="GI:503657419"
                     /translation="MRDIAKSATADFSQADTDFPPPIGGLMKRSFDIVGSLAGLIALS
                     PLFVMIALLVKFSDGGSVFYGHRRIGRGGRVFPCLKFRTMVPDGDKVLAAYLATNPEA
                     NAEWIATRKLKNDPRVTRVGAVLRKLSLDELPQIINILQGDMSLVGPRPVVRDELEIY
                     GSAAVYYLKSRPGLTGLWQVSGRNDVSYDSRVAFDRHYVENWSLFEDVRIIVRTVPAV
                     WMSRGSY"
     gene            274785..276041
                     /locus_tag="MESOP_RS01240"
                     /old_locus_tag="Mesop_0253"
     CDS             274785..276041
                     /locus_tag="MESOP_RS01240"
                     /old_locus_tag="Mesop_0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_013891496.1"
                     /db_xref="GI:503657420"
                     /translation="MFEAFGSGPLSGRSRLMATCLALSLAFPQLATADEYHLGSQDKL
                     TIRIAEWQTVEGTFRDWTAVNGQYTVGPSGTLSVPFVGELPAAGKTTAEVAAAIGEAL
                     QRKLALSDKPEASVEMAQFRPFYISGEVQNPGQFPFVPDLTVLKAISVAGGIRRTADY
                     GPQLGKDLVTAKGNFDISDDQRVRLLVRRARIDADLAGKTSFEAPKEVEGDPRLPTIV
                     ADEMTILTADQKALKLKLEALDDLKSVLQAEIESLQKKIVNQQKQVDLAQQQLASIGP
                     LAQKGLVANARLLDSQQSVTDLQGKILDYETAILTAKQAISKATQDAIDAQNTLSSSL
                     AADRQQTEADLNEAALKVNMQKGLIAQATDPATTAAITNDQQPTLLYSLVRNVDGKTS
                     EIAAKEETQVLPGDVIKVKLAPLASQ"
     gene            complement(276331..277644)
                     /locus_tag="MESOP_RS01245"
                     /old_locus_tag="Mesop_0254"
     CDS             complement(276331..277644)
                     /locus_tag="MESOP_RS01245"
                     /old_locus_tag="Mesop_0254"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide biosynthesis protein"
                     /protein_id="WP_013891497.1"
                     /db_xref="GI:503657421"
                     /translation="MKIPKSLLVDPEKNSAYGAFAVAVSIWAFSYSVIFGQVLILAYY
                     AVWLPLILVDYRRFLRQLSSAWLPLLFAAYVCFSVFWSQAPGTTARTAIQYLSHIACA
                     YVAARTVSARTLTLGALIGIFFVLLYSLKVGGYSEDVLDGTYNFVGAFASKNQIGFVG
                     SLGIYFSVVFLAFLRRGRLSFILTVPVVLLSAYVLVVSHSATSMASIPAVLALIALLA
                     MSKLLSRRYRRVIFLVGAGMIVVVAVVALNLGLMDFVLGIFGKDSTLTGRTYLWEQGW
                     DAAQRSPILGVGYAAYWVQGFAEAERLWNEFYITTRTGFHFHNTYIEALVELGFTGAT
                     MVSLIMLRTLYGHVSMVIFKAWQAESVVLFGVMVLLLIRSFVEVEILNPYIMGSFLMY
                     FSYFKLARLPVTGTRRSPAFEPADANRGEAEWPRHAGRPATADPS"
     gene            277994..278746
                     /locus_tag="MESOP_RS01250"
                     /old_locus_tag="Mesop_0255"
     CDS             277994..278746
                     /locus_tag="MESOP_RS01250"
                     /old_locus_tag="Mesop_0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="WP_013891498.1"
                     /db_xref="GI:503657422"
                     /translation="MPMHFAGRFAGRSAVITGGASGIGLAVAQRIVGEGGRVSVWDRD
                     PAQIEQAKAVVAGLHGVTLDVADAQGVEAATARTIEALGGVDILVTSAAITGPNMTTW
                     SYSTEDWQKVIDININGVFYCNKALVAHMLERDYGRIVNIASIAGKEGNPNASAYSTS
                     KAAVIGLTKSLGKELAKTKITVNCVTPAAVRTAIFKQMSQEHIDFMLSKIPMARFGEV
                     EEVAALICWIASEECSFTTAAVFDVSGGRATY"
     gene            278981..280330
                     /locus_tag="MESOP_RS01255"
                     /old_locus_tag="Mesop_0256"
     CDS             278981..280330
                     /locus_tag="MESOP_RS01255"
                     /old_locus_tag="Mesop_0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891499.1"
                     /db_xref="GI:503657423"
                     /translation="MPEAYPATLSDDELLDRYQRAAFGYFLENVNPDNGLVADTSRPN
                     SPASIAVVGFALSCYPIGVERGWMTRETAVELTLAALRFFSASPQGSGDEVTGHKGFY
                     YHFLDMRTGLRVWRCELSMVDTALLIAGFLVASAYFAGRDEKETEIRELAEALYRRVD
                     WRWAQGSSPTLRQGWKPRSGFLHYGWEGYNEATILYVLSMASPDSPTSDDCYEGWTAT
                     YQWENIYGHDVLYGGPLFMHQFSHAWIDFAGIRDAFMREKNSDYFENSRRSTYLHRDY
                     ARHNPYGFDGYGENLWGLSAGDGPGGFRASVERRRHRFSGYAARGAPFGPDDGTIAPW
                     SYPASLPFAPDICLAALRHLGDRYPQVIDNFRLPSGFNPTLASRRKFGRNGWISEGHY
                     GLDQGIVAMMIENHRSRLIWELMRSNPHIRRGLDKAGFTGGWLSQLASPEPGGRDVA"
     gene            280320..281849
                     /locus_tag="MESOP_RS01260"
                     /old_locus_tag="Mesop_0257"
     CDS             280320..281849
                     /locus_tag="MESOP_RS01260"
                     /old_locus_tag="Mesop_0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric reductase"
                     /protein_id="WP_013891500.1"
                     /db_xref="GI:503657424"
                     /translation="MSRERTKAAAFPVDRNDVELIQGAHPPRWKNPEPDGSYNLVVIG
                     AGPAGLTAARDAASLGAKVALIERRLIGGACVNVGGVPSKSIIRTARLYADMRDAENF
                     GGDTPERLHVDFERAMMRMRQIRERISRADSAAAIASQGIDLYFGEARFAGTDTVVVA
                     GKTLRFRKALIATGAHPSGPAIPGLAEAGYLNNETMFDLTKCPPRLLVIGGGPLGCET
                     AQAFCLLGAKVILAQSDPMFLPGEERDAAQILSDALAREGVEVCLNTEVVAVRTKGGQ
                     KLADLMRDGDVTTISVDEIITGVGRSPNVDGLGLEDAGVAYNANGIKVDDYLKTTNPH
                     IYAAGDVCLEYKFTHTAEATARIVVRNALFRGRGKLSDLVVPWCTYTDPEIAHVGLYP
                     VEARQNGIPVKTYTVLMHDVPRAVMDGEEEGFVKIHVREGSDRILGATVVAAHAGEMI
                     NAVTLAIRSGMGLHALADVIHPFPTQAQGIKMAGDAYRRTRFTTLRRRLAARWLAWSR
                     R"
     gene            281949..282629
                     /locus_tag="MESOP_RS01265"
                     /old_locus_tag="Mesop_0258"
     CDS             281949..282629
                     /locus_tag="MESOP_RS01265"
                     /old_locus_tag="Mesop_0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional DNA primase/polymerase"
                     /protein_id="WP_013891501.1"
                     /db_xref="GI:503657425"
                     /translation="MHGATAEHSGMQPVTETEYAIRLLAKGYICVPLCAGGKHLDLQA
                     MEYRPLHLQSRRRDLKELAFQSVAFHLSQKPPTGDDIRRWFRKFAGNVGILGGFSNLL
                     ILDFDDAATYLSWSSKHEALLNRTPIARSPNGFHVYLRTRDPTASSSLYAGMRRIGHV
                     KALGGYVVGSPSMLKDGSSYSWLKDHSPFDVDPSPIEGLASLSLRAVSPFKYHYDRML
                     NRGFFEPP"
     gene            283558..284775
                     /locus_tag="MESOP_RS32925"
     CDS             283558..284775
                     /locus_tag="MESOP_RS32925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_049802432.1"
                     /db_xref="GI:908670634"
                     /translation="MVERPGHQLDARRDRERRTLIVSYDPASPPTSGSDLRNFRNADA
                     AARFGPVCLVSVKPKIAGNAPDPLIRVEGLSIQGEPRTASVGWWRTRAENRIPRSALT
                     RLETLAREFRPDTIIVEGVGLFKLLRPLRPLAAQLILDMHNVESDLAAQIRRLSAKRT
                     AAAFGVRFLERKALSLVDRVWVCSNLDRQKLMRLSRHKIPIHVVPNGIPQAGDVPTDM
                     PAEPSTGNGFPVIVFIGHLAYPPNVDAAQRLASVILPRIRNALPDARLVLAGRTPRPA
                     VQALAGLPGVELIEDPADVAPLLSSAHLTVVPLTAGGGTRIKILEAMAAGVPVIATPI
                     AAEGLDLVENDEVLLADTDETLAEMAIGLCLDPERRARQRLRAHQAAWARFGLQAIRD
                     AVRDGLGPNGPAA"
     gene            284772..286346
                     /locus_tag="MESOP_RS01275"
                     /old_locus_tag="Mesop_0260"
     CDS             284772..286346
                     /locus_tag="MESOP_RS01275"
                     /old_locus_tag="Mesop_0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_013891503.1"
                     /db_xref="GI:503657427"
                     /translation="MIPAILHQTWKTDRVPARFQAYADSWKRHNPHWTVMFWSDRMLL
                     DFVAEHYPDFLPVFCTYPNGVERSDAARYMLLHHFGGVYADIDCECVAPFDPVMNETR
                     IVLCKEPASHSAVQLEFRGLPYLLFNGTMASPPGHPFWLHLLSMMPGLAGAKDVLDAT
                     GPCLLTSAQRDYDDQAAFAIHPSGLFTPVTSAGSAEREAADDTTALSIHHWAGTWWIP
                     EPPPNWTTKLRNRAYRLWYQLTRGAYLDEAVAKAGVDKAVLSAPPPSGKNIAVLVPLR
                     DAADLIQPFLDALEGLDYPKERIKLVFCEGDSLDGSWERLQAATAGLTGKYRDIVLLQ
                     RRVGTSLDRAKRARPRMQRVRRGAIAKVRNYLIDHGLSKDDDWALWIDIDVWRFPGDA
                     LNRLIATGHRIAVPNCVKIAGGGSFDLNSFIVRRQTRDYRYYRDIRGGLHQPPAQTPN
                     RYHLSDVRHLDIIGLDAVGGTMLLVDAALHRGGLRFPEIPYRDLIETEAFGVLANDLG
                     IRPVGLPKLEILHVPW"
     gene            complement(286416..286991)
                     /locus_tag="MESOP_RS01280"
                     /old_locus_tag="Mesop_0261"
     CDS             complement(286416..286991)
                     /locus_tag="MESOP_RS01280"
                     /old_locus_tag="Mesop_0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891504.1"
                     /db_xref="GI:503657428"
                     /translation="MALQDLTWLNPPPHHAIDGDTVHARTGKETDFWRETFYGFWRDN
                     GHFLHRPVEGDFTAEVTVKGDYKVLYDQAGLMVRLSETHWIKAGIEYTDGLAYVSVVV
                     TNDASDWSLVAIHAGPDGVRIRLTRHAEAIRVQYLDASDGHWKPVRLAYFPVSKTVDV
                     GMMCCSPQREGFEVTFSGYSVGPPISRELHD"
     gene            complement(287071..288510)
                     /locus_tag="MESOP_RS01285"
                     /old_locus_tag="Mesop_0262"
     CDS             complement(287071..288510)
                     /locus_tag="MESOP_RS01285"
                     /old_locus_tag="Mesop_0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_013891505.1"
                     /db_xref="GI:503657429"
                     /translation="MNVFRKNLIDGEWVGDAGSRNINPSDTGDVVGEYASAGVEQAGQ
                     AIAAAKAAFPAWSRSGPLARHAVLKKTADEIMARKDEIGRNLAREEGKTLAEGIGETI
                     RAAQIFDFFAGETLRLSGEMVPSVRPGVGVEITREAVGVVGIITPWNFPIAIPAWKIA
                     PALAHGNTIVFKPAELVPESAWSIVDILHRAGLPKGVLNLVMGKGSVVGQAMLDSPDV
                     NAITFTGSVGTGKRVAAASVEHMRKFQLEMGGKNPLVVLDDADLAVAVDCALNGAFFS
                     TGQRCTASSRLIVTDAIHDRFVDALKDRMGKLVIGDALDAQTQIGPVVDATQLKQDED
                     YIAIGVREGATLAFGGERLDRKTPGFFLRPALLTEATNAMRSSREEIFGPVASVIRVK
                     DYDEALAVANDTPFGLTSGICTSSLKHATHFKRNSEAGMVMVNLPTAGVDFHVPFGGR
                     KGSSFGPREQGRYAMEFYTTVKTAYTFAG"
     gene            288792..289451
                     /locus_tag="MESOP_RS01290"
                     /old_locus_tag="Mesop_0263"
     CDS             288792..289451
                     /locus_tag="MESOP_RS01290"
                     /old_locus_tag="Mesop_0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_041163957.1"
                     /db_xref="GI:752465248"
                     /translation="MAALETTIQRTGATGNVKATREDWLKLALETLISDGVERVRVLT
                     LGQQLDVSRSSFYWYFKSRQDLLDQLLDHWRQTNTKFIVERARRPSATVVRGVMSIFE
                     CWVDERLFDPRLDFAIRAWARRSPAIRRALDEADEERVNAIRDMFMRHGYDEEDAFVR
                     ARILYFMQIGYYSLELDEPMSSRLPHVASYLRSFTGQEPTTADVEDFSRYVVETMARK
                     G"
     gene            289544..290797
                     /locus_tag="MESOP_RS01295"
                     /old_locus_tag="Mesop_0264"
     CDS             289544..290797
                     /locus_tag="MESOP_RS01295"
                     /old_locus_tag="Mesop_0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit beta"
                     /protein_id="WP_013891507.1"
                     /db_xref="GI:503657431"
                     /translation="MTRRYSALSLFKEGLAGQTGWKQAWRSPEPKPAYDVIVIGGGGH
                     GLATAYYLAKNHNIARVAVLEKGWIGGGNTGRNTTVVRSNYYYPESVELYGLAHRLYE
                     GLSKDLNYNVMLSQRGMVNLCHSTAEMEIGARTVNAMQINGIDAELFSPKDVRRVAPI
                     YNFSADARFPVFGGIWQGRAGTARHDAVAWGYARAGSRLGVDIIQNCEITDFIIEGGH
                     CRGVQTTRGVIRAERIGMAVAGHSSVLAAKAGFRLPVNSYALQACVSEPVKPILDTVV
                     LSPGCGVYVSQSDKGEIVIGGGLDRIPSYAQRGNLPTLETVIAGVLEMFPIFGQLKLM
                     RQWAGIVDVVPDSSPIIGETPLPNLFLNCGWGTGGFKAIPAGGTLLANLLATGKHNDI
                     SRPFDLDRFAGGRLIDEAAGSGIAH"
     gene            290806..291072
                     /locus_tag="MESOP_RS01300"
                     /old_locus_tag="Mesop_0265"
     CDS             290806..291072
                     /locus_tag="MESOP_RS01300"
                     /old_locus_tag="Mesop_0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit delta"
                     /protein_id="WP_013891508.1"
                     /db_xref="GI:503657432"
                     /translation="MQLFPCPFCGPRDETEFHYGGDAGNVRPDGAEVPIERWADYLYL
                     RGNPKGTAREIWVHMTCGEFFVMERDTVTHKVLSSAALGGEQAA"
     gene            291069..293942
                     /locus_tag="MESOP_RS01305"
                     /old_locus_tag="Mesop_0266"
     CDS             291069..293942
                     /locus_tag="MESOP_RS01305"
                     /old_locus_tag="Mesop_0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_013891509.1"
                     /db_xref="GI:503657433"
                     /translation="MTASRLATGGSAIDRSRPIRFSFDGTTVQGFAGDTIASALLAGD
                     VAVVGRSFKYHRPRGIWGAGVEEPNALVDVGGATPNTRATTEPARDGLVAKSVNATPN
                     ALVDRNAFLDRFSRFIPAAFYYKTFMWPDWHMFEPRIRAMAGLGKVDAGWASPGLSDQ
                     INHHCDVLVVGAGPAGLAAAKLAAGADQSVVLVDDQLRAGGSLGHRAGEVDGKSATEW
                     VDETVANLAANGHLILPWTTAFGIYDHNLVGLNQRHLDGRSDTLWRVRPRRIVLATGA
                     IERPLPFANNDLPGILSADAALAYLRRHAVLVGRRIVVATNNDSAYEVAEAVAEAGAD
                     VTLVDIRRDGMPAAPVNARVLKGRALASARGKLRVEGVTLDDGSRLDADCVLVSGGWT
                     PTIHLFGQARGKLAWSEARAAFLPGDPVDGISVVGAAAGAVCLSDVFAGVADAFPGKG
                     SAATPRSTGPEATGGIVAAWPMPGSKGRIWIDYQNDVTVKDVELAARENFVSVEHLKR
                     YTTLGMATDQGKTSNLPGLALMAGITGRTVPEVGTTTYRPPFTPVPLASFAGARVGEL
                     MAPVRRLPLENVHRASGAVFQEYGGWLRPAHYGGRDADADRAIQDEARRARQSVALFD
                     GSTLGKIEVIGPQAAAFVDFLYYNTMSTLKPGRCRYGFMLSENGVVFDDGVLVRLDEH
                     RFVISCSSSHVAAVHARLEEWRQDRFGRDAVYIHNATSEMATLTVSGPNARKLLERLK
                     LGLSLDDADLPHMAVGHGRYGGDQVRIARVSFTGDRSYEISIRADRAEPLWAHLRQAG
                     QALDAVVIGLEALMILRAEKGFIVIGKDTDGTTLPHDLGSEGPRAKRKTEYVGRRSLF
                     TEEASRGNRLQLVGLTVPSGEAPLPTGAHGIDRRDGKLKSQGFVTSSYQSPTLGRPVA
                     LGLIERGATRHGETIEIQHLGKIRTATIAAACAFDPAGDRLNA"
     gene            293935..294468
                     /locus_tag="MESOP_RS01310"
                     /old_locus_tag="Mesop_0267"
     CDS             293935..294468
                     /locus_tag="MESOP_RS01310"
                     /old_locus_tag="Mesop_0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891510.1"
                     /db_xref="GI:503657434"
                     /translation="MRDLAEKWPIAPDWPAAMITTPGLAVRTVTGLDQMLVSGDLDAW
                     ARLSGVKAEGVGAFGAAQGERYAARLARDRLLVVSNAPLAIAAGWHKEGFAVTEISTG
                     LQLFEIEGVGLDAFIARGTTIDPRQSSASATLSFAGVSAIVYRHGSKLRIHVDRGLAA
                     YLWTWMEQAAGHVAAGS"
     gene            complement(294485..294970)
                     /locus_tag="MESOP_RS01315"
                     /old_locus_tag="Mesop_0268"
     CDS             complement(294485..294970)
                     /locus_tag="MESOP_RS01315"
                     /old_locus_tag="Mesop_0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891511.1"
                     /db_xref="GI:503657435"
                     /translation="MSKALISFALVAVLTALLMALSLAVARHGYPYGAIGVRRLDGIA
                     DAGTFIPLAAVYFFSALLMMILPIRAASIVLTHAADAIFWTVIVLLATIVGGLLARWA
                     FGQGSALLALLNWRFLFAVAVVGCHFVMNELRRNVLLRSLFFVVFAAAMLACLFWSFT
                     L"
     gene            complement(295089..295649)
                     /locus_tag="MESOP_RS01320"
                     /old_locus_tag="Mesop_0269"
     CDS             complement(295089..295649)
                     /locus_tag="MESOP_RS01320"
                     /old_locus_tag="Mesop_0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="WP_013891512.1"
                     /db_xref="GI:503657436"
                     /translation="MSNPTVVGFSGNITRPSKTRAFVDFVARDIAARHGLSASTYDIE
                     DVGPSLGTARWARDLDSQAQPILAQILSADVLVVGSPTYKGSYTGLFKHFFDLIDPAA
                     LRGKPILLTATGGGERHALIVEHQLRPLFGFFEAFTLPTAVYATDKDFTDGVLRSEAI
                     LKRAAQAVDEVGFVLANRSAGRVAAE"
     gene            complement(295712..296959)
                     /locus_tag="MESOP_RS01325"
                     /old_locus_tag="Mesop_0270"
     CDS             complement(295712..296959)
                     /locus_tag="MESOP_RS01325"
                     /old_locus_tag="Mesop_0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013891513.1"
                     /db_xref="GI:503657437"
                     /translation="MTVSTVKTDHASAAVPPVARPSAPAHIIKDDAEAIAIAHALAAE
                     FAKDSSRRDRERIWPVAELDAFSQSGLWSINVPRAFGGPELSYATLAKVIEIISAADS
                     SIGQVAQNHLGVIAAIRTVSDAEQQKLLFGEALKGTRFGNAFSEFGSKRAADFETRFT
                     DAGDHVVVNGRKFYSSGALLAHLVPIVALDDEGRAWYAIADRGAPGLTVIDDWSSFGQ
                     RTTLSGTVIIDNVKVPKTFLVPGYKGYDRPTADGAIFQIIQVAVDTGIAQAAIDETVH
                     FVRTRSRAWIDSGVDNAWDDPYTIQAIGDLTLRLHAAQALLEKAGHAIDRAVIEPTAE
                     TVAHAQIVTAEAKILSTEIAIAATNKLFELAGTRSTLAEHNLDRHWRNARTHTLHDPV
                     RWKYSILGKYFLNGENPPLHAWS"
     gene            complement(296984..297790)
                     /locus_tag="MESOP_RS01330"
                     /old_locus_tag="Mesop_0271"
     CDS             complement(296984..297790)
                     /locus_tag="MESOP_RS01330"
                     /old_locus_tag="Mesop_0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_013891514.1"
                     /db_xref="GI:503657438"
                     /translation="MPDNDVILAVNAVHATYNHAITALHGVSFEIRRGEILALLGANG
                     AGKTTTLKAVSNLLPAVRGQVNAGTIRYDGSDVSRRKPGDLVRAGLVPVLEGRHCFKS
                     LTVEENLVAGGIGRSGRRAEINVDLERIYGYFPRLREKRRTLSGLTSGGEQQMTAIGR
                     ALMSRPRLLVLDEPSMGLAPLIVQDIFQTLRKLNRETGLSILVAEQNSAVALRYADHA
                     TVLENGVSVLSGPAAELRQREDVRAFYLGQSTSGQQPSPATKTAHLHAVA"
     gene            complement(297867..299204)
                     /locus_tag="MESOP_RS01335"
                     /old_locus_tag="Mesop_0272"
     CDS             complement(297867..299204)
                     /locus_tag="MESOP_RS01335"
                     /old_locus_tag="Mesop_0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891515.1"
                     /db_xref="GI:503657439"
                     /translation="MNFLSTIKAAALSAAMIASVALPAANADEQYFPLQSYRVGPYAA
                     GGTGFFGGFIDYLNLINIRDGGVNGVKLTWDECETQYEVERGVECYERQKSHAGAAAW
                     NPLSVGIAYAMIDRITADKVPLITVNHGRTDSTDGRVFPYVFPLLLNPYSETSGIVNY
                     IASKEGGIDKLKGKKIVVLYHGSPYGKETIPIYELLAQKYGFTIQQIEVPHPGNEQQS
                     QWLTIRRAKPDFVVLRGWGVMNPVALKTAVKVGYPVDHIVGNVWSNSEEDVIPAGDAA
                     KGYTAITTQASGNSYPVVQEIVKTVYGAGKGNLEDKSRIGSVYHNLGIVNGILNVEAI
                     RVAQEKFGHRTLTGDEVRWGFEHLKLDPAKVEALGAKDLFHSINVSWDNHEGEGYVTF
                     QQWDGKKWNVVSDWIAPDWALLRPIIEKSAEAYAAEKGIKLRTADDANAVTTN"
     gene            complement(299287..300327)
                     /locus_tag="MESOP_RS01340"
                     /old_locus_tag="Mesop_0273"
     CDS             complement(299287..300327)
                     /locus_tag="MESOP_RS01340"
                     /old_locus_tag="Mesop_0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891516.1"
                     /db_xref="GI:503657440"
                     /translation="MTAIASDFSSTPALPKWLAPVLLLAFAYGVVPLIGSSYLFEAIL
                     LPFLALSLAGVGLNILTGYAGQVSLGSAAFMAAGAFAAYNFNLRVEGLPLIGSIVLAG
                     LVAAAIGIVFGLPSLRLKGFYLAVSTLAAQFFVQWALTKFSWFSNNSASGVIDAPRLS
                     ISGFALDGAVGRYLFALTIVAVLTFLAHRLVSSQTGRNFIAIRDNETAARIIGIPVLK
                     TKLLAFAISSFIIGVAGVIWAFAYLRTVEPDGFDLDRSFQILFIIIIGGLASVRGAFF
                     GAALIVVFPLGLSRLGGFLLGDVFDSGVLDMSQRIVLGALIILFLILEPDGLVALWDR
                     LRRRLLFAWQTS"
     gene            complement(300331..301230)
                     /locus_tag="MESOP_RS01345"
                     /old_locus_tag="Mesop_0274"
     CDS             complement(300331..301230)
                     /locus_tag="MESOP_RS01345"
                     /old_locus_tag="Mesop_0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891517.1"
                     /db_xref="GI:503657441"
                     /translation="MIADFDYQFFIEVLVGGLLSGVMYSLVAIGFVLIYKTSGVLNFA
                     QGALLLFAALTFVSLVERGVPFALALVATFAIMVAIGVAIERTVLRPLTNKPPITLFM
                     ATLGLSYIIEGAAQLIWGTQVHGLDLGIEDVPLEVGGVLISQFDIFAAVVAAGMVLLL
                     SLFFRYTRIGLSFRAVADDQFAALAVGLRLPLIWATVWAAAGLVALVAGLLWGARLGV
                     QFSLSLVVLKALPVLVLGGFDSILGAIVGGLLIGASEKLAEVYIGDYFGGGIESWFAY
                     VVALVFLLIRPSGLFGQKLVERV"
     gene            complement(301227..302162)
                     /locus_tag="MESOP_RS01350"
                     /old_locus_tag="Mesop_0275"
     CDS             complement(301227..302162)
                     /locus_tag="MESOP_RS01350"
                     /old_locus_tag="Mesop_0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_013891518.1"
                     /db_xref="GI:503657442"
                     /translation="MPLASYSLGMMEASVYAPEIFARGLPSAPQPALPSAGRIEPAGS
                     VSGTAAPLLSLQGIGLSFGGVVALADIDLSVQPGEIRAIIGPNGAGKSSLINVISGVY
                     RPDRGHVLLDGVSHAQVPTQRLARLGVARTFQNLALFKGLSVLDNVASGLAYKVRSNF
                     AGQVLGIGRSRGEQRETRGRADQVLEFLDLTAVRDRLAGTLPYGLQKRVELARALVAQ
                     PRLLLLDEPMAGMTSGEKSEMAGFVRAARDRFATTVVLIEHDVGVVMGLSDRIAVLDY
                     GRKIADGTPDEVRNDQRVIDAYLGVASDNEDGAGI"
     gene            complement(302288..303391)
                     /locus_tag="MESOP_RS01355"
                     /old_locus_tag="Mesop_0276"
     CDS             complement(302288..303391)
                     /locus_tag="MESOP_RS01355"
                     /old_locus_tag="Mesop_0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyl sulfone monooxygenase SfnG"
                     /protein_id="WP_013891519.1"
                     /db_xref="GI:503657443"
                     /translation="MAHADTDAIKFAYWVPNVSGGLVISNIEQRTNHSAEYNRKLAQI
                     AEKAGFDYALSQIRFTAGYGADEQHESVAFSHDLLAATTTLKVIAAILPGPWNPALAA
                     KQIATISYLTNGRVAINLVSGWFRGEFHAIGEHWLDHDERYRRSEEFIRALRGIWTED
                     SFTFRGDFYRFNEYSLKPKPPQPLPEIFQGGSSRAARDMASRVSDWYFTNGNTPAEIA
                     KQVEDLRTKAKANSHSVKVGVNAFAVVRETEDEAKAVLAEIIAKANPEAVNAFGHEVK
                     NAGKASPEGEGNWAKSSFDDLVQYNDGFRSNLIGTPRQVAERIVDLKRAGADLILLGF
                     LHFQEEVEYFGKHVIPLVRELEDAEQAASLAAE"
     gene            complement(303556..305016)
                     /locus_tag="MESOP_RS01360"
                     /old_locus_tag="Mesop_0277"
     CDS             complement(303556..305016)
                     /locus_tag="MESOP_RS01360"
                     /old_locus_tag="Mesop_0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="WP_013891520.1"
                     /db_xref="GI:503657444"
                     /translation="MNALPQSRRLRVAIIGGGFSGAAVAWHLAQLPWFERLSISVIEP
                     RPALGGGLAYSSAEPAHRVNVPAIRMSMAPDDPQHFARWLTGSGELERDTDAIWKNGD
                     AYPRRRVFGRYVAEHLAPWLGSGVVRHVQGLATRVTRDADGAGWSVHTSGGPVAADIV
                     VLAATHLPPGIPDALAALAEAPGFVADPYAASALAHIGREASVLIVGSGLSSADMVAE
                     LDRRGHRGRILALSRRGLRSRGHPDVRGEPFGDFASSPAATALGLLKTIRATLAAARA
                     ANVNWQSVFDQLRLQGPVLWAALAPRERARLVRQLRVFWDVHRFRIAPQVAAVLDRRQ
                     AAGTYETVAARLVASNHEDDGPAVSFQRRGRTRIETVRFDAIINTTGPAHGQALRLNP
                     ALRSLAEAGLIRADAYGLGIETSLDSRAIGRGDKAVATLFVAGPLARGTFGELMGLPE
                     VARHAQAVARETARLLDTVPSAETIGVDADSVAAAR"
     gene            complement(305013..306185)
                     /locus_tag="MESOP_RS01365"
                     /old_locus_tag="Mesop_0278"
     CDS             complement(305013..306185)
                     /locus_tag="MESOP_RS01365"
                     /old_locus_tag="Mesop_0278"
                     /EC_number="1.14.14.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891521.1"
                     /note="catalyzes the release of sulfite from
                     alkanesulfonates; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkanesulfonate monooxygenase"
                     /protein_id="WP_013891521.1"
                     /db_xref="GI:503657445"
                     /translation="MTIDVPDRIKVLWFLPTHGDSRYLGTTEGGRAVDLPYLTQVAKA
                     ADTLGYYGVLLPTGRACEDSWVIASALAPLTERLRFLVAVRPGLQSPTLAARMTATLD
                     RISNGRLLINVVTGGDPLENKGDGIFLSHAERYEVTQEFLRIYKRVLSGETVEHQGKH
                     FRIEDGRLLFPPVQTPYPPLYFGGSSDAGSVVAAQEIDKYLTWGEPPADVERKLDAVR
                     ELAEKAGRKLSFGIRLHVIARETTEQAWAAADSLISRLDDATIASAQKVFARMDSVGQ
                     ARMSALHGGSRDRLEIAPNLWAGVGLVRGGAGTALVGDPDTIAERIDEYRRLGIDTFI
                     LSGYPHLEEAYRFGELVLPKLPTDHPVKSAVSSVNTGPFGETIAGDHRPKSLASAS"
     gene            complement(306441..307346)
                     /locus_tag="MESOP_RS01370"
                     /old_locus_tag="Mesop_0279"
     CDS             complement(306441..307346)
                     /locus_tag="MESOP_RS01370"
                     /old_locus_tag="Mesop_0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="WP_013891522.1"
                     /db_xref="GI:503657446"
                     /translation="MANFQPDDLHGIHAILYALFDENERLDRAAMRSQVEICLATGVH
                     GMAALGLATEVAKLTEAERRTVMDWTAQDTAGKVPLAFTILGASMAEQISQVRHAESV
                     GADWVILQPPPGGSYGALEYIRFFGRVAEATDLPVAIQNAPAFFGRGLTSDEIRDLVT
                     LHPNIRLIKGEGPVTDIAGLIERTEGRIPVFNGRGGLELIDNFRIGCRGMILAPDCVD
                     YAVRAWKAFRAGNEAIAEAEYAKMLPAAVFVMQGIENLICYGKRLFGARTGIPIHDRA
                     PAMRPNETGLAIVERFAAGLGRLPG"
     gene            complement(307358..309070)
                     /locus_tag="MESOP_RS01375"
                     /old_locus_tag="Mesop_0280"
     CDS             complement(307358..309070)
                     /locus_tag="MESOP_RS01375"
                     /old_locus_tag="Mesop_0280"
                     /EC_number="4.2.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528172.1"
                     /note="catalyzes the formation of 3-methyl-2-oxobutanoate
                     from 2,3,-dihydroxy-3-methylbutanoate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="WP_013891523.1"
                     /db_xref="GI:503657447"
                     /translation="MTKRRSQHWFGGNGKDAFIHRSWMKNNGLPDDAFDGRPVIGICN
                     TFSEFTPCHVHFRGLIEHIKAGVLEAGGLPLEFPVFSCGESNLRPTAMLFRNLASMDV
                     EEAIRGNPMDGVVLMAGCDKTTPSLVMGAASCDLPSIVISGGPMLNGRFQGREIGSGT
                     DVWKFSEDVRAGVMSEQDFANAESAMSRSPGHCMTMGTASTMASMVEALGLALPGNAA
                     YPAVDARRSRIARMTGRRIVEMVNEDLRPSAILTRQAFANAIRVNGAIGGSTNAVVHL
                     LAIAGRVGAELTLDDWDAFGRDVPTILDLMPSGRFLMEDFCYAGGIPAVMKEIADMLD
                     LDALTVTGRRLRDNIADAQNYNPEVIRPRDKALTRHGGIAVLRGNLAPDGAIIKPSAA
                     SPALMKHRGRAVVFEDIDDYKARVDDPALDIDESSIMVLRNCGPKGYPGMAEVGNMAL
                     PQKLLKQGVRDMIRISDARMSGTAFGTVVLHAAPEAAVGGPLALVRSGDIIELDVEAR
                     RLHLDVSEQELARRRIGWAPPEPAMRGGYQGLYVDHVLQADRGADLDFLVGSRGHAIP
                     RESH"
     gene            complement(309087..309866)
                     /locus_tag="MESOP_RS01380"
                     /old_locus_tag="Mesop_0281"
     CDS             complement(309087..309866)
                     /locus_tag="MESOP_RS01380"
                     /old_locus_tag="Mesop_0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013891524.1"
                     /db_xref="GI:503657448"
                     /translation="MAERLSGKRIFLTGAAQGIGLAIAEACLAEGARLFLVDRDGALL
                     DRSVAGLAASQGHVGHQAADISDGAAIAAAVGQAGDEIGPINALINNAGMNVFSTPLD
                     ATEEEWNRNFDVNVKGAWNCSKAVLPGMIASGGGAILNVASTHSFTIIPHTFPYPVAK
                     HALLGLTKSLALEYAAQGVRVNALAPGYVETRKAIDYWNSFADPVAARAKTLALHPGG
                     RIASVREIALAAVFMISDECPFMNAATLVVDGGLSQLQHPA"
     gene            complement(309892..310842)
                     /gene="araH"
                     /locus_tag="MESOP_RS01385"
                     /old_locus_tag="Mesop_0282"
     CDS             complement(309892..310842)
                     /gene="araH"
                     /locus_tag="MESOP_RS01385"
                     /old_locus_tag="Mesop_0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891525.1"
                     /note="Part of the ABC transporter complex AraFGH involved
                     in the high affinity transport of arabinose; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose ABC transporter permease"
                     /protein_id="WP_013891525.1"
                     /db_xref="GI:503657449"
                     /translation="MTGQLKKILLGEQGLVVIFVVAFALVSVLVPNFLTDRNMLGLLQ
                     SVVTVGIVACTMMFCLAARDFDLSVGSIVAFAGMVAVMASNYTGSILLGLLAAIACGA
                     FVGFINGVVIAKFRINALITTLATMQIVRGLALIASDGRAVGINSPDFYQLALSKLLG
                     IPTPIWVLAVLFGIFGFVLNRTVFGKNTLAIGGNPEASRLAGVNVDRTRIWIFALQGV
                     VCGIAGILLASRITSGQPNAAVGLELSVISACVLGGVSLAGGRATMSGVIVGVLIMGI
                     AENAMNLLNIPAFYQYIVRGVILLLAVLLDNLRSSALGRR"
     gene            complement(310854..312365)
                     /gene="araG"
                     /locus_tag="MESOP_RS01390"
                     /old_locus_tag="Mesop_0283"
     CDS             complement(310854..312365)
                     /gene="araG"
                     /locus_tag="MESOP_RS01390"
                     /old_locus_tag="Mesop_0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528176.1"
                     /note="Part of the ABC transporter complex AraFGH involved
                     in the high affinity transport of arabinose; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose ABC transporter ATP-binding protein"
                     /protein_id="WP_013891526.1"
                     /db_xref="GI:503657450"
                     /translation="MSFLDFSRITKTYPGVKALSDVSFGVDKGAVHGLMGENGAGKST
                     LIKILSGDQHADEGEISIDGKAQAYASTRDAFDNGVIVIHQELQLVPELTVAENLSLG
                     RFPASAGIIAGRKMLDDVGAKLKSAGIDIDMRRKVKTLSIGERQMVEIAKAIMLDARV
                     IALDEPTSSLSSRESEILFALIDRLRGEGKVIIYVSHRLDEVFRLCDSLTVLRDGKLA
                     AHHASLKGVTRDQVVAEMVGREISDIWGFRPRGSGDVRLEVEGISGAKLKTPASFEAR
                     AGEIVGFFGLIGAGRSELMRLVFGADPRSSGTISVDGKLVHATDPHGSIRAGIVLCSE
                     DRKHDGIIQGRSIEENINISSRRHHTRFGVLDRASEIATAETFIKKLKVRTPSRRQDI
                     INLSGGNQQKVILGRWLSEQGVRVLIVDEPTRGIDVGAKSEIYELLYQLAEDGMAIVV
                     ISSELPEVMGICDRILVMCGGRISAVLTRDQFAEKAILAAALPDQKTPDAIAS"
     gene            complement(312436..313425)
                     /locus_tag="MESOP_RS01395"
                     /old_locus_tag="Mesop_0284"
     CDS             complement(312436..313425)
                     /locus_tag="MESOP_RS01395"
                     /old_locus_tag="Mesop_0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891527.1"
                     /note="with AraGH is involved in the transport of
                     arabinose into the cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013891527.1"
                     /db_xref="GI:503657451"
                     /translation="MRLLKTALVAGALAVLSVTTIAAYAQDTKIGFIVKQPEEPWFQD
                     EWKFADQAAKEKGFTLVKIGAEDGEKLMSAIDNLGAQGAQGFIVCTPDVKLGPGIVAK
                     AAANNLKLMTVDDRLVGADGKALEDVPHMGISATKIGEAVGQAIVDEMKARGWKADEV
                     GAIRVSYDQLPTAVDRVEGAISVLKANGFKAENIFDAPQAKTDTEAALNAATVVLNAH
                     ADIKKWVSFGLNDEAVLGAVRASESVGIPADGMIGVGIGGADSAINEFKKPTATGFVG
                     TVIISPKRHGYETALNMYDWVANNKEPEKLILTSGALAKRDDYQKVRQGLGIE"
     gene            313626..314372
                     /locus_tag="MESOP_RS01400"
                     /old_locus_tag="Mesop_0285"
     CDS             313626..314372
                     /locus_tag="MESOP_RS01400"
                     /old_locus_tag="Mesop_0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013891528.1"
                     /db_xref="GI:503657452"
                     /translation="MTDILKKTPGDTATRRPRVMPDVTKAIASDIFSGRYPAGSSLPT
                     ENELGVEYGVSRTVIREALKVLAAKGLVLSRPRVGTVVCTEDDWNIIDPQVLAWHAPH
                     ALHDKLFDAILETRRAIEPLVAELAAARATLQEIANLEAAWRGMAGAGEDLGTFSRSD
                     IAFHQILYAASHNPIFRQIGNLIDTGLKFSLEATATISLDRRMEAVAAHREVVEALRM
                     RDAEAARSAANRILDLAARDLVSAKKLKNN"
     gene            314380..315528
                     /locus_tag="MESOP_RS01405"
                     /old_locus_tag="Mesop_0286"
     CDS             314380..315528
                     /locus_tag="MESOP_RS01405"
                     /old_locus_tag="Mesop_0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactonate dehydratase"
                     /protein_id="WP_013891529.1"
                     /db_xref="GI:503657453"
                     /translation="MKIISLTTYIVPPRWLFLKIETDAGVTGWGEPVVEGRALTVEAA
                     VKELGDYLIGKDPRLIEDHWTVMHRGGFYRGGPILMSAIAGIDQALWDIKGKALGVPV
                     HELLGGKLRDTIKVYSWIGGDRPAEVAAGAKEVVARGFLALKMNGTEELQIVDSHDKI
                     DAAVERVAMVREAVGPNIGIAVDFHGRVHRPMARILVKELEPYRLMFIEEPVLSENRE
                     ALKEIAALGSTPIALGERLYSRWDFKSVFEQGVVDIIQPDLSHAGGITECRKIAAMAE
                     AYDVAVAPHCPLGPIALAACLQLDAVSYNCFIQEQSLGIHYNAGNDLLDYAANKDVFR
                     YEDGYVAIPDGPGLGVEIDEDYVKERAKEGHRWRNPIWRHKDGSFAEW"
     gene            315670..316371
                     /locus_tag="MESOP_RS01410"
                     /old_locus_tag="Mesop_0287"
     CDS             315670..316371
                     /locus_tag="MESOP_RS01410"
                     /old_locus_tag="Mesop_0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic nucleotide-binding protein"
                     /protein_id="WP_041163958.1"
                     /db_xref="GI:752465249"
                     /translation="MPQSLFRNQVLKALSSQDFALLRPSLHHVELDIKDQLEVAHQPI
                     KDVYFPERGIASVVATMTGGRQSEVGIIGYDGMTGIAVILGQESTATETYIQVAGNGW
                     RLPVETLRSAIAESPSLRASLLDYAHAFLVQSSRTALVNGHSKIEERLARWLLMVHDR
                     AEGDKIYLTHEFLATMLGAHRPGVTTALQMLEYRGLVHAKRGEITIVDRAGLIKLTHG
                     AYGEEEQRYFGLAAA"
     gene            316547..316786
                     /locus_tag="MESOP_RS01415"
                     /old_locus_tag="Mesop_0288"
     CDS             316547..316786
                     /locus_tag="MESOP_RS01415"
                     /old_locus_tag="Mesop_0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891531.1"
                     /db_xref="GI:503657455"
                     /translation="MTNSFRTITVEKAAEAYVLSRGRARFLSIAQAIRAIRTLMPACK
                     ATDRELEELVAAASFVHGVPVAFDARTAKAPRLHS"
     gene            316795..317058
                     /locus_tag="MESOP_RS01420"
                     /old_locus_tag="Mesop_0289"
     CDS             316795..317058
                     /locus_tag="MESOP_RS01420"
                     /old_locus_tag="Mesop_0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891532.1"
                     /db_xref="GI:503657456"
                     /translation="MSAPVETPTLSDVRLAIVRHLIDNVESTSISISEVNRAVRRMFP
                     LCELTDWELDDLIARSAIGAGFAIDFDAGGSWPYRKPIGKSAA"
     gene            complement(317067..317142)
                     /locus_tag="MESOP_RS01425"
                     /old_locus_tag="Mesop_R0003"
     tRNA            complement(317067..317142)
                     /locus_tag="MESOP_RS01425"
                     /old_locus_tag="Mesop_R0003"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(317107..317109),aa:Ala,seq:ggc)
     gene            complement(317316..317702)
                     /locus_tag="MESOP_RS01430"
                     /old_locus_tag="Mesop_0290"
     CDS             complement(317316..317702)
                     /locus_tag="MESOP_RS01430"
                     /old_locus_tag="Mesop_0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891533.1"
                     /db_xref="GI:503657457"
                     /translation="MAKNELGTKRIDPETGRKFYDLNKDPIVSPYTGKTYPRSYFEEG
                     KIAALEEEEEVAEKEVDAEDEEGVEVVSLEEADEDAKGDDLPDLGDDEDVDLGDDEDD
                     TFLADEEEEDDDVADMIGVGDDDDEV"
     gene            317909..319267
                     /locus_tag="MESOP_RS01435"
                     /old_locus_tag="Mesop_0291"
     CDS             317909..319267
                     /locus_tag="MESOP_RS01435"
                     /old_locus_tag="Mesop_0291"
                     /EC_number="2.5.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98CC1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="WP_013891534.1"
                     /db_xref="GI:503657458"
                     /translation="MSHAAAAKPATARKSSALSGTARVPGDKSISHRSFMFGGLASGE
                     TRITGLLEGEDVMRTGAAMKAMGAHIEKRGTEWVIRGTGNGALLQPEGPLDFGNAGTG
                     SRLTMGLVGTYDMETTFIGDASLSGRPMGRVLEPLRQMGVQVLKATPGDRMPITLHGP
                     KHAAPITYRVPMASAQVKSAVLLAGLNTPGITTVIEPVMTRDHTEKMLKGFGANLSVE
                     TDERGVRHIFIEGQGKLHGQTIAVPGDPSSAGFPLVAALIVPGSDITIENVLMNPTRT
                     GLLLTLQEMGGNIEILNPRNAGGEDVADLRVRYSELKGVTVPPERAPSMIDEYPVLAV
                     AASFAEGETLMQGLEELRVKESDRLSAVANGLKLNGVDCTEGEASLAVRGKPGGKGLG
                     GHPNGLDTTVQTHLDHRIAMSFLVMGLATEKPVTIDDQAMISTSFPEFMGLMKGLGAE
                     IG"
     gene            319378..320028
                     /locus_tag="MESOP_RS01440"
                     /old_locus_tag="Mesop_0292"
     CDS             319378..320028
                     /locus_tag="MESOP_RS01440"
                     /old_locus_tag="Mesop_0292"
                     /EC_number="2.7.4.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidylate kinase"
                     /protein_id="WP_013891535.1"
                     /db_xref="GI:503657459"
                     /translation="MTHVFTIAIDGPAGAGKGTLARRLADHYRLNLLDTGLTYRAVAH
                     ALLRLGLPLDNVSAAETAARQVDLATLDRAVLSAHAVGEAASKVAVYPTVRRILVEKQ
                     REFAKTPPGAVLDGRDIGTVVCPDADIKLYVTASAEVRARRRLAEIESIGGTADFAEI
                     LADIERRDERDMGRADSPLKPAADAHLLDTSEMAIEAAFLAAMTVIDDVLAKRNKA"
     gene            320234..321931
                     /locus_tag="MESOP_RS01445"
                     /old_locus_tag="Mesop_0293"
     CDS             320234..321931
                     /locus_tag="MESOP_RS01445"
                     /old_locus_tag="Mesop_0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="WP_013891536.1"
                     /db_xref="GI:503657460"
                     /translation="MSAANPTRDDFASLLEESFTAGHSGEGQVVKGTITAIEKDMAII
                     DVGLKVEGRVPLKEFGVKGKDTTLKVGDTVEVYVERIENALGEAMLSREKARREESWV
                     RLEEKFTKGERVEGVIFNQVKGGFTVDLDGAVAFLPRSQVDIRPIRDVSPLMHNPQPF
                     EILKMDRRRGNIVVSRRTVLEESRAEQRSEIVQNLEEGQVVEGVVKNITDYGAFVDLG
                     GIDGLLHVTDMAWRRVNHPTEILNIGQTVKVQIIRINQETHRISLGMKQLESDPWSEI
                     GTKFPIGKKIKGTVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNVHPGKILSTTQEV
                     DVVVLEVDPAKRRISLGLKQTLENPWQAFASSHPVGSQVEGEVKNKTEFGLFIGLEGD
                     VDGMVHLSDLDWTRPGEQVIEEYNRGDMVKAQVLDVDIDKERISLGIKQLAKDTVGEA
                     ANSGELRKNAVVTCEVIGVKDGGLEVRLVESGIETFIKRSDLSRDRDEQRPERFTVGQ
                     KVDARVIAFDKKTRKLQVSIKALEIAEEKEAVAQYGSTDSGASLGDILGAALKKQGN"
     gene            322065..323933
                     /locus_tag="MESOP_RS01450"
                     /old_locus_tag="Mesop_0294"
     CDS             322065..323933
                     /locus_tag="MESOP_RS01450"
                     /old_locus_tag="Mesop_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891537.1"
                     /db_xref="GI:503657461"
                     /translation="MSNGANNAAARPSWLLRLYTNAPVLFCFCAMAILMTALWCLGFR
                     LNNDADDLLKLHEIRTLLETGNIFDRTLPGIVQPEPYVSHWPWIVDLPYAAFARLVTP
                     FAGFEPALMLASFAVPLLLLAPALYFYNRLVIATGFAYPAVAFPLALIFAARTFFEFA
                     PGRIDYHNLQILLLLAALVLMMSRNRFSAFVNGLLTALSIAVSAEFAPFYALVIAVYA
                     FDWIFDREGGESRIVGFGIALAAGAIGLFAAIVPPSAYTAVRCDTYSTPHVTALVAAG
                     LSFAVVPSLAGRRGGWAMRTAILLVFAAASAAALAKLFPQCLASPYASLDAYVRDNMI
                     NRILQEMSLFRRPDVVLSTGFPSMALLFIGALAPAVICAGRHGRSRPLVILALFSLLA
                     LVLAVGYVRYYRYLPIFAGIGLVFVLASLLSPDARLGRYLKSPVPAASRRYTLILPGL
                     VLSVAMALYNLSVKPSEAAVPAGELADNCYSSPFEPEQGWPAGAIVLSPPLVGSRFVA
                     LADGPKVVTIANHPSAKGIERSYRFLDPATADPRAILDATKATHVAICAWRGPPLPAL
                     EAAYPFAAGLIEGRPPAWLRECPTAASSPLRIYSYRNADGTDAVCPASTLAIQARP"
     gene            complement(323918..324625)
                     /locus_tag="MESOP_RS01455"
                     /old_locus_tag="Mesop_0295"
     CDS             complement(323918..324625)
                     /locus_tag="MESOP_RS01455"
                     /old_locus_tag="Mesop_0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013891538.1"
                     /db_xref="GI:503657462"
                     /translation="MTETLKGRHIVVTGGTGALGGAVVGRLLEQGAICHVPNAHAAAP
                     QHFPFAAHENVKLAHNVDLSDSAKVEAFYAQVPALWGSVHLAGGFAAAPVEKIESASF
                     AEMMDTNARTTFLCSRAAIRSMLESGTAGRIVNVTARAGLDLRRGAGMVAYAASKAAV
                     AAMTVAMAEELKAEGILVNAVAPSTLDTPANRADMPDADFTRWVSLEAAAEAIAYLAS
                     PANQAMSGTLVPLYGRA"
     gene            complement(324863..326443)
                     /locus_tag="MESOP_RS01460"
                     /old_locus_tag="Mesop_0296"
     CDS             complement(324863..326443)
                     /locus_tag="MESOP_RS01460"
                     /old_locus_tag="Mesop_0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891539.1"
                     /db_xref="GI:503657463"
                     /translation="MTTLGEALITLLEAHGVDTVFGIPGVHTVELYRGLARSKIRHVT
                     PRHEQGAGFMADGYARASGRPGVAFVITGPGLTNTITAMGQARADSVPMLVISGVNAM
                     PTLGKGLGFLHELPDQRGMMETVALFSQRITEADELPGALARAFALFSSSRPGPVHIE
                     IPTDVMVKPADGIAALLSNVAPPAPDGAAIADAAKLIAAARRPLILAGGGAKRADMAL
                     RRLAETMGAPVVETTNARGLLHRHPLCVPASPSLKAVRALMADADLVIAAGTEFGPTD
                     YDGYGDGGFVLPSNLIRIDIGADQLARRPMTVAIQADCTEAIEALLAAIGAAHPAAPD
                     GQVRAAAAREAGFAELSPAYVAQVHAVEMIRDTLPGAIIVGDSTQPIYAANLYYDHDR
                     PGGWFNASTGFGALGYGPPAAIGAALAMPDAPVVCLTGDGGFQFTLPELGAALDAAAP
                     VIFVVWNNRGYREIETSMLDVGVEPVGVSPAPPDFCKLAEAYGIGAERLADIGALPRA
                     LKRARATGLPCVIEITID"
     gene            complement(326440..327087)
                     /locus_tag="MESOP_RS01465"
                     /old_locus_tag="Mesop_0297"
     CDS             complement(326440..327087)
                     /locus_tag="MESOP_RS01465"
                     /old_locus_tag="Mesop_0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_041163959.1"
                     /db_xref="GI:752465250"
                     /translation="MNTPSRRSFRREGEERRRQDLIEATLDSVAEHGLQGATLRTIAL
                     RAGVTAGLIRHYFPSKEELLQEAYAALMGRMTEQAKAALVMEDASPRQRLAAFITANL
                     DAPIIDARVFSLWATFIGRARADPTLAHAHREGYLGFRNEVEAVVAEVLAAERRNPDT
                     SQLRHHAIAINAIIDGLWIEGCLAGEMFSPGELAAIGIKTVEAELGLAPEGKKNQ"
     gene            complement(327084..327956)
                     /locus_tag="MESOP_RS01470"
                     /old_locus_tag="Mesop_0298"
     CDS             complement(327084..327956)
                     /locus_tag="MESOP_RS01470"
                     /old_locus_tag="Mesop_0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidinotransferase"
                     /protein_id="WP_041163960.1"
                     /db_xref="GI:752465251"
                     /translation="MSAFGSQSMAAPLRRVLMRSAANAMRNADRDAWHYGPGFNPAKA
                     ASQHALLAELVTASGAEIEWIEDTADGLSDSVFTHDPSLMTDRGALILSMGKPLRARE
                     PSLHEETYRRLGIPILGRVEAPGQVEGGDCVWLDARTLVIGRGVRSNQEGIQQVSNLL
                     TPLGVSVYGFDLPLWQGEEACLHLMSVISPLADDLALVYSPLLPAPFYQMLKARNIRL
                     VEGDAEEFAASNGLSLNVLPTSPLKVIAVAGFPKTKAAMEAAGCTVEIFEADALCIAC
                     EGGPTCLTRPILRQ"
     gene            328167..328982
                     /locus_tag="MESOP_RS01475"
                     /old_locus_tag="Mesop_0299"
     CDS             328167..328982
                     /locus_tag="MESOP_RS01475"
                     /old_locus_tag="Mesop_0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_013891542.1"
                     /db_xref="GI:503657466"
                     /translation="MTVVEAATVQSGKVQDGAAEAIHVENLHKKFGELHVLKGVSLSA
                     RDGEVIAIIGGSGSGKSTLLRCINCLENPTSGIIRVNGEEIKLRADSYGHTVPADRKQ
                     IERIRSKLGMVFQNFNLWSHMTLIENVIEVPVHVLGVKRDEAIAQAEKLLARVGLAEK
                     RDVYPAYLSGGQQQRAAIARALAINPRVMLFDEPTSALDPELVGEVLKVIGDLAREGR
                     TMVLVTHEMKFAREVATHVVYLYNGLVEEEGPPEQIFGAPKSERLKQFIRNIG"
     gene            329037..329837
                     /locus_tag="MESOP_RS01480"
                     /old_locus_tag="Mesop_0300"
     CDS             329037..329837
                     /locus_tag="MESOP_RS01480"
                     /old_locus_tag="Mesop_0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="WP_013891543.1"
                     /db_xref="GI:503657467"
                     /translation="MKTVLKTFAAALLLGVAAMGVAKADPVKIGVAAEPYPPFTSPDA
                     SGKWVGWEIEFIDAVCAEEKLDCVITPVAWDGIIPALTTKKIDLIVSSMSITAEREKT
                     IDFSDKYYNTPTAIIGPKDQKFGSTPEDLKGKVVGVQVSTVHAVYAKKHFGATASEIK
                     EYQTQDEANNDLAAGRLDAVQADSIALGEFLKSDQGKACCDLKGMVAPDDEVLGPGVG
                     AGVRKEDTDLKEKINAGIKAIRANGKYDEISKKYFDFDIYGGGGAQSN"
     gene            330047..330712
                     /locus_tag="MESOP_RS01485"
                     /old_locus_tag="Mesop_0301"
     CDS             330047..330712
                     /locus_tag="MESOP_RS01485"
                     /old_locus_tag="Mesop_0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_041163961.1"
                     /db_xref="GI:752465252"
                     /translation="MLGLLHSIEIALGATCLGLLIGTGGAFGKLYGGPVVRDLLAVYT
                     TVVRAVPELVLILLLYYAGTDLINQALTAMGYQRVDISGLAAGIAVLGFVQGAYSTEV
                     IRGAILAIPQGQIEAARAYGMSPGLMLRRITLPAMLPFAIPGLANLWLIATKDTALLA
                     VVGFYELALATRQAAGVTKAYFTFFFAAAVLYLLLSLISNFLIGRVEAWSRRGMPSLK
                     EAR"
     gene            330712..331521
                     /locus_tag="MESOP_RS01490"
                     /old_locus_tag="Mesop_0302"
     CDS             330712..331521
                     /locus_tag="MESOP_RS01490"
                     /old_locus_tag="Mesop_0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891545.1"
                     /db_xref="GI:503657469"
                     /translation="MANEAAVINVVARTSLWLQPHRIVLILVALGLVLGAIFFMRWDW
                     LPQYYEMGLLGIWRSLWILAVTCVLGFLLAVPLGLAQATGSFWFAALAKAFCTVIRGT
                     PLLIQLWLLYYGLGSLFPQYPWIRESWMWPYLRQAWPYGVLALTLSFAGYEGEVMRGA
                     FAGVPKGQLEAARAFGMSRWKIFRRIWLPQAFYRALPTLTGETVLQLKSTPLVATISV
                     IDIFAVSSKVRQDTYLTYEPLLLLALIYMTITGILVFAFGRIEARIPNKIG"
     repeat_region   331515..331645
     gene            331739..332740
                     /locus_tag="MESOP_RS01495"
                     /old_locus_tag="Mesop_0303"
     CDS             331739..332740
                     /locus_tag="MESOP_RS01495"
                     /old_locus_tag="Mesop_0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactate dehydrogenase"
                     /protein_id="WP_041163962.1"
                     /db_xref="GI:752465253"
                     /translation="MQLSLDQARGLCRMAALGAGANEEAAQSLTASIISAEAEGLSSV
                     GLTHFIDYLEALEAGRIDGNADPVITRPALAVYLSDARGGLAHTGFDRTIDDLAKAAR
                     LFGVAIFSQKNAYTCGALGYFTGRLAAQGLVSFAATNGPAVLAGSGSVKPVYCTNPMS
                     FAAPAADGAPLVIDQSSSATAFVNIRKAAEDGKKIPEGWALDESGNPTTDPAAAMKGA
                     MLAFGGQRGANIALMVEVLAAGLSGANWSLDAPWFSGGPDSPGTGLFVLAVEPKLLDP
                     DFEQRMKDQLDRLRRRYGVHVPGRARAEAAEKAQARGITAPKAVVQRISEFAERYST"
     gene            complement(332754..332984)
                     /locus_tag="MESOP_RS01500"
     CDS             complement(332754..332984)
                     /locus_tag="MESOP_RS01500"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163963.1"
                     /db_xref="GI:752465254"
                     /translation="MAIFLLIPVGFSEAQRDILRVKQAFAFGLLFPPAWIGQARLALD
                     KAGCLQSAKRFSGAQKKTHRAAPCAGSLQVTV"
     gene            332983..333264
                     /locus_tag="MESOP_RS01505"
                     /old_locus_tag="Mesop_0304"
     CDS             332983..333264
                     /locus_tag="MESOP_RS01505"
                     /old_locus_tag="Mesop_0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891547.1"
                     /db_xref="GI:503657471"
                     /translation="MTNTKITMLTAVLLLGSFMGATQAATLKAAPVKPSTPGVITAPS
                     GGATEDHYCKNGHAKFANCSADFVAACKKVGGTMSDVQGWGGRTCFTPS"
     gene            333549..334526
                     /locus_tag="MESOP_RS01510"
                     /old_locus_tag="Mesop_0305"
     CDS             333549..334526
                     /locus_tag="MESOP_RS01510"
                     /old_locus_tag="Mesop_0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-beta-hydroxy-delta(5)-steroid dehydrogenase"
                     /protein_id="WP_013891548.1"
                     /db_xref="GI:503657472"
                     /translation="MTEILQTPKLVVVFGGSGFVGRHVVRALAKRGYRIRVACRRPDL
                     AGHLQPLGNVGQIQPVQANVRVRWSVDRAVQGADHVINLVAVLHESGRQKFSAVHEFG
                     ARAVAEAARSVGAGLTHISALGADLGSGSDYARTKALGEQAVLETIKDAVIFRPSINF
                     GPEDSFFNRFANMARYSPVLPLIGGGHNKLQPVYVGDVAEAVARSVEGKVDGGQIYEL
                     GGPKVLTFRECMEELLEVIERKRLLVPVPWWVANIQASILGLLPNPLLTKDQVMQLRE
                     HNIVSDAATKANRTLTGLGIQPQSIATVLPSYLWRFRAAGQFQQRKPAA"
     repeat_region   334577..334689
     gene            complement(334681..336048)
                     /locus_tag="MESOP_RS01515"
                     /old_locus_tag="Mesop_0306"
     CDS             complement(334681..336048)
                     /locus_tag="MESOP_RS01515"
                     /old_locus_tag="Mesop_0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_013891549.1"
                     /db_xref="GI:503657473"
                     /translation="MDTQPAPFVPPAPKPRTSPPSTLEMIRIVYRNPLELWGEPTYNE
                     PWISANGAGGPLVIANDPGLIRHVLVDNAKNYKMATVRQKILRPILRDGLLTAEGEVW
                     KRSRKAMAPVFTPRHIFGFAQPMLKRTREFATRYEAGGMSDIAHDMTLLTYDILAETL
                     FSGEIAGEQGSFANEIDRLFETMGRVDPLDLLRAPDWLPRLTRIRGRKTMAYFRKIVT
                     DTVKMREEKVRRDPDAVPQDFLTLLLKAEGPEGLTRAEVEDNIITFIGAGHETTARAL
                     GWTLYCLAESPWERNRVEQEIDQVLAREADPTKWLDAMPLTRAAFEEALRLYPPAPSI
                     NREPIVPEMWKDLYIPKHAAVLVMPWVVHRHRKLWDRPDAFLPERFHPGNREKIDRFQ
                     YLPFGAGPRVCIGASFAMQEAIIALAILLSRFRFDVTAETKPWPVQKLTTQPHGGLPM
                     QVTPR"
     repeat_region   336151..337630
     gene            complement(336455..337486)
                     /locus_tag="MESOP_RS01520"
                     /old_locus_tag="Mesop_0307"
     CDS             complement(336455..337486)
                     /locus_tag="MESOP_RS01520"
                     /old_locus_tag="Mesop_0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013891550.1"
                     /db_xref="GI:503657474"
                     /translation="MEHYIGLDVSMKETAISIRQNGKRIWRGKCASDPQLLAAVIRKR
                     APHVRRVVFETGPLSVWFYHALTAEGLPVICIDARHAKAALDMAANKTDANDADGLAH
                     LAEVGFYREVRVKGFDSMLIRTLITARRQLLKMRLQISNQIRGLMKTFGLVVPKGAGS
                     VFERNVRDLLQGEEKLARIVVPMLQAWSGIRYQIAELSKQLAATAREDQHCRLLMSVP
                     GVGTVTATAFAAAVEDPANFRNSRAVGAWVGLTPRRYQSGEVDNDGHISRRGDNQLRG
                     LLYEAAAVILNRSTDTSSLRTWALELKDRIGFKRAAVALARKLAVIMHAMLRTGELFD
                     PHGGTQAAV"
     gene            337734..338303
                     /locus_tag="MESOP_RS01525"
     CDS             337734..338303
                     /locus_tag="MESOP_RS01525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="WP_041164472.1"
                     /db_xref="GI:752465763"
                     /translation="MKHQLNIIIGSTRPGRAGPVFAEWLEAFAREHGKFEPVLTDIAA
                     FDLPVLDEPHHPRLGNYQNDHTKAWSKATDAADAFVFVAPEYNYFVAPAIVNAVDYLA
                     REWKYKPAAIFSYGGVSGGLRAAQALKPLLTSVGIMPIPEGVALPMYQKLLDENRAFN
                     ASEQVAGGAKIMLDELSRWSEALKPMRAA"
     gene            338385..341015
                     /locus_tag="MESOP_RS01530"
                     /old_locus_tag="Mesop_0309"
     CDS             338385..341015
                     /locus_tag="MESOP_RS01530"
                     /old_locus_tag="Mesop_0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C14"
                     /protein_id="WP_013891552.1"
                     /db_xref="GI:503657476"
                     /translation="MRLLFALLLMLATTATAVAERRVALVMADDDYRLVRALANPVHD
                     GEAMEASLKKLGFEVVLETNRDLRRMRRALDDFREDAKGADVALVYFSGHGVEISGDN
                     RLLPVDADASSLDALDKTSLPLEEVRDAVAATAKVGLIVLDACRSDPFSGNGGEGRGA
                     TALAKDVVDKVKPGLGRVGRAENILFAFSAAPGETAADGTGQNSPFTTALTKYLGTDG
                     LEIRSVLTLVQQEVYDLSRGKQLPYVESGLPKLFFAATAREQLPERERLLLAMADVTP
                     EMRGQVEQIASDADMPLAPLYGALISADTSHLSADRLNARLREAADAFVKVRAEMKTL
                     AADDPRVTELRRQAEEQLALGAFGAAQAKLAEAVAVDEVSRKALKANFVDRTLSQAAT
                     LFLSAGAARADLSYAAAIKGYETVLSLYGEAGQTALNLEQADRQSRTLEELGQLYTTV
                     GNVEAAGRAFTALLGDLEQRSRQEADPSVKRDLAISHIKLANIKMAQGDLPTSLENYE
                     AARGMLQQLTASMPNKKDWLGDLAMANDKIGNVLATQGDVGAAAQAYRESLSIKQKLA
                     DAEPDSAYRLRDLTISYDEIGDLARAAGQLDDAQTAFEESLRIRLVLTGNKPDDPERQ
                     RAVAVSQERIGDVLRQRGDAAGALVAYSNSQAIAEDLVRRDPNDTDLKRDLSISYAKI
                     GNALNDQENWPAALASYRQALAVARDLAADDPANTEWQRDLSVCLEKVAGVLDAQGNT
                     GDALQNYQDSLAIADRLAKLDPGNSDWQRDLSITLSEIGMLETKQRHFEGSKKAFEAS
                     LGIRQQLARSDPNNAIWQFDLVQAYINYAYVAKDPKAVLTKALNLALELDRTGRLAPR
                     DKPTIKYLRGLLAKFGTRKK"
     gene            341161..343632
                     /locus_tag="MESOP_RS01535"
                     /old_locus_tag="Mesop_0310"
     CDS             341161..343632
                     /locus_tag="MESOP_RS01535"
                     /old_locus_tag="Mesop_0310"
                     /EC_number="5.99.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_013891553.1"
                     /db_xref="GI:503657477"
                     /translation="MSDQIENTNGAEAEYGADSIKVLKGLDAVRKRPGMYIGDTDDGS
                     GLHHMVYEVVDNAIDEALAGHADLVTVTLNPDGSVTVIDNGRGIPTDIHTGEGISAAE
                     VIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSAWLKLKIRRNGQIFEMSFTHGNA
                     DAPLKVTGAYEQDKQPGTYEGRSGSEITFFPSSETFTMVEFDFGTLEHRLRELAFLNS
                     GVRIVLTDARHADVLRHELHYDGGLEEFVKYLDRVKKPLIDKPIAIKAERDGITVEVA
                     MWWNDSYHENVLAFTNNIPQRDGGTHLAGFRGALTRQITGYGDSSGLTKKEKVSLIGD
                     DCREGLTAVLSVKVPDPKFSSQTKDKLVSSEVRPVVEGLVNEALGTWLEEHPTEGKVV
                     IDKVIQAAAAREAARKARDITRKSSLGVTSLPGKLADCQERDPAKSEIFIVEGDSAGG
                     SAKGGRSRQNQAILPLRGKILNVERARFDRMLGSDMIGTLITALGTSIGKDEFNADKL
                     RYHKIILMTDADVDGAHIRTLLLTFFFRQMPELIERGHLYIAQPPLYKVTRGKSSQYI
                     KNESAFEEFLIGSGLEEASLALGSGEVRAGQDLRSAIDDALAVRQLINGLHTRYNRGV
                     VEQAAIAGGLNPDVFADLGRANAMAERVAQRLDIIAEDTERGWTGRMSTSNEGIGGYV
                     FERTVRSVKEYAHLDMALINSADARQLDRYAQRLSEVYGTPPVLRRKDISETVSGPLA
                     LLNAVFATGRKGLTMQRYKGLGEMNAEQLWETTLDPNVRSLLQVKVNDATDADSLFSR
                     LMGDEVEPRREFIQDNALSVANLDI"
     gene            343869..344795
                     /locus_tag="MESOP_RS01540"
                     /old_locus_tag="Mesop_0311"
     CDS             343869..344795
                     /locus_tag="MESOP_RS01540"
                     /old_locus_tag="Mesop_0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013891554.1"
                     /db_xref="GI:503657478"
                     /translation="MQSSTLSAVGVSTATESSSTAVSWGPIIAGAFAASTLTFILMLL
                     GSGLGLTMVSPWSGSGLSATSFAVSTAIWLVVVQWLSSGVGGYLAGRLRTKWVGIHTD
                     EVYFRDTAHGFLAWALATLLVVGVLGSALSAAIGTGVQAASNVASGAATGASAGASAN
                     ASNASASADNATSYLVDSLFRPADPAKLATGNPGDQAAAAGQASRILIAGTVAGEVSA
                     EDKTYLSQLVAARTGLSEADAKTRVDAVLAKAQDAKVKAQQAADTARKASATFALLGA
                     LSLVIGAFIASAAAALGGRQRDDEEAVFLANP"
     gene            complement(344888..346285)
                     /locus_tag="MESOP_RS01545"
                     /old_locus_tag="Mesop_0312"
     CDS             complement(344888..346285)
                     /locus_tag="MESOP_RS01545"
                     /old_locus_tag="Mesop_0312"
                     /EC_number="1.6.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD synthetase"
                     /protein_id="WP_013891555.1"
                     /db_xref="GI:503657479"
                     /translation="MNANFASFLYLVSGVLFIMALRGLSHPTTSRQGNLYGMIGMGIA
                     IATTLALATPSAPRFGLIVLGLAIGGGVGAVTARRIAMTSMPQLVAAFHSLVGLAAVM
                     VAAAAIYAPESFGIGTAGDIHAQALIEMSLGVAIGAITFTGSVIAFLKLDGRMSGKPI
                     MIGGRHFINAALGVALIVLIILLVTTESKLVFWLIVAASLVLGILLIIPIGGADMPVV
                     VSMLNSYSGWAAAALGFTLGNLALIITGALVGSSGAILSYIMCKGMNRSFISVILGGF
                     GGETTAAADDGIERTVKQGSADDAAYLMMNAQKVIIVPGYGMAVAQAQHALREMADKL
                     KANGVDVKYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEDINSEFAQADVAYVIGAN
                     DVTNPSARDDKSSPIYGMPILDVDKARTCLFVKRSLGSGYAGIDNTLFYKDGTMMLLG
                     DAKKMTEEIVKAMDH"
     gene            complement(346292..346717)
                     /locus_tag="MESOP_RS01550"
                     /old_locus_tag="Mesop_0313"
     CDS             complement(346292..346717)
                     /locus_tag="MESOP_RS01550"
                     /old_locus_tag="Mesop_0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006339983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="WP_013891556.1"
                     /db_xref="GI:503657480"
                     /translation="MDQTLQKALDQLDQASAAVRLAVQNLANAPGGTDAAGDAAHALS
                     GGAIDPFVFRFAIFVLAIFVGYYVVWSVTPALHTPLMAVTNAISSVIVVGALLAVGIA
                     ASGVAAGFGFVALMLVSVNIFGGFLVTQRMLAMYKKKDK"
     gene            complement(346717..347997)
                     /locus_tag="MESOP_RS01555"
                     /old_locus_tag="Mesop_0314"
     CDS             complement(346717..347997)
                     /locus_tag="MESOP_RS01555"
                     /old_locus_tag="Mesop_0314"
                     /EC_number="1.6.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="WP_013891557.1"
                     /db_xref="GI:503657481"
                     /translation="MGQTVFIPRELDANEPRVAASPDTVKRLAGLGFDVVVETGAGTR
                     SRIPDEEFAKAGAAIGKAADVGKADVVLKVRRPSEAELKGYKSGAAVIAIMDPYGNDA
                     AVAALAKAGVTAFSMEFMPRITRAQSMDVLSSQANLAGYQAVIDGASEYDRALPMMMT
                     AAGTVPAAKVFIMGVGVAGLQAIATARRLGAVVTATDVRPAAKEQVASLGAKFLAVED
                     DEFKAAETAGGYAKEMSREYQAKQAALTAEHIAKQDIVITTALIPGRPAPKLVSAAMV
                     ASMKPGSVLVDLAVERGGNVEGAVPGQVVNTANGVKIVGHLNVPGRVAASASLLYARN
                     LFAFLETLVDKTTKTLAINRDDDLVKATMLTDGGKVVHPAFAKADQQPPKGQYVEPAA
                     IPAKTMVADASPKKSAPRKTAASKSPSSKSKGTA"
     gene            complement(348084..348308)
                     /locus_tag="MESOP_RS01560"
                     /old_locus_tag="Mesop_0315"
     CDS             complement(348084..348308)
                     /locus_tag="MESOP_RS01560"
                     /old_locus_tag="Mesop_0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase subunit IV"
                     /protein_id="WP_013891558.1"
                     /db_xref="GI:503657482"
                     /translation="MADHTPSGPVELGAKMDYAEHDRTYAGFLMLAKYGSLFCGAILL
                     AMAFGFFAGGFFSATILFILIMAVGAFILR"
     gene            348519..349334
                     /locus_tag="MESOP_RS01565"
                     /old_locus_tag="Mesop_0316"
     CDS             348519..349334
                     /locus_tag="MESOP_RS01565"
                     /old_locus_tag="Mesop_0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_013891559.1"
                     /db_xref="GI:503657483"
                     /translation="MTTPIQTFDWNETAIAWGTAGSGPPIVLVHGTPFSSHVWHRVAP
                     ELAREHTLYFYDLPGYGRSTKREGQDVSLGIQNEALAAMLAFWKLDRPKIIAHDFGGA
                     TALRAHLIDGRDYDRLLLIDPVAVRPWGSPFVQHVRRHEAAFAGVPDYIQVAILKAYV
                     SGAAARPLSDSELEPYIAPWTGPIGQPAFYRQIAQMDPRFTDEVEPLYGELRCPVALL
                     WGEDDRWISPQSGQKLAAMLPDCALTLVPGSGHLMQEDRPEAIVAAALRFFAG"
     gene            complement(349744..350523)
                     /locus_tag="MESOP_RS01570"
                     /old_locus_tag="Mesop_0318"
     CDS             complement(349744..350523)
                     /locus_tag="MESOP_RS01570"
                     /old_locus_tag="Mesop_0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891561.1"
                     /db_xref="GI:503657485"
                     /translation="MDAHLTALRQVAGVSEENSPDNMSSFARNISAMLERTEYRRCDK
                     GEDLEDIYRLRYKSYRLSDMVPENPDHIIHDELDEAENCSKFGIYIDGDLVSTLRIHH
                     ACHETPQSPSTTVYGDILRPMLAAGAHFADPSRFAADPDWSRVYPQIPYLTLRLAGMA
                     CFYFDAPYCLSTIRPEHAGFYRRIYCSEQIGELRDYPGLNYKVVLYRANVNAIRERSF
                     SRFPFFRSTPLEQRMLFETPGAGELAPLTILPTAKYFREAA"
     gene            complement(350671..352983)
                     /locus_tag="MESOP_RS01575"
                     /old_locus_tag="Mesop_0319"
     CDS             complement(350671..352983)
                     /locus_tag="MESOP_RS01575"
                     /old_locus_tag="Mesop_0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="WP_013891562.1"
                     /db_xref="GI:503657486"
                     /translation="MNLRKKNEIPVDVYIPFVETLFRDGLTLSIGFFAQTLLVVLVYW
                     KTRDPAYLAVTFGFLAVAFLRLRNIRKYRHAPTPKSWEEARRRENDYIFYGSMHGFML
                     GTFCFVGIYLAYDGFAEIAAVCVTLASATSIAGRNYGSPRMVMIFIMTMTWPISLGFI
                     LRGDPYHFILGLLSAPFLFAIKRFADLVREVLFAALSEEKKANRLAQRFNRALNTMSH
                     GLVMLGPDGRVAVANAEAAHLMSLKSADALLGRSIHGLLMRGVAGGMLAPKDCRYIEA
                     QLTRALREGRDRKVLVSLANGQHYEFSAREGSQELGVITFEDVTARVEAEDKIRFMAR
                     YDNLTGLPNRAYFHELIGEAMASGDRDRLCGLAVLDLDDFKSVNDTLGHPIGDGLIYA
                     VAERLAAVAGQGITVSRFGGDEFMVFFDRIEDESHLTIQIDEIFAALQGEVDVAGHGL
                     RIQASGGAVLSRVRDSDVDAMIVKADLALYKAKELGKNGWRLFEAAMDAAFRNRQLMK
                     ADLRSAVESKGLRVVYQPIVAMSTMRIASCEALCRWDHPDLGPVSPGIFIPLAEEMGI
                     ISEISTFVLHAACTECAKWPDQTSVSVNLSAKDFRSRDVIQKVRDALASSGLAAGRLE
                     IEVTETALLDDKSLTRQYIEELKQIGVRIALDDFGTGYSSLSYLHKLPLDKIKIDRSF
                     LMDVTQNSRSLELLKGIVNLSRPLGLSVTVEGVETFEQLKILALEVKPDLVQGFLFGS
                     ALSASGIETMSTTVWPFAKEIKSAKRASRG"
     gene            complement(353127..356606)
                     /locus_tag="MESOP_RS01580"
                     /old_locus_tag="Mesop_0320"
     CDS             complement(353127..356606)
                     /locus_tag="MESOP_RS01580"
                     /old_locus_tag="Mesop_0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010913009.1"
                     /note="Catalyzes the ferredoxin-dependent oxidative
                     decarboxylation of arylpyruvates; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013891563.1"
                     /db_xref="GI:503657487"
                     /translation="MTLHDVALDDKFDLGKERIFLSGAQAVIRMLLMQRERDRRAGLN
                     TAGFVSGYRGSPLGGLDMQLWKAKKQLAGADIVFQPGLNEELAATACWGSQQTELLGE
                     GTHDGVFSVWYGKGPGVDRSGDVFRHANLAGSSKHGGVLALMGDDHMAESSTNAHATE
                     FLFVDTMVPILNPAGVQEIIDYGLYGFAMSRFAGTWAAIKCVKDNIESTASVDASLER
                     LNIVVPEFDMPPGGLNIRHEIDMLGQEERLHEHKRAAASAFIHANGLNRIVYSGGRSP
                     KIGIITLGKSYLDVRQALEDIGIDEAAANRIGVRLFKVGCPWPLDLHHIADFARGLDT
                     IVVVEEKRSLIEVQLRESLYGTASQPVIVGKKDERGDWLFPAKGALDPNEIAIALGEK
                     IVKTIGPSEEISARVGKLRQFQAMLADATDIGSRTPFFCSGCPHNSSTKVPDGSIAAA
                     GIGCHFMALWMDRNTLGFTAMGGEGAQWVGQAPFSKRDHIFQNLGDGTYNHSGTLAIR
                     FALSSEANITYKILYNDAVAMTGGQPHEGGLTVEMIARQVRAEGVDRIAIVTDEPDKY
                     AGKVEFPAGASIHHRDDLDLVQRELRDVKGVSILIYDQTCAAEKRRRRKRGTFPDPDK
                     RVFINELVCEGCGDCGVQSNCVSIQPVETEFGRKRKIDQSSCNKDFSCINGFCPSFVT
                     VHGAKIRKAEGLAGKADPLDGVPTPAEFPLGAEGWAAIIDGVGGTGVVTVGAVLGMAA
                     HLEDKGCGMIDMAGLAQKGGSVFTHVRIARTPDDIHAIRVSAGKADLVLGCDLVVSGA
                     KKVLTAVREGHTIFLANTAEIMPGEFARSADFSLPIERLKKAIRSAAGDDKAHFFDAT
                     RTATALFGNSLGANMFMLGFAFQHGGLPLSAEAVERAIELNGEAVAMNIAAFRWGRRA
                     AHQPDFVRGLVAQPGKAGQAAPVAQTLDEIIGRRVAFLTAYQNAAYGKRYADSLARLR
                     AAETKAVPGSTAVTEAAARNLFKLMAIKDEYEVARLYTDGSFAAELGKQFQSYEKLEF
                     HLAPPIMGRRGNDGKPRKSSFGPWMMKGFRLLAALKGLRGTAFDLFGYTGERRMERQL
                     LAQYEGDLELVAKSLAPGKIEAATALMSVPALIRGYGHVRQASAEKAAGERQRLLERL
                     SAASKRPELQAAE"
     gene            complement(356824..357375)
                     /locus_tag="MESOP_RS01585"
                     /old_locus_tag="Mesop_0321"
     CDS             complement(356824..357375)
                     /locus_tag="MESOP_RS01585"
                     /old_locus_tag="Mesop_0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163964.1"
                     /db_xref="GI:752465255"
                     /translation="MRSRMLRRISRSVVVGAMLIAAAALGACRDTGKDGEGKLFEVSG
                     KIFVFNYRLARATYVVTLRPLRPMGEGQVAVASFQNPAGGAPIVVEQKVWPKLGKVSL
                     ESPALTCIVKNKPYAIAISIKGADGAVLQKIDTTLMSTEDQSILPDRPLVIDQLYTAN
                     PDLAGHPDGKLPGEPKPDCSKAG"
     gene            complement(357356..357967)
                     /locus_tag="MESOP_RS01590"
                     /old_locus_tag="Mesop_0322"
     CDS             complement(357356..357967)
                     /locus_tag="MESOP_RS01590"
                     /old_locus_tag="Mesop_0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891565.1"
                     /db_xref="GI:503657489"
                     /translation="MTVAWTPHRFTGGLLALDTANTVVLRGDPQRTFDRFDDPAEIAR
                     FAEAASGFRADELGDRRLAVSSPAAIAPVVLSIREATDRLFRGAVSKGVLATADMPGF
                     LTACAEGLAGSRTEIGAPGRPFGDPVTPIAFEAALAVSALSLLRDDTVARLRICPNCT
                     WLFVDRSRNSSRLWCDMAVCGNRQKASRHYRRRRMAAHEVKDA"
     gene            358114..359019
                     /locus_tag="MESOP_RS01595"
                     /old_locus_tag="Mesop_0323"
     CDS             358114..359019
                     /locus_tag="MESOP_RS01595"
                     /old_locus_tag="Mesop_0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891566.1"
                     /db_xref="GI:503657490"
                     /translation="MLYFFQQVLNGLHSGALYALLAFGYVLTNGILHRTNLAYGALFA
                     FCGQAMILTVAFGYQVLWLTLLASVLLGVVAALLYAALISHVLSRSVFEPLADRTPNA
                     IVVTTLGILLVLSEASRIAADTHDLWLPPMLAQPIVFAEGAGFKATLTLIQVLDCAAV
                     LAAVLLATWVFARSSFGRSWRAVSDDPGAAALCGVDVRTVFRRAVLYGGLCAALAGVM
                     ASLYYGNVSFGSGLVYGLKILFVTAVGGYLSPPRAALGAAAFGMAESLWAGYFPIEWR
                     DAWMYLFLVAMLVLIGAGRDTSKVV"
     gene            359204..359788
                     /locus_tag="MESOP_RS01600"
                     /old_locus_tag="Mesop_0324"
     CDS             359204..359788
                     /locus_tag="MESOP_RS01600"
                     /old_locus_tag="Mesop_0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_013891567.1"
                     /db_xref="GI:503657491"
                     /translation="MAGLLALSRAIDRLNEFIGKSVSWLILLAILVSAVNAVIRKVFD
                     ISSNAWLELQWYLFGAAFMLAAAYTLKQNEHIRIDIVYGLFSRRVQHWIDLLGHLLFL
                     MPFVTLMVFYFVPYVRLSFHSGEMSNNSGGLIVWPAKAILLVGFFLLALQGISEIIKK
                     IAIIRGDMDDPTPFISVHEQAELEAKALADEVRS"
     gene            359788..361575
                     /locus_tag="MESOP_RS01605"
                     /old_locus_tag="Mesop_0325"
     CDS             359788..361575
                     /locus_tag="MESOP_RS01605"
                     /old_locus_tag="Mesop_0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_013891568.1"
                     /db_xref="GI:503657492"
                     /translation="MEFIAQNMAPIMFASLILFMLIGYPVAFSLAANGLMFFFIGVLL
                     TPYSGGAINLAWPLLYALPDNFYGSRVMSNDTLLAIPFFTFMGIVLERSGMAEDLLDT
                     IGQLFGPIRGGLAYAVIFVGALLAATTGVVAASVIAMGLISLPIMLRYGYDRRLASGV
                     IAASGTLAQIIPPSLVLIVLADQLGRSVGDMYAGALIPGLVLTGLYAFYILIVSIFRP
                     KMMPALPLEARTLGHGVMSLLVALVATVAISYAAYRYLAPAHGDNADILGATAGVIVI
                     YIVAITDRRLNIHMMSRLAQQVVIVLIPPLALIFLVLGTIFLGIATPTEGGAMGAVGA
                     LAMAAAKGRLSLDVIKQALASTTRLSSFVLFILIGARVFSLTFYGVNGQIWVEHLLTS
                     LPGGEVGFLIGVNILVFFLAFFLDFFELAFIIVPLLAPAADKLGIDLIWFGVLLGVNM
                     QTSFMHPPFGFALFYLRSVAARVPYLDRLTGKQVAPVTTGQIYWGAVPFVLIQVIMIG
                     LTISFPQMVMRYKGTATDAGTIDYKVPEMPSLSPLSAPQGGSAPANGGNGPAAPGTPD
                     LSQPPSFGDAPPAKPATPTPDLSQPPSFN"
     gene            361589..362617
                     /locus_tag="MESOP_RS01610"
                     /old_locus_tag="Mesop_0326"
     CDS             361589..362617
                     /locus_tag="MESOP_RS01610"
                     /old_locus_tag="Mesop_0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iditol 2-dehydrogenase"
                     /protein_id="WP_013891569.1"
                     /db_xref="GI:503657493"
                     /translation="MRAVRLEAVGSISLREVDRPVPGPNDLLVRVEACGVCGTDRHLF
                     HGEFPCRPPVTPGHEFSGIIEAVGAEVSGFAVGDRVTGDPNIACGRCPHCHAGRVNLC
                     RNLNAIGIHRDGGFADYVVLPQKQAFILPAALKPTHGAFCEPLGCCLHGVDLAEIKPG
                     SSVVVLGGGVIGLLTVQLARLAGATTIILSTRQASRRTLAEELGATATVDPTAGDVID
                     AIAGPAGLMPGGVDVVFECAGVRETVEQSMRLARAGGTVVIVGVTPQGMKVEFEPFDL
                     LFRELKVLGSFLNPYTHRRAAELIASGAIEIDRLISRQVTLEEAPAVIANPPAPGEVK
                     VLVVPGLG"
     gene            complement(362696..363805)
                     /locus_tag="MESOP_RS01615"
                     /old_locus_tag="Mesop_0327"
     CDS             complement(362696..363805)
                     /locus_tag="MESOP_RS01615"
                     /old_locus_tag="Mesop_0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013891570.1"
                     /db_xref="GI:503657494"
                     /translation="MDRRSFIRKAGVTGVGAAAAAATLAAPAIAQSNPKVTWRLASSF
                     PKSLDTIYGGAEVFSKMLSEATDGNFQIQVFAAGELVPGLQAADAATAGTVEACHTVA
                     YYYWGKDPTWALGAAVPFSLNARGMNAWHYHGGGIDLFNEFLATQGLFGLPGGNTGVQ
                     MGGWFRKEINTVADLSGLKMRIGGFAGKVVQKLGVVPQQIAGGDIYPALEKGTIDAAE
                     WVGPYDDEKLGFYKVAPYYYYPGWWEGGPTVHLMFNKAKYEELSPTYKSLLRTCAQAA
                     DANMLQKYDYLNPPAVKRLVAGGAKLRPFSQDIMAACFEKANEVYAEMEASNAPFKKI
                     WDSIKGFRKEHYLWAQVAEYNYDTFMMVQQRNGKL"
     STS             363586..364094
                     /standard_name="ha2356"
                     /db_xref="UniSTS:515533"
     gene            364069..364842
                     /locus_tag="MESOP_RS01620"
                     /old_locus_tag="Mesop_0328"
     CDS             364069..364842
                     /locus_tag="MESOP_RS01620"
                     /old_locus_tag="Mesop_0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_041164474.1"
                     /db_xref="GI:752465765"
                     /translation="MQQPLVAISTDVRRFDNYTWHAAPQQYLEAAITGAGVFPLLVPS
                     FGDRLDFDELLSSVDGVMVTGSKSNVHPSLYGGDASEANGPYDPARDATTLPLIRKAI
                     ERGVPLLAICRGIQELNVALGGTLGTEIQEREGSLDHRAPVSDKQDERFAIHQTISIK
                     PGSCLAGVFGAGDMKVNSLHRQAIDRLGSKLEVEAVATDGTVEAVSVRGARAFAVGVQ
                     WHPEYWVKSDSNSVKIFRAFGDAVRLHAAAKAGARAAAE"
     gene            complement(364843..365247)
                     /locus_tag="MESOP_RS01625"
                     /old_locus_tag="Mesop_0329"
     CDS             complement(364843..365247)
                     /locus_tag="MESOP_RS01625"
                     /old_locus_tag="Mesop_0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891572.1"
                     /db_xref="GI:503657496"
                     /translation="MKTLSALIAAAALFGGIQLYHGGTWESAANEPAPSNTYRLVANG
                     DEAACAVSRGAEISDGLSLLSVAPACRRLLPGIEQAKFWREQTDGSVAFSANGIDPIV
                     TFSIADGNGYESYAPATPLLSLAATGGLKSED"
     gene            complement(365333..366316)
                     /locus_tag="MESOP_RS01630"
                     /old_locus_tag="Mesop_0330"
     CDS             complement(365333..366316)
                     /locus_tag="MESOP_RS01630"
                     /old_locus_tag="Mesop_0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="WP_013891573.1"
                     /db_xref="GI:503657497"
                     /translation="MTKAEELQAVAILVPAGFSDHAVERIERTFRRIGIERADAALVT
                     DEMRSTVRGIASFAGINAAMMDALPNLELIASFGVGYDSVDVGHAAAKNIMVTNTPDV
                     LTEEVADTAIGLLINTIRDLPRAETWLRDGSWAKKGEYPLSRLTLRARRVGIFGMGRI
                     GRAIARRLEAFGLPVAYHNRHRVEGLAYQYHPTLKGLAEAVDTLISVAPGGASTQKAV
                     NAEILVALGANGVFVNIGRGSTVDEAALAAALANGTIAAAGLDVFAAEPNVPKALLDA
                     PNASLLPHVGSASQHTRRAMADLCVDNLVSWFGERRPLTPVPETANVRARG"
     gene            complement(366313..367290)
                     /locus_tag="MESOP_RS01635"
                     /old_locus_tag="Mesop_0331"
     CDS             complement(366313..367290)
                     /locus_tag="MESOP_RS01635"
                     /old_locus_tag="Mesop_0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013891574.1"
                     /db_xref="GI:503657498"
                     /translation="MSTATVSLALRDSPLVAGSTRDRIKEHARAIGYIYNRRAASLRT
                     SRSGIVGVVVHDIMNPFFAEILRSIESELDRSRQTFILSNHYDQLEKQRTFIDTLLQL
                     GADGVIMSPAIGTPASDILMAEENGLPAVLIARTVEGADVPVFRGDDAYGTGLATNHL
                     ISLGHKRIAMIGGTDQTSTGRDRYQGYVNAMEAAGLEVRPSWRIAGPRTKQAGFEAAG
                     QFLALKDRPTAACCWNDLVAIGLMNGIARAGLVPGVDISVTGYDDLEEAAIATPALTT
                     VWNGQREVGRRAASALLDKLNGQTVRPSQELIKPELHVRQSTGKPVERA"
     gene            complement(367414..368298)
                     /locus_tag="MESOP_RS01640"
                     /old_locus_tag="Mesop_0332"
     CDS             complement(367414..368298)
                     /locus_tag="MESOP_RS01640"
                     /old_locus_tag="Mesop_0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_041163965.1"
                     /db_xref="GI:752465256"
                     /translation="MLSTYVFFTFLDTSSKYLVLAGVSVLIVAWVRFAVHVVLVGALL
                     RGWRQPVRFRPVNLPAHVLRGLFLFGSTIFNVLALRSLQLAETTSIYFFGPMVITALA
                     GPLLGEWAGWRRWLAIVAAFAGVLIITRPGVGVFGIGHLFALGSMLSNCFYVIMTRRM
                     SATETSESLILFSALAPAVLLLPLLPFSFSLPHDGWHWFILLMLGVFGGVGHWLLVQA
                     YRLATTTALAPYPYSQMVWMIISGWIVFKQFPDRWTLLGAAIIVASGLYIVHREHRLR
                     LQSRAASDVEAEALAKKL"
     gene            complement(368497..368904)
                     /locus_tag="MESOP_RS01645"
                     /old_locus_tag="Mesop_0333"
     CDS             complement(368497..368904)
                     /locus_tag="MESOP_RS01645"
                     /old_locus_tag="Mesop_0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891576.1"
                     /db_xref="GI:503657500"
                     /translation="MFDTKFAIVLREDLPVWQKLNVTAFLTSGIVAQFPGIIGEPYRD
                     RSGNLYNPLSIQPVIVLSADQATLAAIHRRTLERGVTTSLYVEEMFSTGFDAANRAVF
                     AEFAPEDAKVVGIALRADKKVVDKITKGARMHA"
     gene            368952..369827
                     /locus_tag="MESOP_RS01650"
                     /old_locus_tag="Mesop_0334"
     CDS             368952..369827
                     /locus_tag="MESOP_RS01650"
                     /old_locus_tag="Mesop_0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013891577.1"
                     /db_xref="GI:503657501"
                     /translation="MSHDLGSQAFEGLGRLCADAAENCIISAPDPAGMERIEARFHGS
                     AFDLHRHDTYAIGVTLQGVQTFRYRGETRVSLPGQIIVLHPDELHDGGAGTEDGLRYR
                     MLYLEPSLMLDCLGGASLPFVRDAVVTDDAFCATLLSALGPLEQELDELFVDDFLAQL
                     MQRLSRHAGQPGKPIARTAWQAAAAARDYLTENLNRPVGSGELEAITGLDRYALSRHF
                     RAAFSTSPHRFLVMRRLQHARRMIIAGEPLAQIAVEAGFSDQSHFNRQFKKAFGMTPG
                     RWSSLIRGPAAMAAA"
     gene            complement(369844..370314)
                     /locus_tag="MESOP_RS01655"
                     /old_locus_tag="Mesop_0335"
     CDS             complement(369844..370314)
                     /locus_tag="MESOP_RS01655"
                     /old_locus_tag="Mesop_0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009756470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013891578.1"
                     /db_xref="GI:503657502"
                     /translation="MAKADKTATMSRLHSAARLARTALAARLLAHGFYAGQDQIMLAL
                     DREDGQTPGNLAGRLGVRPPTITKTINRLQAQGFLEKRASEADARQAHIFLTDTGRET
                     IRAIEKSVKKTEKQALKGLDKKDQKALFKLLARIEANLSNEELVLMDDDAESDD"
     gene            370735..371787
                     /locus_tag="MESOP_RS01660"
                     /old_locus_tag="Mesop_0336"
     CDS             370735..371787
                     /locus_tag="MESOP_RS01660"
                     /old_locus_tag="Mesop_0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein CobW"
                     /protein_id="WP_013891579.1"
                     /db_xref="GI:503657503"
                     /translation="MSDAQTQIPVTVLTGYLGAGKTTLLNRILSESHGKRYAVIVNEF
                     GEIGIDNDLIVESDEEIYEMNNGCVCCTVRGDLIRVVEGLMRRPGRFDAIVVETTGLA
                     DPVPVAQTFFMDDDVRSKTKLDAVVALVDAKHLPLRLKDSREAEDQIAFADVVVLNKT
                     DLVTPEELAKVEATIRAINPAARIHRTTRAGVALSEVLDRGAFDLSKALENDPHFLEA
                     HDDHDHHHHDHDGHDHHDHDRHDHHHHAHPSDIHDVTVQSVSLRGGEMDPKKFFPWIE
                     KITQMEGPNILRLKGIIALKSDDERYVIQGVHMIIEGDHQRAWKDGEKHESRLVFIGR
                     ELDAERLKKSFDACQA"
     gene            371847..372125
                     /locus_tag="MESOP_RS01665"
                     /old_locus_tag="Mesop_0337"
     CDS             371847..372125
                     /locus_tag="MESOP_RS01665"
                     /old_locus_tag="Mesop_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891580.1"
                     /db_xref="GI:503657504"
                     /translation="MPRTADNKTERYQIRIAPAQKAMIARAAALSHQDVADFILNKVV
                     PEAQAVIEAAEVTKVSDRDFTRILDLLEHPPKPNAKLRAAIAALPDTL"
     gene            372122..372649
                     /locus_tag="MESOP_RS01670"
                     /old_locus_tag="Mesop_0338"
     CDS             372122..372649
                     /locus_tag="MESOP_RS01670"
                     /old_locus_tag="Mesop_0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006202377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_013891581.1"
                     /db_xref="GI:503657505"
                     /translation="MTLPSWHEEAIAKRHNRTSFDCGDAQMNDFMRRFARQSHEQNAA
                     KTFCAIDDAAPERILGFYTIAPSAVVHGNVPAAMTKGLARHEVSGFKLARLATDRTAA
                     GQGLGGQLLAAAALRCLRLASEGGGILLIIDAKSERAAKWYASYGAERLQGSDLTLAM
                     PLATFATDLRLKGLL"
     gene            372757..373731
                     /locus_tag="MESOP_RS01675"
                     /old_locus_tag="Mesop_0339"
     CDS             372757..373731
                     /locus_tag="MESOP_RS01675"
                     /old_locus_tag="Mesop_0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891582.1"
                     /db_xref="GI:503657506"
                     /translation="MPTVAPLDLEGHCLAAVFLGDVPHFVLADGAVHRLDNGHKTVQA
                     NDGLLAAFHDAANDRLITGGEDGKVFAVKAGGEAQELASAGKKWITSVAAGPQGAIAY
                     ATGKTAFVRFADGKTREFVHPRSVEGLAFSPKGMRFGVARYNGATLHFPAAEGKPVEL
                     EWAGAHTGITFSPDGAFLVTTMQENALHGWKLADGKHMRMTGYPGKVKSLSWSVKGKW
                     LASSGAPAAIVWPFSGKDGPMGKAPLELGTRGNAMVTAVACHPSQDVVAVGYDDGMVM
                     AVRFSDAKEVLLRRPGKGAITSMMWDKEERRIAFGSAAGDCGVIDITA"
     gene            complement(373747..374199)
                     /locus_tag="MESOP_RS01680"
                     /old_locus_tag="Mesop_0340"
     CDS             complement(373747..374199)
                     /locus_tag="MESOP_RS01680"
                     /old_locus_tag="Mesop_0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891583.1"
                     /db_xref="GI:503657507"
                     /translation="MRTIICVTALLLSVGTAFATGGIWCSVDDTAVKFQVDAGVTTGM
                     GGPIFNFRGDLEIKARPVGDQSRKTTFEDSNLTQYWLDNKELRLNIYHEQEMAKTFSS
                     VELTILTRASDEGVYDGDYKLAVYDSTADKDSDGKPVDLTGKVSCSAE"
     gene            374358..375737
                     /locus_tag="MESOP_RS01685"
                     /old_locus_tag="Mesop_0341"
     CDS             374358..375737
                     /locus_tag="MESOP_RS01685"
                     /old_locus_tag="Mesop_0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_013891584.1"
                     /db_xref="GI:503657508"
                     /translation="MHSDMSKTAIGGISRDRIANLRETEGEVFRKARPKSQAKVGNGL
                     PGFFGGVPMHWMNDWPTPFPILVDSARGATITDIDGNRLDDFCLGDTGSMFGHSPPAV
                     ARAIRRQAGRGLTYMLPSEDALAIGPLLQQRFGLPFWQIATTATDANRFALRVARAVT
                     GREKILVFNGCYHGSVDETMVRLIDGKPINRPGLAGEFRDLTRTAKVIEFNDIPALEA
                     ALKDKDVACVIAEPVLTNSCMVLADPGFHDALRRLTRATGTLLLIDETHTISTGPGGY
                     TRKYGLDPDLFVLGKPIAGGVPASVWGMSDEVASRYADYNRTKEPGYSGMGTTLSANP
                     LQFATMRATLEEVMTEDNYDRMDHLARRLDAGLTGVIDRYNLPWHVARVGARVEFICA
                     PGPLRNGAEAEGAHAPELEAAIHVALVNRGVLIAPFHNMMLISPATSGAQVNRLIAAF
                     GAVAAKLAA"
     gene            375764..377149
                     /locus_tag="MESOP_RS01690"
                     /old_locus_tag="Mesop_0342"
     CDS             375764..377149
                     /locus_tag="MESOP_RS01690"
                     /old_locus_tag="Mesop_0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_041164475.1"
                     /db_xref="GI:752465766"
                     /translation="MTSPSGSSPTEAQAFLDAHPEIEAFDIVLTDANGVGRGKIVRRH
                     ELKSIFEGGRHMPISILGLDITGEDVHETGLIWTTGDGDLRAWPIPGTLVPLHGTNPP
                     RGQVLMAMYHLEGQPMSSDPRLALARQVDILAAKGLYPAGAFELEFFLLANERDADGK
                     VQPARAVLDGRVSGKTEVYSVDHLHGMEPLFSDIYAAAKVQGIPAETVISEYAPGQYE
                     LTLNYRKDVMRAADDLVMLKRLVRAQARRHGVTACFMAKPIEKYAGSGMHFHVSLQDK
                     VGRNVFSEAGGENWSLPLLRGLGGLIQTMAESMLVFAPHANSWRRFVSQSYAPVAPTW
                     GVNNRSVALRVPAGDAKNRRIEHRPSGVDANPYLIAATVLAGIIKGLDEGLDPGPETT
                     GNGYEAAVTRTTMPADWRAAIEAARTSSFLKGALGEDLHRTFVAIKQSEYLRVARTVS
                     ELDYHLYLHEV"
     gene            377204..377887
                     /locus_tag="MESOP_RS01695"
                     /old_locus_tag="Mesop_0343"
     CDS             377204..377887
                     /locus_tag="MESOP_RS01695"
                     /old_locus_tag="Mesop_0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase"
                     /protein_id="WP_041163966.1"
                     /db_xref="GI:752465257"
                     /translation="MMATTGLPRNAKMPARRVSVPRAELISDETDANSIPELRDAAEG
                     CRRCPLWRNATQTVFGEGPDNAKVIFVGEQPGDQEDLAGKPFVGPAGRVFDAILVDAD
                     VDRQKVYVTNAVKHFKFEPRGKRRIHSKPNAGEVQACRWWLDQEFDLIKPNLAVALGA
                     TAALSLLGKATPVMKMRGQVIEREDGLRVFITIHPSFILRIREPADKEAERERFLKDM
                     REVKRLMAA"
     gene            complement(377897..379162)
                     /locus_tag="MESOP_RS01700"
                     /old_locus_tag="Mesop_0344"
     CDS             complement(377897..379162)
                     /locus_tag="MESOP_RS01700"
                     /old_locus_tag="Mesop_0344"
                     /EC_number="1.1.1.81"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxypyruvate reductase"
                     /protein_id="WP_013891587.1"
                     /db_xref="GI:503657511"
                     /translation="MTELDPKAFLISIFDAAVAAADPERTIRDHLPARPKGRTIVIGA
                     GKGSAQMAAAFEKVWDGPIEGLVVTRYGYGAKCERIEIIEAAHPVPDAAGLEASRRLL
                     EKVRGLTADDLVVALISGGGSALLPSPAAGLTLADEIAVNEALLASGAPIAAMNTIRK
                     HLSTIKGGRLAAAAWPAKVVSLVVSDIPGDNPALVASGPTVPDVGSREDALASISAYG
                     MKVPAAVMAHINSPAADAPDPDDQRFSRNEVHLIASAGVSLEAAAAEASRQGIEAVIL
                     SDAIEGEAREVGGVHAAIAREVATRNRPFQKPALILSGGETTVTLRAKGKGGRNSEFL
                     LAFAIGINGVEGIHALAADTDGIDGSEDNAGAFADGSTVSRMRAAGVDAKAMLAGNNA
                     WTAFNAVGDLFVPGPTGTNVNDLRAILIR"
     gene            complement(379159..379662)
                     /locus_tag="MESOP_RS01705"
                     /old_locus_tag="Mesop_0345"
     CDS             complement(379159..379662)
                     /locus_tag="MESOP_RS01705"
                     /old_locus_tag="Mesop_0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891588.1"
                     /db_xref="GI:503657512"
                     /translation="MAVAEDIALIKRQEEALVFPAFDEAVAFKIGSAIRDRALAENMP
                     VIVDIRTFDRPLFYAAMPGSNASNPDWARRKINVVRRYLRSTYRLVLEQQRPDRTFKV
                     GEGLDISDYVLAGGGFPVTVKGSGVIGVIAVSGLPEREDHGVVVDALCAHLGIDRQEL
                     ALPPEAK"
     gene            complement(380018..381334)
                     /locus_tag="MESOP_RS01710"
                     /old_locus_tag="Mesop_0346"
     CDS             complement(380018..381334)
                     /locus_tag="MESOP_RS01710"
                     /old_locus_tag="Mesop_0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891589.1"
                     /note="Catalyzes the deamination of guanine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanine deaminase"
                     /protein_id="WP_013891589.1"
                     /db_xref="GI:503657513"
                     /translation="MISILLRGRTLSFERWPQTIDDHSAWRYEEDGGLLIGDGRIVAA
                     GAYADVEKQAGEAVKKIDHRPHLLLPGFIDAHAHFPQMQVIASYGAELLDWLNTYTFP
                     EETKFANAQHGRRIARLFLDEMVRHGTTTVVAYCSVHKASTEAFFAESHDRNMLNIAG
                     KVMMDRNAPDGVLDTPQSGYDDTKALIKEWHGKGRQLYAITPRFAITSTPQQMEMAGA
                     LCREHPDLHMQTHLSENHAEIAFTQELYPWSRDYTDVYEHYGLLGKKSLFGHCVHLSE
                     READALSDSGSVAVFCPTSNLFLGSGLFDYQRYRKRDKALRIAAATDVGGGTNYSMLR
                     TMDEGYKVIALNGEKLNPFQSFWQITRGNAEALSAVERIGTLTEGTDADIVVLDANAT
                     PAMRLRMETVETLAQELFLLQTLGDDRAVREVYVAGRAAKTDMVAG"
     gene            complement(381337..382554)
                     /locus_tag="MESOP_RS01715"
                     /old_locus_tag="Mesop_0347"
     CDS             complement(381337..382554)
                     /locus_tag="MESOP_RS01715"
                     /old_locus_tag="Mesop_0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006202369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_013891590.1"
                     /db_xref="GI:503657514"
                     /translation="MMDFAIFWDWLSFAVRWLHVITGIAWIGSSFYFVALDLGLRQRP
                     GMPVGAFGEEWQVHGGGFYHIQKYLVAPAEMPEHLTWFKWESYATWLSGFAMLCVVYY
                     AGADLFLIDPNVLPMSVPVGILLSMATIGVGWVVYDLLCRSPLGKSDTGLMLVLYCVL
                     VFIAWGLTHLFTGRAAFLHLGAITATIMSANVFMVIIPNQKIVVADLIAGRKPDPKYG
                     KIAKQRSLHNNYLTLPVLFLMLSNHYPLAFGTEFNWIIASLVFIIGVLIRHYFNSVHA
                     RKGNPHWTWLGALVLFIIIIWLSTVPRVLTGEPKPSASAELYIASAHFPAVRDTVLGR
                     CSMCHAAEPVYEGIYHAPKGVMLDTDAGIAEHAREIYLQAGRSHAMPPANVSQISDKE
                     RALLVTWFEGAGK"
     gene            382791..383711
                     /locus_tag="MESOP_RS01720"
                     /old_locus_tag="Mesop_0348"
     CDS             382791..383711
                     /locus_tag="MESOP_RS01720"
                     /old_locus_tag="Mesop_0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013891591.1"
                     /db_xref="GI:503657515"
                     /translation="MAYLDNIAVFVRVVELGNLSAAGRDMRISPAVASNRIKELEKHL
                     GVRLFNRTTRQLMPTEHGTVFYAGAKQVLEAITEAEAAVSALSGQPRGTIRVTAPLGL
                     GRRLVASGIPDFHDKYPDIEVRLRLSDHNVDIMKEGIDVAFRLGIIEDSSLRMRGIME
                     CERVLVAAPKYLEARGEPVEPQELIGKKHDCLMLRYSGAREYVWTLQTPTGPQKFEVH
                     GPYDTDDGDVLTGWALSGRGIINKPRFEVEPFIRDRRLKVILSNTPPTPVQFAAVYPH
                     KKLQDPKVRLLLDFMAERCQRLIKDLLAGK"
     gene            383840..384793
                     /locus_tag="MESOP_RS01725"
                     /old_locus_tag="Mesop_0349"
     CDS             383840..384793
                     /locus_tag="MESOP_RS01725"
                     /old_locus_tag="Mesop_0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrilotriacetate monooxygenase"
                     /protein_id="WP_013891592.1"
                     /db_xref="GI:503657516"
                     /translation="MHLTVSLNIASMAGQTSALTFRDVAGFVRQAEAVGLDMIILEDS
                     APDAPVSSSPFEATTLLAALATVTSRIGLVAAASTVAHQPYNLARRFASLDIISHGRA
                     GWHATMAQAPREAANFSRPDGFSNDDFRRRTEEYIGIVHGLWQGWDADALLFDKTGGR
                     FHDPDKMHLLDHKGEFFSVRGPLNVARSLQDKPVLLLSVLSEADMDIAARTADVILLD
                     GSAQDAKARHDDLKRHVAACGREPGSVKVLLNVGVDIDRLDTSFRSQDCDGFNIAMPP
                     PALDGFVGRVLPELRRRGLLRESYRGTTLRSHLGLAGGGDQ"
     gene            384790..386043
                     /locus_tag="MESOP_RS01730"
                     /old_locus_tag="Mesop_0350"
     CDS             384790..386043
                     /locus_tag="MESOP_RS01730"
                     /old_locus_tag="Mesop_0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="WP_013891593.1"
                     /db_xref="GI:503657517"
                     /translation="MTAQMKLGAFLWATGHHIAAWRHPKAHVTAGIDIDHYIQLARTA
                     EAAKFDMIFCEDAAGLREANVGIASQTSRSIGFEPISLLSALAVQTSRIGLVSTASTS
                     YNEPYGLARMFLSLDHLSDGRAGWNLVTSASPIEAANFGSTGLKPHADRYERAREFAE
                     VVTRLWHGKLGASGHDGQSFSVRDPLDLPRSPQGAPVMVQAGASDVGRDLAAGTADVV
                     FTAAQTFEEAKAFYDDLKGRMATYGREPDDIKIMPGVAPVVAETEAEAREKFEALQEL
                     IPDDVGVALLSSYLSISDLWRYPIDGPLPELPESEGMKSRQALVIEQSRRDGLSIRQL
                     ARHFAGARGHWRIVGTAAQIADELQARFEGGAADGFNVMPSYFPGELDAFCELVVPEL
                     QRRGLFRRDYEGRTLRDHLGLKRPA"
     gene            complement(386055..387146)
                     /locus_tag="MESOP_RS01735"
                     /old_locus_tag="Mesop_0351"
     CDS             complement(386055..387146)
                     /locus_tag="MESOP_RS01735"
                     /old_locus_tag="Mesop_0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine dehydrogenase accessory protein XdhC"
                     /protein_id="WP_013891594.1"
                     /db_xref="GI:503657518"
                     /translation="MNSKVQSLKAFLASAHRVALVEVADTKGSTPREKGAFMLVSASA
                     TFGTIGGGQLEYMAIDKARQMLFSPLEGGEERSAVGREKANDLAFSATSARSHSEGQA
                     AKRPEGVLSKGTARTSRPVDPTPPGGFAATLPSRGRGTRIAADEVRATLDVPLGPEIG
                     QCCGGRVEVLIRLVDAALAADLIAGAEAEQAHLPHVYIFGGGHVGQALASTVALLPVH
                     GVIIETRAEALEGMPETVETRLTPMPEAEVRNAPAGTAFAILTHDHALDFLIVAEALR
                     RGDTAYVGMIGSKTKKATFRSWFLKSADGTEAEFARLVSPIGGDAVKDKRPQVIAALA
                     AAEIMTALVIHNTALNAGHPAPRGKVMAG"
     gene            complement(387208..389574)
                     /locus_tag="MESOP_RS01740"
                     /old_locus_tag="Mesop_0352"
     CDS             complement(387208..389574)
                     /locus_tag="MESOP_RS01740"
                     /old_locus_tag="Mesop_0352"
                     /EC_number="1.17.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde oxidase"
                     /protein_id="WP_013891595.1"
                     /db_xref="GI:503657519"
                     /translation="MNKHATASLKAEKIVGGVATDQRHDSAHKHVSGTAVYIDDMPEP
                     AGTLHGCLGLSAATHATIVEMDLSAVRTAPGVVDVLTAKDVPGENDISPTGRHDEPVL
                     ADGKVEFYGQPIFCVIAETREQARRATRLAKVEYKALPFVTDIGDLDPRKDKLVTPPL
                     TLRRGDAAAAIRQAPRRLKGKMRVGGQEHFYLEGHIAMAVPGEDQDVTIYSSTQHPSE
                     VQHMVSHALGVPSNAITVEIRRMGGGFGGKETQGNQFAALAAIAAKKHHRAVKIRPDR
                     DDDMIATGKRHDFLVDYEVGFDDEGNILGVDFMFAARCGFSSDLSGPVTDRALFHCDN
                     TYFWPTVHAQSAPLYTNTVSNTAFRGFGGPQGMVGAERVIDEVAFAVGQDPLEIRKRN
                     FYGTSGDSEGGRNITPYHQTVEDNIIQRIVGELEESASYARRRREISAFNANSRFIKR
                     GLALTPVKFGISFTATHYNQAGALVHVYTDGSVHLNHGGTEMGQGLYLKVAQVVAEEF
                     QIDLDQVKITATTTGKVPNTSATAASSGSDLNGMAAQNGARQIKDRLIDFAAEKYQVP
                     HDQVVFLPNRVRVGNQEIAFADLVKQAYMARIQLSAAGFYKTPKIHWNRDKGQGRPFY
                     YFAYGASCSEVSVDTLTGEYVVERTDILHETGRSLNRAIDLGQIEGGFIQGMGWLTTE
                     ELWWDDKGRLRTHAPSTYKIPLASDRPKIFNVTLADWPEASEPTIHRSKAVGEPPFPL
                     GMSVLHALSDAVASVADHKICPRLDAPATPERVLMTIERLKREARAGA"
     gene            complement(389574..391055)
                     /locus_tag="MESOP_RS01745"
                     /old_locus_tag="Mesop_0353"
     CDS             complement(389574..391055)
                     /locus_tag="MESOP_RS01745"
                     /old_locus_tag="Mesop_0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding molybdopterin dehydrogenase"
                     /protein_id="WP_013891596.1"
                     /db_xref="GI:503657520"
                     /translation="MAKVNIRNEIRFILNGRDVVLSSVAPDTTLLDWLRLDRSLRGTK
                     EGCAEGDCGACTVLVGKLSAGGLVYESVNACIRFLGSLDGTHVVTVEHLRGLPGQLHP
                     VQQAMVDFHGSQCGFCTPGFIMSLYGLWMRSSAPSNTTIEKALQGNLCRCTGYEAIMR
                     AAHAISSYGKAAKDPLAAEREAITARLDAMHDGARVEIGAGKARLVVPANVDDLAAIL
                     DKEPTATIVAGATDVGLWVTKHMRDISPVIFIGNLDGLCTISEDKGVISIGAGVTYTE
                     AFSTLSKRIPALGPLFDRIGGEQVRNMGTIGGNIANGSPIGDTPPPLIALGARLTLRR
                     GKKRRTIPLQDFFIAYGKQDRQPGEFVEAVHVPVPAKGAKFAVYKITKRRDEDITAAL
                     GAFFLTLAKDGTVADIRIAYGGMAATPKRATAVEKALLGKPWTEATVEAAMTEYARDF
                     TPLTDMRASAEYRALAAKNLLLRFFVETTGTRAPFQVSRNEAA"
     gene            complement(391059..391433)
                     /locus_tag="MESOP_RS01750"
                     /old_locus_tag="Mesop_0354"
     CDS             complement(391059..391433)
                     /locus_tag="MESOP_RS01750"
                     /old_locus_tag="Mesop_0354"
                     /EC_number="3.5.2.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98CI7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-hydroxyisourate hydrolase"
                     /protein_id="WP_013891597.1"
                     /db_xref="GI:503657521"
                     /translation="MAETSKADGGRLTTHVLDTATGKPAAGLSIALYRLDGAARTLLK
                     TVATNADGRCDAPLLVGGDFRTGEYELIFAAGDYLRGQGTKLPEPAFLDRVPIRFGMA
                     EAVHYHVPLLISPYGYSTYRGS"
     gene            391635..393053
                     /locus_tag="MESOP_RS01755"
                     /old_locus_tag="Mesop_0355"
     CDS             391635..393053
                     /locus_tag="MESOP_RS01755"
                     /old_locus_tag="Mesop_0355"
                     /EC_number="3.5.1.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="WP_013891598.1"
                     /db_xref="GI:503657522"
                     /translation="MRYERDMRGYGANPPDPKWPGGAHVAVQFVVNYEEGGENCVLHG
                     DKASEAFLSEIVGAAAWVGQRHWNMESIYEYGARAGFWRLLRLFSESQVPVTCYGVAT
                     ALARSPDQVTAMQEVGWEIASHGLRWIDYRDHSAEDERHDLEAAIKLHYEVTGQRPTG
                     WYTGRTSVNTVRLVAEEGGFDYVSDTYDDELPYWFEHAGGTQLIIPYTLDANDMRFAT
                     PQGFNSGDQFFAYLKDSFDTLYAEGKAGRPRMMNIGLHCRLVGRPGRVAALKRFVDYV
                     KSHDKVWLARRIDIARHWQENHPYRQAALRPSKMEFETFVHSFGGVFEHSPWIAERAY
                     ELELGTAHDTAGGLHNALCRIFRSASETERLGVLNAHPDLAGKLAKARRLTAESTREQ
                     ASAGLDALTDKERELFSKLNAAYVTTFGFPFIIAVKGKTKEEILAEFEARIGNGRGVE
                     FETACKQVERIALLRLRDMLPQ"
     gene            393064..393927
                     /locus_tag="MESOP_RS01760"
                     /old_locus_tag="Mesop_0356"
     CDS             393064..393927
                     /locus_tag="MESOP_RS01760"
                     /old_locus_tag="Mesop_0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891599.1"
                     /db_xref="GI:503657523"
                     /translation="MDTIRMPDRTYYAPHGGHSGQTELLTGRAVFTEAYAVIPKGVMQ
                     DIVTSALPFWDETRVWILSRPLSGFAETFSQYIVEIAPGGGSERPEPDAGAEGALFVV
                     EGELTVLLAGKKHMLRPGGFAFLPPASGWTVRNESKAAVRFHWIRKAYEAVDGLDVPE
                     AFFTNEQEIAPTPMPGTDGRWATTRFVDPADLRHDMHMTIVTLEPGAVIPFAETHVME
                     HGLYVLEGKAVYRLNQDWVEVEAGDYMWLRAFCPQACYAGGPGKFRYLLYKDVNRHAK
                     LGGADIGGRTR"
     gene            393939..394430
                     /locus_tag="MESOP_RS01765"
                     /old_locus_tag="Mesop_0357"
     CDS             393939..394430
                     /locus_tag="MESOP_RS01765"
                     /old_locus_tag="Mesop_0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ureidoglycolate hydrolase"
                     /protein_id="WP_041164476.1"
                     /db_xref="GI:752465767"
                     /translation="MAHIVARPLTREAFAEFGDVIDMGGDNHYPINGGKAERYHDLAT
                     AEATGPNARVLISMVRGMPYELPLKLTMVERHPFGSQAFIPLSPRPFLVVVCHDGKEG
                     PGEPYAFITAPGQGINYSRNLWHGVLTPLGEAQDFLIVDRGGDGSNLEEFHFSHAYEI
                     HLP"
     gene            394497..395090
                     /locus_tag="MESOP_RS01770"
                     /old_locus_tag="Mesop_0358"
     CDS             394497..395090
                     /locus_tag="MESOP_RS01770"
                     /old_locus_tag="Mesop_0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="WP_013891601.1"
                     /db_xref="GI:503657525"
                     /translation="MTDISLIDRLLDVIEHDIVPKTEEGVAHGNKLFGAAILRKHDRS
                     LVLAETNNEIENPLWHGEVHCLKRFYEMPRAERVDTKDAIFLATHEPCSLCLSAITWT
                     GFDNFYYLFSHEDSRDSFAIPHDLKILKEVFTLDPGGYNAENAYWKSFSIRRLVRALP
                     EAERQRLETRIGKISARYDELSGAYQANKDENDIPLN"
     gene            complement(395101..395412)
                     /locus_tag="MESOP_RS01775"
                     /old_locus_tag="Mesop_0359"
     CDS             complement(395101..395412)
                     /locus_tag="MESOP_RS01775"
                     /old_locus_tag="Mesop_0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891602.1"
                     /db_xref="GI:503657526"
                     /translation="MNNPKSRIRPLTDEEEAEIQRQIAADSDDAEATDEQLARAKPFA
                     EAFPELFESIRRARGRPPVEKPKQVVSIRLDQDVVRKFKATGKGWQAKINEVLKNAKV
                     S"
     gene            395833..397818
                     /locus_tag="MESOP_RS01780"
                     /old_locus_tag="Mesop_0361"
     CDS             395833..397818
                     /locus_tag="MESOP_RS01780"
                     /old_locus_tag="Mesop_0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S15"
                     /protein_id="WP_013891604.1"
                     /db_xref="GI:503657528"
                     /translation="MKTVTEFPRKVVEFPDMGIVMPDGCRLSARVWMPEDAGDDPVPA
                     ILEHLPYRKRDGTIFRDQLTHPYFAGHGYASIRVDMRGNGDSEGLMDDEYSEQELQDA
                     CDVIAWAAAQPWCNGNVGMMGISWGGFNCLQVAAKQPPALKAVISLCSTVDRYADDIH
                     YKGGCLLIENFGWASTMLSYSSRPPDPLISGDNRWRDLWLTRLENQSFLLPLWLSHQH
                     RDAYWKRGSICEDFSAVKAAVLSIGGWHDGYRNTISNLVSNIEAPVKGIVGPWIHKYP
                     HYAGPQPAIGFLQEALRWWDRWLKGIDTGVEADPAYRAYVMDSVRPARWHPERPGRWV
                     AEQQWPSPAIKTQAIELISKGTKPAIVASPQSCGLAGGEYFPFTFGPELPGDQRPDDT
                     LSVCFDQPELAEALDIVGAPEVQVTLSSDRPQANIAIRLCDVHPDGASELISYGVLNL
                     THRDSHEFPQALVPGEAISARVVLDQCAYRVPAGHRLRVAVSNAYWPMIWPSPEPVQL
                     TLSAATLALPLRPLAKGSEVTFAEPEGAAPWATQTVRPANSERHVDRDEKTGIVTLSI
                     ADDFGEVRDLAHGLANGSIAREIWSIHPDNPLSASGKTHWTQTLSRNGWSVRTETWAE
                     MRSDAQNFIVSARIEAYEGEILVFERNFEEKIPRALV"
     gene            397973..399559
                     /locus_tag="MESOP_RS01785"
                     /old_locus_tag="Mesop_0362"
     CDS             397973..399559
                     /locus_tag="MESOP_RS01785"
                     /old_locus_tag="Mesop_0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013891605.1"
                     /db_xref="GI:503657529"
                     /translation="MSNELEFLSRRVAAGKLSRRDFLGRAAALGIAAPFANSLLSSAA
                     RAAGPVKGGTLKAGLVGGESTNSLDPALFMTQVPFAFGKCWGEMIVELSPDGKLENRI
                     AEEIGSSKDAKTWTLKIRDGVEFHNGKKVTAEDVAATLERHSDEKSKSGALGYMKGIE
                     TIKANGKEVVLTLKEANADLPYLLSDYHLIVQPNGGKDKADAGISAGPYKVTTNEPGV
                     RHAGERFANYWQSDKMGHADQIEIIVINDATARTAALQGGQVNMINRVEPKIVDLIKR
                     VPGVTIRNHAGPGHYVFIMHCNTAPFDNNDLRMALKLAIDREEMLTKVLRGYGSLGND
                     FPINSAYPLFTEIEQRKYDPDKAKFHYKKSGHDGTVLLRTSDVAFPGAVDASQLFQQS
                     AAKAGIKIELKREPGDGYWNEVWNKQPFCASYWGGRSTQDQMYSTAYLSTADWNDTRF
                     KRPDFDKMVLAARAELDEAKRKQMYHDMAVLVRDEGGLILPMFNQFIDATGAKVDGWV
                     DDPHQELMNGYALAKCWLQA"
     gene            399576..400535
                     /locus_tag="MESOP_RS01790"
                     /old_locus_tag="Mesop_0363"
     CDS             399576..400535
                     /locus_tag="MESOP_RS01790"
                     /old_locus_tag="Mesop_0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891606.1"
                     /db_xref="GI:503657530"
                     /translation="MSSPILKLIAQRIALGILLLLAISVLIFAGTQILPGDVAQAILG
                     QSATPESLANLREQLGLNDPAYVRYFHWLGGVLTGDLGTAMSSGQDIATSIKGRLWNT
                     LFLAFWAAIVAVPLAIILGLIAVRYRNGWVDKLISGLALASTSFPEFFIGYLLVYFFA
                     VKWQIFPAISTVYDGMPFGERMQAIALPATALTLVVLAHMMRMTRAAILNVMQSAYVE
                     TAELKGLSAFAVIRRHAFPNAIAPIINVVMLNLAYLIVGVVVVEVIFVYPGMGQYLVD
                     HVTKRDVPVVQAVGLIFAAVYISLNIIADIAAIIANPRLRHPK"
     gene            400545..401369
                     /locus_tag="MESOP_RS01795"
                     /old_locus_tag="Mesop_0364"
     CDS             400545..401369
                     /locus_tag="MESOP_RS01795"
                     /old_locus_tag="Mesop_0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891607.1"
                     /db_xref="GI:503657531"
                     /translation="MLDIRRIPIPALIGLVLTALFVLAAIFAPWISPHDNAEIVGDVW
                     EPMSAAHFLGTDNLGRDLLSRMIYGARITLFIAVLATALSFSLGAILGFSAAVFGGWF
                     DTILSRLVDLLMSIPTLIMGLVVLSVLPTNLVTLILVMGILDSTRVYRLSRAVAVDIN
                     VMDYVEAAKLRGEGSGWIIFREILPNALSPLVSELGLRFIYAVLFLSTLSFLGLGVQP
                     PDADWGGMVKENKDGIVFGIAAALIPAGAIAALAISVNLVADWILNRTTSLKGGRG"
     gene            401369..403039
                     /locus_tag="MESOP_RS01800"
                     /old_locus_tag="Mesop_0365"
     CDS             401369..403039
                     /locus_tag="MESOP_RS01800"
                     /old_locus_tag="Mesop_0365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_013891608.1"
                     /db_xref="GI:503657532"
                     /translation="MAETKAKPGQGKPGVLLDIRNLRIEATVYPPGEAPKNIVLVHDV
                     SLTLEKGKVLGLIGESGAGKSTIGLSSMGYGRGGVRITGGEVLLNGRDILKGGKEGFR
                     KLRGREVCYVAQSAAAAFNPAHRLMDQVVEATLLHGTATRAEAEKRAIALFKKLSLPN
                     PETIGERFPHQVSGGQLQRVMTAMALCSEPDLIVFDEPTTALDVTTQIDVLAAIKDAI
                     RDTHVAALYITHDLAVVAQVSDEIMVLRHGRLVEWGGTRQIIKEPRQEYTNALVSVHE
                     IEHAEQKPGTTPFLSVKNVTAAYAGGHVKVLKNVSVDIYPGQTLAVVGESGSGKSTLA
                     RAITGLLPPEQGTVTFDGRPLANRLADRPKEDLRQLQMIYQMADVAMNPRQTVGTIIG
                     RPLEFYFGMRGRQRDARVTELLDKIEMGKGFADRYPAELSGGQKQRVCIARSLAAKPK
                     LIICDEVTSALDPLVANGILKLLLELQKEENVAYLFITHDLATVKSIADSIAVMYRGE
                     VVRYGSKSTVLTPPFDAYTDLLLSSVPEMEIGWLEKAIKGRRMASAGN"
     gene            403145..404734
                     /locus_tag="MESOP_RS01805"
                     /old_locus_tag="Mesop_0366"
     CDS             403145..404734
                     /locus_tag="MESOP_RS01805"
                     /old_locus_tag="Mesop_0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013891609.1"
                     /db_xref="GI:503657533"
                     /translation="MKTELDHLAELAGQGRISRRDFLGRTAALGVSAALATTLAGKAF
                     AQTPAKGGILKAGLQGGESTNSLDPALNLSQVTFSFCKQWGEFLVRLKPDGGVENLIA
                     EEIGASADAKTWTIKVRDGIEFHNGKTVAAEDVAATIERHADEKSKSGALGILKNIKG
                     VKASGKEVIVTLGNADADFPYLMADYHLVIQPNGGKDNPNAGVSAGPYKVTVNQPGVR
                     HGGERFANYWRGDKAGHADQIEIVVINDATARLAALQGGQVQLINRVEPKVVELVKRI
                     PGVTIENVSGRGYYPFNMFCDTAPFDSNDLRMALKLAMDREELLEKILRGYGSVGNDF
                     PINEAYPLFSADIEQRKFDPEKAAAAYKKSGHSGSIVLRTSDVAFPGAVDAAQLYQQS
                     AAKAGIKIEIKREPGDGYWSEVWNKQPFSLSYWGGRATQDQMYSTGYVSTADWNDTRF
                     KRPEFDKMLFTARAELDQAKRKAIYHDMAVLMRDEGGLIVPFFNQFIDAAATNKISGW
                     VKNPNGEMMDGYALNECWLNA"
     gene            404817..405656
                     /locus_tag="MESOP_RS01810"
                     /old_locus_tag="Mesop_0367"
     CDS             404817..405656
                     /locus_tag="MESOP_RS01810"
                     /old_locus_tag="Mesop_0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide pyrophosphatase"
                     /protein_id="WP_013891610.1"
                     /db_xref="GI:503657534"
                     /translation="MALKSKLLLIVLDGVPYRNWRRLMGNLEGWVQSGEARVWKMRSV
                     LPSTSACCYASIHTGVSPQVHGILSNENRFRVGQPDIFSEVSKAGGKTGAVTHSYWSE
                     FFRSYPFDLVEDMEFDEPGGPITHGRFHTMTGYNLRNQMTPSDVDLFATLTMLTKRHG
                     IDYGILHTCTLDSMGHRFGHDCHEMDHAVYAMDAMLAGFLPGWIAAGYEVMVTADHGQ
                     TDRGHHGGHDDEMQDFALYYFGSGKGPDANTLLDQLQLAPTVLSRLGVPVPATMKAKA
                     FLG"
     gene            405933..406499
                     /locus_tag="MESOP_RS01815"
                     /old_locus_tag="Mesop_0368"
     CDS             405933..406499
                     /locus_tag="MESOP_RS01815"
                     /old_locus_tag="Mesop_0368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314331.1"
                     /note="Bacteria have multiple sigma factors which are
                     active under specific conditions; the sigma factor binds
                     with the catalytic core of RNA polymerase to produce the
                     holoenzyme and directs bacterial core RNA polymerase to
                     specific promoter elements to initiate transcription;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_013891611.1"
                     /db_xref="GI:503657535"
                     /translation="MTAATETDRALVDRVAKGDRAAVRLLFMRHHARVYRFVVRQTGS
                     ELMADDIANEVFLELWRQAPGFEGRSEVSTWLLGIARFKALSLLRKKKEDWIDDEAAA
                     AVPDSADTPEVVTMKEDKAAALRRLIDALPEEHRTVIDLAYYHGQSVTEIGEVLGIPV
                     ATVKTRMFYARKKLGEALKAAGYDRGWP"
     gene            406490..407164
                     /locus_tag="MESOP_RS01820"
                     /old_locus_tag="Mesop_0369"
     CDS             406490..407164
                     /locus_tag="MESOP_RS01820"
                     /old_locus_tag="Mesop_0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma factor"
                     /protein_id="WP_041163967.1"
                     /db_xref="GI:752465258"
                     /translation="MAMSAAEKMSRRDEMETLLPFYLNGSLEGSDLEAVEEWLANDPS
                     ALAALGEAEAEFSGASAANEAIRPPADALSRFARAFDAEAGPVRAPAGSSWLAQAWGR
                     FVALPAGVAWAAAAVLLALIMVQSLVQPGGKGGNFEIAGTEDDLAKMPFALVKFKPDA
                     RMSDISGFLGGNGLKVIGGPTADGVFRLGIPAANATDYTRQIGLIAAQPFTDTVIEGR
                     KPADGG"
     gene            407154..408608
                     /locus_tag="MESOP_RS01825"
                     /old_locus_tag="Mesop_0370"
     CDS             407154..408608
                     /locus_tag="MESOP_RS01825"
                     /old_locus_tag="Mesop_0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8"
                     /protein_id="WP_013891613.1"
                     /db_xref="GI:503657537"
                     /translation="MAAEAVIRFAAILAAAITIAAVPASAQTNATSPGRTKIDCNNAA
                     NATAADCAKDNGGEKGGSGAGQPGAVFLPALIVDLFPNPAERPVPVPTPAPRQDPGTS
                     PAVPADTQAGASAGGPIVSPTDLIAVQPPRAVAGDFVPDEVLVTVDGDAGAVQQIAAS
                     FGLEVRSQRQSRLLGTTLVRFGIPDGRPVGIVLAQLAADGRTQRREPNHIYSLQQAAG
                     IVNYAFERIALDAKQASGENVRVAVIDTGIDDTNPALAGVIAGQFDAMPDVPIEKRDH
                     GTSVDGLIAGVGALEGMAPGARIYHARAFEGGKSTMDVILSALDWAAEQDVRIINMSF
                     VGPKNDLLGVACRNARALGIVLIAAAGNNGPKAPYGYPAAFDGVIAVTATDAKDGLMP
                     QANRGAYVFISAPGVEMVAPSGAGTDVVTGTSFAAAIVSGAIANLIHAAPDRSADDIE
                     KALAATARDLGPKGRDNDFGYGLLDIKAAGAGKE"
     gene            complement(408725..409747)
                     /locus_tag="MESOP_RS01830"
                     /old_locus_tag="Mesop_0371"
     CDS             complement(408725..409747)
                     /locus_tag="MESOP_RS01830"
                     /old_locus_tag="Mesop_0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013891614.1"
                     /db_xref="GI:503657538"
                     /translation="MNLKQLAHMLALSQTTVSRALNGYPEVNEETRRRVMDAAKRHGY
                     RPNPSARRLATGKSGMIGYVLPTGAAVDIDPHFVEFLSGLGDYARSHELDLVLSPADA
                     DDQETTYRRIVANRQVDAVYISSPKPQDNRVALVNTLGIPFIVHGRSEGFDFDYPYLD
                     IDNEGAFHEAARLLVQLGHRRLALINGDDGETFAIHRERGVRRALAASGLALGERHVC
                     SVVMTEENGYRATRRLLEASDAPTAIVCSSLIMALGVVRAVRDLSLSIPGDVSLIAHD
                     DVFPWLRPENFSVPLSTTRSSIRLAGARVAERLAARISGLEEGARGEIWPVDLVIRGS
                     VAGAPA"
     gene            410108..411463
                     /locus_tag="MESOP_RS01835"
                     /old_locus_tag="Mesop_0372"
     CDS             410108..411463
                     /locus_tag="MESOP_RS01835"
                     /old_locus_tag="Mesop_0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucoside ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_013891615.1"
                     /db_xref="GI:503657539"
                     /translation="MKKMLLLGAAFATLALNAPAHAELKFKPGEDARFHWANFDELKK
                     VDLKGETLTIFGPWRGEDEALARSVLDYFAEATGAEIKYSSSENYEQQIVIDTQAGSP
                     PNIAILPQPGLIQDLASKGVLTPLGDDVAAWVKENYAAGDSWAKLGTFAGKDGKPGFY
                     ALPYKIDVKGLVWYSPDNFEEAGYKVPKTQEELAELEKKIIADGGKPWCIGLGSGGAT
                     GWPATDWVEDIMLRTQPPEVYDKWVKNEIPFTDPAVVNAIDIFGKIATDDKMVDGGAK
                     AVAATDFRDSPKGLFSVPPKCYMHHQASFIPSFFPEGVKLGQDADFFNYPPYASKPEL
                     GTPLEVAGTLVMITKDSKASHEFIKFLEMPLAHELWMAQKSFVTPFKGANKDAYGSDA
                     LKKQGEILVGATTVRFDGSDLMPGKIGAGSFWTGMIDLVGGKSAQDVATDIQKSWDGI
                     K"
     gene            411699..412712
                     /locus_tag="MESOP_RS01840"
                     /old_locus_tag="Mesop_0373"
     CDS             411699..412712
                     /locus_tag="MESOP_RS01840"
                     /old_locus_tag="Mesop_0373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucoside ABC transporter permease"
                     /protein_id="WP_013891616.1"
                     /db_xref="GI:503657540"
                     /translation="MAAQIFSAIFVIIIGVGGCVAYFWGANRLVDLIFPSRGVSGAAA
                     IDNLRRQGLVRPWLFVGPAMIILTIYLIYPVIETLRLSFLDRGGVNFVGLANYQWAFG
                     DRDFRNSILNNVLWLAVVPAACTFLGLIIAVLTDKIWWGTIAKSLIFLPLAISFVGAS
                     VIWKFIYEYRGEGQVQIGILNAIIQHFGGQPQVWISLPFWNNFFLMVILIWIQTGFAM
                     VILSSALRGIPEETLEAAVIDGANPFQIFWKIMVPQIWGTIAVVWTTITILVLKVFDI
                     VLTMTNGQWNSQVLANLMFDWMFRGGGDFGRGATIAIIIMIAVIPIMVWNIRQANKET
                     GGH"
     gene            412714..413868
                     /locus_tag="MESOP_RS01845"
                     /old_locus_tag="Mesop_0374"
     CDS             412714..413868
                     /locus_tag="MESOP_RS01845"
                     /old_locus_tag="Mesop_0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucoside ABC transporter permease"
                     /protein_id="WP_013891617.1"
                     /db_xref="GI:503657541"
                     /translation="MAVATGNSFASRFGVHIAVLVFVTIWTIPTLGILVSSLRDKDQI
                     IASGWWNSFASSTQTEAGRLPPASAQVQKDGKFVLEGNIFGDGAKRDISAFGVKSAAP
                     TQYAAGTSADLGDGVTLQVNADGSFVMTSPKAFEGDRGQRLYYASSAPPKFTTDNYRS
                     VLFSEGIGRSFMNSLTVTIPATVIPILIAAFAAYALAWMRFPGRALLIAVIIGLLVVP
                     LQMSLIPLLKLYNGVGSFFGVPSKTYLGIWLAHTGFGLPFAIYLVRSYIAGLPREIME
                     SARIDGASDFEIFVKIVLPLSFPVLASFAIFQFLWVWNDLLVAMVFLGTEADQIVLTA
                     KLNALLGSRGGDWEILTTSAFVTIIVPLIVFFSLQRYFVRGLLAGSVKGG"
     gene            413873..415537
                     /locus_tag="MESOP_RS01850"
                     /old_locus_tag="Mesop_0375"
     CDS             413873..415537
                     /locus_tag="MESOP_RS01850"
                     /old_locus_tag="Mesop_0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-glucosidase"
                     /protein_id="WP_013891618.1"
                     /db_xref="GI:503657542"
                     /translation="MQSALKASSKPDLAIDRDWWRGAVIYQIYPRSYQDSNGDGIGDL
                     KGIIQRLPYIAALGADAIWISPFFTSPMKDFGYDVSDYCDVDPMFGTLADFDALTAEA
                     HRLGLKVMIDEVLSHTADIHPWFKESRSSRTNPKADWYVWADARPDGTPPNNWLSIFG
                     GSAWQWDTSRQQYYLHNFLAEQPDLNFHSREVQDALLDVTRFWLERGVDGFRLDTINF
                     YFHSQGLENNPPLAPEERNDQTAPAVNPYNYQDHIYDKSRPENLGFLERFRALLDEYP
                     ATAAVGEVGDSQRGLDVVAAYTAGGKRVHMCYSFDFLAPEKISAAKVRSVLETFGKVA
                     TDGWSCWAFSNHDVMRPASRWAAGEADPTAYLKVISALLMSLRGSVCIYQGEELGLGE
                     AELRFEDLQDPYGIRFWPEFKGRDGCRTPMVWDGNAKNGGFSQAKPWLPVPAKHLSQA
                     VNVQQGDETSLLEHYRRFLTFRRAHPALAKGDIAFIESQGDTVAFTRRAGNEQIVCVF
                     NLGAKPAKVDLSGRSLHPLPGHGFSGQASTGSVELGGYGAWFGRID"
     gene            415585..416697
                     /locus_tag="MESOP_RS01855"
                     /old_locus_tag="Mesop_0376"
     CDS             415585..416697
                     /locus_tag="MESOP_RS01855"
                     /old_locus_tag="Mesop_0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_013891619.1"
                     /db_xref="GI:503657543"
                     /translation="MADVNLRQVKKSYGNLNILHGIDLDIKSGEFIVFVGPSGCGKST
                     LLRSIAGLEEITSGELKIDGEVVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFSMKI
                     GKENKAEIDRRVRQAAEILQLTKYLDRLPKAMSGGQRQRVAIGRAIVRNPKVFLFDEP
                     LSNLDAALRVATRIEIAKLKESMPNTTMIYVTHDQVEAMTLADRIVVLKEGHIEQVGT
                     PMELYKKPGNLFVAQFIGSPAMNILPATIDKTGNPTIVSHVGGRKATVPIATPASAKG
                     AAVSFGVRPEDLIIASGTDYLFEGTVDYVEQLGEVQLVYVDIGRADLPLVTKLPGNVE
                     VKRGSTLRLSANAEDLHIFDADGRSFALHEAEAKAA"
     gene            complement(416774..417019)
                     /locus_tag="MESOP_RS01860"
                     /old_locus_tag="Mesop_0377"
     CDS             complement(416774..417019)
                     /locus_tag="MESOP_RS01860"
                     /old_locus_tag="Mesop_0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891620.1"
                     /db_xref="GI:503657544"
                     /translation="MKKIILAAAAVLAISGSAVAGSDNYGSNGANQPAVTSTDVDASH
                     TGSIRDSGSPVYKLLNSSGNVQKPTPQSNDRDHFGNH"
     repeat_region   416904..417585
     gene            complement(417087..417296)
                     /locus_tag="MESOP_RS01865"
                     /old_locus_tag="Mesop_0378"
     CDS             complement(417087..417296)
                     /locus_tag="MESOP_RS01865"
                     /old_locus_tag="Mesop_0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891621.1"
                     /db_xref="GI:503657545"
                     /translation="MKKIILAAAAVLAVSGGAFAGSDNYGSNGANQPAVTSTDNSYTA
                     STNKKSEPADQKPVFGADHNLFGNN"
     gene            complement(417364..417570)
                     /locus_tag="MESOP_RS01870"
                     /old_locus_tag="Mesop_0379"
     CDS             complement(417364..417570)
                     /locus_tag="MESOP_RS01870"
                     /old_locus_tag="Mesop_0379"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891622.1"
                     /db_xref="GI:503657546"
                     /translation="MKKIILAAAAVLAVSGGAFAGSDNYGSNGANQPAVTSTDNSYTA
                     STKKSEPADQKPVFGADHNLFGNN"
     gene            complement(417649..417864)
                     /locus_tag="MESOP_RS01875"
                     /old_locus_tag="Mesop_0380"
     CDS             complement(417649..417864)
                     /locus_tag="MESOP_RS01875"
                     /old_locus_tag="Mesop_0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891623.1"
                     /db_xref="GI:503657547"
                     /translation="MKKIILTAAALLAISGSAFAGSDHYSSDHYGSNATPAATAVDSS
                     YTASVKKSEPAAQTPVQGADHNLFGNH"
     misc_binding    418356..418558
                     /note="cobalamin riboswitch; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /bound_moiety="adenosylcobalamin"
     gene            418672..419919
                     /locus_tag="MESOP_RS01880"
                     /old_locus_tag="Mesop_0381"
     CDS             418672..419919
                     /locus_tag="MESOP_RS01880"
                     /old_locus_tag="Mesop_0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_013891624.1"
                     /db_xref="GI:503657548"
                     /translation="MDARNDMLRLLNSRRQGFSLEQPFYTDPDYFKLDMELIWYRDWL
                     FIGHDCELPRPGSFITVQIGDYPVVLVRDQQGKINAFHNSCRHRGSRVCNTDKGMAAK
                     LVCPYHQWTYELDGRLLFARQMAEGFDKSQFGLKPVACESVAGYIFICLAKEPADFAP
                     MRAMIEPYLKPHRLGEAKIAFESTIIEKGNWKLVWENNRECYHCAGNHPELCKTFPEA
                     PTVTGVQGADSDPEMLAHWAKCEAAGLPSKFRIDPAGQYRATRAPLLRDAVSYTMNGK
                     RAVRKNLSDSVSADRIGTLMHYHYPTTWNHILIDHAVTFRVLPISATETAVTTKWLVH
                     KDAVEGVDYDLAELTHVWTETNDQDRRIVEENAFGILSPAYEPGPYSELHEGGVIQFV
                     DWYARFIGPRLAEDGKPALRSVA"
     gene            419968..421077
                     /locus_tag="MESOP_RS01885"
                     /old_locus_tag="Mesop_0382"
     CDS             419968..421077
                     /locus_tag="MESOP_RS01885"
                     /old_locus_tag="Mesop_0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH oxidase"
                     /protein_id="WP_041163968.1"
                     /db_xref="GI:752465259"
                     /translation="MNAMTDLGLYRHLDQMAPWNDRLQVLEVIGVSDEAPDVKTFTFR
                     SDNQTWFRYKPGQFVTLELPTSDGPLMRTYTLSSSPSRPFSIAVTVKAQAGSIGTRWM
                     FDHLVPGSHVKAYGPAGDFSLHSHPAAKYLFISAGSGVTPMMSMLRWLNDCAPWTDVG
                     FVNCARRAEEIIFRKELELLGGHMPGLSLGFMIEERSSREGWYGHMGRIDAIRLPLLA
                     PDFREREIFCCGPDPFMRAVRGMLEAAGFDMTQYHQESFAAPAVEEVPAPFAAPAEGG
                     TVVPFGAATPIRFSLSEVDAECVAGQTVLQTARASGVRIPAACEFGLCGTCKVKKVSG
                     HVEMSHNGGILDHEIDDGFILACCSKPLSALEIEA"
     gene            421224..421655
                     /locus_tag="MESOP_RS01890"
                     /old_locus_tag="Mesop_0383"
     CDS             421224..421655
                     /locus_tag="MESOP_RS01890"
                     /old_locus_tag="Mesop_0383"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891626.1"
                     /db_xref="GI:503657550"
                     /translation="MRQSGIYAIASKDIVFESFDGEAVVLDLTTGKYFGFSDSGSRLW
                     DALSSGVPASELVGAATAAGALGAAEIDGFVSQLLEFGLLAAVTDAAARPVPSELLAQ
                     LAGASEPLKVDIHDDLADLIVVDPIHEVEEPLGWPAVKQAN"
     gene            421708..422757
                     /locus_tag="MESOP_RS01895"
                     /old_locus_tag="Mesop_0384"
     CDS             421708..422757
                     /locus_tag="MESOP_RS01895"
                     /old_locus_tag="Mesop_0384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HPr kinase"
                     /protein_id="WP_013891627.1"
                     /db_xref="GI:503657551"
                     /translation="MPKVTLENLADYARHVLAQAESSAAHYPLTRTVGLPHLELTTHL
                     SAGALADAVVHGFVAAPSTRAAADTCRIFVAHPGMDGIAAPASWGQGPFTEHAFASRL
                     AEAGLRGNHFHDLDFWQFYDPDRRLGVQLMTADDRFPPWEPGAPLRPFLHWEYAARGM
                     RLAHAGTLGVGGKGILLAGAGGAGKSGTVVAGLLNGLDSVGDDYVLIDLAGGPTAHPL
                     FATLKQDPEGFGRLGLKHRLKSYGPLNWQGKHQFRIDDITARPIPARLDIVALMVPHI
                     SGGEASSIMPVSRKDAMIALAPSGISQMPGERESGFRFFSDLTRQLPCYQLSLGTRPQ
                     EIAGTISDFIMRSSA"
     gene            422754..423506
                     /locus_tag="MESOP_RS01900"
                     /old_locus_tag="Mesop_0385"
     CDS             422754..423506
                     /locus_tag="MESOP_RS01900"
                     /old_locus_tag="Mesop_0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="WP_013891628.1"
                     /db_xref="GI:503657552"
                     /translation="MRLSVIMPVYNREHYVVAALRSLLRQRDDAELDVIVVDDGSTDG
                     TADTVRAVMREASCIRLFRQAHQGVASARNTGLGQLQPQTQFVSFLDSDDISPAGRFK
                     ADLVHFKADPSLDLTYSLMMMVEDLDDEMLEPTPGSRRKIARGLSLAAGTFSRRLIDR
                     IGSFDEAFRQAEDTDYLLRVFESGPRFVMPDTIALYYRRHPGNMTREPGVPLREYMRA
                     IHKSMKRRKADPSLHTVDGIFDLKDSADWRFM"
     gene            423543..424295
                     /locus_tag="MESOP_RS01905"
                     /old_locus_tag="Mesop_0386"
     CDS             423543..424295
                     /locus_tag="MESOP_RS01905"
                     /old_locus_tag="Mesop_0386"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="WP_041163969.1"
                     /db_xref="GI:752465260"
                     /translation="MKLSVIMPVHNREQFVGLALRSLLRQRENVDLDIIVIDDGSTDG
                     TAAVVRSLVDQAPCIRLFQQANGGVTRARNAGLKQLLAQTRLVSFLDSDDISPIGRFA
                     ADIACFEEDPGLDLTYSRMTLVDKIDGETLEPAADSHAITVRGIHLSAGIFARDLIER
                     TGGFDEDFRQAEDTDYLLRIFESQAKYIMPDTVALYYRRHPGNMTKEADVPFREFMRA
                     IHKSMKRRKADPGLRRVEGIFDFKDLAQWRFL"
     gene            424295..424972
                     /locus_tag="MESOP_RS01910"
                     /old_locus_tag="Mesop_0387"
     CDS             424295..424972
                     /locus_tag="MESOP_RS01910"
                     /old_locus_tag="Mesop_0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="WP_013891630.1"
                     /db_xref="GI:503657554"
                     /translation="MAGYGVVIPAFNAAATIGAALDSVLAQTIKAEAIVVVDDGSTDD
                     TVAVIEAMNLPVTVLRQENAGPGSATTRGFDALSTPFVATLDADDLWLPDKIEKQLAC
                     LDRDPGTAGVFAHWRTFRGDRPDLPETTSVAGWSRTTMMIRQEAVTAVGPIVDPQGGR
                     GEMIDWIARVREAGFVLAMLDDVLALRRIRPGSLSYGRDPARDRGYLEVARLAMKRRA
                     QGRAGGG"
     gene            424972..426444
                     /locus_tag="MESOP_RS01915"
                     /old_locus_tag="Mesop_0388"
     CDS             424972..426444
                     /locus_tag="MESOP_RS01915"
                     /old_locus_tag="Mesop_0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891631.1"
                     /db_xref="GI:503657555"
                     /translation="MAKAVRRITRRFPDYGWSWPTGGLDQLLKAALLDDEEAASQCAM
                     HWLAANDIDLVSFREHRLLAAISDRFGRKLAGHAAFPRLVGLQKMLWTKSRMAMREAE
                     PALKAMADAGCMVMLIKGASRIALDAAAQRGRVAHDIDILVRPQDMQTAFDVLRDREW
                     QIATGVSPQYLRTRLASLRSMNFFKGNFGDIDLHQLAYDGSQQSDEDDIAIWRRADTA
                     IFSGVGVLVPSPADRIALAIAHGGLDAHTHSDWLVDCTVAIRGGDVDWDVFLDLVARR
                     GLAVAAAVALSYLALEIGVAAPDRVLAHVLEMADSAGPSRWSGVLQAKPRTDFGRLVW
                     LSRGLAKQLRLRRKSGRLRQEPPAKAWRSKPGRPEPLNASSPPAFSQAIPCPRTAGDM
                     MLDITVRISVPPVRRRIEMEINADDDHVARLRAMAISRSGGERVLRFRGKVTLDGERQ
                     AMTLEARPSRQFRRWDDAETVATYGALPFQLISATFSPLR"
     gene            complement(426517..427146)
                     /locus_tag="MESOP_RS01920"
                     /old_locus_tag="Mesop_0389"
     CDS             complement(426517..427146)
                     /locus_tag="MESOP_RS01920"
                     /old_locus_tag="Mesop_0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase"
                     /protein_id="WP_013891632.1"
                     /db_xref="GI:503657556"
                     /translation="MLVLPKGVRHMPAYLPRAAQEALVEDVRSIVQQAPLFVPAMPRT
                     GKEMSVRMTNCGPLGWVTDKERGYRYQPTHPVTGMPWPPFPDRLLDLWRQVSGYRHPP
                     EACLINFYTAEAKMGLHQDRDEVDFSAPVVSVSLGDDCLFRVGQTTRDGGTKSFRLKS
                     GDVVVLGGEGRLAFHGVDRIYPSTSALLKNGGRINLTLRRVTKPDEGAA"
     gene            complement(427567..428031)
                     /locus_tag="MESOP_RS01925"
                     /old_locus_tag="Mesop_0390"
     CDS             complement(427567..428031)
                     /locus_tag="MESOP_RS01925"
                     /old_locus_tag="Mesop_0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein LysM"
                     /protein_id="WP_013891633.1"
                     /db_xref="GI:503657557"
                     /translation="MGMFDFVKSVGKKLGIGGDDETAPTADTLKKELDSHKLGTDGVQ
                     VVVQGDTAVLKGVVKDQSIFEKAVIAVGNTLGVSKVQADELQVAPDAGKSAAPAKEPT
                     FYTVQKGDNLWKIAEKSYGKGQGAKNTVIFEANKPMLTHPDKIYPGQVLRIP"
     gene            complement(428123..428560)
                     /locus_tag="MESOP_RS01930"
                     /old_locus_tag="Mesop_0391"
     CDS             complement(428123..428560)
                     /locus_tag="MESOP_RS01930"
                     /old_locus_tag="Mesop_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="WP_013891634.1"
                     /db_xref="GI:503657558"
                     /translation="MPIDDDIIISGEAVIHPGDLHEDFIRSSGPGGQNVNKVATAVQL
                     RFDAQNAAGLSERVRARTIKLAGQRATKDGVIVIEAGRFRTQEQNRADARARLTALVA
                     KAAEPPPPPRKKTRPSKGAVERRLKSKAGRGTIKKLRGRVEND"
     gene            complement(428716..429300)
                     /locus_tag="MESOP_RS01935"
                     /old_locus_tag="Mesop_0392"
     CDS             complement(428716..429300)
                     /locus_tag="MESOP_RS01935"
                     /old_locus_tag="Mesop_0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013891635.1"
                     /db_xref="GI:503657559"
                     /translation="MTARQRGRPPRDQVGVTPGAMLSTALEILDGEGAEALTMRALAK
                     RSGINPMTIYHHFGDRDGLIRALSERVYAGVAAPQKGSARTRLEELLQSYQSQVVQHP
                     GLTLTIFSRPSVFPDQAKRITEDLRTLLRELGLPPSRSQLWVSILVDFTHGAALATAM
                     SRRSENEDGQKTSIGDKEYASALAELLDSLDRSN"
     gene            complement(429297..429833)
                     /locus_tag="MESOP_RS01940"
                     /old_locus_tag="Mesop_0393"
     CDS             complement(429297..429833)
                     /locus_tag="MESOP_RS01940"
                     /old_locus_tag="Mesop_0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deaminase reductase"
                     /protein_id="WP_013891636.1"
                     /db_xref="GI:503657560"
                     /translation="MIKGHVFIATSLDGFIARDDGEIEWLLERDDPSENHGMDDFIEK
                     VDAVIMGRGTFEAVRDVRPWFYRRPVLVLSATLADQPVPDELEGRVRFSGKSPEQAMT
                     MLEAEGCRHVYVDGGLVIQSFLQLGLIDDMTITRVPILLGSGRSLFGPTASDICLIHE
                     ETRSFPSGLVQSRYRLAA"
     gene            complement(430093..431703)
                     /locus_tag="MESOP_RS01945"
                     /old_locus_tag="Mesop_0394"
     CDS             complement(430093..431703)
                     /locus_tag="MESOP_RS01945"
                     /old_locus_tag="Mesop_0394"
                     /EC_number="4.1.1.49"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006201275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="WP_013891637.1"
                     /db_xref="GI:503657561"
                     /translation="MSEVGTRNPACAIDRIGLKTSGVVRYNFGAAALYEESIRRNEAR
                     LTAHGALVAETGQHTGRSPKDKFVVRDAATEPHVWWDNNRAISPAQFETLLADFRAHA
                     ADKDLYVQDLVGGADAELKLPTRVITEFAWHSLFIRNLLIRPGKAELEQFLPEMTIID
                     LPSFRADPARHGSRTETVIAVDLTRKIVLIGGTSYAGEMKKSVFTMLNYLLPEKGVMP
                     MHCSANEGAGGDAAIFFGLSGTGKTTLSADPSRTLIGDDEHGWGPHGIFNFEGGCYAK
                     TIKLSAEAEPEIFATTQRFGTVLENVILDADGAPDFNDGRLTENTRCAYPLDFIPNAS
                     KTGRASHPKNIIMLTADAFGVMPPIARLTPAQAMYHFLSGYTAKVAGTEKGVTEPEAT
                     FSTCFGAPFMPRHPSEYGNLLRELIALHGADCWLVNTGWTGGAYGTGKRMPIKATRAL
                     LAAALDGSLKATEFRTDANFGFEVPVTVPGVDSAILDPRSTWADKAGYDRQAARLVGM
                     FAVNFEKFESHVDAVVLGAAPRMQEAAE"
     gene            432029..432748
                     /locus_tag="MESOP_RS01950"
                     /old_locus_tag="Mesop_0395"
     CDS             432029..432748
                     /locus_tag="MESOP_RS01950"
                     /old_locus_tag="Mesop_0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_019862687.1"
                     /db_xref="GI:518701404"
                     /translation="MREPLEMATIALVDDDRNILTSVSIALESEGYRVETYTDGASAL
                     EGLAARPPNLAILDIKMPRMDGMELLRRMRQKSDLPVIFLTSKDDEIDELFGLKMGAD
                     DFIRKPFSQRLLVERVRAVLRRASAREAAAKAPSQQARSLERGQLVMDQERHTCTWKG
                     EPVTLTVTEFLILHSLAQRPGVVKSRDALMDSAYDEQVYVDDRTIDSHIKRLRKKFKA
                     VDDDFEMIETLYGVGYRFREA"
     gene            432899..434683
                     /locus_tag="MESOP_RS01955"
                     /old_locus_tag="Mesop_0396"
     CDS             432899..434683
                     /locus_tag="MESOP_RS01955"
                     /old_locus_tag="Mesop_0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_013891638.1"
                     /db_xref="GI:503657562"
                     /translation="MAVEAQRSRPTGAARRPSRIMPSFVSKITVPMRRFLGHHIFSSL
                     TRRILFLNLAGLAVLVTGILYLNTFRDGLIDARVESLMTQGEIIAGAIAASATVETDS
                     ISIDPEKLLELQAGESLGPGSDQLDNLDFPINPERVAPVLRRLISPTRTRARIYDRDA
                     NLLLDSRHLYSRGQILRYDLPPVEEEEPDLVERIQKFIFDFFRNTDLPVYREQPGGNG
                     AAFPEVVKALTGSPSTIVRVSEQGEQIVSVAVPIQRFRAVLGVLMLSTEGGDIDKIVA
                     AERKAILRVFGIAALVTAILSMLLASTIANPLRRLSAAAVRVRRGVKSREEIPDFSDR
                     QDEIGNLSIAVRDMTNALYARIEAIESFAADVSHELKNPLTSLRSAVETLPLAKNDNS
                     RSRLMEIIQHDVRRLDRLITDISDASRLDAELAREDAGTVDLKKFITDLVAVSREATR
                     NKKAVEIEFKVAKLPQGVKGYFVVGHDLRIGQVITNLIENARSFVPEDHGHISLSLAR
                     AGKFNILTIDDNGPGIRADNIDRIFERFYTDRPAGEAFGQNSGLGLSISRQIVEAHGG
                     TLTAENIPGTKPGEIKGARFVVTLPADA"
     gene            434683..435144
                     /locus_tag="MESOP_RS01960"
                     /old_locus_tag="Mesop_0397"
     CDS             434683..435144
                     /locus_tag="MESOP_RS01960"
                     /old_locus_tag="Mesop_0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine kinase"
                     /protein_id="WP_041164477.1"
                     /db_xref="GI:752465768"
                     /translation="MAGPVVRPENIHATGLLIGERGILVSGTSGSGKTTLALALVDHC
                     RQRGLFSRLIGDDQLFAEAHAGRLVCRAPATIEGLAEVPGLGPRPLAFEPACVVDLHV
                     RLLPAGEIARFQEDASDDIAGCAVPRIDLAERNVQAALPAVMARLSIMPFL"
     gene            435309..435710
                     /locus_tag="MESOP_RS01965"
                     /old_locus_tag="Mesop_0398"
     CDS             435309..435710
                     /locus_tag="MESOP_RS01965"
                     /old_locus_tag="Mesop_0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006201271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIA"
                     /protein_id="WP_013891640.1"
                     /db_xref="GI:503657564"
                     /translation="MIGLVLVTHGQLATEFRHAVEHVVGPQDNFETVAIGADDDMEQR
                     RRDIIDAVARVDTGAGVIVLTDMFGGTPSNLAISVMESGRTEVIAGMNLPMLIKLSSI
                     RKGDNMAAALDEAQAAGRKYINVASQLLSSK"
     gene            435707..436003
                     /locus_tag="MESOP_RS01970"
                     /old_locus_tag="Mesop_0399"
     CDS             435707..436003
                     /locus_tag="MESOP_RS01970"
                     /old_locus_tag="Mesop_0399"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HPr kinase"
                     /protein_id="WP_013891641.1"
                     /db_xref="GI:503657565"
                     /translation="MNALSPEKDQIVREFPIVNQRGLHARASAKFVQLASGFDASVHV
                     EKDGVKVGGTSIMGLMMLAASPGYSIRVTASGPEALEVMDALEQLVASRFGEES"
     gene            436186..437586
                     /locus_tag="MESOP_RS01975"
                     /old_locus_tag="Mesop_0400"
     CDS             436186..437586
                     /locus_tag="MESOP_RS01975"
                     /old_locus_tag="Mesop_0400"
                     /EC_number="3.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862682.1"
                     /note="catalyzes the formation of L-homocysteine from
                     S-adenosyl-L-homocysteine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylhomocysteinase"
                     /protein_id="WP_013891642.1"
                     /db_xref="GI:503657566"
                     /translation="MTGSKDYVVADISLAGWGRKELDIAETEMPGLMACREEFGAKKP
                     LKGARITGSLHMTIQTAVLIETLKALGADIRWASCNIFSTQDHAAAAIAEAGIPVFAV
                     KGESLEQYWDYTDRVFQWTDGGLSNMILDDGGDATMYILIGARAEAGEDVLSNPQSEE
                     EEYFYAQIKKRLKASPGFFTKQKAAIRGVTEETTTGVNRLYQLQKKGLLPFPAINVND
                     SVTKSKFDNKYGCKESLVDGIRRGTDTMMAGKVAVVCGYGDVGKGSSASLKGAGARVK
                     VTEVDPICALQAAMDGFEVVTLEDAAPTADIVITTTGNKDVVTLDHMRSMKDMVIVGN
                     IGHFDNEIQVASLRNLKWTNVKPQVDMITFPDGKRMILLSEGRLLNLGNATGHPSFVM
                     SASFTNQVLAQIELFTKGEQYQNQVYVLPKHLDEKVARLHLDKLGARLTELSGEQAAY
                     IGVTPQGPFKPEHYRY"
     gene            437786..440341
                     /locus_tag="MESOP_RS01980"
                     /old_locus_tag="Mesop_0401"
     CDS             437786..440341
                     /locus_tag="MESOP_RS01980"
                     /old_locus_tag="Mesop_0401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_013891643.1"
                     /db_xref="GI:503657567"
                     /translation="MPGQYPHGAGQAVSGGHDDSGTTGSATRRERLSWRGRAGLLLAG
                     SMLAGPLFGAAARAQAAGVSTAGLSISTIEVMQLAVFVGVTGTAFLSAIVLIRERART
                     SAENVELRSRVADVNAALRRSEALLNLRDQRVIVWASENKKPELVGILPVESGAPEER
                     AAFLAFGRWLMPRSAAALEHAIAALREKARPFDLVIESQAGAPLEVHGRKSAAHVLVR
                     FVSLSETQRSQARLKIENHRLAADHDTMIGLLEALKMPAWLRDEHGRLKWVNRAYADA
                     VEAESAEAAVRDAKEFLGGQAREAIEAQHKLHPVFEQSLSTVIEGDRRVFAVTDFASA
                     DGSAGLACDTSAIESIRGEYERTVRSHADTLDQLNTAVAIFDTDEKLRFFNQAFQKLW
                     GLDSGFLHSAPDNALLLDRLRSEGKIAEQPEWRRWKEGLLGAYRAVESQEHWWHLPDG
                     KTIRVVANPQPKGGVTWVFENLTEKMDLESRYRTAVRVQGETLDNLAEGVAVFGPDGK
                     LRLSNPAFATLWGLDAEATKPNVHVSTIRDLCDRQAVDSPWPSFVAAITGFDDERRDR
                     HGQTELNNGTVLRYAMIPLPNGQVMMTFVDVTDGVRVERALKDKNEALEKSDQLKNDF
                     VQHVSYELRSPLTNIIGFTELLSLPTTGPLTQKQREYVEHVGSSSSVLLTIVNDILDL
                     ATVDAGIMQLDISEVHVDRTIAAAAELVADRLQEHSIRLEVDAKAAPKTFHGDETRIR
                     QILYNLLSNAANYAPEASTIRLACRHLADGVEFSVHDDGPGMPPDVLDSVFRRFEPRA
                     NGGRRRGAGLGLSIVKSFVELHGGGVRIETGKDKGTTVICTFPDMPGIRAAAE"
     gene            440351..441862
                     /locus_tag="MESOP_RS01985"
                     /old_locus_tag="Mesop_0402"
     CDS             440351..441862
                     /locus_tag="MESOP_RS01985"
                     /old_locus_tag="Mesop_0402"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891644.1"
                     /db_xref="GI:503657568"
                     /translation="MTALVLERLLADETETARLGEDLALALRAGDVLALKGDLGAGKS
                     TLARALIRTLADDAGLDVPSPTFTLVQSYDTRIPVHHFDLYRLSSAAELDELGFDEAL
                     TQGAALVEWPERAEGYLPKASLLIELVQHGEGRQARLSGQGATFDRAARSLAMRDFLE
                     SVGWGEAQRRHFIGDASARSYEVVSLAGREPRVLMNSPRLVLGPPVRDGKPYAVIAHT
                     AQSVSAFVAIDHALKAGGVSVPDIHAEDQEQGFLLIEHLGSEGFLGGDGEPLAERYAA
                     AAELLAMMHGKTWPRRLEAGPGRFHTVPPFDRAAMMIEADLLVDWYVPAISGGPPSDD
                     LRAGYTREWNALFDRLRASEYTLMLRDFHSPNIIWRGDRSGHDRLGIVDFQDALIGPS
                     AYDLASLAMDARVTISPGIERRTLDAYIAARHKAGAFDEASFLESYAIMAAQRNSKIL
                     GIFVRLEKRDGKPYYLKHLPRIRDYLRRALSHPALGSLREFYDAHGLLEERAL"
     gene            441859..442587
                     /locus_tag="MESOP_RS01990"
                     /old_locus_tag="Mesop_0403"
     CDS             441859..442587
                     /locus_tag="MESOP_RS01990"
                     /old_locus_tag="Mesop_0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="WP_013891645.1"
                     /db_xref="GI:503657569"
                     /translation="MTARPDTAIVLAAGLGKRMRPITDTIPKPLVRVAGKTLLDWGLD
                     SLAAAGVGKAVVNVHYLPEQIVSHVAQRHVPRVIISDESERLLDSAGGIVKALPELGA
                     QPFYILNADTFWIDHGPLNLGRLALAWNAAKMDILLMLADLHQATGHCGSTDFLVAPD
                     GALRRSNGDPAGLIYAGAAIIHPRLFADASAEPHSLNAYFDKAIAAGRLYGMPMHGHW
                     ITVGTPDAIPLAEAAVAGALYESQ"
     gene            442584..445718
                     /locus_tag="MESOP_RS01995"
                     /old_locus_tag="Mesop_0404"
     CDS             442584..445718
                     /locus_tag="MESOP_RS01995"
                     /old_locus_tag="Mesop_0404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013891646.1"
                     /db_xref="GI:503657570"
                     /translation="MSGPSRVFSIPSGAPFLPTLAEALLAGRLVPGFRFDGDPLALAD
                     VTIYVPTRRAARALRGVFVDSLKARGGGGSAILPVIRPLGEFDEDEAAFEAEPSAAID
                     LAPPIGATERLLLLTPLVRAWKRRLPAHVAKLFAEEIVIPASTADAIWLARDLAGLMD
                     EIETEGTDWAKLEGLVTGNLAGWWQVTLEFLGIVTDAWPKFLEEQDRSNPAAHRSALI
                     RAEAARLRRNPPAGPVIAAGSTGSIPATAELLAAIARLPGGAIVLPGLDRTLDEASFQ
                     ALVAPGARPAVLGHPQYGLARLIGKIGVLRGDVEEIGVAEPRLALRAALVGEALRPAE
                     TTELWAETRNAFSAPDIAAAFADVTLLEAASERDEAVAIAVALKRAVEEPGQRAALVT
                     GDRALARRVSVELKRFGVVADDSGGTPLANSPAASLLRLALEAVFRPGDPVGLLSLLK
                     HPLLCLGLGRADVRHAAELVELVALRGGTGRPDIASLPDLFETRLTGFDEGSRPPFWV
                     ARLTVRAIESARDLLERLNRALAPLAAFRGQATADLAALVEASVVALEVLGRAADGGL
                     GELYAGDAGEKLAELLRGLVAAPATLSFAANEWPDVMDALIAPETVKPAQGTDRNIAI
                     WGALEARLQDVDTLVIGGLNEGVWPRKPESDRFMSRLMKTGIDLEPPERRIGLAAHDF
                     QMAMGAGKVLLARSARSGDAPAVPSRWLQRLLTFIGNDQAATLRRRGDELLAWARALD
                     TGPKQDFAPRPQPKPPLSVRPTHFSVTEIETLRRDPYAVYARRILGLMPLEPLIRDPG
                     AAERGTLFHAILHLFSSSVADPRAPDALAGLIAAGRACFAEAALPPDVEAVWWPRFEK
                     LAANIVEWERTRADAVIRRHAEERAGKTVVGQSGVTLSGYADRVDLLAGGMADILDYK
                     TGSSPSKAQAHTLLAPQLALEGALLRRGAFKDLGACEPSQLAFIRLKPNGEVFEESIL
                     EHNRQPRTASDLAEEAWARLEKLLIHYADPKTGYLSRALPFREGETDGDYDHLARVLE
                     WSAGGDAGDEGGEA"
     gene            445715..449215
                     /locus_tag="MESOP_RS02000"
                     /old_locus_tag="Mesop_0405"
     CDS             445715..449215
                     /locus_tag="MESOP_RS02000"
                     /old_locus_tag="Mesop_0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_013891647.1"
                     /db_xref="GI:503657571"
                     /translation="MKKAYPIPSDTATSQARAADPQNSAWVSANAGSGKTHVLAQRVI
                     RLLLNGTDPSKILCLTYTRAAAANMSNRVFSTLSEWTSLGDADLAARIEALEGRRPDR
                     DTMRRARRLFAEALETPGGLKIQTIHAFCESVLHQFPLEANIPSHFEMLDSQMEASLF
                     AAARREMISAAGDADLTEAFATVLERGGEAGLDALLGEIVRKRDGLRYFLDAVGRDSF
                     QPLFDEFHFRPGQTAEGIAASAWPLPGFLPDYFTGFAQAAESTDARSVLNNILPYARR
                     AFAESDPVRRLQQLARAFLKTDGDPYDPAKAFKKALTDRLPDLADRYLSASSAIIETV
                     DRLALFRMLEGTAAALTIADWLIARYEVLKRGRGFLDFNDLITRTVNLLARPDAGPWV
                     QYKLDQGIDHILLDEAQDTSPDQWEVVKRLAEEFFAGFGARDRVHRTVFAVGDEKQSI
                     YSFQGAAPDSFADSRLLFSSRVRDAEASFADLKLTWSFRSTDDVLSAVDRVFADPVVR
                     RGISHDPDPLSHKAIRTDAPGYVEVWPSIGADIVDEPDDWTQAIDHAHAPAVRVAENV
                     ATTIAGWIGNGEIIEGRGKRLRPGDVLVLVRKRDSFVHALTRALKRRDIPVAGADRLS
                     LPGHIAVKDLIALGRLLIQPQDDLSLAAVLRSPIFDLPEETLFALAAQRAPGLSLATS
                     LRQHAGESEALAIVVAQLDIWTDEAAFKPVFEFYAGLLARDGVRRKMIARLGPEAGDI
                     LDEFLSFCLAEERTGLPGLEAFLSTLENAGPEIKREMDQTRDEVRVMTVHAAKGLEAP
                     VVFLVDGGSAPFSDQHLPRLMPFDGSGWVGKGYLWRSASDVANGFSKAAAARARELAD
                     DEYRRLLYVGMTRAEDRLIVCGYHGKRAPNTGTWHSIVSRALIGAPESEQRAHPAGGE
                     PVYRFHVTELPPVALATAEQARQTDAFGPLPTNLFRPLPPFEDLPRPLSPSGASALIE
                     EGKETVVDKASPVLDADAEPGFAVLRGLALHKLLQMLPGIAEDQREGAAARYLARTGA
                     EWPPAEREKALASVIAILADPYLGQLFAPSSRAEVAIMGSLEVRGKNRSISGKIDRLA
                     VTPDAVSIVDYKTNRPAPAGLAEVPPAYLLQLALYRALLQPLYPGREVKAALLFTEAP
                     RLIELPAGAMDDALARLTGA"
     gene            449291..449614
                     /locus_tag="MESOP_RS02005"
                     /old_locus_tag="Mesop_0406"
     CDS             449291..449614
                     /locus_tag="MESOP_RS02005"
                     /old_locus_tag="Mesop_0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_013891648.1"
                     /db_xref="GI:503657572"
                     /translation="MTTVKVDKSNFQADVLNANVPVVVDFWAEWCGPCKMIAPALEDI
                     ATELGAKVKIAKLNIDENPELAAQFGVRSIPTLMIFKGGEVADMKVGAAPKTALSHWI
                     NGSLA"
     gene            449747..450028
                     /locus_tag="MESOP_RS02010"
                     /old_locus_tag="Mesop_0407"
     CDS             449747..450028
                     /locus_tag="MESOP_RS02010"
                     /old_locus_tag="Mesop_0407"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_013891649.1"
                     /db_xref="GI:503657573"
                     /translation="MTGSARATVFIDNERVIVTEYRFQPGDNTGWHRHGHDYVVVPLM
                     DGKVKLVTKDGETFAEMKKGSPYFRKEGVEHDVINANEGEYAFIEVELK"
     gene            complement(450050..450469)
                     /locus_tag="MESOP_RS02015"
                     /old_locus_tag="Mesop_0408"
     CDS             complement(450050..450469)
                     /locus_tag="MESOP_RS02015"
                     /old_locus_tag="Mesop_0408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactoylglutathione lyase"
                     /protein_id="WP_013891650.1"
                     /db_xref="GI:503657574"
                     /translation="MIKVKQLAHVCIFAHDLEATRAFYRDVLGLDTQFNFVRDGKVFG
                     FYLNCGGRSHVEVFQKDGTAYSEQNQINHFCLEVENIDAAIAHIKSKDIEVTAKKHAC
                     DSTYQAWIRDPNGVKIELFEYTDESAQFVGGDRIADW"
     gene            complement(450495..451820)
                     /locus_tag="MESOP_RS02020"
                     /old_locus_tag="Mesop_0409"
     CDS             complement(450495..451820)
                     /locus_tag="MESOP_RS02020"
                     /old_locus_tag="Mesop_0409"
                     /EC_number="6.3.2.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="folylpolyglutamate synthase"
                     /protein_id="WP_013891651.1"
                     /db_xref="GI:503657575"
                     /translation="MTTLAADREIEALMALHPKGFDLSLDRITRLLERLGNPQDLLPP
                     VIHIAGTNGKGSCAAFARALLEASGRLVHVHTSPHLVSWHERYRLAAEGGGRLVDDDI
                     FAEAIARVAKANDGQKITVFEILTAVTFILFSEHPAEAAIIEVGLGGRFDATNVVERP
                     AVSVIMPVSMDHEAYLGDRVELIAAEKAGIMKRGCPVVIGSQESETALQVLIETAERL
                     ECPTFVYGQDFLAFEENGRMVYQDEDGLMDLPLPRLPGRHQVANAAAAIAAVKAAGFE
                     ISHRAAEKAMTNVAWPGRMQKLAQGRLADLAPRGADIWLDGGHNPGAGVVVAEALAEQ
                     EEKNPRPLFLISGMINTKDQSGYFRAFKGLVRHVYTVPVNTSDAGVPNDELAIRATEA
                     GLTAEPMSSVANALMLLRDTWDGPPPRILIGGSLYLAGAVLDENGTPPT"
     gene            complement(451940..452866)
                     /locus_tag="MESOP_RS02025"
                     /old_locus_tag="Mesop_0410"
     CDS             complement(451940..452866)
                     /locus_tag="MESOP_RS02025"
                     /old_locus_tag="Mesop_0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase subunit beta"
                     /protein_id="WP_013891652.1"
                     /db_xref="GI:503657576"
                     /translation="MNWITNYVRPKINSMLGRRTDMPENLWIKDPETGEMVFHKDLES
                     NQFVIPSSGHHMKISAKERLKYFLDDGKYEQLENPKVVQDPLKFRDEKRYTDRLKDAK
                     AKTGLEDAIVNALGTVEGLPVVVTVQDFAFMGGSLGMAAGDAIVHAFEVALQRKRPLI
                     LFAASGGARMQEGILSLMQLPRTTVGVDRLKEAGLPYIVVLTNPTTGGVTASYAMLGD
                     VHIAEPGALIGFAGPRVIEQTIREKLPDGFQRSEYLMEHGMVDMVVSRLELRQTISRL
                     LKMLLKMPEEQKPLQPEILPPAVVSAEARPQA"
     gene            complement(452946..453785)
                     /gene="trpA"
                     /locus_tag="MESOP_RS02030"
                     /old_locus_tag="Mesop_0411"
     CDS             complement(452946..453785)
                     /gene="trpA"
                     /locus_tag="MESOP_RS02030"
                     /old_locus_tag="Mesop_0411"
                     /EC_number="4.2.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891653.1"
                     /note="catalyzes the formation of indole and
                     glyceraldehyde 3-phosphate from indoleglycerol phosphate
                     in tryptophan biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit alpha"
                     /protein_id="WP_013891653.1"
                     /db_xref="GI:503657577"
                     /translation="MVTRIDRRMAKLKAEGRPALVTYFMGGDPDYDTSLSIMKALPKA
                     GADVIELGMPFSDPMADGPAIQAAGLRALKGGQTLVKTLKMASDFRSGDNETPIVLMG
                     YYNPIYIYGVDRFLKDAIASGIDGLIVVDLPPEMDEELCIPALKAGINFIRLATPTTD
                     DKRLPKVLQNTSGFVYYVSMTGITGSALADTGKVAAAVQRIKGHTDLPVCVGFGVKTA
                     EQARVIGANADGVVVGTAIVNAVANVLGPKGEKTADPAEAVATLVSGLAQGVRSARLA
                     AAE"
     gene            complement(453788..455038)
                     /locus_tag="MESOP_RS02035"
                     /old_locus_tag="Mesop_0412"
     CDS             complement(453788..455038)
                     /locus_tag="MESOP_RS02035"
                     /old_locus_tag="Mesop_0412"
                     /EC_number="4.2.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314371.1"
                     /note="catalyzes the formation of L-tryptophan from
                     L-serine and 1-(indol-3-yl)glycerol 3-phosphate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="WP_013891654.1"
                     /db_xref="GI:503657578"
                     /translation="MNKPATPNSFRTGPDEQGMFGIFGGRFVAETLMPLILDLERHWN
                     EVKDDPEFRAELTDLSTHYAGRPSKLYFAEGLTRHLREVSAAKGLGGGAKVYFKREDL
                     NHTGSHKINNCLGQILLAKRMGKKRIIAETGAGQHGVASATVAARFGFPCVVYMGATD
                     VARQSPNVFRMKLLGAEVRPVTAGHGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHP
                     YPELVRDFQSVIGTEARAQILEQEGRLPDTIIAAVGGGSNAIGLFHPFLDDKEVRIIG
                     IEAGGRGLDGIEHCASMNAGAPGVLHGNRTYLLQNADGQIMDGHSISAGLDYPGVGPE
                     HSWLRDSGRVDYVPILDDEALEAFKLTTRVEGIIPALESAHAIAHAVKIVPAMDKDQI
                     VIVNLSGRGDKDVHTVASMLGMEI"
     gene            complement(455067..455726)
                     /locus_tag="MESOP_RS02040"
                     /old_locus_tag="Mesop_0413"
     CDS             complement(455067..455726)
                     /locus_tag="MESOP_RS02040"
                     /old_locus_tag="Mesop_0413"
                     /EC_number="5.3.1.24"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-(5'-phosphoribosyl)anthranilate isomerase"
                     /protein_id="WP_013891655.1"
                     /db_xref="GI:503657579"
                     /translation="MALDIKICGLKTDQAMAAALAGGASHVGFIFFTKSPRYLEPAEA
                     GRLREVARGKALAVAVTVDAGDAFLDEIVAKMQPDMLQLHGSETPERVAEVKARHSLP
                     VMKALPLSEAADLDRIRPFIGVADRFLFDAKRPKGSELPGGNGVTFDWRILAGLDAGV
                     DYMLSGGLNAANIGDAIRLANPPAIDISSGVESAPGVKDPALIEQFFRAVRAARDDRA
                     A"
     gene            455839..456057
                     /locus_tag="MESOP_RS02045"
                     /old_locus_tag="Mesop_0414"
     CDS             455839..456057
                     /locus_tag="MESOP_RS02045"
                     /old_locus_tag="Mesop_0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891656.1"
                     /db_xref="GI:503657580"
                     /translation="MADRTVAELRQKIVQAREVIAHLMDKAAFNGAEAHRVLDYFGSD
                     AFDRNFLPWPHHADEGLRPDELNAANDD"
     gene            456285..457268
                     /locus_tag="MESOP_RS02050"
                     /old_locus_tag="Mesop_0415"
     CDS             456285..457268
                     /locus_tag="MESOP_RS02050"
                     /old_locus_tag="Mesop_0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="taurine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013891657.1"
                     /db_xref="GI:503657581"
                     /translation="MDRRRFLSFASTFSLGLAFGPPARAALTVDPDTTLAVADQSEFV
                     RNLLEASGEAPKLGFKGSFPNFAGGPAILEAIRAGALDIAYVGDTPPIQARAAGTLLP
                     IVGTFTRQVAQYHLISRPGLVIHKLAELKGKKLSYVEGSGRQVFLIEALNRAGVSLKD
                     VELVNLRVADLPDAVRSGAVDVAVLTEPHVTRLVKQVGASPVLDPLERQILPSTSYFY
                     ARPEVLTDPQKAAAIGSFLGAFARAAKWANANKQAWAKHYYTDFQRLTPDDTAAVVAG
                     ESPLVLQTAAEAIPHHQKLIDILYQAGLLKERFDAKSFFVDTYDSIVSAER"
     gene            457298..458161
                     /locus_tag="MESOP_RS02055"
                     /old_locus_tag="Mesop_0416"
     CDS             457298..458161
                     /locus_tag="MESOP_RS02055"
                     /old_locus_tag="Mesop_0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate ABC transporter permease"
                     /protein_id="WP_013891658.1"
                     /db_xref="GI:503657582"
                     /translation="MTEFISDRPFPTHVRKASAGGGREARTSGSIRLAPSRLPPGARL
                     LGPALVVLVWEAASRMGILSPYTLTAPSTAVVTGYELLADGSLLPHLLASAGRAYAGL
                     FLGVTVGVILALLSGLTRSGEALIDGVVQIKRAVPTLALIPLVIIWLGIGEAMKIFLI
                     FTAVLVPVYINTHAAIKGIDIGHVELARTLGLTRSEFIRKVALPGALPGLFVSLRLAV
                     TICWTTLVVLELINTQTGIGYLMNRARDWGQTDVIVVGIFIYAILGLVSDALVRLIEA
                     RTLAYRRALGT"
     gene            458158..458886
                     /locus_tag="MESOP_RS02060"
                     /old_locus_tag="Mesop_0417"
     CDS             458158..458886
                     /locus_tag="MESOP_RS02060"
                     /old_locus_tag="Mesop_0417"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonate ABC transporter ATP-binding protein"
                     /protein_id="WP_013891659.1"
                     /db_xref="GI:503657583"
                     /translation="MNVHTASFGPVLLRNLSRGFGQKTILNDITLEIPRGQFVALLGE
                     SGSGKTTLLRALAGLDDDAVTQGDFRTPRNTSVLFQDARLLPWMSVIDNLTLGLRRSD
                     ARAAASAMLDSVGLADKADVWPATLSGGQKQRAALARSLLRQPELLLADEPFGALDAL
                     TRMRMHGLLFRLVEQHKPTVVLVTHDVDEALLLSDRILVLKDGRIAEDHQVALPHPRS
                     PGDQTFVELRQTLLRSLGVETNLM"
     gene            458898..460235
                     /locus_tag="MESOP_RS02065"
                     /old_locus_tag="Mesop_0418"
     CDS             458898..460235
                     /locus_tag="MESOP_RS02065"
                     /old_locus_tag="Mesop_0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="WP_013891660.1"
                     /db_xref="GI:503657584"
                     /translation="MARKMHFNLFLMPRGHHEGAWRHPDSTRRALTDLELYVEAARIA
                     EAAKFDAVFLADVLVAPNNGGLVATGALEPITLLSALAARTSQIGLIGTASTTYSLPF
                     THARQFASLDHLSGGRAGWNIVTSWAPQAGANYGLEQDVAHGDRYALADEFVEAVDAL
                     WRSFPAEAIVDDRDAGQYLDPRLIQPANYRGSHFRTHGPLNVPSSPQGRPVYVQAGQS
                     ETGRAFAARWAEAIFTAHLAKETAQSFYADVKGRAAAFGRRPQDIVVLPGISAAIGST
                     THEAKQVWEELDALTSPQIGLVRLSARFGGHDFSGIPLDRPLTRGDFPDPSQVEASRS
                     RATGYIDVALKEGLTLRQLLQKLAGARGHFTATGTPEQVADIVADWFHSGAADGFNVM
                     PPIVHKQFELFATEVVPILRKRGLFREDYEGTTLRSHFGLDPIRQDIPLAHSA"
     gene            complement(460263..461021)
                     /locus_tag="MESOP_RS02070"
                     /old_locus_tag="Mesop_0419"
     CDS             complement(460263..461021)
                     /locus_tag="MESOP_RS02070"
                     /old_locus_tag="Mesop_0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891661.1"
                     /db_xref="GI:503657585"
                     /translation="MTIGFFRNLTKPKPTPAVEREYCVAGRTLPLKIVESARARRLTL
                     RIDSGGQGLRITVPPGLRRGEVDRFLERHQDWLEQRLAKVPTRPQVRPGIRIPIRGVP
                     HRIVHEPSKRGTVTVSRDERGPLLIVHGDRIHLPRRIADFLKREAKKEIEKLVVKHTG
                     ALGKRAKAIRYKDTSSRWGSCTSEGNLSFSWRIMMAPQPVINYLVAHEVAHLKEMNHG
                     PKFWKLCEKLCPDTDRCKDWLKRNGGALQAIMFE"
     gene            complement(461121..461603)
                     /locus_tag="MESOP_RS02075"
                     /old_locus_tag="Mesop_0420"
     CDS             complement(461121..461603)
                     /locus_tag="MESOP_RS02075"
                     /old_locus_tag="Mesop_0420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891662.1"
                     /db_xref="GI:503657586"
                     /translation="MNTSALIRPAWTPATIALMVIGFMVFWPLGFAMLAYIIWGDRLD
                     GFKRDVNRATDGIFAGCRRGSDKAARWGHGSARTGNVAFDDWREKELERLNEERRKLD
                     EMLTQFDEYARELRRAKDQDEFDRFMANRNKSTAPTKTDPSTGTTTTKRGKGSNLLDD
                     "
     gene            complement(461721..462869)
                     /locus_tag="MESOP_RS02080"
                     /old_locus_tag="Mesop_0421"
     CDS             complement(461721..462869)
                     /locus_tag="MESOP_RS02080"
                     /old_locus_tag="Mesop_0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="benzoate transporter"
                     /protein_id="WP_013891663.1"
                     /db_xref="GI:503657587"
                     /translation="MSMRLSIPISAFVAAIVGFGGTLAIVIAAAHAVGATQIQTASWV
                     TTICLAMAIESLWLSWRTKMPVITAWSTPGLALMAASSGFSIGEAVAAFIVTAILLIA
                     TGLFKPLTQLISRIPPSVASGMLAGIVVTFALNAVKTVPVDPWLILPLIAAFFIIRLF
                     NPALSVLAVLIGGGLAAFLTGRVGGLPTPELSTLTLIAPDFTAKAMIGLALPLYLVTM
                     ASQNLSGLAVLRAAGYHPEPGPLIGVTGLFSLLSAPFGGSTTNLAAISAAICTGPDVH
                     PDPAERWKTGPFYALAYLIFAIFGASLVAIFAVLPQSLIVLVAGLALMASLANALAIA
                     LKDEGQRMAATVTFVVTASGLTLFGVGAAFWGLIAGLVVLFLDTLKKR"
     gene            complement(462869..463636)
                     /locus_tag="MESOP_RS02085"
                     /old_locus_tag="Mesop_0422"
     CDS             complement(462869..463636)
                     /locus_tag="MESOP_RS02085"
                     /old_locus_tag="Mesop_0422"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxymuconic semialdehyde hydrolase"
                     /protein_id="WP_013891664.1"
                     /db_xref="GI:503657588"
                     /translation="MTATPPIFLDVDGSRIAVRHSTGSTPGIVWLGGYKSDMLGTKAE
                     TLSDWAASESRAFLRHDYSGHGESGGAFADGTISTWLSQSLAVFRHFTRGNQILVGSS
                     MGAWIALRMVQELRKAGDASVVGLVLLAPAPDFTAELVEPVLTKAQKRDLAKKGFFAK
                     PSDYSQEPYIYTRALIEDGRDNRVMTGPIDTHCPVHILQGLADADVPSSHALKLVSLL
                     PADDVTLSLIPDGDHRLSRPQDLDMLVRSVGDMAKRG"
     gene            463988..464392
                     /locus_tag="MESOP_RS02090"
     CDS             463988..464392
                     /locus_tag="MESOP_RS02090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="WP_019862661.1"
                     /db_xref="GI:518701376"
                     /translation="MLLAEEAGLDLVEISPNAVPPVVKILDLGKLKYANQKKAAEARK
                     NQKVIEIKEIKMRPNIDSHDYETKMKAVRRFFEEGDKVKLTLRFRGREMAHMELGMQL
                     LNKVREEVATIAKVEAEPKLEGRQMMMVLAPR"
     gene            464550..465176
                     /locus_tag="MESOP_RS02095"
                     /old_locus_tag="Mesop_0424"
     CDS             464550..465176
                     /locus_tag="MESOP_RS02095"
                     /old_locus_tag="Mesop_0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_013891665.1"
                     /db_xref="GI:503657589"
                     /translation="MDNELKYGLGNYQQMRRLVLAVLVVVLFLALLFGQSTFPPDTPV
                     HETIEMFGVLLIFLGIVGRLWATLYIGGRKSSEVVTGGPYSITRNPLYVFSTLAAAGV
                     GAQIGSFSGIILFALLCAGAFHIVILREEKFLKEALGAPYAAYLARVPRFFPNLSLYQ
                     EGDTGSFKPRLLLTTLLDGLVFLVALPAFELIDGAQQSGMLPVWFTLP"
     gene            465359..465562
                     /locus_tag="MESOP_RS02100"
                     /old_locus_tag="Mesop_0425"
     CDS             465359..465562
                     /locus_tag="MESOP_RS02100"
                     /old_locus_tag="Mesop_0425"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:C3MCP8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="WP_006201248.1"
                     /db_xref="GI:493220759"
                     /translation="MPKMKTKSAAKKRFKITGTGKVLSAAAGKRHGMIKRSNKFIRNA
                     RGTMVLAEPDGKKVIKNFLPNGL"
     gene            465655..466056
                     /gene="rplT"
                     /locus_tag="MESOP_RS02105"
                     /old_locus_tag="Mesop_0426"
     CDS             465655..466056
                     /gene="rplT"
                     /locus_tag="MESOP_RS02105"
                     /old_locus_tag="Mesop_0426"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98CP8.1"
                     /note="binds directly to 23S ribosomal RNA prior to in
                     vitro assembly of the 50S ribosomal subunit; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="WP_006201247.1"
                     /db_xref="GI:493220753"
                     /translation="MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRIAKQAVEKSLQ
                     YAYRDRKNRKRSFRALWIQRINAATHEHGLTYGRFIDGLNKAGIEIDRKILSDMAIHE
                     PQAFAALVAKAKVALEYLKNTTPNAFESAVA"
     gene            466204..467301
                     /locus_tag="MESOP_RS02110"
                     /old_locus_tag="Mesop_0427"
     CDS             466204..467301
                     /locus_tag="MESOP_RS02110"
                     /old_locus_tag="Mesop_0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit alpha"
                     /protein_id="WP_013891666.1"
                     /db_xref="GI:503657590"
                     /translation="MNATAGNLEALEDSLLADIASAADEPAIEAVRIAAFGKKGTVSE
                     MLKTLGAMTPGERQVKGPAINGLKNRVTEALTARKAELKDVAIAARLAAEKVDVTLPV
                     RQSPAERGRIHPISQVIDEIAAIFGDLGFAIAEGPDIETDYYNFTALNFPEGHPAREM
                     HDTFFFQPDEKGERKLLRTHTSPVQIRTMEKQKPPIRIVIPGKTYRQDSDATHSPMFH
                     QVEGLVIDKSANVANMKWVLEEFCKAFFEVPSVKMRFRPSFFPFTEPSLEVDIQCDRS
                     RPGEVRFGEGSDWMEILGCGMVHPNVLRAGGLDPDEYQGFAWGMGIDRIAMLKYGMPD
                     LRAFFDADVRWLSHYGFRPLDMPTLFGGLSA"
     gene            467298..467720
                     /locus_tag="MESOP_RS02115"
                     /old_locus_tag="Mesop_0428"
     CDS             467298..467720
                     /locus_tag="MESOP_RS02115"
                     /old_locus_tag="Mesop_0428"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde-activating protein"
                     /protein_id="WP_013891667.1"
                     /db_xref="GI:503657591"
                     /translation="MTEAHTGGCRCGAVRFEVSVEPHHVSYCHCGDCRRASGAPVSAF
                     VGFPVDKVAFTGKALKMYENGPVTRSFCGICGSPIAYVDDRLEDDIYFVLGAMDRPAD
                     FKPTQHAYVSEQLPFLHMSDDLPRHLKTSVKRPDGTIQ"
     gene            467717..470125
                     /locus_tag="MESOP_RS02120"
                     /old_locus_tag="Mesop_0429"
     CDS             467717..470125
                     /locus_tag="MESOP_RS02120"
                     /old_locus_tag="Mesop_0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008872758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit beta"
                     /protein_id="WP_013891668.1"
                     /db_xref="GI:503657592"
                     /translation="MKFTLSWLKDHLETDATLAEIVERLTSIGLEVEHVDDKSSLKPF
                     VIAKVLTAVQHPDADRLRVLTVDTGDGKPPVQVVCGAPNARAGLIGAFAAPGTYVPGI
                     DVTLTVGKIRGVESHGMMCSERELELSDEHNGIIDLPADAPVGTSFATYAHLDDPVIE
                     INLTPNRPDATSVYGIARDLAASGLGRLVGGAIMPHAGSGMCPVKVKIVAPELCPGFA
                     LRLVKGVKNGPSPKWLQQRLIAIGLRPISALVDITNYVTFDRGRPLHVFDARKVAGNL
                     VVRRARNGEKVLALDGREYTLTPEMCVIADDDGVESIAGIMGGEHSGCDENTTDVLVE
                     SALWDPITTARTGRTLGIITDARYRFERGVDPEFMVPGVELATKLVLDFCGGTPTEIE
                     VAGYGGHQPKMVSFPLSDIRRLTGIEVPRAESLDILSRLGFTADGSGDVVNVTVPSWR
                     PDVDGKADLVEEVMRIHGVDNIAPQPLGAHDAVNAKILTTLQVRTRTAKRALAVRGMM
                     EAVTWSFIPARHAELFGGGQTALKLANPIAADMSDMRPSLLPGLIAAAQRNADKGIGD
                     VALFEVSGTYEGDGADQQRRVAAGVRRGTAKLDGSGRNWAGNSGAVGVFDAKADAIAA
                     LEACGAPVDRLQIEPGGPAWYHPGRSGTIKLGPKTVLGTFGEFHPKTLEGLDVSGPLC
                     GFEVFVDAVPEPKAKPTKTKPKLELSAFQAVKRDFAFVVDRSVEAGTLVRAALAADKK
                     LITGVSVFDIFEGASLGADKKSIAIEVSIQPVEKTLTDEDFEALAKRIVENVGKQTGG
                     VLRG"
     gene            470165..470767
                     /locus_tag="MESOP_RS02125"
                     /old_locus_tag="Mesop_0430"
     CDS             470165..470767
                     /locus_tag="MESOP_RS02125"
                     /old_locus_tag="Mesop_0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891669.1"
                     /db_xref="GI:503657593"
                     /translation="MDHLRYSGLPFEAQRAVFLDIVSADPLVQDALVRAHSLDLPDWL
                     VVSGALYNSVWNHLTGKPSSYGIKDVDLFYFDDADLSYEAEDAIIRRAAQHFEGLALP
                     VEVRNQARVHLWYPQKFGQPCPRYTSSSDSVGHFASKTHAVGVRYGGDGQLELVAPFG
                     VDDIFSFRITPNRVMDNQRTHDAKGARARECWPEIAVVPW"
     gene            complement(471021..472016)
                     /locus_tag="MESOP_RS02130"
                     /old_locus_tag="Mesop_0431"
     CDS             complement(471021..472016)
                     /locus_tag="MESOP_RS02130"
                     /old_locus_tag="Mesop_0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="WP_013891670.1"
                     /db_xref="GI:503657594"
                     /translation="MQTRKLGTELNVYPVGLGCMGMSFAYGGQPEAEAIATLRRAVDI
                     GVNFFDTAEVYGPYENEVLVGKALKPVRDKVTIATKFGFKILEEGTGTDRMAGVDSRP
                     EHVKAVAEASLKRLGTDVIDLYYQHRVDPNVPIEDTVGAMAELVREGKVRALGLSEAS
                     AATIRWAHAVHPIAAVQSEYSLWSRDPEDEVFAVCRELGIGFVPYSPLGRGLLTGTIA
                     KPEALSDDDWRRTLPRFQTNAMEANAKIVATLEKLAAEKGVTSAQLALAWVLHQGDFI
                     VPIPGARKIRHLEQNTAAAGIELSAAEVAAIGDALSPDKVVGKRYTEELLALVNG"
     gene            472113..473003
                     /locus_tag="MESOP_RS02135"
                     /old_locus_tag="Mesop_0432"
     CDS             472113..473003
                     /locus_tag="MESOP_RS02135"
                     /old_locus_tag="Mesop_0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013891671.1"
                     /db_xref="GI:503657595"
                     /translation="MNRANLSQLAVLATVAQCGSFRGAAKELAIAPSAVSHAVSSLEA
                     RLGVRLLSRSTRSVAPTEEGARLLERLRPALSEIDLALETAVEARDRPAGNLRLSVPR
                     TAAHLVLTPRLGAFAAAYPDIVLEIVVEDRFTDVVEGGFDAGVRLGESLQRDMIAVRI
                     GPDIRGAVVGAPSYFEAMPIPRHPRDLADHRCIRFRFSSGILYRWEFEKGREAIEMAV
                     EGPLILDEDHLIAQAAVDGAGLAFVFEPYVRAPLADGRLIRVLEDWCPSFDGFFVYYP
                     SRRQMRPALRAFVDFFKVSA"
     repeat_region   473132..474346
     gene            complement(473143..474246)
                     /locus_tag="MESOP_RS02140"
                     /old_locus_tag="Mesop_0433"
     CDS             complement(473143..474246)
                     /locus_tag="MESOP_RS02140"
                     /old_locus_tag="Mesop_0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011472524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013891672.1"
                     /db_xref="GI:503657596"
                     /translation="MVFLDVFGEVPDPRDLTAQHPLPEILFVALAAVLCGATHCTEME
                     LFARSRLDLLRQFIPLERGAPSHDTFSRVLAALDPVALNEAFMRFMAAFGEQARIDAP
                     KGQVAVDGKSLRRAYAKGRSHMPPLVVTVFGCDTFMSLAQTVAQEGGEVQAAIAALEL
                     LSLKGLTVTADALHCHRRMTKTVRDGGGHYVIAIKGNQSKLAAEANTALDKAAAGKAT
                     KFHQTEEDAHGRHEVRRAFVIPFAQTPGKNALVDLCAIGRVESWRTVEGKTTHKVRCY
                     ALSRKMPAHELLATVRRHWSIENDLHWQLDVLLGEDHIRGRKNNTAANHAILRRLTLN
                     VLRADPEKIPLSHKRLKARWADQDLLSLFTHMR"
     gene            474396..474968
                     /locus_tag="MESOP_RS02145"
                     /old_locus_tag="Mesop_0434"
     CDS             474396..474968
                     /locus_tag="MESOP_RS02145"
                     /old_locus_tag="Mesop_0434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B"
                     /protein_id="WP_013891673.1"
                     /db_xref="GI:503657597"
                     /translation="MQASITNTRTRYGWATILIHWLIGIIFIGQFGLGFVMVRLTSQR
                     AAFELIQLHKSLGFLLFGLIILRIAWRLGNAAPPLPASVGALERRSAPLAHLALYAFQ
                     IALPLSGWALVSVSTLEIPTMPFNLFVMPNLPLAESDLAESLWASVHWYLAYAGIALV
                     ALHVAAALRHHFLLRDSVLTRMITPSSGRE"
     gene            475069..475644
                     /locus_tag="MESOP_RS02150"
                     /old_locus_tag="Mesop_0435"
     CDS             475069..475644
                     /locus_tag="MESOP_RS02150"
                     /old_locus_tag="Mesop_0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891674.1"
                     /db_xref="GI:503657598"
                     /translation="MYARIFGFAAVTACLAMPVSAAISLGEAAGSYTINPAASSIRFT
                     IGKAGGGGFDGAFGRFKGTIRIDNSDVGRSKVDFTIYPESVGTGQGRIDAFLRSDAVF
                     DAANSPEIQFRSTSVTRTGDTSALVTGRLTARGKTFAEKFTAEFDGSKGGTIKFHVTG
                     KVLRSRYGMDVGTPLYSNIVDFDMSLTGKRG"
     gene            475768..476754
                     /locus_tag="MESOP_RS02155"
                     /old_locus_tag="Mesop_0436"
     CDS             475768..476754
                     /locus_tag="MESOP_RS02155"
                     /old_locus_tag="Mesop_0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_013891675.1"
                     /db_xref="GI:503657599"
                     /translation="MFRWGVLSTAKIGREQLLPAIVEAENGVLSAIASRDLSKAKALA
                     ERFGARHAFGSYEELLASKDIDGVYIPLPTSQHVEWTAKAIEAGKHVLVEKPLALDAK
                     DIPPLIQLRDQKKVLVCEAFMVIYHPQWIKVRDLIASGAIGRLRHVQGAFSYYNVDPN
                     NMRNQLDLGGGALPDIGVYPTVSTRFSTGKEPLRVQATIERDKKFGTDIYSSIRADFG
                     DFELSFYLSTQMAARQVMVFHGEKGFIEVFSPFNAGLYDHHRVELHNQNHTEAQVFRF
                     PGTQQYRLEVETFARAAAGGKERVFTLEESVLNQKVIDAIFRAGGKDGWESV"
     gene            476795..478453
                     /locus_tag="MESOP_RS02160"
                     /old_locus_tag="Mesop_0437"
     CDS             476795..478453
                     /locus_tag="MESOP_RS02160"
                     /old_locus_tag="Mesop_0437"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891676.1"
                     /note="proposed role in polysaccahride synthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding dehydrogenase"
                     /protein_id="WP_013891676.1"
                     /db_xref="GI:503657600"
                     /translation="MADDADVIIVGAGLAGLVAAAELAEAGKKIIIVDQEPEQSLGGQ
                     AFWSFGGLFLVDSPEQRRMRIRDSHDLALEDWLGTAAFDRPEDDWPRKWAEAYVGFAA
                     GEKRSWLMERGLKFFPVVGWAERGGGNAIGHGNSVPRFHITWGTGPGVLEPFVLRVRE
                     AQKRGSISFRFRHRVNELTRTGAAVTGVRGDILEPSTVERGHKSSREISGDFELHAQA
                     VIVASGGIGANHQLVRENWPKRLGAAPKRMITGVPDHVDGRMLAITEQAGGSIINRDR
                     MWHYVEGIKNWAPIWTDHAIRILPGPSSLWLDARGKRLPVPLYPGFDTLGTLSHIMGT
                     GFDYSWFILTRKIIQKEFALSGSEQNPDLTGKSWRQVLGRATSGIPGPVKAFMEKGED
                     FIVEADLSKLVTRMNALAGGEPLLELAQVEREIRARDRQLDNPFSKDMQITALRGARA
                     YLGDRLIRTAKPHKMLDPANGPLIAVRLNILTRKTLGGLQTDLDSRVLGEDGQPVPGL
                     YAVGEAAGFGGGGVHGYAALEGTFLGGCIFSGRGAGRAAAAAIL"
     gene            complement(478476..479414)
                     /locus_tag="MESOP_RS02165"
                     /old_locus_tag="Mesop_0438"
     CDS             complement(478476..479414)
                     /locus_tag="MESOP_RS02165"
                     /old_locus_tag="Mesop_0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipase/esterase"
                     /protein_id="WP_013891677.1"
                     /db_xref="GI:503657601"
                     /translation="MTDYSTLIDAETWAFIERTNSYYPPDTIDYTIAEQRAIYDRMCR
                     EFFAGYPEGVAVETSAIATSTHNIPIRSYRSARQAAATVLYIHGGGFILGGLDSHDDV
                     CAELCARTGYEVVSVDYRLAPEHLHPAAFDDAMSAFEWVAANRDHPIVLCGDSAGGNL
                     CAAVSHATRGHAKRPFGQVLIYPGLGSDRSRGSYVTHAEAPMLTARDIEFYKHVRTGG
                     LDQTGDITLSPLADADFANLPPTVLITAECDPLSSDGEAYRDRIVAAGGRAYWLEEPG
                     LVHGYLRARHTVGRARASFTRIVDAVAALGQGAWLW"
     gene            complement(479637..480419)
                     /locus_tag="MESOP_RS02170"
                     /old_locus_tag="Mesop_0439"
     CDS             complement(479637..480419)
                     /locus_tag="MESOP_RS02170"
                     /old_locus_tag="Mesop_0439"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528298.1"
                     /note="catalyzes the dehydration of L-carnitinyl-CoA to
                     crotonobetainyl-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carnitinyl-CoA dehydratase"
                     /protein_id="WP_013891678.1"
                     /db_xref="GI:503657602"
                     /translation="MPDVISTRREGTILEVTLDRPKANAIDLKTSRLMGETFKAFRDD
                     PELRVAIVKTAGDKFFCAGWDLKAAAGGDAVDGDYGVGGFAGLQELRDLNKPVIACVN
                     GMAVGGGFELALSCDLIYASDHSSFALPEIRAGTLADAATIKLPKRIPYHVAMDLLLT
                     GRWMDVAEAHRWGLVNEVLPKDKLEDRVWEIARLLAGGPPLVFAAIKETARVAEALTF
                     QDAMNKVTRRQLATVDALYGSEDNMEGFRAFAEKRDPVWKGK"
     gene            complement(480412..482490)
                     /locus_tag="MESOP_RS02175"
                     /old_locus_tag="Mesop_0440"
     CDS             complement(480412..482490)
                     /locus_tag="MESOP_RS02175"
                     /old_locus_tag="Mesop_0440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA synthetase"
                     /protein_id="WP_013891679.1"
                     /db_xref="GI:503657603"
                     /translation="MHKLERLLRPKSIAVFGGVQAAAVVAQSIKMGFAGEIWPVHPAK
                     DEVAGRKAYRSVADLPGAPDAAFVGVNRHLTIEVVKALAERGAGGAVCFAAGFLETEA
                     YDDDGERLQAELVAAAGEMPIIGPNCYGLINYADGALLWPDQHGGIRLEQGGKGVAII
                     TQSSNIAINMTMQKRGLPIAFLMTAGNQAQTGLSEMALGLIEDERVTSLGLHIEAFDS
                     VAGFERLAARARELKKPIIAMKVGRSEQARQATVSHTASLAGSDAASGAFLRRLGIAR
                     VDSIPAFIEALKLLHITGPLPGYRLSSMSCSGGEASVMADSAEGRWVNFPVLTDRHRA
                     HVKSTLGPLVAVANPLDYHTFIWNNEPAMTATFTAMVSGGFDLNMLVLDFPRPDRCSV
                     TDWWATLRAFESALKTNKAHGAIVSSLPENLPEEYTAELMARGMVPLFGISEAMDAAQ
                     AAAFIGWAWHEPQAQPVDTSASGAAGGEHVTPDEAQAKARLIMAGLPVPKGERAGNAV
                     EAVISSMALGFPVALKALGVTHKSEVGAVRLNLKDAESVSTAAHDLLPLGTGLYVERM
                     VRDGVAELIVGFTRDPMFGAVMTLGTGGVLVELLRDSVTLMLPATRDDIEAALRGLKL
                     FPLLEGYRGRPKADVQAAIDAIAGIAAFVQTNAGEIEELDINPLIVCAEGKGAWIADA
                     LLVLGENKNA"
     gene            complement(482494..483657)
                     /locus_tag="MESOP_RS02180"
                     /old_locus_tag="Mesop_0441"
     CDS             complement(482494..483657)
                     /locus_tag="MESOP_RS02180"
                     /old_locus_tag="Mesop_0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_013891680.1"
                     /db_xref="GI:503657604"
                     /translation="MDFGLSEEQKLIVETTRAFVENELYPHEREVERTGVLRRELIEE
                     IKAKAIEAGLYAANMPADVGGAGLDTVTWLLYEKELGRANYALHWTCVARPSNILLAG
                     TPEQREKYLFPCIRGEKWDCLAMTEPGAGSDLRGMKATAVQDGDDWVLNGTKHFISHA
                     DLADFAICFMASGEEETARGKRKKITAFFVDKGTKGFTVRDGYRNVSHRGYTNAILEF
                     DDCRLPASQVLGEVHKGFDVANSWLGATRLQVGATCLGRAERALGHAIEYSAQRQQFG
                     QQIGKFQGVSFKLADMATELKAADLMVFEAGWKYDQGTVTDQDMAMAKLKATEMLAFV
                     ADEAIQIHGGMGLMDDLPLERIWRDARVERIWEGTSEIQRHIISRALLRPFGA"
     gene            complement(483662..484756)
                     /locus_tag="MESOP_RS02185"
                     /old_locus_tag="Mesop_0442"
     CDS             complement(483662..484756)
                     /locus_tag="MESOP_RS02185"
                     /old_locus_tag="Mesop_0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006202316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybutyryl-CoA dehydrogenase"
                     /protein_id="WP_013891681.1"
                     /db_xref="GI:503657605"
                     /translation="MSIVNKAAAIGGGVIGAGWVARLLLNGIDVSIFDPDPEASRKVS
                     EVMKGARRAYKQMVPGGLPKEGKLTFAKTIAEAVADADFIQESVPERLDLKHRVLAEI
                     DTHAPANAIVGSSTSGIKPTDMQVAMKKHPERLVVGHPFNPVYLLPLVEIVGGEQTFP
                     EAIEVAREIYASIGMKPVVIRKEIEAFVGDRLLEAAWREALWLIKDGICTVEELDDIM
                     RYGFGLRWAQMGMFQVYRVAGGEAGMRHFMAQFGPCLKWPWTKLMDVPEFNDELVDLI
                     ATQSDDQAHGLSIRELEKIRDDNLVAIMDALSKQNKGKGWGAGALHKDYTRQLAKLAA
                     KKPAASKAAEKAKASKPVKKAEKPKKKKKG"
     gene            complement(484753..485382)
                     /locus_tag="MESOP_RS02190"
                     /old_locus_tag="Mesop_0443"
     CDS             complement(484753..485382)
                     /locus_tag="MESOP_RS02190"
                     /old_locus_tag="Mesop_0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_013891682.1"
                     /db_xref="GI:503657606"
                     /translation="MTTVKFTAMKDGDRDDYEFLTAHEIDYAAKTGERLLDALVQLDE
                     GLSGYKITRLGHSLRAATRAWRDGADTDWIACAVLHDIGDIYAPYNHDEYAASILKPF
                     VREQCTWVVEKHGDFQRLYYAHHLGGNRHARDRFAGHAYFDDCDQFCERWDQSSFDPD
                     YDTLPIEFFRPFVLEVFARKAYDPSVIRAGERVPLIDLETAKTRTGASA"
     gene            complement(485400..486317)
                     /locus_tag="MESOP_RS02195"
                     /old_locus_tag="Mesop_0444"
     CDS             complement(485400..486317)
                     /locus_tag="MESOP_RS02195"
                     /old_locus_tag="Mesop_0444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891683.1"
                     /db_xref="GI:503657607"
                     /translation="MPLAMNREVFITCAVTGSGGSQDRSPHVPRSPKQIADSAIDAAK
                     AGAAIVHCHVRDPETGKPRRDVHLYREVTERIREANVDVVLNLTAGMGGDMVFGSPEA
                     PLPLNEKGTDMGGATNRMEHVRQCLPEICTLDCGTMNFAEADYVMTNTPGMLRAMGGM
                     MTALGVKPEIEAFDTGHLWFAKQLVEEKVLNPDALVQLCMGVPWGAPDDLNTFMAMVN
                     NVPSTWNWSAFAIGRNQMAYAAAAVLAGGNVRVGLEDNLWLDKGVLATNAQLVERAAS
                     IVTNLGARILGPEEVRKKLNLTKRAPIAA"
     gene            486395..487375
                     /locus_tag="MESOP_RS02200"
                     /old_locus_tag="Mesop_0445"
     CDS             486395..487375
                     /locus_tag="MESOP_RS02200"
                     /old_locus_tag="Mesop_0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013891684.1"
                     /db_xref="GI:503657608"
                     /translation="MTKSEKPTIFRAERSPLKVTLLVFSGSSIMCVASAVDPLRAANR
                     ISGETLFDFKLVSVTGEAPVTTCGLPVAVSGRFDAAAPTDVLVVVAGFGTQNYATTAL
                     LSGLRRAARAARACGGVEAGTWLVARAGLLEGRSATTHWEDMEDFSSAFPGVDVRPDR
                     YVIDGPVFTSGGASPTFDLMLHLIRTRLGMAVALDVASVFIYDQARAATDAQPLVSLG
                     RLDGYDPRLAQAIRLMESHVDQPLTIEAVAKRAGVTARTLESIFRRSIGETPGAYYLR
                     LRLAAARRLVVDTRVAMADIAGRTGFSSAAAFSRAFSRAFGEAPVRLRRG"
     gene            complement(487392..487595)
                     /locus_tag="MESOP_RS02205"
                     /old_locus_tag="Mesop_0446"
     CDS             complement(487392..487595)
                     /locus_tag="MESOP_RS02205"
                     /old_locus_tag="Mesop_0446"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891685.1"
                     /db_xref="GI:503657609"
                     /translation="MQHEREIDALLASGETGSIIDRLMALPRPTDDVKNQWDRAVSNR
                     FEVRLARQMRSQIDAGGDRQNAA"
     gene            complement(487799..489124)
                     /locus_tag="MESOP_RS02210"
                     /old_locus_tag="Mesop_0447"
     CDS             complement(487799..489124)
                     /locus_tag="MESOP_RS02210"
                     /old_locus_tag="Mesop_0447"
                     /EC_number="5.3.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98CR8.1"
                     /note="catalyzes the interconversion of D-xylose to
                     D-xylulose; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase"
                     /protein_id="WP_013891686.1"
                     /db_xref="GI:503657610"
                     /translation="MSSGFFGDIQKIKYEGPDSTNPLAYRFYNPDEVVAGKRLEDHLR
                     FAVAYWHSFAWPGGDPFGGQTFDRPWFPKAGGVDTMELAKLKADVAFEMFSLLGAPYF
                     CFHDADVRPEGKDFSESAARLDEIADYFAGKMKQSGVKLLWGTANLFSNRRFMSGAAT
                     NPDPDVFAYAAATVKSCIDVTKRLKGENYVLWGGREGYETLLNTDLAREQEQAGRFLS
                     LVVDYKHKIGFKGTILIEPKPQEPTKHQYDYDVATVYGFLKRFGLEKEVKLNIEQGHA
                     ILAGHSFEHELALANALGVFGSIDMNRNDYQSGWDTDQFPNNVPEMALAYYQVLQAGG
                     FKTGGTNFDAKLRRQSLDPQDLLIGHIGGMDACARGLKAAARMVEDKALSAPLAERYA
                     GWNSAEAKAMLSGERTLEDIAERVVKKKIEPQPRSGRQELLENIVNRYV"
     gene            489249..489611
                     /locus_tag="MESOP_RS02215"
                     /old_locus_tag="Mesop_0448"
     CDS             489249..489611
                     /locus_tag="MESOP_RS02215"
                     /old_locus_tag="Mesop_0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891687.1"
                     /db_xref="GI:503657611"
                     /translation="MTDLNTIAEGYITAWNESDASRRAELLKATFTEDVSYRDPIMQG
                     DGHEGVAALIDGVQQRFAGFRFSLKGTPDGFADKIRFSWNLGPEGVPSVIEGTDIGII
                     ENGRLKSITGFLDKVPAQ"
     gene            complement(489809..491263)
                     /locus_tag="MESOP_RS02220"
                     /old_locus_tag="Mesop_0449"
     CDS             complement(489809..491263)
                     /locus_tag="MESOP_RS02220"
                     /old_locus_tag="Mesop_0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylulokinase"
                     /protein_id="WP_013891688.1"
                     /db_xref="GI:503657612"
                     /translation="MYLGLDLGTSGVKALLIDAGQSVIGSGHGSLDVSRPHPGWSEQD
                     PSHWIRACEEAIAELKASHPRQFAAVKGIGLSGQMHGATLLDAADGVLRPCILWNDTR
                     SHVEAAALDADPRFRALTGNIVFPGFTAPKLAWVKNNEPAVFAKVAKVLLPKDFLRLW
                     LTGEHISEMSDAAGTAWLDVGKRRWSGDLLAATSLDETQMPSLVEGTGKAGGLRAELA
                     SKWGVEAGIPVAGGAGDNAASACGMGTVGAGHAFVSLGTSGVLFAANASYLPNPASAV
                     HTFCHALPNTWHQMGVILSATDSLNWLSEITGKGAGELTTELGDALKAPSGVSFLPYL
                     SGERTPHNDSAIRGSFTGLAHESSRAVLTQAVLEGVAFAFRDSLEALKTAGTVLTRAT
                     AIGGGSRSRYWLKAIATALQLPVDIPADGDFGAAFGAARLGLIAATGADPLAVCTAPK
                     TDATIEPDAALGGAYADAYQRYRALYPAIRAVTA"
     gene            complement(491345..492667)
                     /locus_tag="MESOP_RS02225"
                     /old_locus_tag="Mesop_0450"
     CDS             complement(491345..492667)
                     /locus_tag="MESOP_RS02225"
                     /old_locus_tag="Mesop_0450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891689.1"
                     /db_xref="GI:503657613"
                     /translation="MAIRDGFGLAFSGATEAGLTPYSQAVRELQCFIGDPVASVDRAI
                     AENPGFVMAHVFKGYLFGLATEQEATAVARACHEAALPLAATTREQAHVLALGHLANG
                     RWHDAAGILEDIAIDFPLDAVALQVGHQVDFFTGNARMLRDRIARALPSWQSGMPGYH
                     AVLGMQAFGLEEMGDYGRAERLGRAAVEIEPRDGWAQHAVAHVMEMQSRQRDGIAWMR
                     ADPEAWTRESFLQVHNWWHLALFHYDLGETDEVLALYDGPIYGTPSAMALNMVDASAI
                     LWRLYLGGVDVGDRWAALAANWPKVGAGNYAFNDAHAMMASVGAGLDAAALGLLDAQR
                     EAMHGSDDNAAFTRDVGHPLTRAIKAFGEGNYTEAIRLIRPIRAIAHRFGGSHAQRDV
                     IDLTLIEAALRAGDAALARALTAERSAARPDSPLSVLFSRRAADLSEN"
     gene            492959..495682
                     /locus_tag="MESOP_RS02230"
                     /old_locus_tag="Mesop_0451"
     CDS             492959..495682
                     /locus_tag="MESOP_RS02230"
                     /old_locus_tag="Mesop_0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter"
                     /protein_id="WP_049802434.1"
                     /db_xref="GI:908670636"
                     /translation="MQQGPKRTNPRLISFLATTALTLLPNSAAFAACMLGPTAGNTVY
                     TCDSGDSGGSLTDTDGNNTLNFPAGGTGQISGNVTFGIGTDRINMQSGTITGTVDQGD
                     GTDFFTIGAGTVAGNVQQGAGIDDFNMSDGLIGSLNQGDGLDTFTMTGGRIVDFFDDG
                     DRAVMTGGRIGRVNMKLDQNYFNMSGGIIDRNLVTGFDKDTIILSGGIIGGNISVSGG
                     ADSVTVTGGTVGGDVLMSVGSDNFVWNGGGIIYGSVDLGGDNDTAKLSNLTNGNLGDT
                     KAITAGAGTDTLTFDNVKLEGIARVQNWETINATNDTQLMLDGNLVLGDSGTGTGSLN
                     VDQASTLYGGGFNSAIQAFTSGQLANVVNAGRIDLTNGTTGATDQLTISGNYTGLGGL
                     LLIQTELGDDTSASDRLILSGGTASGSTGIGVINVGGAGAETTADGIMVVQAINGATS
                     SASAFALDAPVAAGAFEYYLFKGGVSAGSGENWYLRSTLITPTSPAAAPSALEPAPNL
                     QPEPPAAEPPPPPPSNLPPVPVPTEGDINNPPVDPTPPVQAADPKPESPPPPPPAPPA
                     DPPPPPPVVPTVVPDLPTPAPGEQILLYRIEVPVYSALPPVAEHLAMTTLGTFHERRG
                     EQSLLSDTEMSPAWGRIFGQDAKMGWSGTVSPSFDGTLFGLQAGFDVFGRETASGGIH
                     RAGLFVAYGSMKGDVSGQALGQNDLSVGKLDVNGTSVGGYWTRIGQGGWYLDGVLMAT
                     FFGGDATSSRGVGIDVDGTGVTASLEGGYPIALGQGWTLEPQAQLVWQHLSLDDTEDR
                     FSSVSFGTDSSVTGRLGARLQGETTINGLAVQPYLKANFWHDFGGTDTVSFDTTDIAT
                     EGRSTSFEFGGGVVAKVNDKVSIFATGDYTTNLGGDKRRILEGNLGFSVKW"
     gene            complement(495755..496378)
                     /locus_tag="MESOP_RS02235"
                     /old_locus_tag="Mesop_0452"
     CDS             complement(495755..496378)
                     /locus_tag="MESOP_RS02235"
                     /old_locus_tag="Mesop_0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="WP_013891691.1"
                     /db_xref="GI:503657615"
                     /translation="MSFENWAAFAAASSILLIIPGPTILLVVSYALGQGWRTALPMAV
                     GVALGDFTAMTLSMLGIGALLAASATIFTVLKLIGAGYLIYLGVKLFRAGGALRAEPR
                     TDAVSAAKMMAHTWLVTALNPKSITFFVAFLPQFLDRHANFWTQMLVFETTFLALAFA
                     NAFGYALVAARARNVVRNPKAIRIFNRTGGTLLVGAGIATVAMRSGN"
     gene            496743..497513
                     /locus_tag="MESOP_RS02240"
                     /old_locus_tag="Mesop_0453"
     CDS             496743..497513
                     /locus_tag="MESOP_RS02240"
                     /old_locus_tag="Mesop_0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891692.1"
                     /db_xref="GI:503657616"
                     /translation="MRELPQGPTPPRNGGAVDIDLHLSRRAVLTGAGALALLSAAGCS
                     TSGDGGMPVLQLDNTVTGSVPPMRPAISVDKNITGADVMYAALTDNGFNVPEVPYLKV
                     KPEFRRQIVVDTTGEAPGTIVVHLKERMLYLVQPGGDAIRYGVGIGKDGFRWSGRANI
                     QYGREWPTWTPPPEMIQRKPELVKWQGGQPGGLTNPLGARALYIYQDGKDTGYRIHGS
                     PEWWSIGQAMSSGCVRLINQDIIDLYSRVSKKNPVVVM"
     gene            497688..498854
                     /locus_tag="MESOP_RS02245"
                     /old_locus_tag="Mesop_0454"
     CDS             497688..498854
                     /locus_tag="MESOP_RS02245"
                     /old_locus_tag="Mesop_0454"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="WP_013891693.1"
                     /db_xref="GI:503657617"
                     /translation="MTGTFVIAQGGGPTAVINQTVVGATLEIRKRHPGAKVLGSIHGV
                     RGIRDGNYVDLSAIPEDRLRLIAGTPSAALGSTRDKPDAAYCEIILNGLKKAGADAFI
                     YIGGNDTSGTQQILTDAAGGSIAFVHAPKTIDNDLEENDHTPGFISAAEFVAGAFLSV
                     DLDFRALPGIYVGIVMGRHAGFLTAAAAAWQLDPGSGPHLVYVPERPFSAAGFIDDVR
                     ATLDRHKRCIVAVSEGVSTADGKALVESLVPPNKLERDAHGNVKLSGSDLPAALERAL
                     AEGLPGKRARVDALGYMPRGYVGAISAVDAQEAFDAGAFAVSVAEQGGGSVALQYDGA
                     KTVLKKVPLKNVAGKTRHMPDNFMQPDVNQLSEAGMAYLKRLVPEKYKVGKPFV"
     gene            498854..499570
                     /locus_tag="MESOP_RS02250"
                     /old_locus_tag="Mesop_0455"
     CDS             498854..499570
                     /locus_tag="MESOP_RS02250"
                     /old_locus_tag="Mesop_0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactamase"
                     /protein_id="WP_013891694.1"
                     /db_xref="GI:503657618"
                     /translation="MEWFSRSIVDDRTTMLTEPFVHDYVRANIWHLHGRDADLLVDTG
                     MGIRPLAPEIETPRGKPLLVVATHIHLDHVGSLHEFPWRAGPRMSAAQFESMDEAATY
                     AYMFHDLEGAVSKLPEPGWKTADYKIPSAPLTRTLDEGDVIDLGDRQFRVLHLPGHSP
                     DSIALFDEADGLFFSGDAIYDDTLIDSLPDSDRAAYIGTMRRLLDLPIRIGHGGHGPS
                     FDGERMRAIATAYLRSHAGL"
     gene            499767..501308
                     /locus_tag="MESOP_RS02255"
                     /old_locus_tag="Mesop_0456"
     CDS             499767..501308
                     /locus_tag="MESOP_RS02255"
                     /old_locus_tag="Mesop_0456"
                     /EC_number="3.4.21.108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_013891695.1"
                     /db_xref="GI:503657619"
                     /translation="MSPLGILRRHRVAALLGAALIISPVVVSFAQNTNGIAKIVATTQ
                     TPVPGISAPNGSFAPVVAATKPAVVTVTTVMKAQPEAMNEASPFQDNSPFDDYFRQFF
                     GDQGMPMPRTPPQQQAPRTEALGSGFIVGADGTIVTNNHVVDGASSIKVTLDDGTELP
                     AKVVGSDAKNDLAVLKIKASKPLPTVKWGDSDRLMTGDQVLAIGNPFGIGTTVSAGIV
                     SARGRDLHSGPFDDFIQIDAPINHGNSGGPLVDVNGNVIGINTAIYSPNGGSVGVGFA
                     IPSDQAQKVVAKLEKGGSIQYGYLGVDIQPVTPDVASAMGLDHPGGALVSQVNDGSPA
                     ALAGVETGDVITGFAGQDVKDPKDLSRAVADVAPGTRETLDVWRKGKAMKISVDVGRN
                     SDDAKTASTGGSGAPGAEQGSGAPALGLGLMDITPDIRQQMNLADNERGAVVARVNPD
                     KAAAAAGIQPGDIIVAVNQVPVKSAKQVTQAVAQAGKSGRKSVLLLVERGGSQIYVAV
                     PFANG"
     gene            complement(501391..502350)
                     /locus_tag="MESOP_RS02260"
                     /old_locus_tag="Mesop_0457"
     CDS             complement(501391..502350)
                     /locus_tag="MESOP_RS02260"
                     /old_locus_tag="Mesop_0457"
                     /EC_number="2.7.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006201285.1"
                     /note="catalyzes the formation of
                     (R)-4'-phosphopantothenate in coenzyme A biosynthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="WP_013891696.1"
                     /db_xref="GI:503657620"
                     /translation="MDQLAPTEKYSPFRFFSAEQWSQFRADTPLTLSEDEFRRLRSLN
                     DPVDLAEVSRIYLSLSRLLSAHVEASQLLFRQRQAFFNAVDIVKTPFIIGIAGSVAVG
                     KSTTARVLKELLARWPSSPKVDLITTDGFLLPNEVLRRENLMERKGFPDSYDVGALLR
                     FLSGIKSALPDVRAPVYSHLTYDVIPGEFVTIDRPDILIFEGINVLQPGKLPQDGKIV
                     PFLSDFFDFAIYIDADEKLIHEWYISRFMRLRETAFRNPDSFFHRYSQLSEDSARAIA
                     EGLWTNINLKNLRENILPTRARADLILRKGADHLVEEVALRKL"
     gene            complement(502375..502698)
                     /locus_tag="MESOP_RS02265"
                     /old_locus_tag="Mesop_0458"
     CDS             complement(502375..502698)
                     /locus_tag="MESOP_RS02265"
                     /old_locus_tag="Mesop_0458"
                     /EC_number="3.6.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP pyrophosphatase"
                     /protein_id="WP_013891697.1"
                     /db_xref="GI:503657621"
                     /translation="MAEFSLSDLEKIVHERAHSGDPDSWTAKLFARGIDKAAQKLGEE
                     AVETVIAAVKGDKQGLVSESADLIYHWLVVLGLSGVPLSDVLKELESRTGRSGIAEKA
                     SRPKG"
     gene            complement(502807..503598)
                     /locus_tag="MESOP_RS02270"
                     /old_locus_tag="Mesop_0459"
     CDS             complement(502807..503598)
                     /locus_tag="MESOP_RS02270"
                     /old_locus_tag="Mesop_0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase"
                     /protein_id="WP_013891698.1"
                     /db_xref="GI:503657622"
                     /translation="MLKARVIPCLDVKNGRVVKGVNFVDLIDAGDPVEAAKAYDAAGA
                     DELCFLDITASSDNRETIFDVVARTAEQCFMPLTVGGGVRQVADIRKLLLAGADKVSI
                     NTAAVTNPDFVAEAADKFGNQCIVVAIDAKKVSGDGEADRWEIFTHGGREKTGIDAVE
                     FARKMVDRGAGEILLTSMDRDGTKAGYDIALTRAVADAVRAPVIASGGVGTLDHMVEG
                     IRDGHAGAVLAASIFHFGTYTIAQAKAHMAAAGLPMRLDSSGDRS"
     gene            complement(503598..504434)
                     /locus_tag="MESOP_RS02275"
                     /old_locus_tag="Mesop_0460"
     CDS             complement(503598..504434)
                     /locus_tag="MESOP_RS02275"
                     /old_locus_tag="Mesop_0460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginase"
                     /protein_id="WP_013891699.1"
                     /db_xref="GI:503657623"
                     /translation="MKLTIILASYDSGHYHGGMGQGPDALIAGGLVDALTMAGHDVTV
                     EDIGRVGDAQEREIATGFAVCNAVSGEVRIAIDRGRFPIVLAGNCLTSAGAVAGEGAD
                     AIIWADQHGDLNTPETSTYGFLDGMALATVLGLCWRPMAGAIPGFKPIDPSRCVLVNA
                     RDLDPDEEKLVETLPIIRTECPGVAQATAKLKAAGAERVHMHLDLDVHDPEELQANRY
                     VTPGGPDPEQLRDAACAIALAVPVVGITVSAYDPAFDAQADVPPLVGQLLNDLIATIE
                     GR"
     gene            complement(504431..505180)
                     /locus_tag="MESOP_RS02280"
                     /old_locus_tag="Mesop_0461"
     CDS             complement(504431..505180)
                     /locus_tag="MESOP_RS02280"
                     /old_locus_tag="Mesop_0461"
                     /EC_number="5.3.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891700.1"
                     /note="catalyzes the formation of
                     5-(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino-l-
                     (5-hosphoribosyl)imidazole-4-carboxamide from
                     1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide isomerase"
                     /protein_id="WP_013891700.1"
                     /db_xref="GI:503657624"
                     /translation="MILFPAIDLKDGKCVRLKHGDMATATIYNDDPAAQARAFEEQGF
                     EWLHVVDLNGAFKGQSVNSAAVGAILKATKNPVQLGGGIRTLEQIEDWLARGLARVIL
                     GTVAVRDPDLVRQACKAFPGKVAVGIDAKGGKVAVEGWAEASSLGVIELARKFEGAGV
                     AAIIYTDIDRDGVLTGINWDATIDLAEAVSIPVIASGGLASIADIVRMTMPDAQKLEG
                     AISGRALYDGRIDPTEALAILRGKPAMEARS"
     gene            complement(505239..505889)
                     /locus_tag="MESOP_RS02285"
                     /old_locus_tag="Mesop_0462"
     CDS             complement(505239..505889)
                     /locus_tag="MESOP_RS02285"
                     /old_locus_tag="Mesop_0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase"
                     /protein_id="WP_013891701.1"
                     /db_xref="GI:503657625"
                     /translation="MRVAIIDYGSGNLRSATKAFERAARETGISAEIDLTADAERVRT
                     ADRIVLPGVGAYADCAAGLRAVEGMWEAVEDVAIARGRPFLGICVGMQLMSQRGLEKT
                     VTNGFGWIAGDVKEITPADPALKIPQIGWNTIELRRQHPLFSGIPTGPEGLHAYFVHS
                     YHLDARKADEVLAVADYGGPVTAAVARDNLAGTQFHPEKSQALGLALITNFLRWRP"
     gene            complement(505891..506367)
                     /locus_tag="MESOP_RS02290"
                     /old_locus_tag="Mesop_0463"
     CDS             complement(505891..506367)
                     /locus_tag="MESOP_RS02290"
                     /old_locus_tag="Mesop_0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891702.1"
                     /db_xref="GI:503657626"
                     /translation="MASYVVMEPPGRSERAGATVFVRDGFTWLGLLVPPLWFAWHRLW
                     IEAALTFVVMGLLSMLGEKLGLGLAGSLLSLLVSLYVGLEGQGLRIAALRRRGWHEWG
                     VVQAGWLDDADVRYALEAEAHADEAVAAPRMVPDAALARPAQPGMALGLTHIPGRR"
     gene            complement(506372..506971)
                     /locus_tag="MESOP_RS02295"
                     /old_locus_tag="Mesop_0464"
     CDS             complement(506372..506971)
                     /locus_tag="MESOP_RS02295"
                     /old_locus_tag="Mesop_0464"
                     /EC_number="4.2.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006201293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="WP_013891703.1"
                     /db_xref="GI:503657627"
                     /translation="MAPRSAEANRKTRETDISVSVHVDGSGKSDIATGVGFFDHMLDQ
                     LSRHSLIDMTVKAKGDLHIDDHHTVEDTGIALGQALTKALGERRGIMRYASIDLAMDE
                     TLTRAAIDVSGRPFLVWNVSFSSPKIGTFDTELVREFFQALAQNAGITLHVINHYGAN
                     NHHIAETCFKAVARALRAALERDPRQPDAVPSTKGSLKG"
     gene            507199..507750
                     /locus_tag="MESOP_RS02300"
                     /old_locus_tag="Mesop_0465"
     CDS             507199..507750
                     /locus_tag="MESOP_RS02300"
                     /old_locus_tag="Mesop_0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_013891704.1"
                     /db_xref="GI:503657628"
                     /translation="MSDNLTMHATTIVTVRKGNKVVIAGDGQVSLGQTIMKGNARKVR
                     RIGKGGNVIAGFAGATADAFTLLERLEAKLEQYPDQLTRACVELAKDWRTDRYLRRLE
                     AMMLVADKSVSLALTGTGDVLEPEHGVMAIGSGGNYALAAARALMDTDKDAEEIARKA
                     MQIASDICVYTNNNFVVETLDAG"
     gene            507740..508261
                     /locus_tag="MESOP_RS02305"
                     /old_locus_tag="Mesop_0466"
     CDS             507740..508261
                     /locus_tag="MESOP_RS02305"
                     /old_locus_tag="Mesop_0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside 6-adenylyltransferase"
                     /protein_id="WP_013891705.1"
                     /db_xref="GI:503657629"
                     /translation="MPAESGVLYDFRPVTEKDLPMIAGWLAEPHVAQWWDDPETEIAE
                     IREHIDSISVEPLIVELDGIPIAYLQSYDPHLEDDHPYADQPFGTLGIDVSIGRPELV
                     GLGHGSAIVRQFVEQLFEEGVPRVIIDPDPANLRAIRAYERAGFRAIDRRQSVYGDAV
                     LMAIDADDEQEGE"
     gene            508266..508865
                     /locus_tag="MESOP_RS02310"
                     /old_locus_tag="Mesop_0467"
     CDS             508266..508865
                     /locus_tag="MESOP_RS02310"
                     /old_locus_tag="Mesop_0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013891706.1"
                     /db_xref="GI:503657630"
                     /translation="MSTPGVNERYSAYEDSWRMGLLLVLGLLIFQAGALYGMGHPPIC
                     TCGYVKLWHGVVNSSENSQHISDWYTFSHIIHGFLFYALAQFLFPRSPIGLKLAFAVF
                     IEGGWELLENSPFIIERYRAGTISLDYYGDSIINSVSDTLAMVLGFVMARKLPIWVIV
                     SLAVLFELGTGYLIRDNLTLNVIMLLHPFEAIKQWQSGI"
     gene            508870..510180
                     /locus_tag="MESOP_RS02315"
                     /old_locus_tag="Mesop_0468"
     CDS             508870..510180
                     /locus_tag="MESOP_RS02315"
                     /old_locus_tag="Mesop_0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="WP_013891707.1"
                     /db_xref="GI:503657631"
                     /translation="MSTFSPREIVSELDRFIIGQKDAKRAVAIALRNRWRRQQLEGQM
                     REEVMPKNILMIGPTGVGKTEISRRLARLAGAPFVKVEATKFTEVGYVGRDVEQIIRD
                     LVEIAIGLVREKMREDVKARAHVNAEERVLEALVGKTASPATRDSFRKKLRDGELDDK
                     EIEIEVADTGTGGMPGFEIPGMPGANIGVLNINDMLSKAMGGKKTKLRKTTVKESYDL
                     LVNDESDKLLDQDEVVRRALDAAENDGIVFLDEIDKIAARSDISGGPSREGVQRDLLP
                     LVEGTTVATKYGPLKTDHILFIASGAFHVSKPSDLLPELQGRLPIRVELRALEKEDFV
                     RILTETEASLIKQYIALMKTEGVELTFTDDAIDSLAGIAVDLNASVENIGARRLQTVM
                     ERVLDEISYDAPDRNGTSVTIDAAYVEKHVGDLSRNTDLSRFIL"
     gene            510415..511374
                     /locus_tag="MESOP_RS02320"
                     /old_locus_tag="Mesop_0469"
     CDS             510415..511374
                     /locus_tag="MESOP_RS02320"
                     /old_locus_tag="Mesop_0469"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891708.1"
                     /db_xref="GI:503657632"
                     /translation="MKKLILVLLGLTLAATLFGAQAATLVPPGNRNAEQPDIPGASSR
                     RTQATNTTFQAKYRKVYALLQNDADLRAKIKKAASAYGIDPMHIVGAIVGEHTYNVDA
                     YDRLQTYYVKAISYLSSKLSFAYDGEDITDFVQRPEFRKCAGMSDSYDLWECREQVWN
                     RSFRGKTVGGTSFPNDRFGATFFQPYYAGQTFGLGQLNPLTALQMSDLVHKVSGLPEL
                     DVADPNAVYKTIMDPDLTLPYVAATIRKSIDAYKSIAGFDISGNPGLTATLYNVGNPE
                     QRAYALRAENDKRRAAGEPAKLPEENYYGWLVNDKLSELKALF"
     gene            complement(511488..512726)
                     /locus_tag="MESOP_RS02325"
                     /old_locus_tag="Mesop_0470"
     CDS             complement(511488..512726)
                     /locus_tag="MESOP_RS02325"
                     /old_locus_tag="Mesop_0470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin reductase"
                     /protein_id="WP_041163970.1"
                     /db_xref="GI:752465261"
                     /translation="MMDMARGMIIIGAGECGGRAALALRDLGYDGPVTLVGDEPHLPY
                     ERPPLSKDAMASDAPEIKAIASDEMLAEKSIRHIHSVQAVGIDRAAHAVRLSDGSVLP
                     YDKLLLATGSIPRKLPMPGLGARCVYLRTFADALAIRAHLSAGNRIAVIGGGFIGLEL
                     AAAARKLGASVTVIEAQPRILMRGVPAEIAEIIHQAHSAEGVDILCGDGIASIADDGR
                     QVRIALAGGHQVSADLAIIGIGAMPVTALAAEAGLAIENGIAVDEQLRSSDADIFAAG
                     DCCSFPLAVYGGRRVRLEAWRNAQEQGALAARNMLGAGEAHAAVPWFWSDQYGLSLQI
                     AGLSDEGRSTVRRDLGDSAFILFHLAEDGRLVAASGIGPGNAVARDIRLAEMLIGKRA
                     KPAPEALGSQDVKLKSLLAA"
     gene            complement(512723..513037)
                     /locus_tag="MESOP_RS02330"
                     /old_locus_tag="Mesop_0471"
     CDS             complement(512723..513037)
                     /locus_tag="MESOP_RS02330"
                     /old_locus_tag="Mesop_0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rieske family ferredoxin"
                     /protein_id="WP_013891710.1"
                     /db_xref="GI:503657634"
                     /translation="MSHWVEACAAGDIDEEDVMRFDHGGRTFAIYRSPDDEYFATDGL
                     CSHEKVHLADGLVMDDIIECPKHNGRFNYKTGAARGAPVCVNLKTYPVKVDAGKVLVQ
                     IG"
     gene            complement(513063..514154)
                     /locus_tag="MESOP_RS02335"
                     /old_locus_tag="Mesop_0472"
     CDS             complement(513063..514154)
                     /locus_tag="MESOP_RS02335"
                     /old_locus_tag="Mesop_0472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase"
                     /protein_id="WP_013891711.1"
                     /db_xref="GI:503657635"
                     /translation="MTIAPSRRDYSLIGRDAKLAVENGLSAAEWYHTDIPRKQMKELM
                     QRSDGPAIRDTAIWIAALVVSGAGGAWFWGSWWCLPFFFVYGVLYGSSTDSRWHECGH
                     GTAFRTQWMNDIVYQIACFMIMRNPVTWRWSHTRHHTDTIIVGRDPEISVMRPPDLVR
                     AILGFVGVLDAWHAMSDMLRNAAGNISAAEKTFIPEQEQGKAIRIARIWTAIYAATIA
                     LALYSGSFLPLMLVGLPRLYGAWHHVMVGLLQHGGLADNVTDHRLNSRTVYMNPISRF
                     IYWNMNYHVEHHMFPMVPYHALPKLHALIKHDLPAPTPSILAGYREMIPVFLRQLRNE
                     DYFLKRELPPTARPYREEFHSDAVAAAAE"
     gene            514318..515349
                     /locus_tag="MESOP_RS02340"
                     /old_locus_tag="Mesop_0473"
     CDS             514318..515349
                     /locus_tag="MESOP_RS02340"
                     /old_locus_tag="Mesop_0473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_013891712.1"
                     /db_xref="GI:503657636"
                     /translation="MAKRPTITDLARISGVSVATVDRVLNNRLPVREETARRVYQTAT
                     EIGYHAAGLIKQRMRHELPEYRLGFLLLRGNDVFYSEFARQLELAVSQSQRFRGVAII
                     DFTSSLTPDEIVERTHRLAARCNAIALVGPDHPTLTVAVEEMKARGLPVFSLLSDFAA
                     GIREGYVGLDNRKVGRTAAWMISKAAKRPGKVALFVGSHRFHGHELREIGFRSFFREQ
                     AQEFTLLETLVNLEANQITQDTLLELLHRHPDLVGCYVAGGGMEGAVAALRQARPAEM
                     PAVVCNEITAVSRSALADGVLTMVISTPLAALCRELVDLVAHAIEAGAANAPGQTFLP
                     FEIYLPENI"
     gene            515414..516205
                     /locus_tag="MESOP_RS02345"
                     /old_locus_tag="Mesop_0474"
     CDS             515414..516205
                     /locus_tag="MESOP_RS02345"
                     /old_locus_tag="Mesop_0474"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891713.1"
                     /db_xref="GI:503657637"
                     /translation="MGEDRFGYIAFGKDELYARGALFSALRLQHYCPGAKITVLTDRP
                     SVFDGYSIETIELTPDTKAEMSFGNRYLFGIKAAGIIEMLRRCERLFFMDTDMYPTGD
                     ISHCFDGISSSLSTMRKCEGTPKPAYREIEDKGFLLGNHRLTGREPMWNSGVLGVHNA
                     NIPALTEAYHAMEQMIGVVRAHTTEQFCIGVALSNDGRKIRRHRLPIRNYNTRGRKLF
                     ARRRIDAFFEANGNLDAAQLRKQAAAYRVWRGPLDLLLQRGIWHF"
     gene            516621..517562
                     /locus_tag="MESOP_RS02350"
                     /old_locus_tag="Mesop_0475"
     CDS             516621..517562
                     /locus_tag="MESOP_RS02350"
                     /old_locus_tag="Mesop_0475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhizopine-binding protein"
                     /protein_id="WP_013891714.1"
                     /db_xref="GI:503657638"
                     /translation="MKKLLLGVAFAALMSSSAFAAKIGVSMAKFDDNFLTVLRNGMIE
                     QAKGMSGVELQVEDAQNDVAKQLDQIKNFAASGVDAIIVNPVDTSATQAMSDAAAAAK
                     IPLVYVNREPVNVNTLPDNQAFVASNEADSGTLETKEVCRLFKEAGKKEANVYVIMGE
                     LSNQAAVQRTKDIEEVIATPDCSFIKIIDKQTSNWNRDEAQNLMTNWLSTGKPFDGVI
                     ANNDESAIGAIQAMKAANIDMKSVVVGGVDATQDALAAMQAGDLDATVFQDAAGQGAG
                     ALDAALKLAKGEKVEHKVYVPFQLVTPANIDKFLKKN"
     gene            517668..518744
                     /locus_tag="MESOP_RS02355"
                     /old_locus_tag="Mesop_0476"
     CDS             517668..518744
                     /locus_tag="MESOP_RS02355"
                     /old_locus_tag="Mesop_0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter permease RbsC"
                     /protein_id="WP_023765674.1"
                     /db_xref="GI:563560097"
                     /translation="MAQTSHGVGGVSYDAKKRNWPAEFNVFLALVILVVIFELIGRIF
                     LGDSFLFNTRSDVGGLFNEARLQIIILQVSIVGIIAIGVTQVIITGGIDLSSGSIVGA
                     TAMIAMSFAQVATVNGNPNPKAMFLAQGWTDLPVIVPVLVAIGCGLFAGLVNGALIAY
                     TRIPPFIATLGMMVTARGIAKWWSKGQPISFPTESFAAIGKGLMPVIIFLSLAILFQL
                     IMTYTRYGKHCYAIGSNEDAARMSGIKIANHKILVYVIAGILAALAAVVLSSKNLTAQ
                     SGMGVMYELDAIAMAVIGGVSLSGGRGSIIGTVIGSLIFGVIISGFTFLRLDAYYQEM
                     VKGVIIVGAVVLDQWRQRMRALRA"
     gene            518747..519529
                     /locus_tag="MESOP_RS02360"
                     /old_locus_tag="Mesop_0477"
     CDS             518747..519529
                     /locus_tag="MESOP_RS02360"
                     /old_locus_tag="Mesop_0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_013891716.1"
                     /db_xref="GI:503657640"
                     /translation="MPDISTTDIVLKTENLTKRYGGVHALEGANFELRKGEHVAIMGD
                     NGAGKSTFVRQITAVEQRTSGQVWFDGKEVNFAGPIEARTAGIETVFQNLALADDLDV
                     PSNLFLGREKVLFNLGPFSILDRKYMRKATEAALIRTAVKIPNLSNTIRHMSGGQRQC
                     VAIARTATFASKLIIMDEPTAALGVQETAQVENIIRTLKDNGEPLILISHNMRQVFDL
                     CDRIVVFRRGRIVANLRKENTDGQDIVSYITGAKTGEAELAA"
     gene            519651..520646
                     /locus_tag="MESOP_RS02365"
                     /old_locus_tag="Mesop_0478"
     CDS             519651..520646
                     /locus_tag="MESOP_RS02365"
                     /old_locus_tag="Mesop_0478"
                     /EC_number="1.1.1.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol 2-dehydrogenase"
                     /protein_id="WP_013891717.1"
                     /db_xref="GI:503657641"
                     /translation="MTVRFALLGAGRIGKVHARAVGSNPQAKLVAVADAFEKAATELA
                     SAYGAEVRSIDAIEKAGDIDAVVICTPTDTHADLIERFAKAGKAIFCEKPIDLDVKRV
                     EKCLAVVDKAKATLMVGFNRRFDPHFAAVRKAIDDGAVGTVEMVTITSRDPGAPPIDY
                     IKRSGGIFRDMTIHDFDMARFLLGEEPVAVSAHASVLVDKKIGEAGDFDSVSVILETA
                     SGKQAVISNSRRATYGYDQRIEVHGSKGMVAAENQRPVSIEVANDKGYTRPPLHDFFM
                     TRYLDAYAIEIAAFIAAATSGKKASPSGADGLVALKLADAALKSATSGKTVRLDK"
     gene            520678..521472
                     /locus_tag="MESOP_RS02370"
                     /old_locus_tag="Mesop_0479"
     CDS             520678..521472
                     /locus_tag="MESOP_RS02370"
                     /old_locus_tag="Mesop_0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013891718.1"
                     /db_xref="GI:503657642"
                     /translation="MSASADRNSNTRAIVTGGAQGIGFAVATALADEGCRALALIGRS
                     QEKGDKAVAALKKSGVDAIFISADVSDVADCKRAVAAALSHFGTINALVNAAATSARG
                     SLVETSEELFDTIFDTNVRGPFFLMQGVVAHLLEKKAPGSIVNVLSMSAHTGQSFLTP
                     YSTSKGALMTLTKNVANAYRFNRIRCNAVLPGWMDTEGEDIVQKKWHDAPDDWLAKAE
                     ATQPMGQLVKPDQLARLVSYMVSPQSGVMTGSLVDYDQSVAGASPE"
     gene            521539..521823
                     /locus_tag="MESOP_RS02375"
                     /old_locus_tag="Mesop_0480"
     CDS             521539..521823
                     /locus_tag="MESOP_RS02375"
                     /old_locus_tag="Mesop_0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891719.1"
                     /db_xref="GI:503657643"
                     /translation="MRGSADFDSYMVRLKPVLFAPVLSVDARAAPHLPAGILSPYSDG
                     ERGALASDFANSSTARDKRLRFDYMSRMIHLTATYWYFSSSLAAGGLRSI"
     gene            521911..523002
                     /locus_tag="MESOP_RS02380"
                     /old_locus_tag="Mesop_0481"
     CDS             521911..523002
                     /locus_tag="MESOP_RS02380"
                     /old_locus_tag="Mesop_0481"
                     /EC_number="2.5.1.54"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
                     /protein_id="WP_013891720.1"
                     /db_xref="GI:503657644"
                     /translation="MLTTTDDLRVKEIRELSTPDQVMREIPRTLTATRTVSASRNAIH
                     AILNGTDDRLLVVVGPCSIHDPVAAVDYASRLAALREALSDRLEIVMRVYFEKPRTTV
                     GWKGLINDPDLDGSFNIDKGLRMARNVLSAVNNLGLPAATEFLDMTTPQYIADLVAWG
                     AIGARTTESQIHRELASGLSCPVGFKNGTDGNLRIAAEAVKSAAQPHHFMAVTKGGRS
                     GIATTTGNEDCHVILRGGVQPNYDAVSVEAASVELARIGVAPRLMIDVSHANSSKKPE
                     NQPKVAADVAGQVAAGDERIVGVMIESNLVAGRQDVVAGKPLVYGQSITDGCIDWATT
                     ETVLHGLAGAVEWRRSARRAMMESRPGAA"
     gene            complement(523050..523685)
                     /locus_tag="MESOP_RS02385"
                     /old_locus_tag="Mesop_0482"
     CDS             complement(523050..523685)
                     /locus_tag="MESOP_RS02385"
                     /old_locus_tag="Mesop_0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine transporter RhtB"
                     /protein_id="WP_013891721.1"
                     /db_xref="GI:503657645"
                     /translation="MNYAENLWLFFILLFGIIAVPGMDMLFVLANALTGGRDRGLAAT
                     GGIMVGGMVHTLNGAIGVGLLMHFVPILFTPLLIAGAAYMAFIGITLMRSSITVGDGG
                     PAGSRSAWKAFRQGFVTCLINPKAYLFVLAVYPQFLKPDYGPIWMQATIMGLMTVLTQ
                     AAIYGGLAISAGRSRKLLIANPRATVLAGRAAGLLLFAVSVFTAWEGLRTA"
     gene            523833..524531
                     /locus_tag="MESOP_RS02390"
                     /old_locus_tag="Mesop_0483"
     CDS             523833..524531
                     /locus_tag="MESOP_RS02390"
                     /old_locus_tag="Mesop_0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013891722.1"
                     /db_xref="GI:503657646"
                     /translation="MRKASRLFEIIQILRLARQPVTAATIAAQLEVTVRSIYRDIAAL
                     QAMRVPIEGGRGIGYILRPGFDLPPLMFSIEEMEAIVLSLALLERTGDDELKQAAKRV
                     GAKIAGAVPPPLRQTLDANALHAWGFAAPSAGTIDLALVRRAIRDEEKLDLSYRDEMG
                     RASERLVRPIALIYYAETANIVAWCELRQAIRNFRSDRIADCQPTGLRFKGEGDRLRQ
                     VWVNGWEANAAVGS"
     gene            complement(524699..525808)
                     /locus_tag="MESOP_RS02395"
                     /old_locus_tag="Mesop_0484"
     CDS             complement(524699..525808)
                     /locus_tag="MESOP_RS02395"
                     /old_locus_tag="Mesop_0484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="myo-inositol 2-dehydrogenase"
                     /protein_id="WP_013891723.1"
                     /db_xref="GI:503657647"
                     /translation="MVGVGLIGTGFMGKCHAIAWSAVGAVFPGVAKPRLVHLGEVNED
                     LAQRKAGEFGFEKASGDWRAVVNDPEVDIVSLTTPNQYHPEMAIAVLEAGKHLWCEKP
                     MAPSFAEAEAMAAAARKSGKVAALGYNYIQSPAIRHIGALLDEKIIGEVNHLRIEMDE
                     DFMADPEALFFWKHEAASGYGALDDFAVHPLSLVSALFGRVASVICDMAKPYADRKLA
                     AGGRRAVETYDIASVLMHLENGIAGTLLVNRSAWGRKGRIAIQIFGSKGSILFDQERM
                     NEFQLYLTSDRPTEQGYRTILVAPQHKPYDLFVPAPGHSLGFNDLKIIECHELLTRLA
                     GKPARLIEFGEGLEIERTVHAMARSFEEKRWVDVR"
     gene            526070..526915
                     /locus_tag="MESOP_RS02400"
                     /old_locus_tag="Mesop_0485"
     CDS             526070..526915
                     /locus_tag="MESOP_RS02400"
                     /old_locus_tag="Mesop_0485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_013891724.1"
                     /db_xref="GI:503657648"
                     /translation="MDERVPRDFETLRATILDRRESLPKRIAQIAAYALDNPDDIAFG
                     TAASIAASAGVQPSTLIRFAQQLGFDGFTSLQQVFRERLRERNSSYDERLQALRAKAD
                     AGAGHRAIFDGFIAAASTSLNDISRTLDDAHLEDAISLLAKAQTIYVLAKRRSYPVAS
                     YIAYALGKLKIRNQLIESAAGLNAEMVSFATPADAVIAISFSPYAPATIEEARAISEQ
                     GVPIVAITDSSFSPLAQFASVWFEVAEADFAGFRSLSATMALAMALTVGVGEKRRDVS
                     RKRKA"
     gene            527139..529073
                     /locus_tag="MESOP_RS02405"
                     /old_locus_tag="Mesop_0486"
     CDS             527139..529073
                     /locus_tag="MESOP_RS02405"
                     /old_locus_tag="Mesop_0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-dehydro-2-deoxygluconokinase"
                     /protein_id="WP_013891725.1"
                     /db_xref="GI:503657649"
                     /translation="MSEAVDARQAPLDVITIGRASVDLYGQQIGSRLEDITSFAKSVG
                     GCPANISVGTARLGLRSALLTRVGDEQMGRFIREQLKREGVNTDGLKTDKERLTALVL
                     LSVEDEGVSPMIFYRSDCADMALAEEDIDEAFISSARAIVVTGTHFSRPNSDAAQRKA
                     IRIMKAKGGKVVFDIDYRPNLWGLAGHAEGFERYVKSDRVSAQLKTVLPDCDLIVGTE
                     EEIMIASGADDCLSALKTIRALSSATIVLKRGAMGCIVYDGPISDDLEDGIVGKGFPI
                     EIYNVLGAGDAFMSGFLRGWLGGEDHATAATWANACGAFAVSRLLCAPEYPTFEELQF
                     FLKNGSKHRALRKDEAINHIHWATTRRRDVPSLMALACDHRIQLEDVAAKAGADPARI
                     RDFKVLAVKAAAKVAAGRDGYGMLIDEKHGREAMFEFARHPFAWLGRPVELPGSRPLR
                     FEFSQDIGSQLTEWPVDHCIKCLCFYHPDDPAALKEEQQQKLRALFEAARKVGRELLI
                     EIIAGKHGKLDDTTIPRALEELYALGIKPDWWKLEPQASSGAWARIEAVILKHDPWCR
                     GIVLLGLEAPQDELEAAFAATAKAPIVKGFAVGRTIFVHAAEQWLAGKMSDDEAVADM
                     ASRFEQLTEAWLAARGRKAA"
     gene            529124..530974
                     /locus_tag="MESOP_RS02410"
                     /old_locus_tag="Mesop_0487"
     CDS             529124..530974
                     /locus_tag="MESOP_RS02410"
                     /old_locus_tag="Mesop_0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
                     hydrolase"
                     /protein_id="WP_013891726.1"
                     /db_xref="GI:503657650"
                     /translation="MSKTIRLTMAQALIRFLSRQMAEIDGQKVPIFGGVWAIFGHGNV
                     AGIGEALYQVRQELPTFRAHNEQAMAHAAIAYGKANFRRRFMAATSSIGPGALNMVTA
                     AALAHVNRLPVLFLPGDVFANRIPDPVLQQAEDFSDGTATVNDCFKPVSRYFDRITRP
                     EQIIPALSRAMQVLTDPAECGPVTLSLCQDVQAEAYDYPESFFAERVWHQRRPRPDRG
                     ELAAAVAALKSAKKPLIIAGGGVLYSQASDELAKFVEGAGIPVCETQGGKSSLPDNHP
                     LNMAAVGVTGTSAANRLAEEADVVLAIGTRLQDFTTGSWALFKNSGKTIIGLNVQPFD
                     AGKHRALPLVADAAEGLAELGAALKGWKAPAAWTDNSAAGKKAWQVDASKVTASTNAA
                     FPSDAQVIGAVQRAMGSGVILLNASGGLPGELHKLWQAGAPGSYHGEYGFSTMGYEIA
                     GGLGAKMAKPDREIVVMVGDGSYLMMNSEIATSVMLGLKLTIVVLDNRGYGCINRLQM
                     ATGGANFNNLLKDSRHEILPDIDFAAHAASLGAIAEKVPSIAGLENALQKAKANDRTT
                     VLVIDTDPLVSTDAGGHWWDVAVPEVSARPQVNAARKAYDEKRQMQSVGD"
     gene            531057..531974
                     /locus_tag="MESOP_RS02415"
                     /old_locus_tag="Mesop_0488"
     CDS             531057..531974
                     /locus_tag="MESOP_RS02415"
                     /old_locus_tag="Mesop_0488"
                     /EC_number="4.2.1.44"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="myo-inosose-2 dehydratase"
                     /protein_id="WP_013891727.1"
                     /db_xref="GI:503657651"
                     /translation="MKAKLGMSPIAWWNDDLAELSDDVSLEECLRQSRSAGFTGMEMG
                     RRFPNDPAVMLPILKKADVTLCGGWFSGTLVDEEMAKNQDRIQPMIDLFKAVNAPCIV
                     YGEVGRSIQGDRSKPLATKPKLSDDEMKAYAKRVTAFGEWCAGQGMPLSYHHHMAAVV
                     ETEPELNAFMRHSGEGIPLLLDAGHLAFAGGDVLRAIDNHHKRISHVHVKDVRMGVID
                     KLDRTKQSFLDAVALGAFTVPGDGSLDFGAIVQRFADHGYEGWFVVEAEQDPKKNPPL
                     KMAQLGHKELMRVMTAAGYTVETQGFPNA"
     gene            532018..532236
                     /locus_tag="MESOP_RS02420"
                     /old_locus_tag="Mesop_0489"
     CDS             532018..532236
                     /locus_tag="MESOP_RS02420"
                     /old_locus_tag="Mesop_0489"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891728.1"
                     /db_xref="GI:503657652"
                     /translation="MKDSEHPFFRPLWRRVAVVAVCVIWSIIEFATGTPFWGVIALGF
                     AGYGVWQFFYLYKPVDESKAPAEAEPKE"
     gene            532404..533216
                     /locus_tag="MESOP_RS02425"
                     /old_locus_tag="Mesop_0490"
     CDS             532404..533216
                     /locus_tag="MESOP_RS02425"
                     /old_locus_tag="Mesop_0490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-deoxyglucuronate isomerase"
                     /protein_id="WP_013891729.1"
                     /db_xref="GI:503657653"
                     /translation="MSKLLVKADKGHGRVAHVTPESAGWTYVGFDLHRLKPGETASGK
                     TDDREICLVFVTGKGKAKAGGKDLGLLGERMSPFEGKPWSVYVPQGSDWSVTADTELE
                     LAVCSAPGLGGGLPVRVIGPDDLGQEVRGKGTNTRYVTNILPEGQPADSLLVVEVITP
                     GGHTSSYPPHKHDQDNLPAESYLEETYYHRLNPPQGFAFQRVYTDADKSGHRALDEAM
                     AIEDGDVVLVPEGYHPCAACHGYDLYYLNVMAGPKRTWKFHNAPEHEWLMKA"
     gene            533370..534077
                     /locus_tag="MESOP_RS02430"
                     /old_locus_tag="Mesop_0491"
     CDS             533370..534077
                     /locus_tag="MESOP_RS02430"
                     /old_locus_tag="Mesop_0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006325715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein"
                     /protein_id="WP_013891730.1"
                     /db_xref="GI:503657654"
                     /translation="MRYAIYFTPRQDEPLARIAANWLGRDPFGAATKPVEAVADLSAA
                     EVAFHTASARRYGFHATLKAPFRLAANETEASLRAALDHFAEATPVVTIPRLVVSQID
                     SFFALVPEGPLPPLNRFADDVVRDFDRFRAPLTEAEIERRSPDSLKPAEFRNLCQWGY
                     PYVFETFRFHMTLSGRAGPQESPRLRAAIDSLFAEVLSQPVLVDALTLFVELEPGAPF
                     MVLSHHALGRRPARKTA"
     gene            534119..535273
                     /locus_tag="MESOP_RS02435"
                     /old_locus_tag="Mesop_0492"
     CDS             534119..535273
                     /locus_tag="MESOP_RS02435"
                     /old_locus_tag="Mesop_0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein PhnM"
                     /protein_id="WP_013891731.1"
                     /db_xref="GI:503657655"
                     /translation="MTAETVLSNARIVLADEIVEGSLVLRDGLIAGIDAGTGQTGGNM
                     AGEDMGGDYIIPGLVELHTDHLEGHYAPRPKVRWNPIAAVLAHDAQVATAGITTVLDA
                     LRVGMDEDADLTSADIRKLADAIEDSVQQDRLRADHFIHLRCEVSAPDCLKAFANFDG
                     DERVKLASLMDHAPGQRQFVNLETYAYYYQRKLKLTDRDFQKFCEKRMSESALNSRPN
                     RVHIAAACQERGIVLASHDDATIGHVGEAIEQGVRVAEFPTTQEAARASKEAGLGVLM
                     GAPNVMRGASHSGNVSARTLASDGLLDILSSDYIPFSLIQSAFFLGDVVEGISLPQAV
                     AMVSKNPAEAVGLNDRGIIEQGRRADLVRVRVDDHVPVVRTVWRQGLRVA"
     gene            535270..535899
                     /locus_tag="MESOP_RS02440"
                     /old_locus_tag="Mesop_0493"
     CDS             535270..535899
                     /locus_tag="MESOP_RS02440"
                     /old_locus_tag="Mesop_0493"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020629115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 1,5-bisphosphate phosphokinase"
                     /protein_id="WP_013891732.1"
                     /db_xref="GI:503657656"
                     /translation="MMVSALIERELSAETFPIRHGVFVAVVGPSGAGKDTVIGYARAL
                     FTDETRLEFVRRVITRPCDAASEDHDTLADAAFVEAEADGAFAISWEAHGLRYGLPAD
                     VDWSVANGRVAVANVSRAVIPVLRERYANLAIVEITASPNVLAERLAMRGRESRGEVL
                     ARLARSANVTLSGPGVTSIDNSGAREVAGERFAELLRKAMAFSDMSGLI"
     gene            536208..537017
                     /locus_tag="MESOP_RS02445"
                     /old_locus_tag="Mesop_0494"
     CDS             536208..537017
                     /locus_tag="MESOP_RS02445"
                     /old_locus_tag="Mesop_0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013891733.1"
                     /db_xref="GI:503657657"
                     /translation="MRTFLGGAGALLAGFVLALSALLPSIASAQSVEDIISRGKLVVA
                     IDTTTPPYGFLDANLKPTGFDIEVANKMGEALGVPVEFVTVTSPGRIPALLTKQVDAV
                     ISIFSITPARAIQIDYSIPYAGQSAVVIAPKSTSIKGVADLVGKKVGLTRGTGEDGLL
                     TKAAEANPGIEILRFDDYSSLLQAMVSGQIDAMGGGDYGEIYLKKAQNGDAFEQKYVL
                     KTFYFGIGVAKGNDNLRQWINTWLFAMKTDGTLDALSMKYRNQPLPVLPVF"
     gene            537077..537742
                     /locus_tag="MESOP_RS02450"
                     /old_locus_tag="Mesop_0495"
     CDS             537077..537742
                     /locus_tag="MESOP_RS02450"
                     /old_locus_tag="Mesop_0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891734.1"
                     /db_xref="GI:503657658"
                     /translation="MQTALQFGPILVHLDLLLRGLEKTIQLAALSILFGTAIGILGAV
                     GRSFGPRFLSWTIAAYVELIRNTPLLIQLYFVFFSLPLFGFKLSSNMAAVVALSIHLG
                     AYATEILRAGIEAIPEGQIEAAKSLGLGRYRIIRHVVLVPAARAVYPSLSAQFILQIM
                     GTSIVGAIAAEELTAVANNLVMQTFRSFEVYIVIAIIYFVLVQTASLLFAGIGKLMFR
                     WKA"
     gene            537746..538438
                     /locus_tag="MESOP_RS02455"
                     /old_locus_tag="Mesop_0496"
     CDS             537746..538438
                     /locus_tag="MESOP_RS02455"
                     /old_locus_tag="Mesop_0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_013891735.1"
                     /db_xref="GI:503657659"
                     /translation="MSLRDFGPNELMFLLLATRWTILLALIAFAGGGLIGLVVAAIRV
                     APARPLRWLAAGYIQFFMGTPILIQLFMAYYGSSFLGYRPDPWVAAAVTFSLNGGAFF
                     GEIFRGAIEAIPKGQWEAATALGFRFVRTLRLVIIPQAVRLMLPPTVGFMVQIVKTTS
                     IASLIGLTELARAATQVNTVTFQPVMVFGTVSIIYFALCWPLSLYAGYLERRFATGTV
                     RKVETPLVMSAV"
     gene            complement(538443..539324)
                     /locus_tag="MESOP_RS02460"
                     /old_locus_tag="Mesop_0497"
     CDS             complement(538443..539324)
                     /locus_tag="MESOP_RS02460"
                     /old_locus_tag="Mesop_0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconolaconase"
                     /protein_id="WP_013891736.1"
                     /db_xref="GI:503657660"
                     /translation="MVEITCVVDAGAELGEGTLWDPKAGVLWWIDIWKKLIHRYDPAT
                     GKDDVFETPEYLGCLGLREKGGLVLTMTDGFHFFDPATGKFEAIVDPEAHMPKTRFND
                     GKPDRQGRFWSGTMFEVQGKPIEFIGALYRLDPDLSVHKMVDGIGCSNGLAWSPDSRT
                     MYFSDSHAGAVWAYDFDPATGDIENRRTFIDMTVTGGVADGATVDAEGCYWVTIPVTG
                     KVCRYDPDGRLMQTVLLPTDLPTCCEFGGKDLDILYVTSAVLRRPAGHFVGQKNPGGL
                     FALDVGVKGLALPAFKG"
     gene            complement(539327..540295)
                     /locus_tag="MESOP_RS02465"
                     /old_locus_tag="Mesop_0498"
     CDS             complement(539327..540295)
                     /locus_tag="MESOP_RS02465"
                     /old_locus_tag="Mesop_0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="WP_013891737.1"
                     /db_xref="GI:503657661"
                     /translation="MSAFLARNRLIVLAYAGMVVLLLVTALFSPGFLSVSNMRSTVVL
                     AAFVGIVALGQTFVIIGGGIDLSVPWVLNSAAIVMALLCGGQDLPLVWVMPLLLAGGA
                     FIGLINGVGVAQFGVPPIIMTLATNVILQGLILVLTGGSPTPSAPALIQFLSVGRLGG
                     FPVIALIWLGLTLVATLLLSKAAFGRHLYALGTSATVAEFSGVPTARTTILTYVLSGL
                     TAAFAGMLLTGYSGQAYLGMGDAYLFTSIAAVAIGGASILGGSGHYLGTVAGAMVLTI
                     LTGLLPALNLSSGALLIVYGAVILLTVSIGSETFAGLGGKLRGKEG"
     gene            complement(540292..541314)
                     /locus_tag="MESOP_RS02470"
                     /old_locus_tag="Mesop_0499"
     CDS             complement(540292..541314)
                     /locus_tag="MESOP_RS02470"
                     /old_locus_tag="Mesop_0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="WP_013891738.1"
                     /db_xref="GI:503657662"
                     /translation="MSVEQAVEMAQMPAKMKSGTPAVDWRGRALDRAPFLVACLMLAL
                     IVAVYGSLQSGVFTLDEINLDTAAAMTLMLAATGQTIVLVRGGIDLSIGGMISLGTVI
                     AATRFTDDPSTTALWALIILALGFAVGALNGLLISVLKLQPFLVTLATWSILNGVAMI
                     ILPTDGGSVPSWWVGFASAQMFSLTSPVWMLLALLVFWWWFRATRVGIAIQATGSNEK
                     SAFLSGVSITRVNLVTYGLSGLFAAGAALFLVTQTGAGSPTIGKDYILPSVAAAVIGG
                     VSLFGGRGHLAGTLIGAFVLTLIGNLVFVLHVSSYWQPVVSGVILLLSVLASSVAEKA
                     ARNRVQ"
     gene            complement(541318..542850)
                     /locus_tag="MESOP_RS02475"
                     /old_locus_tag="Mesop_0500"
     CDS             complement(541318..542850)
                     /locus_tag="MESOP_RS02475"
                     /old_locus_tag="Mesop_0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_013891739.1"
                     /db_xref="GI:503657663"
                     /translation="MSGELFESAFMDLVTVKGLSKRYGGIVALSEATFSARAGEVHAL
                     LGENGAGKSTFIQILSGAVRHDGGSILVDGQDYRPANPDAAQARGIAAVFQELSLIPD
                     LSVEQNIWFRHEPRTLLRTVNRAEMRRKTLALLEKYNFPPLRPDRELRRLTLAERQVV
                     EIAKGLAKDPRILILDEATSALPAREAEWLLKLTRQLATEGRLVIFISHRMAEVRAIA
                     DRLTIFRNGSTVAAHEANAVSDNEIVTQMIGRHLDRLYPERIATATDRVALRVKGFSS
                     GSRLSGVDFALREGEVLGVGGLQGHGQRELFQALFGATRASGAIELWGKPVSIGNPRQ
                     ALTGKDGIALVPEDRRGQGLLLTKSVRENLTLSVIKRFTENGLLSRQKEAALVKEMVD
                     FLRIKAGTPEQLAGTLSGGNQQKVIFGKMLLTEARVLLLYDPTRGVDVGTKGEIFQLM
                     RDLAAKGYAILFHSSDMPELVHVADRVLVMRNGRIAATLEGDRISEAGILRAAMLESE
                     AA"
     gene            complement(542888..543955)
                     /locus_tag="MESOP_RS02480"
                     /old_locus_tag="Mesop_0501"
     CDS             complement(542888..543955)
                     /locus_tag="MESOP_RS02480"
                     /old_locus_tag="Mesop_0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_013891740.1"
                     /db_xref="GI:503657664"
                     /translation="MKLKTVCGGLAALAMSAIAVGTAPSHAEDKKPYTIYLSNNFVGN
                     DWRQQMERVATVSVNKGPLKGRVDLKIENVENTVQAQINSLNNIIRQKPDAILVDAGS
                     DSALNPTIKKACDAGIVVISFDQVVTEPCAFAVASDWDRIPSVMAEWMATQLGGKGNI
                     ILDRGLAGAPISAQLQQGYEKVLAKYPDIKVVGYYNGNYALGPEQSGVAALLAANPQI
                     DGIMTQGYGSGAIQALKDAGRPIVPVVGFSYNVAAVTCAQTQGAKCILGSNPAYLSSE
                     AIKLAVDILDTGKKPAERSVSVKGDFVTTDPFESKLYPGTKMIKIAVGENAFPDQAPG
                     LTLPITPDWVEITAAEAAGSK"
     gene            complement(544109..545173)
                     /locus_tag="MESOP_RS02485"
                     /old_locus_tag="Mesop_0502"
     CDS             complement(544109..545173)
                     /locus_tag="MESOP_RS02485"
                     /old_locus_tag="Mesop_0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_013891741.1"
                     /db_xref="GI:503657665"
                     /translation="MKAGVFFAGLAVIAATLLSVDTVPANAQDKKPYTIYLSNNFVGN
                     DWRQQMLRSADIAVKKPPLAGRVDLKVEVVETTVQAQINSLNNIIRNKPDAIVIDAGS
                     GEALNPTIEKACKAGIVVIAFDQIVSAPCAYTMESDWGRAPRVEAEWLVKKLGGKGKI
                     LVDRGLAGAPISAQLQGGFEEVIKKSPGIEVVGYFNGDYALGPEQAGVASLLAAHPQV
                     DAIFVQGYGAGAIKALQDAGRPIVPITGSPFNLTTTTCAQTKGAQCILAPNPAYLSAE
                     ALKLAVEILDGKKPAQKKILLRNAFLTTDPVPSELYPDAAMQKIEVGTNAFPDMAPGL
                     FLPASPDWVEITPAEAAGSK"
     gene            complement(545487..546251)
                     /locus_tag="MESOP_RS02490"
                     /old_locus_tag="Mesop_0503"
     CDS             complement(545487..546251)
                     /locus_tag="MESOP_RS02490"
                     /old_locus_tag="Mesop_0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013891742.1"
                     /db_xref="GI:503657666"
                     /translation="MDHPTIDSLPRRTLGRANGPLYRQLADILREPIGNGTFPVGGEL
                     PKEATIAEHFGVSLITVRQALRDLEADGLIRKRSAKPAVVAARSPSVNLSWKFKNFAD
                     MAAFTKDAELTVKSYRKEVSPVLQRHFGMAKDEAGYCLRSVLSIGEQRKAQITTYFPP
                     DIGARMKREDFSDVLIFRSVQKHLGLRLDVAHVTVRAEIADEAVAGDLGIALGSPVLT
                     VEMLYQSADQRSIEFSVARHPADIFSITYDAPNDLS"
     gene            complement(546390..547118)
                     /locus_tag="MESOP_RS02495"
                     /old_locus_tag="Mesop_0504"
     CDS             complement(546390..547118)
                     /locus_tag="MESOP_RS02495"
                     /old_locus_tag="Mesop_0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="E3-binding domain-containing protein"
                     /protein_id="WP_013891743.1"
                     /db_xref="GI:503657667"
                     /translation="MNMAATQAPRLAVSPYARRLARERALPLETLRGSGPGGRILAAD
                     VIGFVPLVVPVNFPDVVAPAAAPSIGASRIAAFATSIALEGLRDLLAALANSGTVFDI
                     DDLLLRAAGRAFAEAPEIVKGADVAVALELTSRQAVFAASPEMSLTSLRALRLAALAD
                     NHDDADKPAMLSLRLLPASDIRPVMMPLLPGRAMRLTVSLNSAGGQAECLLTADANNV
                     DEVIASAWLSALKSAIENPLRLFV"
     gene            complement(547115..548125)
                     /locus_tag="MESOP_RS02500"
                     /old_locus_tag="Mesop_0505"
     CDS             complement(547115..548125)
                     /locus_tag="MESOP_RS02500"
                     /old_locus_tag="Mesop_0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding protein"
                     /protein_id="WP_013891744.1"
                     /db_xref="GI:503657668"
                     /translation="MKILCANWQAADEAELERQHYPDIEFILARSTNDKAAELDPAVC
                     EAVDAVINYSPTHNVAAAPTSFPKARIAVRSGVGFDNIDTAGWGARRIPACNVPDYGT
                     TEVADHAIGLMLALTRGTSAYGAELSGHGAIGWHFSRAPLVRRHKSATFGIVGLGRIG
                     LATARRAAAFDMKVVFYDPHLLSGVDLSTGYERVHSLGELMARADVVSVHAPLSEDTR
                     KLLGAAAFAAARPGLVLVNTARGPIVDLDALESAMRNGTIAGAGLDVLPNEPGDLDHP
                     LLAAWRRREPWIANRLIVTPHAAFYSPASMRDLRLKSIEVVYAYLAEGRLTNCVNSEH
                     LK"
     gene            complement(548157..550553)
                     /locus_tag="MESOP_RS02505"
     CDS             complement(548157..550553)
                     /locus_tag="MESOP_RS02505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase E1 component"
                     /protein_id="WP_013891745.1"
                     /db_xref="GI:503657669"
                     /translation="MAISAARARDDFKSAPNLPDKQVLLDLFERMVLLRRFESIAQIA
                     CRKGETPGFLHLYIGEEATGVGVCAHLRPTDWVTSTHRGHGHALAKGANPGRVMAELF
                     GKADGICGGRGGTMHLYDRSVGLFGTNGIVAAGIGHAVGIGMSARQQGRDDIGVAFFG
                     DGAANHGGFHEALNFAAVQRAPAVFICENNLYATATPLKSITLNPEIATKAASYGMPG
                     VAVDGNDVFAVWLAMKEATERARSGKGPTLIEAKTYRTVGHHEGDPVIGTYRTQEELD
                     AWIKRDPIDMFRKKLVEDYGIADAEALAAIEARIEKVVDEALAFARNSPEPDPASMRL
                     HVFADPINPPAALATRALGETRTQGWLEAVRDGIAEEMRDNPAILYFGEGTGERGGSF
                     AHTKNLWQEFGAERMVDTPISEQGFTAAAVGASATGARTVSDLMFADFAFETAGQIFL
                     QAAKLRYMTSGRMSAPMVVRVGAGALRSSGPHHSGIYHPVFAHMPGLIVCVPSTPADA
                     KGLMKTALRAGDPVIMLEPKALFASKGEVPTGEHYVPFGVARIARAGTDITIVAAGQM
                     VQRALEAAEALAAEGIEAEVIDPRTIMPLDIDTIVASVSKTHRLLIVDEAWAMCGLGG
                     EIAQAINELAFDELDAPPGRLHAAPTSHPFAPVLERAMLVDAARIVQGVRDVIAGKPP
                     VPDHWYTVGLKSAAPANPVPAAVKLQPAAPAVAAPAAGDDEPITMPFGDLTVSEGTVI
                     KWLKAVGDAVNEGELIAEIETDKAVVEIEAPIGGTLSAIDQPVGAVVPMGGRIGGIKK
                     "
     gene            complement(550685..551905)
                     /locus_tag="MESOP_RS02510"
                     /old_locus_tag="Mesop_0507"
     CDS             complement(550685..551905)
                     /locus_tag="MESOP_RS02510"
                     /old_locus_tag="Mesop_0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydratase"
                     /protein_id="WP_013891746.1"
                     /db_xref="GI:503657670"
                     /translation="MKIVALETLQLAEFPFLFWLRVHTDAGIVGTGETFWAPGPVASY
                     VHDNVAAYLLGRDPRDIELHDRTLGSVYVGARDSGAEVRGNSAVNIALWDIYGQALGE
                     PVWRLLGGRTQQSVPIYNTCAGYKHVRATKKNALFERGEDWSLKAGDSNEGPYEDLLA
                     WRYNAGDLAKSLKSEGIGAMKIWPFDIAAEASNGTRISLADLDKALEPFGKIRDAVGR
                     DMEIMVELHGLWTLPPVLRIAEALKSYDVAWLEEPVRYNELDAMAELARHTSIPIAAS
                     ERLASRQMFKQLIAKRAASVIMIDLAWCGGLSEARKIANMAEASELPVTLHDCTGPIV
                     YAASCALSATLPNVNYQEAVRAYFTGWYTEIVADIPQVKDGHVAPLEGPGLGLSLRPE
                     LFQRPDATVRITKI"
     gene            552022..552813
                     /locus_tag="MESOP_RS02515"
                     /old_locus_tag="Mesop_0508"
     CDS             552022..552813
                     /locus_tag="MESOP_RS02515"
                     /old_locus_tag="Mesop_0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="WP_013891747.1"
                     /db_xref="GI:503657671"
                     /translation="MTAENQNAAPGRALVTGAAGGLGREVAIQLARRGCVVAITDING
                     EGLAETARQIGTGAATEIMTSDFTLEGAPEAAVGKVVARWGGIDILVNNAGYGVIEPF
                     LDASYKAWTRTLALNVTALAMACKAAGRVMREQRSGRIVNITSPGSRMALPDYTAYTA
                     SKAGVDSITRAAAVALAPYGVLVNSLAPGMMDTEMQRSTEADLARANGRNDLQAFLDE
                     RTRRIPLGRRAEISEVAEAVVWLCLDSPKYMTAERLNMSGGLDKD"
     gene            552818..553666
                     /locus_tag="MESOP_RS02520"
                     /old_locus_tag="Mesop_0509"
     CDS             552818..553666
                     /locus_tag="MESOP_RS02520"
                     /old_locus_tag="Mesop_0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_013891748.1"
                     /db_xref="GI:503657672"
                     /translation="MLRNSPPGGADIGALERKAKLLRRHMLTMARGQGQGYIGQGLGI
                     ADALAALYFHELRYDPHNLDWPDRDRFLLSTGHYSIALWAAFAEAGILPVEELATYGA
                     DNSRLEMSTLDTTPGVEMIGGSLGHGLGQGVGQALGLRVDRSDARVFVELSDGEMQEG
                     STWEAAMSASHFKLDGLVALIDCNGIQADGPVVLDMEPVADKWRAFGWQTLEIDGNDM
                     RAIIGALADARQRNSKPKAIVLRTLPGKGVPRIETSEKSHFFRVDVAQWDGIIAEFDK
                     STGAAQ"
     gene            553663..554652
                     /locus_tag="MESOP_RS02525"
                     /old_locus_tag="Mesop_0510"
     CDS             553663..554652
                     /locus_tag="MESOP_RS02525"
                     /old_locus_tag="Mesop_0510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_013891749.1"
                     /db_xref="GI:503657673"
                     /translation="MSGAAMEAGRTLAMGQDEAAGGGRQSVEAPFGRALARLGQSRPE
                     IVGLTADLGKYTDILPFRDAFPDRFFNVGMAEQNLVAVAAGLARTGKVPFATTYGVFA
                     TRRAYDFVAIALAHSNLDVKIVAGLPGLTTGYGGTHQAIEDLALMRMIPGLTIIDPCD
                     ATEIESATAAIAEHKGPVYMRLLRGSVPVVFEPGYRFEIGKARRLREGSDVGIISTGF
                     MTERALDAADALQGQGISTGVLHVPTIKPFDAGAVAEFAGSVDRVVTAENHVVVGGLA
                     SLVVETLFDAGIAKRVTRIGLPDRYIECGAVPTLQAKYGLTTEAVLATITALP"
     gene            554721..555890
                     /locus_tag="MESOP_RS02530"
                     /old_locus_tag="Mesop_0511"
     CDS             554721..555890
                     /locus_tag="MESOP_RS02530"
                     /old_locus_tag="Mesop_0511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase"
                     /protein_id="WP_013891750.1"
                     /db_xref="GI:503657674"
                     /translation="MKITEIETFAVGAGWKNWLFVKVHTDKGVHGIGEGTLNGFIKTT
                     EAGVHELKHLAIGQDPRRINVLAKRMLDSVSLDGGHIHRTVIAAIEVACWDILGKSLG
                     VPIHQLLGGQVRDSVLGYANGWYRTERSPEAFLEAAKAVLAKGFKAFKLDPFGTAQGF
                     ISREELELSYAICRTLRDRLPKDTLILIDVHARFTEIAALQAAQRFADLDIYWWEEPT
                     SRDRQETVHEVAHRSPIPVATGEMYDTVGQFYTLAAGGGVNIFQPEPMSLGGIGPSMQ
                     VANLALAHGSHIAPHQSGGPVATAVCLQLAAAVPNFLIQEHFDAFNDPWTRDLVTWHP
                     TVNPDNGHLSLPDAPGLGIDLNIEAIKDHPYDPDAYLNVHAEGWEKRLGRREEKP"
     gene            complement(555891..556922)
                     /locus_tag="MESOP_RS02535"
                     /old_locus_tag="Mesop_0512"
     CDS             complement(555891..556922)
                     /locus_tag="MESOP_RS02535"
                     /old_locus_tag="Mesop_0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_013891751.1"
                     /db_xref="GI:503657675"
                     /translation="MTDRPPAGEKKPQRLGVREIAKRVGVAPMTVSRALSNPDMVSPE
                     TRAKVLEAIEEAGFVPNRLASSMRGNGRMIGTVVPPLINSGIAEQVQGMSDECHESGY
                     SMLLVQGEFTQEAEEKSIRNLLGWRPVGMILQSFVQSEAARALLKTSGAPVVEISEIK
                     GRKPIDMVVGVSNFETAYAMTMHLAAKGYKRIGFVSTPIHGNDRLQQRRTGYHAALTE
                     LGFKNHADMEVEVPITAQGGAEALITLTSRHRDIDAIFFSSDTLAVGAVQECHRRRWA
                     VPGKIAIAGYGDMDLAAQLYPPLTTVKVNRYEMGRRAVRQLLARLGGDTKVPTITSLG
                     FEIVDRESA"
     gene            557170..558180
                     /locus_tag="MESOP_RS02540"
                     /old_locus_tag="Mesop_0513"
     CDS             557170..558180
                     /locus_tag="MESOP_RS02540"
                     /old_locus_tag="Mesop_0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891752.1"
                     /db_xref="GI:503657676"
                     /translation="MNSAADVSSPPRDAQSFRRRLIGFIAVGEVGVLAAMALLIAFFW
                     LLEPAFLSERNIRAILNVVSFVGIIAIGQTILLVAGEFDLSVGSVAGLSAVVAAKLMT
                     AAALPVTTGILGGIAVGALIGLLNGLIVVRLGIPAFIQTLGMLFIGQGLIQVVTGGYP
                     VYPLPEAINTIGGTDLAFGLGWSFAFFIIAAIAADFVLRRTVLGRNMYATGGNKEVAH
                     LVGINTNAYKIGAFITVGALSAIAGMFVMADLGSGGTSIGSGWELTVIAGVVVGGVSL
                     FGGAGTVAGGVVGILMLKVVQSGLVVIGVNSNWQQIAVGVIMVMAVGLDIVRRRYFIA
                     GA"
     gene            558246..559220
                     /locus_tag="MESOP_RS02545"
                     /old_locus_tag="Mesop_0514"
     CDS             558246..559220
                     /locus_tag="MESOP_RS02545"
                     /old_locus_tag="Mesop_0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_013891753.1"
                     /db_xref="GI:503657677"
                     /translation="MKIDLKKGLVGAALVAAAVATSLGSAGLARAADVHLLWVQAMKD
                     HPVHRLMQAGFLNKCKELGYTCEVVGDPSATNWDIPATLPLAEAALARTKYDAIGVYG
                     PDPAIYSYISKLAKEGFPIVTWHVLPPEGTVNGLKAATGENIAEAGTNAAIAIGDKLG
                     GKGTVALTQGASNDTENAMSDAFRKTIAAKYPGIKVLDTQMEGFEPSAAEAKAVAILQ
                     GNPDVTAAFGTTGNSIQTWSGAARKAGRDVVIIGMDYIRQNLDLVKSGAAYGIVAQPL
                     YEESAKVAELLGDLAQGKTVPYSNPLPAKVITSGDLEPYYKMLDSAGQ"
     gene            559274..560836
                     /locus_tag="MESOP_RS02550"
                     /old_locus_tag="Mesop_0515"
     CDS             559274..560836
                     /locus_tag="MESOP_RS02550"
                     /old_locus_tag="Mesop_0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_013891754.1"
                     /db_xref="GI:503657678"
                     /translation="MSDASQEPLFSATAIAKNFGGVQALRGVDFDVVPGEIHALLGQN
                     GAGKSTLVKILNGVHPAGSYSGIIKLDGQAVNFASPADARSNGVGYVPQEIEVLEQLS
                     VAENVFAGRTGLGDGVLVHQRKLEKRAGEIFADLGIAINPTAYVASLTSAQRHLVMIA
                     RAIVLKPRVLMLDEPTASLSGTEVDALFSVLRPLKAQGVAMIYITHRLPEVLAICDRA
                     TVLRDGQVAVRIAREDFDAETFIFSMSGQRLQRLFPEHAAPMGAPTALEVRSLTVAGH
                     SGAVHGARDIALSVAAGEIVGLAGLLGSGRSEILHGIYGRVPAEGEIRVAGQAVSIRS
                     PSDARAAGIALLTEDRKRDGLLFNLPVGANITIGNLAPLSRHGMLRGGLERGSILAAM
                     RALNVKASSPQAAVTHLSGGNQQKLLFARVLMRAPKVLLLDEPTKGVDAATRHEIYKL
                     VVELAEKGVALIIVASELEELIGLCDRCLVVADGSIVDEFSRGEGGEDRVLRAVTAAQ
                     AERHAMAARGSP"
     gene            560833..561594
                     /locus_tag="MESOP_RS02555"
                     /old_locus_tag="Mesop_0516"
     CDS             560833..561594
                     /locus_tag="MESOP_RS02555"
                     /old_locus_tag="Mesop_0516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="WP_013891755.1"
                     /db_xref="GI:503657679"
                     /translation="MMFAGKRVFVTGAATGIGRATAEYLVAEGAKVFGAGLDGEEGKA
                     LAARHAESQLSFRESDLTREDDVQAAVAAAKERFGGLDAVVNCAGIYPTGKRLEELSD
                     EDWDRTIAVNLTAIFRVCRATLPLLRAAGGGSIVNIASVHADATVPGVPAYAATKTAV
                     VGLSRQMALDYAVDRIRVNAVLVGSVATRMTLDGLEAAGGAEALGLSFEPNRIARIAN
                     PSEIATAIGFLISDAASFVTGSAMQVDGGLLARLL"
     gene            complement(561591..562490)
                     /locus_tag="MESOP_RS02560"
                     /old_locus_tag="Mesop_0517"
     CDS             complement(561591..562490)
                     /locus_tag="MESOP_RS02560"
                     /old_locus_tag="Mesop_0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldose 1-epimerase"
                     /protein_id="WP_013891756.1"
                     /db_xref="GI:503657680"
                     /translation="MGAISEPLTLKAGALEVGLVPHIGGSVSALRWRGIDLMRRLSNA
                     DLDAGNVLGVAMFPMTPYANRIAGNTFEFGGKRWQVLPNNPPEKFNVHGSGWQHAWTV
                     TEAGTADATLSLDIAAGADPYSYRATQAFSVSEEGLGVTMTMTNTGPVPLPFGFGLHP
                     WFDRDPDVTLQFEGKRFYLEEPDGISGDPVTLPPELDFAEARPLPGGWRNNDYGGWGG
                     EATIRFPGRGAGLCIKADPVFKHLMLYADPAKPYFCVEPQTNASGAFNRGRWDDPDEG
                     VIVLAPGESAAGTVRFAPFALEP"
     gene            complement(562474..563049)
                     /locus_tag="MESOP_RS02565"
                     /old_locus_tag="Mesop_0518"
     CDS             complement(562474..563049)
                     /locus_tag="MESOP_RS02565"
                     /old_locus_tag="Mesop_0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pteridine reductase"
                     /protein_id="WP_013891757.1"
                     /db_xref="GI:503657681"
                     /translation="MDIELAGATVALDGETNPIVDAVLAALRACGGTIVEATQPADIL
                     LISNPLRPGTTAQDPRFLHADARKAAVAMAERGGRIVFLVSAVAGMPMRRHPRFSMEN
                     ASILAGMRTLAMEFGPKVLVNAVGFGAIEDATIISGDKAMLSHTPVGRAGSIEEAVAA
                     VLFFCDPMNTYTTGQMLGVDGGWMAGYGRNF"
     gene            complement(563058..563837)
                     /locus_tag="MESOP_RS02570"
                     /old_locus_tag="Mesop_0519"
     CDS             complement(563058..563837)
                     /locus_tag="MESOP_RS02570"
                     /old_locus_tag="Mesop_0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="WP_013891758.1"
                     /db_xref="GI:503657682"
                     /translation="MRCDLRGKVALVTGAAGAIGSSIARRLSDNGAAVVVADIDGEGA
                     SQVAAGLSNAMACTTDIRDIASVDGAVAAILERHGRLDILVNNAGVNTLAHRVTLDEF
                     PSQEWDRITGIDLDGLYIMSRAALAPMLATGRGGRIVNIASVVGLAAMRLQSPFVAAK
                     AAIIHLTRSMAIELGAKGILTNAVAPGSVMTALTAKLFYGDDGKFAGRTQEFLAHVPL
                     GRPAEPREIAEAVLFLASPAASYVNGQVLAVDGGWTAGYMM"
     gene            complement(563922..564917)
                     /locus_tag="MESOP_RS02575"
                     /old_locus_tag="Mesop_0520"
     CDS             complement(563922..564917)
                     /locus_tag="MESOP_RS02575"
                     /old_locus_tag="Mesop_0520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_013891759.1"
                     /db_xref="GI:503657683"
                     /translation="MSKKDLGLLILILVVGAIVAIINPRFLLPINLANTSNLIGLFGI
                     LSIGQAFVIITGGIELSVGSVVALLGTLFIDLIAVRDLDWPLAFVLIIALGAIIGLVH
                     GWLITRLKLQPFVVTLCGLLIYRGVARFYTADGTAGFAFGQNFPELEFLTAGRSWGVP
                     NSFIALIVIAIVMWVVLHRSVFGRYLYAIGKNEEAAKYSGIRTGRIVMAAYVICGVLT
                     ALSAIYFAMYTRSISPASHGQFYELYAIAAAVLGGFSLRGGEGSLIGVVLGTVLLQEL
                     QNLVNLLGIPSSLNFAVMGGVILIGVLVDQQWGVFRARRLMVEAARKNVAGAPAE"
     gene            complement(564972..566510)
                     /locus_tag="MESOP_RS02580"
                     /old_locus_tag="Mesop_0521"
     CDS             complement(564972..566510)
                     /locus_tag="MESOP_RS02580"
                     /old_locus_tag="Mesop_0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891760.1"
                     /note="with RbsBCD acts to import ribose into the cell;
                     RbsA contains 2 ATP-binding domain; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose transporter ATP-binding protein"
                     /protein_id="WP_013891760.1"
                     /db_xref="GI:503657684"
                     /translation="MNYSDTSIAASTPFLSLENVRKTYPGVVALDGFSMEVRPGEVIG
                     LVGENGAGKSTLMKILGGVTTPDTGTITVDGTAHNSLTVEGSLGSGIAFVHQELNLFD
                     NLDVAANIFFGREPLRAGPLRLVDRARLRAMVAPLLKRVGANFSADMQVADLSLAQQQ
                     MVEIAKALSIKARLVILDEPTSSLPIAETDKLLDVIKALKADGISVIFISHRLHEIER
                     VADRVVVLRDGMLAGTLQKRDINHDQMVKLMIGRMLKEREKASEAARAPGAVALAAKA
                     VRTPTYPGRPVDLDVRRGEILGLAGLVGSGRTELARVFFGIEGSLGGTLELDGKPLVL
                     GSAADAVAHGIFLVPEDRKLTGILLDLSIAQNISLPNLPAHAKRSLVSASAETATAEK
                     QKKDLGIKAPSVQTRTGTLSGGNQQKVVLGKWLAMNPKVMILDEPTRGIDIGAKAEIY
                     GLMRALADAGVAVLMISSDMEEVIGVSDRIAVMHEGQISGILDKDQFSQENVLLLAVG
                     KQPK"
     gene            complement(566625..567587)
                     /locus_tag="MESOP_RS02585"
                     /old_locus_tag="Mesop_0522"
     CDS             complement(566625..567587)
                     /locus_tag="MESOP_RS02585"
                     /old_locus_tag="Mesop_0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013891761.1"
                     /db_xref="GI:503657685"
                     /translation="MKSLIRNASVATAALLLGLTATAIARADDKPTLAFVVNGASDFW
                     KAAEAGVKKAQGELPDYTLELKYPEQSSVAIQQRLMDDLVTAGVKGIMVSAVDPKTST
                     DGLNKIASETALFTTDSDAPQTKRVAYIGSSNVDAGKQAAEIAKKAMPNGGKCLGFVG
                     LLGADNAKERIQGMKDGLAGTKIELVDVRGDDIDQARAKKNVEDALVASPDVTCMVGF
                     YSYNTPRIYEALRDAGKLGSITVVGFDDDPITLGGVKEGTIAATVVQQPFEWAYQGMK
                     LMAAYLKGDKSGIPEGNLIIIPTKIIGKDDVDAYAANLKAMSGN"
     gene            568218..569327
                     /locus_tag="MESOP_RS02590"
                     /old_locus_tag="Mesop_0523"
     CDS             568218..569327
                     /locus_tag="MESOP_RS02590"
                     /old_locus_tag="Mesop_0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_049802435.1"
                     /db_xref="GI:908670637"
                     /translation="METARRRKAAAKPKGRVTMTDIARAAGCSQATVSFVLNNSPGIK
                     LSQQTRERVIEAARALGYSAPAFSALKTPIAAFEGRVFEGPVFDGLDGVIGFAVDQLA
                     TSPEAVVAIEGARQASWNAGNVLLVAQTMGDAVMEPRAIQALTRRGISALIYMTIFTR
                     EITAPDYLYGLDIPVILLNCYTADYAFPAVVPSEIAGGQSSTRHLISHGHRRIATITG
                     EPWMQAAQDRLKGYRRALATADIPFDPELVVEGDWSASAGYAATVKLLALKDRPTAIF
                     CQNDRTAIGCYEALKEAGLHIPQDISVVGYDDEEIARHLFPPLTTSILPHMAMGQWAI
                     EQLEAPPAPGRGRYPITKLECPLVERDSVRAVKGG"
     gene            complement(569368..569598)
                     /locus_tag="MESOP_RS02595"
                     /old_locus_tag="Mesop_0524"
     CDS             complement(569368..569598)
                     /locus_tag="MESOP_RS02595"
                     /old_locus_tag="Mesop_0524"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891763.1"
                     /db_xref="GI:503657687"
                     /translation="MHSFEMIDLLCVVEACKRDPAVGNFVSMAEGVEELRVLTGDFVS
                     SDHAVANALSKVALARGCSVLFDEQAGAEIPF"
     gene            569876..570577
                     /locus_tag="MESOP_RS02600"
                     /old_locus_tag="Mesop_0525"
     CDS             569876..570577
                     /locus_tag="MESOP_RS02600"
                     /old_locus_tag="Mesop_0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013891764.1"
                     /db_xref="GI:503657688"
                     /translation="MALNGPRPTWLTFDCYGTLIQWDEGLMAAMETILSRKGRKIGAE
                     EFIPVYDRHEHQLEHTKPHLSFADVTAKALQLAMRDFSLDADAGDAELLTSSIGRMPP
                     FPEVVATLRRLKQAGFKLAIISNTDDAIIAGNVAQLGGAIDRVITAQQAQAYKPSRQI
                     FEHAWRALGVTREDLVHICASPHLDLTAARDLGFRAVWVDRGTGRRPPADYEPDAIAH
                     GLDDVPGFFEKAGWV"
     gene            complement(570606..571136)
                     /locus_tag="MESOP_RS02605"
                     /old_locus_tag="Mesop_0526"
     CDS             complement(570606..571136)
                     /locus_tag="MESOP_RS02605"
                     /old_locus_tag="Mesop_0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891765.1"
                     /db_xref="GI:503657689"
                     /translation="MPLTVHKFQVVEDQEWIFPADDDDYETFFALDGRVIQDWIAPVM
                     KLDTAGRTYSDFPWLGEHAPILKKPAVEALAPVLVEHGQLLPIKGEAVWLFNATTVLD
                     ALDHERSRIAYFDNGDILDIERHVFRTERIGAAELFRLPMRASAVYVTGSFVEKVRNA
                     GLRGVEFAHVWTSAEK"
     gene            complement(571164..572135)
                     /locus_tag="MESOP_RS02610"
                     /old_locus_tag="Mesop_0527"
     CDS             complement(571164..572135)
                     /locus_tag="MESOP_RS02610"
                     /old_locus_tag="Mesop_0527"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013891766.1"
                     /db_xref="GI:503657690"
                     /translation="MHHVTFAVYPGFELLDTSGPISVFTSANRSLGLREKPPFYAIDL
                     VSAAGGSVASSSGIAVETRSLEERARKAVDTLLVAGAEREHLLPVLAHSAWAASLRKL
                     AGKAQRLGSVCSGAIILARLGLLDGHRVATHWDACAPLGAAFPSITVDPDSLYVVDGR
                     LWTSAGVTTGIDMALAMVAHDLSAEIAGEVAKRLVLYARRPGYQSQFSPLLQAQVKAD
                     SPFAELIAWILANLGASLEVPVLADRAGLSERTFHRKFVAATGETPARFVETARLDAA
                     RMLLCRGLSLKSVAAEIGLSPATRFSEAFERRFGVSPRLFRKMHAEF"
     gene            572331..573602
                     /locus_tag="MESOP_RS02615"
                     /old_locus_tag="Mesop_0529"
     CDS             572331..573602
                     /locus_tag="MESOP_RS02615"
                     /old_locus_tag="Mesop_0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Salicylate 1-monooxygenase"
                     /protein_id="WP_013891768.1"
                     /db_xref="GI:503657692"
                     /translation="MKALIAGAGIGGLTTALFLHRAGIEVEIFERAEAVRELGVGINM
                     LPHAVGLLAELGLMAALDAAAIRTRELIYANRFGQIVWRELRGIEAGHAVPQFSIHRG
                     TLLGLIHRAVIDRLGPGAIRTNCAVTGFEQEGRRATVYLSEAGKSLQASGDLLVGADG
                     IHSTVRANLYPDEGPPIWNGVMLWRGATWWPTWRDGRTIAIAGGNHAKFVFYPIGKDP
                     DNPGMRLTNWAVRARSRQATSRTLTLGDWSRPGKLDEVLPFVRDRFHLDYVDPAEIIR
                     ATGAFHEYPNCDREPLPRWSFGRVALLGDAAHPMYPVGSNGASQAILDASSLAEHLRT
                     QGSVEAALAAYDAERRPNTAQIVHSNRKGGPEGVIDLVESRAPDGFDDIETVASYEER
                     QRVVRGYASLAGFAADNPQGTVKQAKGRLRP"
     gene            574402..574854
                     /locus_tag="MESOP_RS02620"
     CDS             574402..574854
                     /locus_tag="MESOP_RS02620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013514564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049802334.1"
                     /db_xref="GI:908670536"
                     /translation="MPFADWDYYYTTKSLEWRADKGIAMEPVAVSVPAGFVTDLASIP
                     PEFWSGLPPAARYSYPAIVHDYLYWFQPCKREEADGVLKAAMADMKVSSATAFIIYQA
                     VRLGGGRAWDANATMRDAGERRVLCKYPSDVATTWNQWKQQPNVFTPE"
     gene            574890..576563
                     /locus_tag="MESOP_RS02625"
                     /old_locus_tag="Mesop_0531"
     CDS             574890..576563
                     /locus_tag="MESOP_RS02625"
                     /old_locus_tag="Mesop_0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019966248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C14"
                     /protein_id="WP_013891770.1"
                     /db_xref="GI:503657694"
                     /translation="MIAMSQALVIGNGAYAPNLKLACPPNDATEVGRTLGELGFQVTL
                     GINLSFETTLAQIEKFVALVNEPTTTVSLLYYSGHGLQIDDQNYMVPIDFDQFAEQKI
                     AQLVSVQSIVEKMTSKTAVRIVLLDACRNNTDARVFVGGKGIKVGKEILIDNQPIPAT
                     GLASMQAATNTFIAFAAAPGQVAYDGSPGDLLSPFSASFVRYLDAVDLPISNLTSRIR
                     QDVLNHTDGNQRTWDQSSLMAPFYFNPGSLLLFTGNLMALVGLFLSLIPYSLILAWPN
                     RTWPWLMIASALPMISLGILLFGAQTVYSRLRGRFEGDSNAPHTIVEHLRTAAQKGLL
                     GGYLGSSAASLLLSLLYYRGWDWPTEPFGALLLEITIATALTACLLGALGLFFARASI
                     GWSGFYVTDDRSPRRMVIGATCGGALAGVIAAPLITMYFGKIHDRPEMTPGLLLPGSI
                     LGASIIIFSIVNFDFERLSARRVRTSAGAAVAALALGGVAACIVFGPLYMFGVVDAVK
                     LYLEINANNLLGLASGGAVYGLPVGVVLGVVIGSAIVLTEKWSRKPVLE"
     gene            complement(576857..576933)
                     /locus_tag="MESOP_RS02630"
                     /old_locus_tag="Mesop_R0004"
     tRNA            complement(576857..576933)
                     /locus_tag="MESOP_RS02630"
                     /old_locus_tag="Mesop_R0004"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(576897..576899),aa:Arg,seq:ccg)
     gene            complement(577184..578110)
                     /locus_tag="MESOP_RS02635"
                     /old_locus_tag="Mesop_0532"
     CDS             complement(577184..578110)
                     /locus_tag="MESOP_RS02635"
                     /old_locus_tag="Mesop_0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013891771.1"
                     /db_xref="GI:503657695"
                     /translation="MSTVPKASEQKAADNENDSGGEYFEAPTIEEDLHGVSDEHFDTP
                     EVPDSEPSGTGASRFKPKKKPSAISGRKFRKRDLVRIDTLRPSLADRIHADHPDLPKG
                     ARISREELGRYRMRYMEELLQQEHGEFSELDRQVVESIARQDTISENSEEEFEEHRSF
                     ADRVSDNMAAFGGSWWFLISFGSVLLIWIGINLIAGMSSAFDPYPFILLNLLLSCIAA
                     IQAPIIMMSQRRTEAKDRLRSFNDYRVNLKAELEVRHLHEKLDYLISRQWTRLAEMQQ
                     MQLDAMHELTGAKKAKRAVRGVRRTVKGEGEA"
     gene            complement(578285..579178)
                     /locus_tag="MESOP_RS02640"
                     /old_locus_tag="Mesop_0533"
     CDS             complement(578285..579178)
                     /locus_tag="MESOP_RS02640"
                     /old_locus_tag="Mesop_0533"
                     /EC_number="3.4.16.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="WP_013891772.1"
                     /db_xref="GI:503657696"
                     /translation="MSHLHPLSFVHKVLAAFALLVLLAGCSTTTPPDSVLAVPAPPQK
                     YAAIVVDAQTGKQLFEVNSTAQRYPASLTKMMTLYLLFEAMDSGRVTKETQIPVSDHA
                     ASQPPTKMRFRRGETIDVDSAIRAIVVKSANDVAVAVGEYLGGSEDQFAAMMTSKARQ
                     LGMTSTTFRNASGLPDDSQMTTARDMALLGMALHSRFPQHFHYFSESDFMFRGRLVRG
                     HNDMLGRVRGVDGIKTGYIRASGFNIVTSYNADGRRLIVVVMGADSARQRNDHVEALI
                     QRSLSPMVADTKTRLMFAEQQ"
     gene            579466..581280
                     /locus_tag="MESOP_RS02645"
                     /old_locus_tag="Mesop_0534"
     CDS             579466..581280
                     /locus_tag="MESOP_RS02645"
                     /old_locus_tag="Mesop_0534"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_013891773.1"
                     /db_xref="GI:503657697"
                     /translation="MTNIGAGGAAPSLIRASLSRTGKWAGSIAFIGGAVSDILNPLAP
                     FAAYIALVASIAAVIIAIAIVLRLVLAAKALPALVFATSAAAVAGGVYAVQKETSSQN
                     GIIASLVPAVARLQQSIGIVSEKVAKIEQTVTQTQKTVEEVKKSTDTVAQKADQIASA
                     QQQQTQQGAETQKTVEAVKQTTDTLAAGQQQQQAQAEKLQATTEQIAVSIDTIAKGFA
                     QLAAQGGAIAEPKRPDEFYHNARVYELSGDMLNARRAYLAFAGFDVDAIDPYTRFATL
                     LRVQDGKAGAREVFGQIAEKAKSPSIKLVHLLQFDDAQRVDKLNAFIAANPGYAPAYY
                     LLAQEFSEDRLGSQTLADKRGEAQALTKFVAYEKDGGLLKYFVDQTQLADWLDRSRSR
                     LTALGDVLDPARFAPSLTPMRSNQGWSMTISLPEPATAISWRIGDSGAFTDTGVLALN
                     DQRTGKPMPNPSFELPDSTAATTIAIKYLDIRGRETGPFDIRFDPDAALQQGDKQILD
                     QFWTSWIAFDAGGNHGLVYFTQMLSYRCAIKEVRYSLNGAALDKQIKMPPCDKKDPYA
                     IPYDYQPYFKVADSVKSMSVQVTYTDSTKSPVREYKRQ"
     gene            581413..582507
                     /locus_tag="MESOP_RS02650"
                     /old_locus_tag="Mesop_0535"
     CDS             581413..582507
                     /locus_tag="MESOP_RS02650"
                     /old_locus_tag="Mesop_0535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891774.1"
                     /db_xref="GI:503657698"
                     /translation="MDISTIKARGISVSLDLTVGHIADMTVDGDGRQLKPLHRAPWVD
                     AGETLPMDLPQGTVRLSGDFLCAPFSRSDVEDAPLHGWPANSAWDITESSATDGGWRA
                     VFRLRHKVMGASVDKILTLIDGHPFLYQEHVFSGGHGAISVAHHPMTAMKGGGRLAFS
                     PKRFAATPADPLEPDSARGRFMLAYPARSADLGHFPAAAGGTRDLTDYRMDDRREDFV
                     TLIEADHGGPGWTALARKAEDDLVLVLKNPAELPVTMLWLSNGGRDYAPWSGRHLGVL
                     GIEDGRAAVGHAASIGDNWLKREGVATAFALGDRFSFRHVIGALPLPGGEPPQEVVTA
                     DGRMRLSAGGSTWDVPFDSDFLRIGQPAAA"
     gene            582642..583253
                     /locus_tag="MESOP_RS02655"
                     /old_locus_tag="Mesop_0536"
     CDS             582642..583253
                     /locus_tag="MESOP_RS02655"
                     /old_locus_tag="Mesop_0536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside triphosphate hydrolase"
                     /protein_id="WP_013891775.1"
                     /db_xref="GI:503657699"
                     /translation="MSEIAHLAATIFKRAGKAKRFIVAIAGPPGAGKSTLSASLHDLL
                     PEGAVEVVPMDGFHYDDIVLNARGLRARKGAPETFDFAGFEALLKRIRAGEAEIAIPV
                     FDRGLELSRAAAAIVGTETKFILVEGNYLLLDEEPWSRLAPLFDYSIFVDVPRNELER
                     RLMERWHEHGRSDADARAWIASNDMPNIERVLARRRAADLVIG"
     gene            583346..583654
                     /locus_tag="MESOP_RS02660"
                     /old_locus_tag="Mesop_0537"
     CDS             583346..583654
                     /locus_tag="MESOP_RS02660"
                     /old_locus_tag="Mesop_0537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoglutarate decarboxylase"
                     /protein_id="WP_013891776.1"
                     /db_xref="GI:503657700"
                     /translation="MATKARKPAKTKPAKATQAKAGAGPAVAERSKDAKGAFGKAAPR
                     KVVPAAKTASPRKAAPNKAGAVRTAANVAAGAVVATARGAASLAASVIGRGSSKAKAK
                     "
     gene            complement(583679..584383)
                     /locus_tag="MESOP_RS02665"
                     /old_locus_tag="Mesop_0538"
     CDS             complement(583679..584383)
                     /locus_tag="MESOP_RS02665"
                     /old_locus_tag="Mesop_0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_013891777.1"
                     /db_xref="GI:503657701"
                     /translation="MADLSAFPITARWPAKHPDQIQLYSATTPNGVKISIALEEIGLP
                     YEPHWINIGQNESWTPEFLSLNPNGKIPAIIDPNGPDGKPIGLFESGAILLYLAEKTG
                     LLMPVDAARRYETIQWVFFQMASVGPMFGQVGFFHKFAGREIADKRPLERYRDESRRL
                     LGVLDGRLKGRKWIMANDYTIADISLLGWVRNLIGFYEARDLVGFDDFGNVAAWLERG
                     LARPAVQKGLTIPAKA"
     gene            complement(584586..585794)
                     /locus_tag="MESOP_RS02670"
                     /old_locus_tag="Mesop_0539"
     CDS             complement(584586..585794)
                     /locus_tag="MESOP_RS02670"
                     /old_locus_tag="Mesop_0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006200747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ACP synthase"
                     /protein_id="WP_013891778.1"
                     /db_xref="GI:503657702"
                     /translation="MLKRVVITGLGGICGLGTNAPAIWGEMRAGRSAIGPIENHSLHD
                     LKVRTGCEVKALPDHGIERKQLVSMDRFSLLAVIAAREALQQSGLAAHADNTYRMGTI
                     VGVGVCGFETVEENYRAILVEGKNRAGIFTVPRVMPGAAAGQVSMHLGLRGPVFGVTS
                     ACSSANHAIASAVDQIRLGRADVMVAGGTDAPLVWGVLKGWEALRVLSPDTCRPFSAD
                     RQGLVLGEGAGMAVLESYEHATARGATILAEIAGTGLSADASDIVAPTIEGPEAAMRF
                     CLADAGLNPEDIDYLNAHGTGTKANDQIETTAIKRVFGEHAYKLSVSSTKSMHAHCLG
                     ASGGLEMIACVMAIREGVVPPTANFREADPDCDLDVTPNVARERKVRAAISNGFAFGG
                     TNAVLAFKAV"
     gene            complement(585799..586053)
                     /locus_tag="MESOP_RS02675"
                     /old_locus_tag="Mesop_0540"
     CDS             complement(585799..586053)
                     /locus_tag="MESOP_RS02675"
                     /old_locus_tag="Mesop_0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine-binding protein"
                     /protein_id="WP_013891779.1"
                     /db_xref="GI:503657703"
                     /translation="MADQLATEIIEKIKAHAEPGGEEITTATELTALGIHSLELTEII
                     FDLEEQYGIEIEMNTVDAWSNLKNVGDMVEAVRALIAKKA"
     gene            586256..587098
                     /locus_tag="MESOP_RS02680"
                     /old_locus_tag="Mesop_0541"
     CDS             586256..587098
                     /locus_tag="MESOP_RS02680"
                     /old_locus_tag="Mesop_0541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreD"
                     /protein_id="WP_013891780.1"
                     /db_xref="GI:503657704"
                     /translation="MDTIEYTKFSGQPAQRAAGLAQLGCASIDGRTRLRRLYQDGSAK
                     IRLPAVSAGPLEAVLINTAGGLTGGDRLGWDVDVGANASAAITTQACEKVYRAASDRA
                     EVSIKLTVGENGRIAWLPQETIVFDRAAFARTLDVELAAGTEALLVEATVFGRLAMGE
                     RAAHGNFHDRWRVRGNGSLIHAEDFRIGPDIAAILGRPAVAGGAIAVATLLLVSPRAE
                     ALLDPVREIIGDQGGASIWSVGTSGKLLARLYAEDGYQLRQRLVPLVGLLNGEAGLPK
                     LWSL"
     gene            587127..587429
                     /gene="ureA"
                     /locus_tag="MESOP_RS02685"
                     /old_locus_tag="Mesop_0542"
     CDS             587127..587429
                     /gene="ureA"
                     /locus_tag="MESOP_RS02685"
                     /old_locus_tag="Mesop_0542"
                     /EC_number="3.5.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98CY3.1"
                     /note="UreA, with UreB and UreC catalyzes the hydrolysis
                     of urea into ammonia and carbon dioxide; nickel
                     metalloenzyme; accessory proteins UreD, UreE, UreF, and
                     UreG are necessary for assembly of the metallocenter;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit gamma"
                     /protein_id="WP_013891781.1"
                     /db_xref="GI:503657705"
                     /translation="MNLTPREKDKLLIAMAAIVARKRLERGVRLNHPEAIALITDFVV
                     EGARDGRPVAELMEAGAHVVSRAQVMEGIAEMIHDVQVEATFPDGTKLVTVHEPIR"
     gene            587440..587694
                     /locus_tag="MESOP_RS02690"
                     /old_locus_tag="Mesop_0543"
     CDS             587440..587694
                     /locus_tag="MESOP_RS02690"
                     /old_locus_tag="Mesop_0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891782.1"
                     /db_xref="GI:503657706"
                     /translation="MLDLRPNCECCDKDLPPEATDALICTFECTFCADCAEGVLGGVC
                     PNCGGNFSARPIRPAAMLKKYPASTKRVLKAEGCGPRKAA"
     gene            587728..588315
                     /locus_tag="MESOP_RS02695"
                     /old_locus_tag="Mesop_0544"
     CDS             587728..588315
                     /locus_tag="MESOP_RS02695"
                     /old_locus_tag="Mesop_0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein hupE"
                     /protein_id="WP_013891783.1"
                     /db_xref="GI:503657707"
                     /translation="MIPAKRLCLSAILLMAAAMPAYAHVGIGTTSSFTAGFMHPLSGL
                     DHMTAMIAVGLWAALKGGKAIWAWPAAFAGVMLVGGALGMLHMPLPFVEPGILASVVA
                     LGLLVALATDLPVSTGATILALFALFHGHAHGTEVPENAGGLEYMAGFAVATVLLHAT
                     GIAAGLSLGQRLRGLARIAGAACAAIGVGLAFGVV"
     gene            588322..588627
                     /gene="ureB"
                     /locus_tag="MESOP_RS02700"
                     /old_locus_tag="Mesop_0545"
     CDS             588322..588627
                     /gene="ureB"
                     /locus_tag="MESOP_RS02700"
                     /old_locus_tag="Mesop_0545"
                     /EC_number="3.5.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008872958.1"
                     /note="ureases catalyze the hydrolysis of urea into
                     ammonia and carbon dioxide; in Helicobacter pylori and
                     Yersinia enterocolitica the ammonia released plays a key
                     role in bacterial survival by neutralizing acids when
                     colonizing the gastric mucosa; the holoenzyme is composed
                     of 3 UreC (alpha) and 3 UreAB (gamma/beta); in Brucella
                     suis the urease encoded by this operon (one of two
                     urease-encoding operons found in its genome) is involved
                     with urease activity, optimum growth, resistance to low-pH
                     killing in-vitro and persistence in-vivo, while the other
                     operon does not seem to be active; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit beta"
                     /protein_id="WP_013891784.1"
                     /db_xref="GI:503657708"
                     /translation="MIPGEIIPAQGDIELNKGLATVTLKVANSGDRPVQVGSHYHFFE
                     TNEGLKFDRERARGMRLDIAAGTAMRFEPGQERDVTLVPLGGKREVYGFQQKVMGKL"
     gene            complement(588703..589197)
                     /locus_tag="MESOP_RS02705"
                     /old_locus_tag="Mesop_0546"
     CDS             complement(588703..589197)
                     /locus_tag="MESOP_RS02705"
                     /old_locus_tag="Mesop_0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891785.1"
                     /db_xref="GI:503657709"
                     /translation="MTVTILPDARWPHAFAAAAFLAASIPQAVLNAQSLESPETVDRI
                     VGSQVNQEEAKATAEIGKVSSAIDRTRENISTVRKTSKLDRVDIVFLTDAARSEGGPP
                     PVIENKVRQHQDDVAELRKEIEANALLFNAIDSRRVLAEDVLAVEFDDPGKIVIYAAA
                     KPPG"
     gene            complement(589324..589713)
                     /locus_tag="MESOP_RS02710"
                     /old_locus_tag="Mesop_0547"
     CDS             complement(589324..589713)
                     /locus_tag="MESOP_RS02710"
                     /old_locus_tag="Mesop_0547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163972.1"
                     /db_xref="GI:752465263"
                     /translation="MEGRSMRKAIVLAAAATLTLAGAASAQQQPAQQPAQAPAAPAPG
                     GQQAAPAIQSVNIVDITELPKDTQTQVNQVIAQRGDDGLKKLRSSIDATPKVKSALEA
                     KGMTSAQVVAASMEPNGALTLITKKAS"
     gene            589866..591578
                     /gene="ureC"
                     /locus_tag="MESOP_RS02715"
                     /old_locus_tag="Mesop_0548"
     CDS             589866..591578
                     /gene="ureC"
                     /locus_tag="MESOP_RS02715"
                     /old_locus_tag="Mesop_0548"
                     /EC_number="3.5.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006200756.1"
                     /note="ureases catalyze the hydrolysis of urea into
                     ammonia and carbon dioxide; in Helicobacter pylori the
                     ammonia released plays a key role in bacterial survival by
                     neutralizing acids when colonizing the gastric mucosa; the
                     holoenzyme is composed of 3 ureC (alpha) and 3 ureAB
                     (gamma/beta) subunits; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit alpha"
                     /protein_id="WP_013891787.1"
                     /db_xref="GI:503657711"
                     /translation="MARITRAAYAQMYGPTVGDRVRLADTELFIEVEKDFTIHGEEVK
                     FGGGKVIRDGMGQSQVSRAQGAVDTVVTNALVIDASAGIFKADIGLRDGRIAAIGKAG
                     NPDTQDGVTIIIGPGTEIIAGEGKILTAGGFDAHIHFICPQQIEEALMSGITTMLGGG
                     TGPAHGTLATTCTPGPWHMARMIQSFDAFPMNIGLSGKGNASLPAALEEMVLGGACSL
                     KLHEDWGTTPAAIDCCLSVADDHDVQVMIHTDTLNESGFVENTVAAIKGRTIHAFHTE
                     GAGGGHAPDIIKVCGLPNVIPSSTNPTRPYTVNTLAEHLDMLMVCHHLSPSIPEDIAF
                     AESRIRKETIAAEDILHDIGAFSIISSDSQAMGRVGEVAIRTWQTADKMKRQRGSLPQ
                     ETGNNDNFRVRRYIAKYTINPAIAHGLSKEIGSIAVGKRADLVLWNPAFFGVKPDMVL
                     IGGMIAAAPMGDPNASIPTPQPMHYRPMFGAYGKARTNSSVTFVSKAALGSGLHGRLG
                     VDKQFVAVENTRGGIGKHSMVLNDATPHIEVDPETYEVRADGELLTCEPATVLPMAQR
                     YFLF"
     gene            591769..592257
                     /locus_tag="MESOP_RS02720"
                     /old_locus_tag="Mesop_0549"
     CDS             591769..592257
                     /locus_tag="MESOP_RS02720"
                     /old_locus_tag="Mesop_0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891788.1"
                     /db_xref="GI:503657712"
                     /translation="MNKIFRKQQLTPYEADYAQWCAEQGALLREGRLSDLDRENLAEE
                     IESLGRSDKREIASRLGTLILHLLKWEFQPEQRKTGWLLTIREQRYRIENLLDESPSL
                     KAYPAQMLGREFKIARLKALDETGLSDRDFPVDCPFTIRKILDHGYFPGRPWSSDKLI
                     RE"
     gene            592317..592910
                     /locus_tag="MESOP_RS02725"
                     /old_locus_tag="Mesop_0550"
     CDS             592317..592910
                     /locus_tag="MESOP_RS02725"
                     /old_locus_tag="Mesop_0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013891789.1"
                     /db_xref="GI:503657713"
                     /translation="MATEIASPHDIFPHIRIVMGMVIGLGVARLLSGVARIVQHPGQY
                     RLYPVHLAWVASVLLMLVHFWWWEFGLYAIETWTFGKYLFIIFYAITLFLLCALLFPD
                     SMLDYTSYEDFFYSRRAWFFGLLAATYLLDVIDTLLKGPEHFARFGNEYLFRTPVFVA
                     FCIAAILVRDRRFHIAFVTAALIYQISFILRLFDTIV"
     gene            592955..593560
                     /locus_tag="MESOP_RS02730"
                     /old_locus_tag="Mesop_0551"
     CDS             592955..593560
                     /locus_tag="MESOP_RS02730"
                     /old_locus_tag="Mesop_0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_013891790.1"
                     /db_xref="GI:503657714"
                     /translation="MYKAVGSRGSRVSRVLWMLEELGEPYEFVAVHLRSPEAYALNPS
                     GKVPILIDGELTVTDSAAICVYLADKHADKGMGANPGIAGRAEMDSWMHFAQSEFEAP
                     LWNKLRHRFLLPKEVRVDVGPAATYDFISELQALDRRLGDKPFALGDRFSAVDVMLGD
                     MGGWARAGKFPIESERVNAYFDRVLARPARAKAQANGGSMK"
     gene            593557..594168
                     /locus_tag="MESOP_RS02735"
                     /old_locus_tag="Mesop_0552"
     CDS             593557..594168
                     /locus_tag="MESOP_RS02735"
                     /old_locus_tag="Mesop_0552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreE"
                     /protein_id="WP_013891791.1"
                     /db_xref="GI:503657715"
                     /translation="MKLNLNTDFTKFPRAVSVLLAGMAGTTAPSGRAVLAHDERHLRR
                     RAIELADGSKVLVDLPEPVALNDGDRLVLEDGGHIEIVAAPEDVYDVRARDAVHLTEL
                     AWHIGNRHLAAGIEADRIVILSDHVIKVMLEGLGATVREVSEPFKPVRGAYSAHSGAH
                     GHDHGHHAEAHTHSHSEAHSHAHGEQHSHSHSHSHDGHHHDHD"
     gene            594161..594832
                     /locus_tag="MESOP_RS02740"
                     /old_locus_tag="Mesop_0553"
     CDS             594161..594832
                     /locus_tag="MESOP_RS02740"
                     /old_locus_tag="Mesop_0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreF"
                     /protein_id="WP_013891792.1"
                     /db_xref="GI:503657716"
                     /translation="MTDQLSNIALLRLMAWLSPAFPVGGFAYSHGLERAVHDGLVADA
                     ASLAGWLETLVEMGSGWNDAVLFAESWRRAHNAGDLVEVAALAEALAGSRERHTETML
                     QGTAFIKAASAWPNPVLERLPAECAYCIAVGTIAGGNGIALRDALSAFLQAFFSNLVQ
                     AAIRLGVVGQSEATVLLAGFEPLALATAARAASSSLDDLGGCAFVSDVMAMKHETQYS
                     RLFRS"
     gene            594829..595269
                     /locus_tag="MESOP_RS02745"
                     /old_locus_tag="Mesop_0554"
     CDS             594829..595269
                     /locus_tag="MESOP_RS02745"
                     /old_locus_tag="Mesop_0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891793.1"
                     /db_xref="GI:503657717"
                     /translation="MIALAFVLSFVLLLITALHVYWGIGGIWPGRDAKSCAHAVVGFR
                     GIDEMPTPFASFAVAACLALATLWPLALIGFFASPFPREGLAATALLIGLVFLGRGIA
                     GFTPWWRRLTPEQPFARLDISYYSPLCLLIGLGFAVLAITEFPT"
     gene            595266..595907
                     /locus_tag="MESOP_RS02750"
                     /old_locus_tag="Mesop_0555"
     CDS             595266..595907
                     /locus_tag="MESOP_RS02750"
                     /old_locus_tag="Mesop_0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreG"
                     /protein_id="WP_013891794.1"
                     /db_xref="GI:503657718"
                     /translation="MTQANGPLRIGIGGPVGSGKTTLTEKLCKALRDEFSIAVVTNDI
                     YTREDAMMLARLQALPEDRIVGVETGGCPHTAIREDASINLQAIAELNRKFPDLDIIF
                     IESGGDNLAATFSPDLADLTLYVISVCQGEEIPRKGGPAITRSDFLIINKSDLAPYVN
                     VNLDVMESDAGRMRGKRPFGFTDLSRGKGLQEVIDFIVEHGGLRAGIAASTAA"
     gene            595995..596762
                     /locus_tag="MESOP_RS02755"
                     /old_locus_tag="Mesop_0556"
     CDS             595995..596762
                     /locus_tag="MESOP_RS02755"
                     /old_locus_tag="Mesop_0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891795.1"
                     /db_xref="GI:503657719"
                     /translation="MSIARLQKETLTNLPFYEERVDLACAFRWTARLNMHEAVANHFS
                     LAVNEDGTQFLMNPNQVHFSRIKASDLLMIDANDPDTLTGPNAPDPTAWGLHGAIHRN
                     VRHARCVMHVHSIHATVLASLADSRLPPIDQNSAMFFNRHVVDAHYGGLAFEEEGERC
                     SQLLTDPKVKVMVMGNHGVLVIGDTVADAFNRMFYFERAAETYIKALWTGRPLRTLSD
                     PIAEKTASEMDDYPGQAERHLSELKAILDEQEPVYRN"
     gene            complement(596775..597407)
                     /locus_tag="MESOP_RS02760"
                     /old_locus_tag="Mesop_0557"
     CDS             complement(596775..597407)
                     /locus_tag="MESOP_RS02760"
                     /old_locus_tag="Mesop_0557"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_013891796.1"
                     /db_xref="GI:503657720"
                     /translation="MTPKAVFWDMDGTLVDSEPLHEAALVAAMRNAGLIPPDDLHERV
                     LGVAAWPVYEMMRDEFGLDLPFDEWIVHKYEHYLPLVESLQPRPGAIEIFNELRAKGV
                     AQAVVSNSDRMIVDANLRMVGLTYPGMKTISRNDVREGKPHAEPFLRAAYLADVDPAH
                     AVAIDDSWPGALAGLAAGMKTIFWPEKPMEGPPGATVINSAEELRGELGL"
     gene            597654..598613
                     /locus_tag="MESOP_RS02765"
                     /old_locus_tag="Mesop_0558"
     CDS             597654..598613
                     /locus_tag="MESOP_RS02765"
                     /old_locus_tag="Mesop_0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_013891797.1"
                     /db_xref="GI:503657721"
                     /translation="MNTRQDGGNNRLDDAARAGWLYYVAGNTQDQIAATLGISRQTAQ
                     RLVSLAVSEGLIKVRVDHPIANCLDLAARLKSRFALDLVEVVPSDPNSSSTTIGIAEA
                     AAAEIERRLRSPTPIVMGIGTGRTLKAAIEQLPPMECPQHKVVSLTGNISPDGSAAFY
                     NVIFTMADRVKARSFPMPLPVIASSPQEREMLLNQPMIQPTLALAAEADVTFIGIGDL
                     GPKAPLYEDGFISESELKALQKAGGIAEIVGWVFDREGRMIEGITNDRVSSASLPSRE
                     KSLVIALAMGERKLPGILAAVNRRLVNGLITDERTAAALLASI"
     gene            complement(598655..598840)
                     /locus_tag="MESOP_RS02770"
                     /old_locus_tag="Mesop_0559"
     CDS             complement(598655..598840)
                     /locus_tag="MESOP_RS02770"
                     /old_locus_tag="Mesop_0559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891798.1"
                     /db_xref="GI:503657722"
                     /translation="MTMAQQKCTPAPDHRWISWLADGFGWFASRKKAHLDIRDLSPHL
                     QRDLGFLDGNDPFGRHG"
     gene            598951..599856
                     /locus_tag="MESOP_RS02775"
                     /old_locus_tag="Mesop_0560"
     CDS             598951..599856
                     /locus_tag="MESOP_RS02775"
                     /old_locus_tag="Mesop_0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013891799.1"
                     /db_xref="GI:503657723"
                     /translation="MPDLSSRQVSQLPPLQAIRVFEAVARHLSFTKAAEELAMTQAAV
                     SYQIKVLEERVGAPLFLRRPRQIALTEAGQRLAPAVSEAFAILGQAYAAARGGADGVL
                     CVTTVLTFASNWLAHHLGSFQIAHPSLAVRLETSSRLTDFAREDVDLAIRSGGGKWPG
                     LEAYKLLDADFTPMLSPKLAASIGGVREPADLLRLPILDPGDIWWTQWFEAAGVHSHD
                     LAKRPGSSMGAQAYEANAAIAGHGVAILTRALFKAELADGRLIQPFDLVGDDGHAYWL
                     VYPEARRNVPKIRAFRDWLLAEIAC"
     gene            600139..601449
                     /locus_tag="MESOP_RS02780"
                     /old_locus_tag="Mesop_0561"
     CDS             600139..601449
                     /locus_tag="MESOP_RS02780"
                     /old_locus_tag="Mesop_0561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008872944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_013891800.1"
                     /db_xref="GI:503657724"
                     /translation="MKLRTLILGLCSTSALAFAAHAESITIATVNNGDMVRMQKLTDD
                     FTKANPDIQLNWVTLEENVLRERVTTDIATKGGQYDVMTIGTYEVPIWAKQSWLLPLD
                     KLGDDYDAKDIIPAIAGGLSVDGKLYAAPFYGESSFVMYRKDLMDKAGLKMPDAPTWD
                     FIKQAADKMTDRANGVNGVCLRGKAGWGENMAFLTAMSNSFGARWFDENWKPQFDQPE
                     WKNTLQFYVDLMKADGPEGASSNGFNENLALFQQGKCGMWIDATVAASFVSDPKASQV
                     ADKVGYALAPDNGLGKRGNWLWAWSLAIPAGTQKADAAEKFVSWATSKHYAELVASKE
                     GWANAPPGTRSSLYANADYQKAAPFAKMTLDSINAADPTHPTVKPVPYVGVQFVAIPE
                     FQGLGTTVGQLFSAALAGQSSVDDALKQAQDAATATMTEGGYIK"
     gene            601589..602461
                     /locus_tag="MESOP_RS02785"
                     /old_locus_tag="Mesop_0562"
     CDS             601589..602461
                     /locus_tag="MESOP_RS02785"
                     /old_locus_tag="Mesop_0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_013891801.1"
                     /db_xref="GI:503657725"
                     /translation="MATQQTRSLARFMMAPSVVLLLVWMVVPLALTLWFSFQQYNPLN
                     PIRDGFVGVSNYALFYSNPAFLQSILNTLVLVISVLLITVIGGILLALLIDQPMWGQG
                     IVRILVISPFFVMPPVAALVWKNMIMHPQYGVFADIARFFGAQPIDWFGQHPMTAIII
                     IVAWQWLPFATLILLTALQSLDGEQKEAAEMDGAGFISRFIYLTLPHMSRAITVVILI
                     QTIFLLSVYAEILVTTNGGPGYASTNLPFLVYQKALLEFKIGQASAGGVIAVILANIV
                     AFFAMRAVGKNLDK"
     gene            602473..603297
                     /locus_tag="MESOP_RS02790"
                     /old_locus_tag="Mesop_0563"
     CDS             602473..603297
                     /locus_tag="MESOP_RS02790"
                     /old_locus_tag="Mesop_0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018425975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol ABC transporter permease"
                     /protein_id="WP_013891802.1"
                     /db_xref="GI:503657726"
                     /translation="MARSVTTQHKTIATVAAWIVALLIFFPILYTIITSFKSEQEAIQ
                     GFNLIPSGTFESYTEVQAQSGYFKFFFNSVLLSVGSTILALLVAIPAAWSMAFSPTKR
                     TKDILMWMLSTKMMPAVAVLFPIYLIFRNLGLLDSRIGLMVMLMLINLPIVVWMLYTY
                     FREIPGEILEAARMDGASLWNEIVYVLTPMAVPGIASTMLLNIILAWNEAFWTIRLTT
                     TDAAPLTAFISSFSSPQGLFWAKLSAASTLAIAPILIMGWFSQKQLVRGLTFGAVK"
     gene            603369..604373
                     /locus_tag="MESOP_RS02795"
                     /old_locus_tag="Mesop_0564"
     CDS             603369..604373
                     /locus_tag="MESOP_RS02795"
                     /old_locus_tag="Mesop_0564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter ATPase"
                     /protein_id="WP_013891803.1"
                     /db_xref="GI:503657727"
                     /translation="MGNITLKNVSKSFGSTSIIPGLDLVIENGEFVVFVGPSGCGKST
                     LLRLIAGLEDTSGGTINIDGRDVTGEAPAKRKLAMVFQSYALYPHMTVAKNIAFPLKM
                     AGEDQATIDKKVKDAARVLNLTNYLERRPGQLSGGQRQRVAIGRAIVRQPSAFLFDEP
                     LSNLDAALRGTMRLEISELHHQLKTTMIYVTHDQVEAMTMADKIVVLNAGNIEQVGSP
                     MELYKTPRNLFVAGFIGSPKMNLIEGAPAAKHGAKTVGIRPEHMEISTTAGEWKATVG
                     VAEHLGSDTFLHVQADGVGPLTVRAEGELAVHHGDTIYLTPDKAKLHRFGADGKAMVQ
                     "
     gene            604370..605140
                     /locus_tag="MESOP_RS02800"
                     /old_locus_tag="Mesop_0565"
     CDS             604370..605140
                     /locus_tag="MESOP_RS02800"
                     /old_locus_tag="Mesop_0565"
                     /EC_number="1.1.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008872940.1"
                     /note="Converts D-sorbitol to L-sorbose; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sorbitol dehydrogenase"
                     /protein_id="WP_013891804.1"
                     /db_xref="GI:503657728"
                     /translation="MRLNGKSALITGSARGIGRAFAEAYAREGAVVAIADINLEAAEK
                     TAAEIGAKAYAVKLDVTDQSSIDAAVKAVETRTGGLDILINNAALFDLAPIVEISRAS
                     YEKLFSVNVAGTLFMLQAAARSMIARGKGGRIINMASQAGRRGEALVGVYCATKAAVI
                     SLTQSAGLDLIKHRINVNGIAPGVVDSDMWDQVDALFAKYENRPKGEKKRLVGEGVPY
                     GRMGRPEDLAGMAVFLASDEAEYIVAQTYNVDGGQWMS"
     gene            605307..606785
                     /locus_tag="MESOP_RS02805"
                     /old_locus_tag="Mesop_0566"
     CDS             605307..606785
                     /locus_tag="MESOP_RS02805"
                     /old_locus_tag="Mesop_0566"
                     /EC_number="1.1.1.67"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006201823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol 2-dehydrogenase"
                     /protein_id="WP_013891805.1"
                     /db_xref="GI:503657729"
                     /translation="MTVKLSSSNLARLPANVAGPKYDRSKLKAGIVHFGVGNFHRSHQ
                     AVYLDDLFNAGIGHDWALVGAGVFDGEKIGRGKLEEQDWLTTVVEQDEGHMSARVTGA
                     MIDFLVPGDAAGIIEKLADPAIKIVSLTITEGGYFIDPASGVFNPAHPDIVADAQPGA
                     TPKTVFGIILAGLMRRRDDGIVPFTVMSCDNIPHNGHVTSDGVIGLARLIDEDLAAWV
                     SEHVAFPNGMVDRITPATTDRERGILAKDFGVKDSWPVFCEPFRQWVLEDHFTDGRPP
                     LEKVGVQFVRDVAPYELMKIRILNGGHATIAYPAGLMDIHFVHEAMQEPLVRGFLDKL
                     EHDEIIPTVPPVPDTVLEDYYQLIEKRFSNPKIGDTVRRLCLDGSNRQPKFIIPTIAD
                     RLKAGKGVAGLALESALWCRYCFGTSDSGAVIEPNDPSWDRMQATAKAAKDAPAAWLA
                     MEDIYGDVGRATAFVEAFAHALNLLWANGARATLTRYIAGKL"
     gene            606801..607484
                     /locus_tag="MESOP_RS02810"
                     /old_locus_tag="Mesop_0567"
     CDS             606801..607484
                     /locus_tag="MESOP_RS02810"
                     /old_locus_tag="Mesop_0567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013891806.1"
                     /db_xref="GI:503657730"
                     /translation="MTPELVIFDCDGVLVDSEALSVSALLGMIALAGGNVGEDAAYEH
                     FLGKSMKSVREILGRDFGLEISDQHLTAMRVDLMRKFREELKPIPGISEVLPKLGLPF
                     CVASSGTLERIRYALDVTGLLGLLEPHLFSAAMVAKGKPAPDLFLHAAASMRAHPRKC
                     LVIEDSPAGIAAARAAGMRVFAFTGGSHAGNPALKARLASSEPDFIFADMLQLPDLIA
                     GLGARVRAS"
     gene            607481..609067
                     /locus_tag="MESOP_RS02815"
                     /old_locus_tag="Mesop_0568"
     CDS             607481..609067
                     /locus_tag="MESOP_RS02815"
                     /old_locus_tag="Mesop_0568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_013891807.1"
                     /db_xref="GI:503657731"
                     /translation="MTKQFVCAVDVGTGSARAGILDTSGTLLGRAERPIAMNQPKADH
                     AEHDSRDIWSAVCAAVRAAREKAGVAAEDIVGISFDATCSLVVRDRQGGQLSVSTTGD
                     KRWDTIVWLDHRAIAEADECTASGHEVLNYIGGVMSPEMATPKLMWLKRNLPRTWNEA
                     GYLFDLTDFLTWQATASLARSQCTLTAKWTYLAHEEIGWQRDFFALVGLDDLFEHGNL
                     PERASPVGGYIGPLTAQAADELGLTEKCRVGAGVIDAYAGALGVLGGFAGDEHNIGRH
                     LALIAGTSSCVMAMSPDPQPFAGVWGPYYGAALPKLWLSEGGQSATGALLDHIIRWHG
                     AGGEPDAAMHARIAKRVAELRAAEGDNLAARLHVLPDFHGNRSPLADPHAVGVVSGLT
                     LDSSFDSLCKLYWRTAVGIALGVRHVLEALNENGYLIDTLHVTGGHTKNPLLMELYAD
                     ATGCTVVEPLADEAVLLGTGMVAATAAGLFPDLNAACLAMQQGGKTRAANPAAGARFD
                     RDYRIFLEMHRQRQALDAIR"
     gene            complement(609076..610164)
                     /locus_tag="MESOP_RS02820"
                     /old_locus_tag="Mesop_0569"
     CDS             complement(609076..610164)
                     /locus_tag="MESOP_RS02820"
                     /old_locus_tag="Mesop_0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_013891808.1"
                     /db_xref="GI:503657732"
                     /translation="MSAIVCSHVDKSYGATSVIRDLNLAIEDHEFVVFLGPSGCGKST
                     LLRMLAGLEDISGGEVSIGGKVVNDLDPGDRGIAMVFQNYALYPHMTIFDNIAFGLKR
                     QKVPKAEIQKRVEAVSKTLGLDPYLGRKPAELSGGQQQRVAIARAMIKTPKVFLFDEP
                     LSNLDAKLRNHMRVEIARLHQSLNTTTVYVTHDQLEAMTLADRIVLLRDGRIEQIGSP
                     AEIYERPGNLFVAGFIGTPNMNFIDVTVGRKGNGWTLTNGATVFTVDGSRFKLQHGEK
                     AVLGIRPPDLRIAAADRSENVLAGTADLIEFHGNDALVTFVLGGKEISALVSSRACPV
                     VRSDVRYTFDESNMHLFDAKSGLSLLAR"
     gene            complement(610172..611218)
                     /locus_tag="MESOP_RS02825"
                     /old_locus_tag="Mesop_0570"
     CDS             complement(610172..611218)
                     /locus_tag="MESOP_RS02825"
                     /old_locus_tag="Mesop_0570"
                     /EC_number="1.1.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_013891809.1"
                     /db_xref="GI:503657733"
                     /translation="MRALVLEKKGELALREIALPLDVGPDDVRIAIHTVGVCGSDVHY
                     YTHGAIGSYVVRAPMVLGHEASGTILEIGANVRTLKVGDRVCMEPGVPNLSSRATKLG
                     IYNVDPDVTFWATPPVHGILAPEAVHPAAFTYRLPDNVSFAEGAMVEPFAIGMQAAAR
                     ARIVPGDVAVVVGCGPIGIMIALAALAGGCSKVLISDFSAPKLEIAARYPGIVPVNIG
                     ERSLADAVAAATDNWGADIVFEASGSPKAFTDLFDVVRPGGAVVLVGLPVEPVLLNVP
                     AAISKEVRIETVFRYANIFDRALQLIASGKVDLNPLITGTYDFSDSIAAFERAAAGKP
                     EDVKLQILISSEKA"
     gene            complement(611234..612046)
                     /locus_tag="MESOP_RS02830"
                     /old_locus_tag="Mesop_0571"
     CDS             complement(611234..612046)
                     /locus_tag="MESOP_RS02830"
                     /old_locus_tag="Mesop_0571"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_013891810.1"
                     /db_xref="GI:503657734"
                     /translation="MRPGRLIGKAVLAFAGFIAVFPLLWTALNSLKNNVDIITRVPRL
                     VFTPTLANISYIIGRDSVMTGLYNSVIACGAAVLIGVVLGLPAAYAVARYPNRWAGDI
                     QFFVLSLRFLPPVAVAIPLMVIWLQLGLYDTLAALIVTYSLLTISVIMWLAIPAFQAV
                     PKEVEEAAFVDGYGAYSVFWRIALPVAARSLIGAVAFSFVLVWNEFLIALMLSSSNAK
                     TLPIVASELSQQGMNVPWGILNASVVLLSLPPLLFLGVLSGFLNSVFRQKKT"
     gene            complement(612043..612909)
                     /locus_tag="MESOP_RS02835"
                     /old_locus_tag="Mesop_0572"
     CDS             complement(612043..612909)
                     /locus_tag="MESOP_RS02835"
                     /old_locus_tag="Mesop_0572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_013891811.1"
                     /db_xref="GI:503657735"
                     /translation="MPRRSSLPVTFVVPTLVILLILSMVPTFYAIVIALQNRELSSTA
                     YSYVWLSNFADLFADRRFLNAVWVSVKWEFVTVVATMVVAIGLGVLMFEVASPRLRNV
                     YCLLFIIPVLLPRVSAAFVWKFAYHPLYGIATYPCRLLTGGLIFDPLSKPATALFAVA
                     SVDVWQWGLFFAVIVLKLLETLPPQPIEAARLDHARRWQIHGYVTLPMLKAPLISLMF
                     VKMIESLRSFDLIYVMTRGGPGVATETLDMYAFSQGFIESGKVSYASAMAVLMMIATV
                     ITFTMLWKRVQA"
     gene            complement(613060..614331)
                     /locus_tag="MESOP_RS02840"
                     /old_locus_tag="Mesop_0573"
     CDS             complement(613060..614331)
                     /locus_tag="MESOP_RS02840"
                     /old_locus_tag="Mesop_0573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_013891812.1"
                     /db_xref="GI:503657736"
                     /translation="MRPVRLAASLGAAFLLSATVSTLALAQAPVCSAPVKVLAQPRDG
                     LTLLEDSKAEFEKLAGAGFQIDYLNENDRRAKSRADASTVGNYNVYYVDEANVALFAS
                     SKWIVPLTDYYPADYDYADFDPGRQKVATYDGKVWFAPLTGGGDLMVYRKDVLEAAGI
                     QPPKTLDELIADVPKLTNPDKGMYGIALRGARGSGANVWRWMPFFKAYGGQWFDGDKP
                     AFNSDAAVKATETYLKLFKDSAPGTQTGSWDESTGAFLSGQVAILVESTPLSGMAVDP
                     KTSQVVGKIGFLPPPSPLTGGGYGHGLAIAAKANADDASKKCAGLFIAWATSKENEKR
                     RLDAHQFGELNRTSVLSSKEFADIYGADLGQALAETGKVTAVNFWQDPRWPDLGDRWG
                     IILEELVTGTRTDIKGGLNELEAYANDLVKK"
     gene            complement(614561..615478)
                     /locus_tag="MESOP_RS02845"
                     /old_locus_tag="Mesop_0574"
     CDS             complement(614561..615478)
                     /locus_tag="MESOP_RS02845"
                     /old_locus_tag="Mesop_0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013891813.1"
                     /db_xref="GI:503657737"
                     /translation="MAFRQRKNPVATLRTAPAFEHIVTEASDSFLWRLDDYPWERNVW
                     NFHPEYEIHLLRKSSGVVLVGDHIGEFGPGYLTIVGGGLPHDWVTAVQPGELIEGRDI
                     VLQFDAQRLRGSAGLLPELRELEPFLERSARGMVFHGRTALEGAALMERMGTVHGLAR
                     LCLFLELVDLLARTDEYELLSSPDFSPVLDAASLDIIQRALTYLFQHFAEDLKLPEVA
                     DLAGMTESTFSRFFQKNTGNSFSDHLAKLRLWQACKLLADTDIPITDICFQVGYMNIS
                     NFNRAFMRKHKMTPSSYRKLSRQRLTMRA"
     gene            615731..617134
                     /locus_tag="MESOP_RS02850"
                     /old_locus_tag="Mesop_0575"
     CDS             615731..617134
                     /locus_tag="MESOP_RS02850"
                     /old_locus_tag="Mesop_0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter MatE"
                     /protein_id="WP_013891814.1"
                     /db_xref="GI:503657738"
                     /translation="MSAIEAGARAPENLWRQEIRATLALAWPMVLTNLGQTAMTATDV
                     MMMGRLGPDTLASGALGANLYFMPLIFGLGLMLATSPMIATELGRRRHSVRDLRRTVR
                     QGLWLAILISIPIWLVLWHGEAILLAMGQEPALAHQAGIYLRWLEWAVLPFYGYIVLR
                     SFISALERPGWALVIVFVAVACNAFFNWVFMFGNLGVPSMGIAGSGLATSLSSTLMFT
                     GMAVVVMLEKKFRRYRLFGRFWRSDWPRFKGLLRLGLPIAGILAFEVTIFNAAALLMG
                     LIDADSLAAHAIAIQIASISFMVPLGLNQAVTVRVGLAHGAGNPEGVSRAGWTAFVIG
                     VSFMALMGLVMVLWPHLLISAFIDLTNPANARVIALAVSFLVFAALFQVFDGAQAVAA
                     GMLRGLHDTKVPMIYAAIGYWGVGLPLGVLLAFHFGFHGVGIWIGLSSGLAVVAALLL
                     ARWLRRDRIAPPLVFGH"
     gene            complement(617200..617634)
                     /locus_tag="MESOP_RS02855"
                     /old_locus_tag="Mesop_0576"
     CDS             complement(617200..617634)
                     /locus_tag="MESOP_RS02855"
                     /old_locus_tag="Mesop_0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008872811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_013891815.1"
                     /db_xref="GI:503657739"
                     /translation="MTQAKNGDTVRINYTGRLADGTQFDASGGEPLQFTLGEGQVIAG
                     LETHVEGMEVGAKSTVTVPAEAAYGPHRPEAVMTIDRARVPDNINVDIGTRLQVRTSE
                     GRPMPVTVVGVNDASVKLDGNHPLAGKDLVFDVELVEIVQAA"
     gene            complement(617858..618505)
                     /locus_tag="MESOP_RS02860"
                     /old_locus_tag="Mesop_0577"
     CDS             complement(617858..618505)
                     /locus_tag="MESOP_RS02860"
                     /old_locus_tag="Mesop_0577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_013891816.1"
                     /db_xref="GI:503657740"
                     /translation="MIEFTLWDIIRNLLLAARWTVLLSLAAFIGGAIVGMIVLFFRIS
                     KNTWSRRIASGYIALFQGTPLLMQLFLMFFGLPMLGLRIEPWTAAVIGLTFFASAYLA
                     EIWRSGVDALPLGQWDAGASLGLHYLQELRLIILPQAFSITRAPTVGFLVQLIKSTAL
                     TSIIGFEELVRTSNAINNATFEPFKVYGLVALIFFVMCFPLTQYARRLEKHASAH"
     gene            complement(618502..619158)
                     /locus_tag="MESOP_RS02865"
                     /old_locus_tag="Mesop_0578"
     CDS             complement(618502..619158)
                     /locus_tag="MESOP_RS02865"
                     /old_locus_tag="Mesop_0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter permease"
                     /protein_id="WP_013891817.1"
                     /db_xref="GI:503657741"
                     /translation="MAFGWLPGAVGDIAHGAATTILLIAVTTLAGTLLSILGAAGRRN
                     GPVALKRAIACYVEVMRNTPFLVQLFFIFFGLPSLGIRLDPILAAMLAMTLNMAAYTI
                     EIVGAGLDAVPGGQTEAALALGLRPRQVFIKIVLPQALKIIYPALTSQIVIMMLESAV
                     VSQIAVRELTYEADMLQARTFRSFETYFVVTLVYLLLSMALRRLLVTGGRQVLGAGVS
                     "
     gene            complement(619165..619974)
                     /locus_tag="MESOP_RS02870"
                     /old_locus_tag="Mesop_0579"
     CDS             complement(619165..619974)
                     /locus_tag="MESOP_RS02870"
                     /old_locus_tag="Mesop_0579"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013891818.1"
                     /db_xref="GI:503657742"
                     /translation="MTIRTTLRSSIAAVLVLGAAGMGSATQAANADALADITKAGSIN
                     VGVFADFPPFSSASADMSLKGYDMDVAQYIADTLKVKLNPVAVTGQNRIPYLNDHRVD
                     ILMSVGYSKEREQVIDFAAAYAPYYIAVIGPAAMAVKGKEDLADKSIAVNRGTLEDTS
                     LTEAAPASADIKRFDNYNSVIQAFISGQTQLMVVGNDVGAQVLAKQDALKPEQKFQLL
                     TSPSHIGLNKNEDALKKAVNDAIAKMLADGKLDESSKAWLKTPLNPDNLKD"
     gene            complement(620057..621118)
                     /locus_tag="MESOP_RS02875"
                     /old_locus_tag="Mesop_0580"
     CDS             complement(620057..621118)
                     /locus_tag="MESOP_RS02875"
                     /old_locus_tag="Mesop_0580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatinase"
                     /protein_id="WP_013891819.1"
                     /db_xref="GI:503657743"
                     /translation="MGYDRGKLDALRRKYGESHGGEMFDPKFRKVADKIFSKSGTRLA
                     PYAGIPTFLAAPYREIAAENPDFGDLQVAMIGVPMDLGVTNRPGSRFGPRALRAIERI
                     GPYNHVLECAPTHELRVADIGDTPFRSRYRLETSHEDIERRTNQIVDAGVIPLSVGGD
                     HSISHPILKAVGKKAPVGLIHIDAHCDTSGLFDMTKFHHGGPFRNAVLDGVLDPTRTI
                     QIGIRGSAEYLWEFTYESGMTVVHAEEVTGLGLPAIIEKARKIVGDGPTYVSFDIDSV
                     DPAFAPGTGTPEVGGLTTREVLELLRGLKGLNIVGGDVVEVAPQYDATTNTAHAAAQV
                     LFEILSLMVFSPAITGKGA"
     gene            621330..622304
                     /locus_tag="MESOP_RS02880"
                     /old_locus_tag="Mesop_0581"
     CDS             621330..622304
                     /locus_tag="MESOP_RS02880"
                     /old_locus_tag="Mesop_0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013891820.1"
                     /db_xref="GI:503657744"
                     /translation="MAKRLPPLNPLRAFEATARHGSLTKAASELNVTHGAVSHQIKAL
                     EQSLGVKLFERVGQRVKLTPHGAELLPAVSTAFDGIAAATQRLTRPASSGALSVSCVP
                     ALLLLWMTPRLGSFTAQYPDIQLTLIPSNDARDIRAPHIDVCVHYGNGTWTDCWMRKW
                     SGLELFPVVSPTLINNRPIRSVRDLADHVFLHGDDGREWHTWLAAADALDLERGRRHH
                     LGDARMATEAAVHGHGVALGDSVTASALLARGMLVAPFSLSVPAVDDFYVVCRNEMRA
                     TPIVQVFIDWLFAEKAGDDGRADAPVAGRIISRRKRPALKVIGAKTAG"
     gene            622438..623742
                     /locus_tag="MESOP_RS02885"
                     /old_locus_tag="Mesop_0582"
     CDS             622438..623742
                     /locus_tag="MESOP_RS02885"
                     /old_locus_tag="Mesop_0582"
                     /EC_number="2.4.2.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="WP_013891821.1"
                     /db_xref="GI:503657745"
                     /translation="MAKTDIARRVYNHTWKLDPIVRSLLDTDFYKLLMLQMIWGMYPK
                     VDTTFSLINRTTSVRLADEIDEGELREQLDHARTLRFSKKEMIWLGGNTFYGRKQIFE
                     PEFLAWLEGFRLPDYELSKRDGQYELTFSGPWMYTTLWEIPALAIINELRSRAAMRAF
                     GPFALDVLYARAKAKMWAKTERLKALPGIRISDFGTRRRHSFLWQRWCVEALKEGIGE
                     AFTGTSNVLLAMDNDLEALGTNAHELPMVFAALANSEKELRVSPYKVLQDWQRYYGGN
                     LLIVLPDAFGTASFLRDAPDWVADWTGFRPDSAPPIEGGEKILSWWREKGKDPKQKLL
                     IFSDGLEVETIEETYRHFKGKVRMSFGWGTNLTNDFEDCAPIETNRLDAISLVCKVTE
                     ANGRPAVKLSDNPAKATGDEKEIERYIRIFGEKDRVEQLVKV"
     gene            623930..625369
                     /locus_tag="MESOP_RS02890"
                     /old_locus_tag="Mesop_0583"
     CDS             623930..625369
                     /locus_tag="MESOP_RS02890"
                     /old_locus_tag="Mesop_0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891822.1"
                     /db_xref="GI:503657746"
                     /translation="MSGRTEGGAVERYYLLLALLSAALLALLPTQAFAHASDRGHVLL
                     LPTGYYLAGGAFAVAVSFLVLALLPPVALDKFWRRRLQFFTVSDGARTAVSLTSFAGF
                     AILIAAGLFGSRDPLSNPLPLLIWTLMWAGLTLLQGVFGDLWSWLNPWYGPWRLISRL
                     LRAGDEGILLLPRWLGCWPAVILFFAFAWFELIDPAPDDPARLAVAAGVYWLLTFLAM
                     LAFGYRGWSRGGEFLTVFFSMVARFAPVERNDAGRLALCWPGAKLLAAEPLPPSGIAF
                     LLLALSSVSFDGLSKTFFWLGLFGINPLEFPGRTAVIGSGTFGLVLTFLLLAVVFLFA
                     VWLGQRVAGSDQPLRHAAGLLVWSIVPIALAYHVAHYLTALLVDGQYTLASLSDPFAL
                     GWNLFGTADMQIEAGIVAGAGSAWWLWNIQAGAIILGHVLAVLVAHGLAWRLHPQPGR
                     AALSQFPLTLLMIAYTVFGLWLLATPTVG"
     gene            625532..626836
                     /locus_tag="MESOP_RS02895"
                     /old_locus_tag="Mesop_0584"
     CDS             625532..626836
                     /locus_tag="MESOP_RS02895"
                     /old_locus_tag="Mesop_0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_013891823.1"
                     /db_xref="GI:503657747"
                     /translation="MTDKNGFFDLSKTTLSRRTALKGLAAGAGLTLAPGFVRYSQAQS
                     SAPIKIGFQSHRTGIGAAYGRWYEKTTAAAIKAINAAGGINGRQVEVIIEDDGTDPGR
                     GAEVVGKFATQHKTDIVFGTLFSHVVIGSAPAAGENKMPYFVVSEGHHVASTKLNRYV
                     FQPGITDVKSQIQSMAPWIAANAGKKVTQIFPDFAFGYDHRDYLPPALKAQGAEVIAQ
                     IAIPPTESSFTKYFPQIPAETEVIYHVMVGPAVLTFVKELGEFYGSNRPQLFGFIDSL
                     EATDINSPGLEFLDGSHFWEGSPRYAQPDDSEAQKAYRAAVGIDDNGAAVGDPKDVST
                     AAHMFGCWETLYVVKKAMEDAGYKGPEDRAKLVEATEALTAFAEGPEHPQGPKTFNGK
                     IHQCFGIQNISKVEGGKLKVVHKTKIEDGLYEAEGDYTTQAL"
     gene            627050..627931
                     /locus_tag="MESOP_RS02900"
                     /old_locus_tag="Mesop_0585"
     CDS             627050..627931
                     /locus_tag="MESOP_RS02900"
                     /old_locus_tag="Mesop_0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_013891824.1"
                     /db_xref="GI:503657748"
                     /translation="MHFGPHLLLAALEGLVTSAVLALTALGLSLVFGVMRVVNVAHGE
                     FFMLGAVLAWAISTAVGSHPALGFLAALVIAPLIVGAIALIAERLVLRRLNYNPEATI
                     VATIGMLYIIQQLALTFYGPEARPVEPPFNHRILLPWFGYSGYKLSVVAASALLLIAT
                     WLVLTRTKAGLVMRATQYDSETAQAFGIPVGRVYGGVFALGAMLAAIAAVLIVPISQA
                     HYLMGQDPLLLSFIVVIIGGLGSLRGTVVAAVLIGMSDGIISMFFSPTLAKIIATLLV
                     AMVLVFRPQGLFGTASR"
     gene            627928..628890
                     /locus_tag="MESOP_RS02905"
                     /old_locus_tag="Mesop_0586"
     CDS             627928..628890
                     /locus_tag="MESOP_RS02905"
                     /old_locus_tag="Mesop_0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_013891825.1"
                     /db_xref="GI:503657749"
                     /translation="MSEASPAKAYALHLGVIALLFVLSFVLPDYYHGLLARILVLAVF
                     AMGYNLLFGYVGLLSLGHAMFFAAGLYGAGLAVIQLGWNVPLAFAAGIACGAVLALAI
                     GLLALRTTGVAFMIVTMMFAQVFYLLILYFAVWTGGDQGQVVPQPARVLNLGATSLDL
                     TNPTVRYMSALALFSLVLMITLAIVRSRHGRVLVAIRENEERAKMLGYDTFSNKLAAV
                     VVSGAICAASGAAYALLFGYIGSSFASVQYSILPLLWVLLGGAATTLGPLIGTLFMYY
                     VIDVTSGYTSAYLLIVGIALILLVLFFPKGVLGSIRQRWLGWLP"
     gene            628887..629612
                     /locus_tag="MESOP_RS02910"
                     /old_locus_tag="Mesop_0587"
     CDS             628887..629612
                     /locus_tag="MESOP_RS02910"
                     /old_locus_tag="Mesop_0587"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_013891826.1"
                     /db_xref="GI:503657750"
                     /translation="MTPLLTTKGLSRSFGGLRAVDSVDFTLMPGEIRAVIGPNGAGKT
                     TFVSLVSGRIQPTSGAIVFDGTDITGLPAYVRVRQGIAYTFQITSVFANLSAYDNVAL
                     PVQRTLSDGRSKGAVRAGVMSALERTGLADRAHMPAGQLSYGHQRLLEVAMGLALKPR
                     LLILDEPTQGLADSEIDNFIALVRDIANGATVLLIEHNMPVVMQLADRITVFNAGKIL
                     AEGTPEAIRENAAVQEAYLGTAP"
     gene            629624..630346
                     /locus_tag="MESOP_RS02915"
                     /old_locus_tag="Mesop_0588"
     CDS             629624..630346
                     /locus_tag="MESOP_RS02915"
                     /old_locus_tag="Mesop_0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urea ABC transporter ATP-binding protein"
                     /protein_id="WP_041164486.1"
                     /db_xref="GI:752465777"
                     /translation="MTQTGKPEALAISGLDCFYGEVQVLYGLDLVLNKGEVLCLFGRN
                     GAGKTTTLKAIMGLVPAGTGSIKLGGQELTGLPAHEVPKAGVAYVPQGRRLFAEMTVA
                     ENIEIGLMARGKGKDVRENVLDLFPLLRQRLRQRSGTLSGGEQQMLAMARALCLEPEV
                     LLLDEPTEGLMPSMIAKIRETVAKLRDMGVSTILVEQRVDAVLSVADRVCFIENGRNR
                     ETVDVEGLRADPSAVRRYVGVG"
     gene            complement(630347..631756)
                     /locus_tag="MESOP_RS02920"
                     /old_locus_tag="Mesop_0589"
     CDS             complement(630347..631756)
                     /locus_tag="MESOP_RS02920"
                     /old_locus_tag="Mesop_0589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_013891828.1"
                     /db_xref="GI:503657752"
                     /translation="MAGAAIAVALLFPGVAFAAEEHGLPGAAMSLWWALPFAGLLLSI
                     ATGPLLFHHAWEHHYGKITALWAALVIVPLALAFGIPSATEAVLHALLTEYMSFIILL
                     FALYTISGGILLAGNIHGTPLVNAGLLLAGAILASVIGTTGASMILIRPILRANDNRP
                     FNAHVVIFFIFLVSNIGGSLTPLGDPPLFVGFLRGVDFFWTTTNLYRETLFVGLVVLA
                     VFLVIDIILHRREAGAPKIKDPTPDTKVRLRGLANLPLLAGVIAAILLSAAWKPGVSF
                     SVFGVGLELQNLVRDAIILALALLSLPLSYKSHREANGFNWGPIAEVAKLFAGIFICI
                     VPVIAILRASHEGALAPLVSLVSSPSGQPNDLAYFWLTGALSSFLDNAPTYLVFFELA
                     GGDPLHLMTEFASTLAAISAGAVFMGANTYIGNAPNFMVYAIARHRGVKMPGFFGYMA
                     WSGLVLIPTFLVAGFLFFG"
     gene            complement(631801..632415)
                     /locus_tag="MESOP_RS02925"
                     /old_locus_tag="Mesop_0590"
     CDS             complement(631801..632415)
                     /locus_tag="MESOP_RS02925"
                     /old_locus_tag="Mesop_0590"
                     /EC_number="3.5.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase"
                     /protein_id="WP_013891829.1"
                     /db_xref="GI:503657753"
                     /translation="MADEALVVIDLQNDFCPGGALAVAGGDEIVPLVNDMIRHADHVV
                     LTQDWHPAGHSSFASSHPGAQPFTMIEMPYGQQTLWPDHCIQGSLGSDFHSGLAWTKA
                     ELVIRKGFRPAIDSYSAFFENDHATPTGLAGYLRERGIDTLTLVGLATDFCVGFSALD
                     AVSHGFKTTVRLDACRGIDLNGSLDAMLQRMRDAGVTLEDQLSD"
     gene            632675..633529
                     /locus_tag="MESOP_RS02930"
                     /old_locus_tag="Mesop_0591"
     CDS             632675..633529
                     /locus_tag="MESOP_RS02930"
                     /old_locus_tag="Mesop_0591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine dehydrogenase"
                     /protein_id="WP_041164488.1"
                     /db_xref="GI:752465779"
                     /translation="MIRYAKPTTVDEALALLGEGAWRILAGGTDFYPAQGSKPFRDNV
                     LDINGLTALRGIAETDSHWVIGARTTWTDLLRHPLPPAFDALKQAAREVGSAQIQNVA
                     SVVGNLCNASPAADGVPALLILDAEVELRSAAATRLLPLPDFILGNRRTALRPGEMVT
                     AIRMPKPAGTSAFVKLGARRYLVISIAMVAARLVVEGGIVTDAAIAVGSCSAVAKRLA
                     GVEAALRGLAADCGLADAVQSAPMAELSPIADVRGSAEYRLDAAGEIVARALLTAAGP
                     MNDHMVAA"
     gene            633526..636354
                     /locus_tag="MESOP_RS02935"
                     /old_locus_tag="Mesop_0592"
     CDS             633526..636354
                     /locus_tag="MESOP_RS02935"
                     /old_locus_tag="Mesop_0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde oxidase"
                     /protein_id="WP_013891831.1"
                     /db_xref="GI:503657755"
                     /translation="MSQVLPEMSEALPDLGGVPLGLERADIAFAVNGVAVSVNVPPLR
                     RLSQVLRDELQLTGTKVGCDAGDCGACTVLVDGDPVCACLMPAASAAGASVTTVEGLA
                     NGRLSALQASFLAHGAAQCGICTPALLVAATALLEKKTSPTEIEVQDALGGILCRCTG
                     YRKIIAAVMDASLQTASLDFRLPQVGQAIGSSPIRLDGVPKVTGAEKFGGDAFPADAL
                     AVLVVRSPHYHASFAFGDLDSWAKAHPGIVGVFTAADIPGKNCFGVIGPFADQPALAE
                     GFTRLRGEAVALVAGEREAMLDLDLSDFPVRWTELPHFLQPGEAQADGAALIHQARPA
                     NLLTKGFVERGDPEAALASAAVTVSGAIDTSYVEHAYIEPEAGHAYMDGDTLVVVACT
                     QAPYMDRDETAKVLGLAVDKVRIVPTATGGGFGSKLDVSLQPLIGLVALKTGRPAALA
                     YTRNESMISTTKRHPAQMKATIGADANGHVTGMIFSGDFNTGAYASWGPTVANRVPVH
                     ASGPYATPNYRAEGRAIHTHGPISGAFRGFGVPQATIMQETLYDELAGKLGIDRLDFR
                     LKNCLRNGSETVTGQRLESGVGIAECLESLRPHWARATADADAFNSASVDRKRGVGVA
                     SCWYGCGNTSLPNPSTIRVGISPSGDVILHQGAVDIGQGSNTVIAQICADALGLPLDK
                     FRLKSADTAISPDAGKTSASRQTFVTGKAAEKAGRALREKILRFANVSEKASMQLDGS
                     AIVIGEGEATRRIDLASLDANADGLVFRAEETYDPPTLPLDAKGQGKPYAVYGYGAQI
                     AELEVDLKLGTVKLIKITAAHDVGKAINPLLVEGQIEGGIAQGIGMALMEEYIPGRTE
                     NLHDYLIPTIGDVPPIETILVEVPDPEGPFGAKGLGEHVLIPTAPAILNAIRHATGVL
                     VTKVPATPTRIRAGIREKDGIREKEARP"
     gene            636351..637892
                     /locus_tag="MESOP_RS02940"
                     /old_locus_tag="Mesop_0593"
     CDS             636351..637892
                     /locus_tag="MESOP_RS02940"
                     /old_locus_tag="Mesop_0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891832.1"
                     /db_xref="GI:503657756"
                     /translation="MSELAERFETHDPGEKLVAEKIRCDACPVMCYIADGRTGACDRY
                     GNVGGRIVRMDPLTILDHAAETGATMVPFVAEGEAWDGELVNTGRRFVTAIGAGTTYP
                     DYKPAPFIVSQEVEGVDLVTVVTEGIFSYCGVKVKIDTDRHIGPETAVVRSQGEAIGH
                     VTTGEYGSQMLSLGGVHHLTGGSKAEGRATCDALLDLCNRKPVELGIDGGATIVVEAG
                     KPPVIDGKQEHRMRVGCGSATIGMFATQWRGLVDEVVVVDDHITGVVSEHQAGKVLGW
                     QDTGIKIIGRRSTPGRYFKVSEPGLGWGGTSISDPLSILGEWNAKKGARPGLSLLMVS
                     TTGEQFAYYELDDELKPVEKPFPERLQKSVGLIEDNCEPALCTVLFIGGAGGSLRAGV
                     TENPVNLTRSVQGLKTYVTVGGAPVYVWPGGGITLMVDVTRVPEGAFGYVPTPALVAP
                     IEFTLRRDDYIRLGGYEAEIRSVHDIVAKGGEYLNARRGTGAPGGNPWPPLAQLHRVP
                     ANGAG"
     gene            637892..638776
                     /locus_tag="MESOP_RS02945"
                     /old_locus_tag="Mesop_0594"
     CDS             637892..638776
                     /locus_tag="MESOP_RS02945"
                     /old_locus_tag="Mesop_0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ApbE"
                     /protein_id="WP_041164490.1"
                     /db_xref="GI:752465781"
                     /translation="MQGPQVHWLQDGKRLHLSHGPIDLIVEAFGEADECRAAYEQAVA
                     RFQTILIELVKELPELRLPAFFLAPRAFDGPTARRMEAAVIPLAECFITPMAAVAGSV
                     ADEMLTALLTGRKLDRAYVNNGGDSALHIGNGLSMNLAIAGTGHDMADRIMIRAQDGV
                     RGVATSGWRGRSFSLGIADAVTVLARTGAEADAAATLIANAVDLPGNPAIKRIPASEL
                     SPDSDLGPRLVTQSVGTLAPGEVARALDNGLAVAEDFRRRGLIAGSALFLGGEARISG
                     SVALAAPNKNSREEVAHA"
     gene            638769..639353
                     /locus_tag="MESOP_RS02950"
                     /old_locus_tag="Mesop_0595"
     CDS             638769..639353
                     /locus_tag="MESOP_RS02950"
                     /old_locus_tag="Mesop_0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891834.1"
                     /db_xref="GI:503657758"
                     /translation="MPEFPIRKIAVLTEEIFHEGGPIAEVPRRRAAAMALVKNPFAGR
                     YAEELQSAMDDLKPLGLLLADRLIAALGGDVKQIDGYGKGAIVGIAGELEHGALWHVP
                     GGYAMRERLGDAKAIVPSAKKVGAFGSKLDVPLGHINAAYVRSHFDAMEVGISDGPRP
                     DEILFCLAMTCGPRIHNRMGGLAADDIKAWDGLR"
     gene            639350..639811
                     /locus_tag="MESOP_RS02955"
                     /old_locus_tag="Mesop_0596"
     CDS             639350..639811
                     /locus_tag="MESOP_RS02955"
                     /old_locus_tag="Mesop_0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013891835.1"
                     /db_xref="GI:503657759"
                     /translation="MSGEDNLLKLVEVEAPDDQDYLLQEQVGFILRKAHQRHVSIFAA
                     HIGDLTPPQFAALAKLRDVGETSQNQLGTLIAMDAATVKGVVDRLKARGLVELSKHEV
                     DKRRLLVNLTAEGREAIERLIPLAREITAETLAPLSAKEAATFMRLLVKLA"
     gene            complement(639857..640858)
                     /locus_tag="MESOP_RS02960"
                     /old_locus_tag="Mesop_0597"
     CDS             complement(639857..640858)
                     /locus_tag="MESOP_RS02960"
                     /old_locus_tag="Mesop_0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkane 1-monooxygenase"
                     /protein_id="WP_013891836.1"
                     /db_xref="GI:503657760"
                     /translation="MTELSVLDLSPIVEGSDASQSLANSLDLARHAERLGYKRYWLAE
                     HHNMPGIASAATAVVIAHVAGGTRTIRVGAGGIMLPNHAPLVIAEQFGTLAALFPGRI
                     DLGLGRAPGTDMNTARALRRNLEAGVDNFPQDVVELMGYFLPAEEGQRLRAVPGEGQT
                     VPIWILGSSLYGAQLAAMLGLPYAFASHFAPAELDHALDIYRSRFQPSEQLDKPHVML
                     GLNVFAAPTDAEARLLFTSLQQAFVNLRTGRPGRLPPPVENYDRDLDPMAKTMLGQAL
                     SCAVVGSPETVRQGIDAFVRRTGADELMVTAQISDHAARVRSFEILAEAHKSLSQAA"
     gene            complement(640855..641688)
                     /locus_tag="MESOP_RS02965"
                     /old_locus_tag="Mesop_0598"
     CDS             complement(640855..641688)
                     /locus_tag="MESOP_RS02965"
                     /old_locus_tag="Mesop_0598"
                     /EC_number="2.3.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_013891837.1"
                     /db_xref="GI:503657761"
                     /translation="MSDAPFDLDAYFARIGYAGSRDASLDTLKTLHFLHPQAIPFENV
                     DPFLGRPVRLDLAALQDKIVADGRGGYCFEHNLLFMHVLKALGFEVGGLAARVLWGQA
                     EDAITARSHMLLRVELDGRTYIADVGFGGLTLTAPLLLEPGTEQKTPHETFRIVAADD
                     HFRLQAAIGGDWRSLYRFDLQPQYEVDYSIASYFLSTNPISHFLTSVLAARAAPDRRY
                     ALRGNRLSIHHIGGRTEQKDIATAAELADTLEGQFGIIIPDRAGFEARVREKKIVETN
                     A"
     gene            complement(641761..642930)
                     /locus_tag="MESOP_RS02970"
                     /old_locus_tag="Mesop_0599"
     CDS             complement(641761..642930)
                     /locus_tag="MESOP_RS02970"
                     /old_locus_tag="Mesop_0599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013891838.1"
                     /db_xref="GI:503657762"
                     /translation="MKTEPAALGAGAAAEPDPRVEARADTHLMRLLLVGIFLFMAIYA
                     LYFARAFFMPVILAFLLALTLTPIVRILRKRGIPEVASATLLVLLSICVFASAGYLLS
                     SPVFDLINNSSSIGQQLTERLAQLRRPLEKIMQISHQIEQLTETSQEPGIQKVAVAQS
                     GILSAAASNILSAGTSLTIIFVLSLFLLASGTMFYEKIIQSFASLSEKKRALRVVYDV
                     EREISHYLLTVTIINAGLGTVIGLGLWALGVPNPLVWGVAAALFNFLPYVGALLTIVL
                     VAVIALISFDTISYALLAPAFVLLCDVVEGQFVTPMVVGRRLEINAVAIFIAIAFWSW
                     LWGFVGALMAVPLLVVIKVFCDHFDGLSHVGNFLAAQHTAVVEEEPAEENGKASA"
     gene            complement(643054..644115)
                     /locus_tag="MESOP_RS02975"
                     /old_locus_tag="Mesop_0600"
     CDS             complement(643054..644115)
                     /locus_tag="MESOP_RS02975"
                     /old_locus_tag="Mesop_0600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="luciferase"
                     /protein_id="WP_013891839.1"
                     /db_xref="GI:503657763"
                     /translation="MELGLYTFADVSPQPGPGAIGPHERLRNLIEEVELADQVGLDVF
                     GLGEHHRPDYAASAPVVALAAAAERSKRIRLTSAVTVLSSDDPVRVFQQFATLDLLSG
                     GRAEIMAGRGSFIESFPLFGYNLEDYDELFAEKLDLLLAIRDQVKVTWSGNLRAPIND
                     RGVYPRPFQDRLPVWIAIGGTPQSAARAGALGLPLALAIIGGEPARFAPLFDLYREAA
                     KRAGSDPTGLATSINVHGFIAGTTEQAADDFYGPQAEVMNRIGRERGWGPTSRAHFDQ
                     SRGPNGALFVGNPEQVAEKIVAQHKIFNNDRFLLQMAIGTMPHAKIMNAIELYGTRVA
                     PIVRKETAKSAPALATPAA"
     gene            644432..644860
                     /locus_tag="MESOP_RS02980"
                     /old_locus_tag="Mesop_0601"
     CDS             644432..644860
                     /locus_tag="MESOP_RS02980"
                     /old_locus_tag="Mesop_0601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891840.1"
                     /db_xref="GI:503657764"
                     /translation="MAIYREKDIFERRNAANEAKKALLERFKSKPAADDPAVLARQAE
                     RKAILEAREIREAEKARLKQEKLAREAVEKAEREAAAEAARVAAEEAAQAEAKIKEAE
                     ENERIARLLADEAERKAKRDARYAARKQRTGRTPPGFSAR"
     gene            complement(645031..645345)
                     /locus_tag="MESOP_RS02985"
                     /old_locus_tag="Mesop_0602"
     CDS             complement(645031..645345)
                     /locus_tag="MESOP_RS02985"
                     /old_locus_tag="Mesop_0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_013891841.1"
                     /db_xref="GI:503657765"
                     /translation="MSWIFLFFAGLFEIGWAIGLKYTDGFTRLVPTVLTVASMVVSLT
                     LLGLALKALPVGTAYAVWTGIGTVGTALLGIWLFGEPATAIRLACIALIVCGIMGLKF
                     AA"
     gene            645895..646704
                     /locus_tag="MESOP_RS02990"
                     /old_locus_tag="Mesop_0604"
     CDS             645895..646704
                     /locus_tag="MESOP_RS02990"
                     /old_locus_tag="Mesop_0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase"
                     /protein_id="WP_013891843.1"
                     /db_xref="GI:503657767"
                     /translation="MRIHIGCEMSFDFPQETPLIAMLNVHYSRASDLERPDFLTSNPP
                     VPIESYRDSFGNWCNRFVAPPGRFTFGTDAVIRDPGTFEMSELMAWQHEGRDLPAETL
                     LFLLPSRFCESDLLASEAWRLFGHTPPGIPRVQAVCDFVHNHIVFNYGNARPTRTAAE
                     AYREQSGVCRDFAHLAVTFCRALNIPTRYCTGYISDIGMPKPWASMDFCAWMEVYLGG
                     RWHAFDPRNNAPRIGRILIASGRDAADVPLTHIFGPGTLAGFKVWTDEIVE"
     gene            646826..647794
                     /locus_tag="MESOP_RS02995"
                     /old_locus_tag="Mesop_0605"
     CDS             646826..647794
                     /locus_tag="MESOP_RS02995"
                     /old_locus_tag="Mesop_0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_013891844.1"
                     /db_xref="GI:503657768"
                     /translation="MAGHGGSKTVIYAALAGNLAIALTKFAAAFFTGSSAMLSEGVHS
                     LVDTGNGSLLLYGMHRAARPADRTHPLGHGRELYFWSFIVALLVFALGAGVSFYEGII
                     HIMAPEPVANVKVNYIVLGLSFLFEGSSWLVALKEFRRQKGRQEGWLQAVQSSKDPSV
                     YTVLFEDSAALLGLIVAFAGILAAELLDMPELDGAASIGIALILGATAVFLARESKGL
                     LIGEPASPEVQKRVLAIVQQDSAVQRANGVLTVHMGPAEIVAALSIEFEDHLAAPEIE
                     ACVERIEKRLNTEMPEITRLFVKPQTTGTWEQRRKLIGAMSDPALD"
     gene            647859..648263
                     /locus_tag="MESOP_RS03000"
                     /old_locus_tag="Mesop_0606"
     CDS             647859..648263
                     /locus_tag="MESOP_RS03000"
                     /old_locus_tag="Mesop_0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde-activating protein"
                     /protein_id="WP_013891845.1"
                     /db_xref="GI:503657769"
                     /translation="MKIDGGCHCGAITYEAEVDPEKTSICHCTDCQQLTGTAFRVTVP
                     APENNYRITRGTPKIYIKTVASGAKRVQAFCADCGSHLYATSVGDGPKVYGIRAGTAR
                     QRQDLVPTLQKWHRSALHWLPEFQGMTTVEEQ"
     gene            complement(648285..649556)
                     /locus_tag="MESOP_RS03005"
                     /old_locus_tag="Mesop_0607"
     CDS             complement(648285..649556)
                     /locus_tag="MESOP_RS03005"
                     /old_locus_tag="Mesop_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombinase"
                     /protein_id="WP_013891846.1"
                     /db_xref="GI:503657770"
                     /translation="MNDLSTILSEPVARLGASTITLGHALAFGALLFLGLFVALVVAL
                     WRSAKARAVAAAEAADHARDAEARMAGILQSQAEMQGRMGAIAEVFGARQAELTQSIG
                     QRLDAMTGRIGQTMTEQTKSTHESLAKLQERLAVIDTAQGNIQSLAGQVVQLQAILSN
                     KQTRGAFGQSRMEAIVADGLPHGAYEFQATLSNGSRPDCLVKMPNGAPSLAIDAKFPL
                     EAWNAIRAADGADLQKVAAQAFRRDIEIHVRDISEKYLIQGETQDTAFMFVPSESVFA
                     EIHENFEAIVHKAHRARVVIVSPSLLMLSIQVIQAILKDARMREQAHLIQGEVIRLME
                     DVARVDERVRKLQVHFGQSAKDIDDILVSTSKVTKRGQKIEALEFGAQPDGDAGPDGA
                     SRAPAAKADAGPRVADSKTGQLRLRVVEGDD"
     gene            649660..650190
                     /locus_tag="MESOP_RS03010"
                     /old_locus_tag="Mesop_0608"
     CDS             649660..650190
                     /locus_tag="MESOP_RS03010"
                     /old_locus_tag="Mesop_0608"
                     /EC_number="3.5.1.88"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_013891847.1"
                     /db_xref="GI:503657771"
                     /translation="MPIKPLIILPDPILRQVSKPVERVDAPLRGLADDMLATMYDAPG
                     IGLAAIQIGEPLRMLVIDLAKEDETPAPHVFINPEILESADARSVYEEGCLSIPDYYA
                     EVERPASVRVKYLDRDGKLQEMEAEGLMATCLQHEIDHLNGVLFIDHISKLKRDMVVK
                     KFKKLAKDKAPGKLVG"
     gene            650194..651147
                     /locus_tag="MESOP_RS03015"
                     /old_locus_tag="Mesop_0609"
     CDS             650194..651147
                     /locus_tag="MESOP_RS03015"
                     /old_locus_tag="Mesop_0609"
                     /EC_number="2.1.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_013891848.1"
                     /db_xref="GI:503657772"
                     /translation="MPLRVIFMGTPEFSVPTLRALAEAGHQIAAVYTQPPRAAGRRGL
                     ELTPSPVQREAERLGVEVRMPVSLKGEAEQAALHALGADIAVVVAYGLLLPKAVLDAP
                     RLGCINGHASLLPRWRGAAPIQRAIMAGDLETGMMVMRMEEGLDTGPVGLVEKCAIEP
                     DMTAGDLHDRLMSIGAALMVEALARLEESTLRFTTQAVDGVTYARKIDKSETHVDWTR
                     PAAEVHNTIRGLSPFPGAWSEIDIGGRPERLKLLRSTLSEGLPLSDDLGESGGILDDR
                     LTVACGTGAVRLVEVQRAGGRPAAAPEFLRGAKIEKGMKFS"
     gene            651144..651650
                     /locus_tag="MESOP_RS03020"
                     /old_locus_tag="Mesop_0610"
     CDS             651144..651650
                     /locus_tag="MESOP_RS03020"
                     /old_locus_tag="Mesop_0610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5 family acetyltransferase"
                     /protein_id="WP_013891849.1"
                     /db_xref="GI:503657773"
                     /translation="MSMMSIRAATPRDREAIRDVEEHAFGQQAEAGLVDALVTGGDAV
                     VELVAEEDGQVVGHILFSRLFVQNGGKSFAAVALAPLAVEPSFHGSGIGGALIREAHI
                     RLKDTGETLAVVLGDPAYYGRFGYSHTRAEKFESEYQGEALQALAWGDAPETGSLIYA
                     SAFTALAA"
     gene            651674..652423
                     /locus_tag="MESOP_RS03025"
                     /old_locus_tag="Mesop_0611"
     CDS             651674..652423
                     /locus_tag="MESOP_RS03025"
                     /old_locus_tag="Mesop_0611"
                     /EC_number="5.4.99.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="WP_013891850.1"
                     /db_xref="GI:503657774"
                     /translation="MPRFRLDIEYDGSLFAGWQHQADQPSVQQAIEEAIEKFCGEAVR
                     LRAAGRTDAGVHATAQVAHVDLVKAWPGDKVRDAVNAHLQAAGARVVILKAGVVPDDF
                     DARFSATGRHYLYRILNRRAPSALEKGKVWWVPKRLDAGAMHEAAKILLGRHDFTTFR
                     STQCQANSPVRTLEQLDVSRQGDMIEVRASARSFLHNQVRSMVGSLKRVGDGSWSAND
                     FKAALEARDRAACGQVAPPDGLFLIGVDYSE"
     gene            complement(652459..653091)
                     /locus_tag="MESOP_RS03030"
                     /old_locus_tag="Mesop_0612"
     CDS             complement(652459..653091)
                     /locus_tag="MESOP_RS03030"
                     /old_locus_tag="Mesop_0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_013891851.1"
                     /db_xref="GI:503657775"
                     /translation="MLSADETQASLTGAWRLMLGKVDGLRLLDLSADGFWNSFFAIIV
                     AAPALIVGWVGIANEIGDPDAFAGRFSMLLRLATVDIGSWVLPLVALALVAPRAGIGG
                     RFVHYVVASNWASAITAWLMLPSALIRLFLSSASQVSSLVSLLLFALSMVLTWRMTNA
                     TIGKGAAVGTAVFVGMFIASLLVLFGLQMLLGIAVPDDVGAQSLSGLYPG"
     gene            complement(653097..654290)
                     /locus_tag="MESOP_RS03035"
                     /old_locus_tag="Mesop_0613"
     CDS             complement(653097..654290)
                     /locus_tag="MESOP_RS03035"
                     /old_locus_tag="Mesop_0613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-diaminopimelate desuccinylase"
                     /protein_id="WP_013891852.1"
                     /db_xref="GI:503657776"
                     /translation="MTLPTDPAANLATLIRCASVTPAEGGALGALETMLKPLGFLVER
                     PVFSEDGTPDIENLYARRSGNGPHLMFAGHTDVVPVGDEAAWTHPPFAAEIANGEMYG
                     RGAVDMKGGIACFIAAVARHVEANGGPKGSVSLLITGDEEGPAINGTVKLLEWAASRG
                     EKWDASIVGEPTNPDALGDMIKIGRRGSMSGAVTVNGRQGHAAYPQLADNPVRGLMSL
                     VDALLHPVFDKGTRDFQPTNLEVTSIDVGNPATNVIPAKAVAVFNIRFNDTWTAETLQ
                     AEIHNRLDQAAGRKKYRPGKKTPVDYDLVWRDRPSHVFLTRDDRLVETLAGSIKSAVG
                     KEPTLSTSGGTSDARFIKDYCPVVEFGLVGKTMHMVDERVAIADLETLTRIYQRFIED
                     WFGQG"
     gene            654418..655467
                     /locus_tag="MESOP_RS03040"
                     /old_locus_tag="Mesop_0614"
     CDS             654418..655467
                     /locus_tag="MESOP_RS03040"
                     /old_locus_tag="Mesop_0614"
                     /EC_number="1.1.1.169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="WP_013891853.1"
                     /db_xref="GI:503657777"
                     /translation="MTNGGKKIVIAGAGSIGCYAGGCLALAGRQVILLARPRIETALR
                     QSGLRVSDLEGRDRLVKPDALEVTADPATALRQADVILVTVKSGATQEMAALIQAHAR
                     PDAVAVSLQNGVDNADRLRAGLDGRTVLAGMVPFNVVQPPDGELPLRVHRASDGKVMI
                     QDGLAGLLDVASFLNVEGLAVETHGDMKAVLWGKLLMNLNNALVALSDLPLARELADR
                     RWRLILAGQIDEALRAMKASGIEPARIAGLRPALLPKVLRLPDWLFKLLARRMLAIDP
                     EARSSMWDDLRRGRPTEIGELQGAVLGLAEKTGTPAPLLKSVTALVRAAEAARLGSPG
                     LTPEQVLAPGGPRSA"
     gene            complement(655370..656143)
                     /locus_tag="MESOP_RS03045"
                     /old_locus_tag="Mesop_0615"
     CDS             complement(655370..656143)
                     /locus_tag="MESOP_RS03045"
                     /old_locus_tag="Mesop_0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891854.1"
                     /db_xref="GI:503657778"
                     /translation="MRYRTLDPKLIVETAERLEGRIADRFPDAGLRGVAAELVSLSRD
                     LAKAAKALEAPIWWLRGIIVAAVGAGALVFLFVGTILPLIHISQADDAVQSVQGIEAT
                     INMMILAVLGFLALIRTEERIKRKQVFRQLHGLRSLIHVIDMHQLTKDPAALSANFKP
                     TLHSPARIINAADLARYLDYCSEMLSITGKIAALFAQSVNDAVVIDGVNDIENLSSNL
                     SRKIWQKITLIEGHPAPEPVPASGPAIQAAPLRPRAPKR"
     gene            complement(656157..656534)
                     /locus_tag="MESOP_RS03050"
                     /old_locus_tag="Mesop_0616"
     CDS             complement(656157..656534)
                     /locus_tag="MESOP_RS03050"
                     /old_locus_tag="Mesop_0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891855.1"
                     /db_xref="GI:503657779"
                     /translation="MPESSNLTWLFFKTSGRVSRAAYFLGGLLVAIIQAFPLYRFTLV
                     PEGSAESNMWSFIFFVAFIASLWSNIVLAVKRLHDLDKPGIAALILFVPVVSIVAFLV
                     LCLFPGQPGPNRYGRRTNEPEQP"
     gene            complement(656527..656880)
                     /locus_tag="MESOP_RS03055"
                     /old_locus_tag="Mesop_0617"
     CDS             complement(656527..656880)
                     /locus_tag="MESOP_RS03055"
                     /old_locus_tag="Mesop_0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891856.1"
                     /db_xref="GI:503657780"
                     /translation="MDWKYLLTSYEGRINRAKFWAGVGIIFVGAVIAMILDNILGTTF
                     NQMPYGFIYLLYSLAMLYSVFAFYAKRWHDRGKSGWWSLIILVPFIGAIWFLVECGIL
                     EGTKGANQYGPDPLA"
     gene            complement(656953..657807)
                     /locus_tag="MESOP_RS03060"
                     /old_locus_tag="Mesop_0618"
     CDS             complement(656953..657807)
                     /locus_tag="MESOP_RS03060"
                     /old_locus_tag="Mesop_0618"
                     /EC_number="2.3.1.117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008833995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-carboxylate
                     N-succinyltransferase"
                     /protein_id="WP_013891857.1"
                     /db_xref="GI:503657781"
                     /translation="MSKPDLASLEKTIEKAFEERDTISTATRGETRDAIQSALDLLDR
                     GTVRVAERQDDGKWHVNQWLKKAVLLSFRLNPMEIIKGGPGQAVWWDKVASKFDGWSA
                     VDFEKAGFRAVPGSIVRRSAYVAPGAVLMPSFVNVGAYIDTGTMVDTWVGVGSCAQIG
                     KNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGQS
                     TKIVDRATGEVFYGEVPPNSVVVAGSMPGKPLPNNEPGPSLYCAVIVKRVDAKTRSKT
                     SINELLRD"
     gene            657960..658796
                     /locus_tag="MESOP_RS03065"
                     /old_locus_tag="Mesop_0619"
     CDS             657960..658796
                     /locus_tag="MESOP_RS03065"
                     /old_locus_tag="Mesop_0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="WP_032923005.1"
                     /db_xref="GI:696347853"
                     /translation="MEKAGWTPLPHSDEDLERSRSVPDTPQTRAETYRLAWNDPEFMT
                     RRELRAVRLQLELLKPEMILAERGIHSTVILFGGARLPEPGGEAWAAKNETQKKNLEE
                     NSKYYEEARKFARLCSQQSATSYYREYVVVTGGGPGVMEAGNRGADDVGAPSIGLNIV
                     LPHEQAPNAYVTPELCFNFHYFAIRKMHFVMRAKAVAVFPGGFGTMDEFFETLTLIQT
                     GRMERVPVILFGKSFWKRAIDLDFLAEQGTISPGDQDIIDFVDTADEAWGIISRFYKL
                     GE"
     gene            complement(658889..659608)
                     /locus_tag="MESOP_RS03070"
                     /old_locus_tag="Mesop_0620"
     CDS             complement(658889..659608)
                     /locus_tag="MESOP_RS03070"
                     /old_locus_tag="Mesop_0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_013891859.1"
                     /db_xref="GI:503657783"
                     /translation="MTTLPDPARFAHVTDWVFDLDNTLYPHHSNLFSQIDVKMTAYIG
                     ELLALPRDEARKLQKELYLEYGTTLNGLMTRHGIDPDDFLEKVHDIDYSWLVPDPVLG
                     TAIRQLPGRKFIFTNGDRRHAERTARQLGILDHFDDIFDIIAADLNPKPARQTYEKFA
                     ELHAVTGHNAVMFEDLARNLSVPKSLGMTTVLVVPRNFEPTFSEIWERDPAQEDDVDF
                     VTDDLATFLTAIVEGVEELKN"
     gene            659770..660531
                     /locus_tag="MESOP_RS03075"
                     /old_locus_tag="Mesop_0621"
     CDS             659770..660531
                     /locus_tag="MESOP_RS03075"
                     /old_locus_tag="Mesop_0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_013891860.1"
                     /db_xref="GI:503657784"
                     /translation="MNTIILKSAAIAFASVAISLLLTLIIVPAMGFPMSRTIWLTSTV
                     CPLVLAWVACASTFWQSDRLKNAHRELARAHAQLAAAHRRLAEKASRDDMTGMLNRES
                     FFAALDGSRRKSDRGALLIIDADHFKKINDSFGHLTGDDALLLIASAIERGVRHGDVL
                     GRIGGEEFGAFLVGATEQEAKRVAERIRREVELIRFRPVDERTIPLTVSIGGTVCGEE
                     ANVSELMRAADRRLYQAKHAGRNLSILDTDISAAA"
     gene            660743..660937
                     /locus_tag="MESOP_RS03080"
                     /old_locus_tag="Mesop_0622"
     CDS             660743..660937
                     /locus_tag="MESOP_RS03080"
                     /old_locus_tag="Mesop_0622"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891861.1"
                     /db_xref="GI:503657785"
                     /translation="MSFFKEMSRRTIMQALIAMPALSLFRKSPDADAAPPDASRVDAL
                     ADPNEIVEANGWILKRSDLA"
     gene            660934..662373
                     /locus_tag="MESOP_RS03085"
                     /old_locus_tag="Mesop_0623"
     CDS             660934..662373
                     /locus_tag="MESOP_RS03085"
                     /old_locus_tag="Mesop_0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_013891862.1"
                     /db_xref="GI:503657786"
                     /translation="MIFDSYEAYRAANFKPKVCILGSGPAGTTIARKLGAAGIPVVVL
                     EAGARDFSDESQDFYRGTTVGDFYFDLDITRLRFMGGSSNHWAGWCRVLDKQDFEPKA
                     WAPDTGWPIRRADIEPYLNEVHDILDLPDFRPDVPISDDIRWVQLIKSPAVRFAEKFG
                     DELDKSGNIAVVLNTYATELAGDGKRVTGARLWSDGQDAGFFSADYFIVCTGGLENSR
                     LLLWSNRRSNGGVVPNAAALGRYWMEHPTFEGGNAILADYGEFEVDAVNEAFFSPTLA
                     AMERLQIMNFGIRLIETPYPGVKSLIADLACTAPNMAEWMSSKLSQNLRCAAQLYVAW
                     EQAPRASNQIELSKTDVDHAGVPRIELHWKKSDLERRTLLEGLRLFGTTLIKKNLGRV
                     RIADWIANGQDYPTNDETAGHHHMGGTRMGTDVTKSVVDANCKVHGMDNLYVGGSSVF
                     CTSGQANPTTTITALACRLGEHLAKVVAV"
     gene            662693..663190
                     /locus_tag="MESOP_RS03090"
                     /old_locus_tag="Mesop_0625"
     CDS             662693..663190
                     /locus_tag="MESOP_RS03090"
                     /old_locus_tag="Mesop_0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_041163973.1"
                     /db_xref="GI:752465264"
                     /translation="MVEINSSSGNRKAMTAEIGLAIMQWQDATQAYDEAVGVKLGLNM
                     AERHCLGLLYGGPQSAGAIATATGLTPAAVTALIDRLEARGLLTRTRSLEDRRKVVVE
                     ATEATRDLSARYYGAIAREGEKVIAAFSDAELATISRFVNAALDLQRDQLARLKAEGP
                     VIPGR"
     gene            complement(663239..663871)
                     /locus_tag="MESOP_RS03095"
                     /old_locus_tag="Mesop_0626"
     CDS             complement(663239..663871)
                     /locus_tag="MESOP_RS03095"
                     /old_locus_tag="Mesop_0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013891865.1"
                     /db_xref="GI:503657789"
                     /translation="MEIEGETRSARKDREIIQAATAAFIGKGYDGTSMEEIATRAGAS
                     KQTIYKHFTDKETLFGEVVLSTATQVNDVIESVTTLLSEAKFMEGGLQQLARRLVTML
                     LDEELLKLRRLIIANADRMPQLGRSWYEKGFERMLASTASCFQKLTDRGLMQTSDPRL
                     AASHLFGMLLWIPMNEAMFTGSNPRSKAELERHADASVEAFLVAYGVQPK"
     gene            663974..664366
                     /locus_tag="MESOP_RS03100"
                     /old_locus_tag="Mesop_0627"
     CDS             663974..664366
                     /locus_tag="MESOP_RS03100"
                     /old_locus_tag="Mesop_0627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_013891866.1"
                     /db_xref="GI:503657790"
                     /translation="MTKMIFLNLPVRDLQAATNFYLAIGGTLNPQFSNDQASSIMFSD
                     SIGVMLLTHQHYSQFTARQKRDSQMLIALTTDSRDEVNAIIEKGVAAGGRADPNPAQD
                     LGFMFNRHIEDPDGNVWEFLWMNPSAMQ"
     gene            complement(664448..665284)
                     /locus_tag="MESOP_RS03105"
                     /old_locus_tag="Mesop_0628"
     CDS             complement(664448..665284)
                     /locus_tag="MESOP_RS03105"
                     /old_locus_tag="Mesop_0628"
                     /EC_number="1.14.16.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanine-4-hydroxylase"
                     /protein_id="WP_013891867.1"
                     /db_xref="GI:503657791"
                     /translation="MTTMSVAEYARDCAAQGLRGDYSVCRADFTVAQGYDYSAEEQAV
                     WRTLCDRQTKLTRKLAHHSYLDGVEKLGLLDRIPDFGDVSAKLRKLTGWEIVAVPGLI
                     PAAPFFDHLANRRFPVTNWLRTRQELDYIVEPDMFHDFFGHVPVLSQPVFADFMQMYG
                     KKAGDVIALGGDEMITRLYWYTAEYGLMQEAGQPLKAFGAGLMSSFTELQFAVESKDA
                     HHVPFDLETVMRTGYEIDKFQRAYFVLPSFDALRDAFRTADFEAIFTRRKGQPALDPA
                     TV"
     gene            665422..665898
                     /locus_tag="MESOP_RS03110"
                     /old_locus_tag="Mesop_0629"
     CDS             665422..665898
                     /locus_tag="MESOP_RS03110"
                     /old_locus_tag="Mesop_0629"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_013891868.1"
                     /db_xref="GI:503657792"
                     /translation="MPQFDDFEIKMLDVLQRDGRKPVSELAQEIGLSTTPCARRFEAL
                     QDAGIIKGFAAVISRRAVGLMVEVFIQVRLVSHSDGSPESFIAAVQRMDEVSSCWTMT
                     GDHDFLLHVMVPSVDELNAFVMHRLMRLDGVRDVHTQLVLQNIKGPGHVPLAHLKR"
     gene            666016..667563
                     /locus_tag="MESOP_RS03115"
                     /old_locus_tag="Mesop_0630"
     CDS             666016..667563
                     /locus_tag="MESOP_RS03115"
                     /old_locus_tag="Mesop_0630"
                     /EC_number="1.14.13.81"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-protoporphyrin IX monomethyl ester
                     cyclase"
                     /protein_id="WP_013891869.1"
                     /db_xref="GI:503657793"
                     /translation="MKIVLINPPHTAIGSRVPDDHLPPLGLLAIGGPLIDAGHEVRLV
                     DAEFGPMPLDIVVRSALDDRPDFVLIGHSGSTSAHPTALLIAGMIKAREPATIVIYGG
                     VFPTYHWRDILAATDVFDFIVRGEGEATDVALVEALEMHQPPASVAGIAFRDDLRRPF
                     ATQPAMTVAELDAYRVGWELIDHSRYSYWGGKRAVVMQFSRGCPHLCNYCGQRGFWTR
                     WRHRDPKKFAREIAWLHREHGVELINLADENPTVSKKAWRAFLDALIAEDVPVLIVGS
                     TRADDIVRDADILHLYRKAGVIRWLLGMENTDEQTLQLIRKGGSISSDREAIRLLRKH
                     GILSMATWVAGFEDEGFRHLWRGFRQLIAYDPDQIQALYVTPHRWTPFFRIARDRKVI
                     QQDARLWDYKHQVLHMTRLKPWMLFFSVKLIELAVQSRPKALARILFHPDPEQRHSMR
                     WYTRMGRRVWFREVWGFLARDIRVKDGPTLAEFCGAPQDAEEESMVFARQARKPAASA
                     VAQSRTA"
     gene            667670..668128
                     /locus_tag="MESOP_RS03120"
                     /old_locus_tag="Mesop_0631"
     CDS             667670..668128
                     /locus_tag="MESOP_RS03120"
                     /old_locus_tag="Mesop_0631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="WP_013891870.1"
                     /db_xref="GI:503657794"
                     /translation="MNLVTHKKMKGDRLMPWGKGTVVTGAKGFVFLAGNTGTAENYDP
                     SSGKGGAVGDAATQWRSILTNIKSDLEELGSSLEHLVKITQYVKGPFPDGGALSSPNF
                     RLDVMDEFFAEHCPKHCSYNNPPPSEVIGVVALAHPDLVIEIVAVAALPD"
     gene            complement(668163..669056)
                     /locus_tag="MESOP_RS03125"
                     /old_locus_tag="Mesop_0632"
     CDS             complement(668163..669056)
                     /locus_tag="MESOP_RS03125"
                     /old_locus_tag="Mesop_0632"
                     /EC_number="2.7.2.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528489.1"
                     /note="catalyzes the phosphorylation of
                     N-acetyl-L-glutamate to form N-acetyl-L-glutamate
                     5-phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate kinase"
                     /protein_id="WP_041164491.1"
                     /db_xref="GI:752465782"
                     /translation="MTEITATAEMQAALLSRALPYMQRYEHKTVVVKYGGHAMGDIEL
                     GKAFARDIALLKQSGVNPIVVHGGGPQIGAMLAKMGIESKFEGGLRVTDQKTVEIVEM
                     VLAGSINKEIVALINAEGEWAIGLCGKDGNMVFAEKARKTMIDPDSNIERVLDLGFVG
                     EPVEVDRTLLDLLARSEMIPVLAPVAPGRDGHTYNINADTFAGAIAGACKATRLLFLT
                     DVPGVLDKNKKLIDELTVAEARALIKDGTVSGGMIPKVETCIEAIERGVEGVVILNGK
                     TPHSVLLELFTEHGAGTLIVP"
     gene            complement(669208..670701)
                     /locus_tag="MESOP_RS03130"
                     /old_locus_tag="Mesop_0633"
     CDS             complement(669208..670701)
                     /locus_tag="MESOP_RS03130"
                     /old_locus_tag="Mesop_0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-aminohexanoate-cyclic-dimer hydrolase"
                     /protein_id="WP_013891872.1"
                     /db_xref="GI:503657796"
                     /translation="MSVERILWEEDATGLAGLVRKGELSAIELTEAAIARAEATRPEI
                     NATAEPLYEAARTRAKTMDRSLPLAGVPFAIKDLGIAIKGVPSHGGSRIPAWLPDVNS
                     VMTERYLAAGLVPIVTSTSPEHGLRLMTESKAFGITRNPWNTGHTTGGSSGGAAALVA
                     AGVVPVAHASDGGGSIRVPSACTGLVGLKTSRGRIPLTPLVSESWYGMVVDHAVTRSV
                     RDCALLLDLTHGPDSLSPYAALPPKGTFAAAAARDPGKLSLAVYRKSPLGLPISAETM
                     KALDIAVALAREGGHTVEDIDLPFIGRDFFADFCRTVASAVAGTLRAEAQRVGRAVTG
                     DVERATRVLGRLGEMVSAGETYAALQRLHAASRQLITETAQYDAVLLPVIAHPPLACG
                     AMDPRGADELIENLLDKLHLTPLLKVKSVFGQLMDKSLWFTHWPAIHNVSGQPSIALP
                     VHVTDAGLPLGIQAAGRPGDEETLLSFAAQMEKISGWLKRRAPLMMP"
     gene            670841..671380
                     /locus_tag="MESOP_RS03135"
                     /old_locus_tag="Mesop_0634"
     CDS             670841..671380
                     /locus_tag="MESOP_RS03135"
                     /old_locus_tag="Mesop_0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006200641.1"
                     /note="Bacteria have multiple sigma factors which are
                     active under specific conditions; the sigma factor binds
                     with the catalytic core of RNA polymerase to produce the
                     holoenzyme and directs bacterial core RNA polymerase to
                     specific promoter elements to initiate transcription;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_013891873.1"
                     /db_xref="GI:503657797"
                     /translation="MTPQDITKLIVRTSMKDRAAFDLLYRQTSAKLFGVCLRVLNDRG
                     DAEEALQEVFVKIWTKADRFAVSDLSPISWLVAIARNHAIDRIRARRKPAADIDAALD
                     VADPAPGPEAMAMAGDETERVHHCLDELEKDRAAAVRGAYLKGESYAELAERHGVPLN
                     TMRTWLRRSLMKLRECLER"
     gene            671365..672099
                     /locus_tag="MESOP_RS03140"
                     /old_locus_tag="Mesop_0635"
     CDS             671365..672099
                     /locus_tag="MESOP_RS03140"
                     /old_locus_tag="Mesop_0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma factor"
                     /protein_id="WP_041163974.1"
                     /db_xref="GI:752465265"
                     /translation="MPGEMTLAEDNGPERGGDDMFAAEYVLGVLPADERQIASRRIDS
                     ETDFARLVDGWEVRLSPLADAYPEIEPPASVKAAVDRRLFASTPAAPAEPRAGLWSSL
                     AFWRGLAVAAVAALALYIAVPYVNPVAVQPQTRLVASLAADGSDVKYLAVYDAAHHEV
                     SLSHVSGERASGKDFELWMIEGKNAPVSMGVIPSGATAHIVVSPSAQQKLAQGAVLAV
                     SLEPSGGSPTGQPTGPVVAAGNLKSI"
     gene            672323..672880
                     /locus_tag="MESOP_RS03145"
                     /old_locus_tag="Mesop_0636"
     CDS             672323..672880
                     /locus_tag="MESOP_RS03145"
                     /old_locus_tag="Mesop_0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fasciclin"
                     /protein_id="WP_013891875.1"
                     /db_xref="GI:503657799"
                     /translation="MRKFATLLLAGTIAVSALATAAYAENPMVGGAAMFANKTIVENA
                     VNSKDHTTLVAAVKAAGLVETLQGAGPFTVFAPTNEAFAALPAGTVDTLLKPENKDKL
                     AKILTCHVIGAKAMGADVAAMAKADGGTHKVKTAGGCELSLKADGGKVTVTDENGNVA
                     NVTIADVEQSNGVIHVIDKVLLPKM"
     gene            673106..673609
                     /locus_tag="MESOP_RS03150"
                     /old_locus_tag="Mesop_0637"
     CDS             673106..673609
                     /locus_tag="MESOP_RS03150"
                     /old_locus_tag="Mesop_0637"
                     /EC_number="1.8.4.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase"
                     /protein_id="WP_013891876.1"
                     /db_xref="GI:503657800"
                     /translation="MNRRDFLLSGVAAVGVVGAAATLLRMGSPQAAQAAEKFEVTKTD
                     DEWKAILSPAAFDVLRKEGTEYPGTSPLLNEHRKGIFACAGCDLPVYPSETKFDSGTG
                     WPSFWQEIANGIGKTEDRSLGMTRTEVHCRRCGGHLGHVFDDGPAPTGLRHCINGVAL
                     TFKPATA"
     gene            complement(673733..675322)
                     /locus_tag="MESOP_RS03155"
                     /old_locus_tag="Mesop_0638"
     CDS             complement(673733..675322)
                     /locus_tag="MESOP_RS03155"
                     /old_locus_tag="Mesop_0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013891877.1"
                     /db_xref="GI:503657801"
                     /translation="MATATITAGSARPSVPDTISTRRIIAFLAMVFGMFMAILDIQIV
                     SASLAEIQAGLSASSDEIPWVQTAYLIAEVVMIPLSGFLSRMLSTRVLFTIAAAGFTA
                     ASALAATATNIDQMIVYRAVQGFIGGGMIPSVFAAAFTIFPPSRRAIVSPMIGLVATL
                     APTIGPTVGGYISHAFSWHWLFLVNVVPGILVATAAWSLIDFDKPNLKLFSKFDWWGL
                     AGMAAFLGCMEYVLEEGPNNDWLQDHAVFICAIIMTIGAVVFFWRVFTAEEPIVDLRA
                     FSNINFAFGSLFSFVIGIGLYGLTYLYPVFLGRIRGYDSMMIGEALFVSGLAMFVTAP
                     ISGILSSKMDLRLMMMIGFFGFATGTWWMTHLTADWDFYELLIPQILRGCSMMLCMVP
                     INNIALGTLPPDRLKNASGLFNLTRNLGGAVGLALINTVLIDRNAFHYARLSEHVQWG
                     SAAAQTKLQNMTLNFEQTTGLDAASAAISKLSGMVQQQAALLSFMDVFYMLTVLFATL
                     GLFTMLINKPAAPGGGGGGGH"
     gene            complement(675396..676583)
                     /locus_tag="MESOP_RS03160"
                     /old_locus_tag="Mesop_0639"
     CDS             complement(675396..676583)
                     /locus_tag="MESOP_RS03160"
                     /old_locus_tag="Mesop_0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="WP_013891878.1"
                     /db_xref="GI:503657802"
                     /translation="MSSNAPSTAEVRPFPSAKVAPATEAPEIPVQPAAAPPPAEAPAK
                     KKRSVRSFLLPIIGVALLGAGAWYGYDYWMTGRFMISTDDAYVQADMAFVSPKISGYV
                     DQVKVSENQLVKAGDPLLTIDDGDYKIAVAQADAQIATLSKTLDRIDAQTKAAQASLQ
                     QAQAQKVADQAAASNAARAQQRAAQLVKTHVGTQAQLDDAQTALDQANAALVGADAQI
                     AAAQANIGVLEAQRAESASTLASLQLSRDKAARDLSFTVLKAPYDGVVGNRSVEQGDL
                     VSPGQKLAVVVPMDKLYIVANFKETQLARLVPGEKVNISVDAIDGQPIQGTVSSLAPA
                     SGAVFSLLPPENATGNFTKVVQRVPVRIDVPADALKTGKLRAGLSVVVNVDSRTAPAA
                     TTN"
     gene            676716..677450
                     /locus_tag="MESOP_RS03165"
                     /old_locus_tag="Mesop_0640"
     CDS             676716..677450
                     /locus_tag="MESOP_RS03165"
                     /old_locus_tag="Mesop_0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_013891879.1"
                     /db_xref="GI:503657803"
                     /translation="MADTTPDAENDKCEDLLDSLRRGRPAAGQDPVKRSQIIDGARRV
                     FIDKGFEAASMNDITREAGVSKGTIYVYFANKEELFEALIEEERGSIFKNMYDLLDRS
                     DDLRQTLVKFGKVLSMKITSARVIQAQRTVIGASDRIPDMGARFYERGPKRGHDRMVA
                     FLNAAIERGLLRIDDVDLAAYQFTDLCLAGLFRQCIFAYRVKAPSQEEIEHIVRSGVD
                     MFLKAYGTASLAEEERHQMIALEAKS"
     gene            complement(677463..678122)
                     /locus_tag="MESOP_RS03170"
                     /old_locus_tag="Mesop_0641"
     CDS             complement(677463..678122)
                     /locus_tag="MESOP_RS03170"
                     /old_locus_tag="Mesop_0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_013891880.1"
                     /db_xref="GI:503657804"
                     /translation="MNALNSTTIGTDLFTRGWIFIRGVPAMKFLPPEGPPEIAFAGRS
                     NVGKSSLINALVNQKGLARTSNTPGRTQELNYFVPDGFSGEGADLPPMALVDMPGYGY
                     ATAPKEKVDEWTKLVFDYLKGRVTLKRVYVLIDARHGIKAKDDEVLSLLDKAAVSYQI
                     VLTKTDKIKVAGVPRLIEETLAKIKKRPAAFPFVLATSSEKGEGLEELQAAIVLAANG
                     G"
     gene            complement(678119..678757)
                     /locus_tag="MESOP_RS03175"
                     /old_locus_tag="Mesop_0642"
     CDS             complement(678119..678757)
                     /locus_tag="MESOP_RS03175"
                     /old_locus_tag="Mesop_0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chloramphenicol acetyltransferase"
                     /protein_id="WP_041163976.1"
                     /db_xref="GI:752465267"
                     /translation="MDGPNPGIKHPIPMHTRVGFLKPLVSAPNIEIGDFTYYDDPDGP
                     DKFADKCVLHHYPFIGDKLIIGKFCAIAEGARFIMNGANHAMSGFSTYPFNIFGHGWE
                     NGFDPATWSKEVRGDTVVGSDVWIGMEAVILPGVQVGPGAIIAAKSVVTHDVPPYAIV
                     AGNAAKVVKMRFDDRTIRRLLAVAWWDWPVDKIGRNLDAIRGADISLLEAAA"
     gene            complement(678882..679196)
                     /locus_tag="MESOP_RS03180"
                     /old_locus_tag="Mesop_0643"
     CDS             complement(678882..679196)
                     /locus_tag="MESOP_RS03180"
                     /old_locus_tag="Mesop_0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891882.1"
                     /db_xref="GI:503657806"
                     /translation="MNWIKIAAVAGLLVCPGIAVAKEAVSCGGAAMLGGAQLNCSHVE
                     PKAPPQFCTFSWALHTMAGDQKVVEGTFLLPPGASNFTVYQGSGFDSALSNPIVICRG
                     NK"
     gene            679373..679837
                     /locus_tag="MESOP_RS03185"
                     /old_locus_tag="Mesop_0644"
     CDS             679373..679837
                     /locus_tag="MESOP_RS03185"
                     /old_locus_tag="Mesop_0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013891883.1"
                     /db_xref="GI:503657807"
                     /translation="MPISPNISFVLHDVARPLRKRFEQRSRTSGLTRAQWQVLAYLSL
                     HEGIHQNRLADLIEIVPITLARLLDKMEARGFIESRPNPADRRAWLLYLTPLAHPLLE
                     IMRANGQKTRDEAFDGLSSDAQQQLLQTLSLIKSNLLAACTQPAVDREKIHG"
     gene            679916..681145
                     /locus_tag="MESOP_RS03190"
                     /old_locus_tag="Mesop_0645"
     CDS             679916..681145
                     /locus_tag="MESOP_RS03190"
                     /old_locus_tag="Mesop_0645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="WP_049802436.1"
                     /db_xref="GI:908670638"
                     /translation="MQLDSEREQRRANVVIENDELDAPVAPEPATLEAPAKEPQPRQA
                     PAAVAPPAPAPTRPKRGLTRPILFGLLPVALVVGGYYYVTGGQVMTTDNAYIQAQSLG
                     VSTDVSGTVQEIDVHENQTVKKGDVLYRLRPASFETALAAAQAQLGTVRNQVLTLQAS
                     YQQSLSLIEQAQADIPYYESAFQRQQDLLKTSTASKASFDSAQHDLVAARQKVSVAKA
                     QAQATLAQLGGDANQPVEKNPFYLQAQSGVDDAQRNLADSVVKAPFDGVVTNVDALQV
                     GKYLPASQPAFSLISQTDLWIEAEPKETELTYVRPGQTATISVDTYPGAVWHGRVASI
                     SPASSSSFSLLPAQNTTGNWVKVVQRIPMRVTVDDPQGKPPLRGGMSVVVGIDTGHAR
                     GLPDFVTDLIGRFGQKS"
     gene            681142..682689
                     /locus_tag="MESOP_RS03195"
                     /old_locus_tag="Mesop_0646"
     CDS             681142..682689
                     /locus_tag="MESOP_RS03195"
                     /old_locus_tag="Mesop_0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="WP_013891885.1"
                     /db_xref="GI:503657809"
                     /translation="MTSASATGATAVVANRGAITACVILAVIMQALDTTIANVALPYI
                     QGSVSASADQINWVLTSYIVAAAVMTPPSGYLANRFGRKRILLTSITGFVVASVLCGF
                     AQSLPQIVGFRLLQGLFGAALVPLSQSILLDIYSVEERGSAMALFGVSVMVGPVLGPV
                     IGGWLTENVSWRWVFYINVPIGALAFAGVSMFVQETKLDIKARLDWLGFGMLSVTIAA
                     LQMFLDRGEQLNWFSSSEIIVEALICASAFYIFLVHTFTAKNTFVNPRLFLDRNFAVG
                     MIFIFIIGITYLASLALMTPYLQTLMGYPVVTAGIVMGPRGLGTMACMFLVGKLIGKV
                     DTRWLLLIGLLITAWAMYDMTGWTPEVSQWTIVSTGFVQGAGLGFLFVPLTTITFATL
                     APERRAEGTGLYNLSRNIGSSVGISVVTALLTQNVQINHANIATYVTPFNQAFGNPAI
                     FQAMNPYSAAGRAALDGVVTLQATIISYMNDFKLMMILSLAAIPLVLLLRKPATPAKV
                     DHSAVME"
     repeat_region   682745..682875
     gene            complement(683026..683586)
                     /locus_tag="MESOP_RS03200"
                     /old_locus_tag="Mesop_0647"
     CDS             complement(683026..683586)
                     /locus_tag="MESOP_RS03200"
                     /old_locus_tag="Mesop_0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fasciclin"
                     /protein_id="WP_013891886.1"
                     /db_xref="GI:503657810"
                     /translation="MRLPSFRIIALSALVAGAAIAAPAYAKNPTVGGAPMYATKNIVE
                     NAVNSKDHTTLVAAVKAAGLVDTLQGAGPFTVFAPTNEAFAALPAGTVETLLKPENKD
                     QLTKVLTAHVVAGKISGKDMMAKAKAMGGKYEMKTVSGDTLTAEVKKGKLYIMDESGG
                     EAKVTIADVNQSNGVIDVVNKVLLPK"
     gene            complement(683811..685622)
                     /locus_tag="MESOP_RS03205"
                     /old_locus_tag="Mesop_0648"
     CDS             complement(683811..685622)
                     /locus_tag="MESOP_RS03205"
                     /old_locus_tag="Mesop_0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98D88.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="insertase"
                     /protein_id="WP_013891887.1"
                     /db_xref="GI:503657811"
                     /translation="MENNRNFFITIALSVLILTLWQVFYMNPRVEQQREAAKIEQQRV
                     EEQKKAAEATNPGAATPAPAPGTIPNAPGGDAVTAAGRDQALAASKRVKIDTPSLEGS
                     INLTGARLDDLKLKHYTETVDKNSPEIELLNPQALPTGYFAEIGFVGNDKTGAVPGSD
                     TVWSVEGNPTLSPSTPVTLTYTNDKGLTFKRVFSVDANYMFTVTDTVQNSGASAVSLF
                     NYGRVTRYDKPAVASTYVLHEGLIGVTGTEGLAEYKYAKIESEKQVTPGKSTDGWLGI
                     TDKYWAVTLVPTEKQPFQPRYAFFEDGRHRYQSDFLTDAINVDAGQSATVETEIFAGA
                     KEVAKINAYEADRHIRQFNLVIDWGWFYFITKPMFWLIDTLYKFFGNFGLAILATTVI
                     VKALFFPLANKSYASMANMKKVQPKMLEIREKYADDKMKQQQAMMELYKTEKINPLAG
                     CWPVALQIPVFFSLYKVLYITIEMRHAPFFGWIQDLAAPDPTSIFNLFGLVPVTLPHM
                     LMIGVWPLIMGVTMFLQMRMNPTPPDPTQAAIFTWMPVIFTFMMAGFPAGLVIYWAWN
                     NTLSILQQGLIMKRQGAKIELWDNLVALFRKKPSPAE"
     gene            complement(685637..685990)
                     /gene="rnpA"
                     /locus_tag="MESOP_RS03210"
                     /old_locus_tag="Mesop_0649"
     CDS             complement(685637..685990)
                     /gene="rnpA"
                     /locus_tag="MESOP_RS03210"
                     /old_locus_tag="Mesop_0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862424.1"
                     /note="protein component of RNaseP which catalyzes the
                     removal of the 5'-leader sequence from pre-tRNA to produce
                     the mature 5'terminus; this enzyme also cleaves other RNA
                     substrates; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P"
                     /protein_id="WP_013891888.1"
                     /db_xref="GI:503657812"
                     /translation="MPATGKPVGVNPKRLLKRAEFLAVRRGEKRRGRFFLVEVLDRGD
                     GGVPRVGFTVTKKVGNAVVRNRVRRRLKEAVRVHAADDMMPGNDYVIVGRDDALRAPF
                     GQLKAELSRRLRGTR"
     gene            complement(686005..686139)
                     /gene="rpmH"
                     /locus_tag="MESOP_RS03215"
                     /old_locus_tag="Mesop_0650"
     CDS             complement(686005..686139)
                     /gene="rpmH"
                     /locus_tag="MESOP_RS03215"
                     /old_locus_tag="Mesop_0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6WYM6.1"
                     /note="in Escherichia coli transcription of this gene is
                     enhanced by polyamines; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L34"
                     /protein_id="WP_008833937.1"
                     /db_xref="GI:496109430"
                     /translation="MKRTYQPSKLVRKRRHGFRARMATKGGRGVVAARRNRGRKRLSA
                     "
     gene            686419..687906
                     /locus_tag="MESOP_RS03220"
                     /old_locus_tag="Mesop_0651"
     CDS             686419..687906
                     /locus_tag="MESOP_RS03220"
                     /old_locus_tag="Mesop_0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006200653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_013891889.1"
                     /db_xref="GI:503657813"
                     /translation="MSEATQAGEGTGTAPAAVRTVPLSRGLSTKLLLLTIVFVLLAEV
                     LIFLPWIASYRLNWLKERLSTAAAVSIVLVQGESTSLSRTAQNDVLMAIGAKAIAVRD
                     GGVSRLLVVADMPPQVDEHIDLASVGMVKGMTGALDTLFFGGDRMLRVFGPVGDSDKE
                     FELIMPDYSLRHAMLRYSRNVAFVSLLISLFTAMLVYAAIDLIMIGPIRTMTRSMLSF
                     SEAPDDPGRIIRPAARADEIGVAERELSQMQERLQKMLSEQKHLADLGLAVSKINHDM
                     RNILASAQLMSDRLRQVRDPTVQAFAPKLLRALDRAVSYSEGVLAYGRTQEPPPSRRR
                     VRLYQLVEDVHGLLDIGQGIEFINAVEAAFEVDADSDQLFRVLTNLCRNSVQAMAADT
                     ESAVVRRLAVSAERMGSVSRIVVTDTGPGLPPKARENLFAAFRGSARSGGTGLGLAIA
                     HELIRAHGGTVELVESIGGRTTFSVTIPDQPVRLDQARGSLRRPA"
     gene            688183..688259
                     /locus_tag="MESOP_RS03225"
                     /old_locus_tag="Mesop_R0005"
     tRNA            688183..688259
                     /locus_tag="MESOP_RS03225"
                     /old_locus_tag="Mesop_R0005"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:688217..688219,aa:Arg,seq:acg)
     gene            688480..689457
                     /locus_tag="MESOP_RS03230"
                     /old_locus_tag="Mesop_0652"
     CDS             688480..689457
                     /locus_tag="MESOP_RS03230"
                     /old_locus_tag="Mesop_0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013891890.1"
                     /db_xref="GI:503657814"
                     /translation="MSEVDWLSHLLQMITVTGQLEVRCAYGAPWRVTWGRAAANEIPY
                     HVIVKGRAILEDPETRTARELQSGDIVLLPHGAAHVLHDGSGQTPIRTHESVGSAGWM
                     LSENDGQGEQLDLLCGRFFVAPPHDRLIRNYLPTNLVARSMDGHGDESIGSASNQLAS
                     LVRLMRMESAGDRAGGRAILDALSSALFTLVLRSASEAEKAPEGLLALAGHPRLAPAI
                     AAMFADPARSWKLPDLAGMCGMSRATFMRHFRDRLGCSALDLLTDLRMSLAANELKKP
                     AISTEAVAETVGYQSVSAFRRVFAERMGMTPGEWRRLAHNGEQDARPGI"
     gene            689621..689952
                     /locus_tag="MESOP_RS03235"
                     /pseudo
     CDS             689621..689952
                     /locus_tag="MESOP_RS03235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009488365.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
     gene            689966..690883
                     /locus_tag="MESOP_RS03240"
                     /old_locus_tag="Mesop_0654"
     CDS             689966..690883
                     /locus_tag="MESOP_RS03240"
                     /old_locus_tag="Mesop_0654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020048033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH:quinone reductase"
                     /protein_id="WP_013891891.1"
                     /db_xref="GI:503657815"
                     /translation="MKAIVATDQAAGTAGMKLVQRPEPQAAINDVVVEVHAAGFVNTE
                     LEWPSTWADRAFRDRTPSILGHELAGVVTALGYGTTGLSIGQRVFGLADWHRDGTLAE
                     YVAMEARNLAPLPGDVDFTVGASLPISGLTAWQGLFQHGRLQAGQSVLAHGAAGAVGS
                     MVTQLAREAGAYVIGTGRAADRQKALDFGANEFVDLDNDKLEEVGGVDLVFDVIGGDI
                     QKRSAALIRAGGTLVTVVGPTDIRPADGLTVDFVVEADRGQLWEIVQRIRNGRLRTNI
                     GKVSSLDDAVATFNSTERRAGKTVVRVRP"
     gene            complement(691058..692490)
                     /locus_tag="MESOP_RS03245"
                     /pseudo
     CDS             complement(691058..692490)
                     /locus_tag="MESOP_RS03245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002714853.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="copper oxidase"
     gene            692689..694197
                     /locus_tag="MESOP_RS03250"
                     /old_locus_tag="Mesop_0657"
     CDS             692689..694197
                     /locus_tag="MESOP_RS03250"
                     /old_locus_tag="Mesop_0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper oxidase"
                     /protein_id="WP_013891894.1"
                     /db_xref="GI:503657818"
                     /translation="MHRRGFLAAGLATVLASPRALAQMKMDDMSTMPGMEMSGHNMDA
                     VTQGATMLPEGEALRALPLLANEAARPSVFKAKLTAEATIARFAEGLETPILAYNGMS
                     PGPLIEAFEGDRVEVSFANRINSEASTVHWHGMPVPADQDGNPMDPVAAGADRVYAFD
                     LPEGSAGSYWYHPHPHGRTAEQVYRGLAGAFVVKSKADPVPAEYGDTVLMLTDLRLAA
                     DGSIPGNTMTDLMNGRVGDQVLVNGQRNPRLAVAKGDRRRLRLYNATNARFLKLAFEG
                     AAMTIVGTDGGLIEAPVAVDEILLSPGERIELVVAFDRPGPATLGTLDYDRGWMGAGR
                     PADAGLTLLTVDVSEVPGAAMPPLPARLRPIAPLSAPAVSRRLVFTEIMATNATGMEM
                     GFLINGKTFDMARIDIVAKAGETELWEIVNQADMDHPFHVHGTQFQVIEHERDGKVSK
                     PPFVAWKDTVNVARGETVRLLLRQEQPGRRMYHCHILEHEQLGMMGVLDVRA"
     gene            694194..694757
                     /locus_tag="MESOP_RS03255"
                     /old_locus_tag="Mesop_0658"
     CDS             694194..694757
                     /locus_tag="MESOP_RS03255"
                     /old_locus_tag="Mesop_0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_013891895.1"
                     /db_xref="GI:503657819"
                     /translation="MKTRIPAGAATLALAGWMVLCSSMAPASSDATVAARQASMKAMA
                     GAARTIAEMFDGKREYNAGGFKAAADALSAHTSPALFAEFPAGTLGAPSGARVEIDQA
                     RPEFEALARHIGKLASALAAKADKAPAEISDDMRMGAGLPMDGGSLLGKRPDTAQADP
                     AKLPAEHLLHLILQDCSGCHSKFRQKK"
     gene            694879..695637
                     /locus_tag="MESOP_RS03260"
                     /old_locus_tag="Mesop_0659"
     CDS             694879..695637
                     /locus_tag="MESOP_RS03260"
                     /old_locus_tag="Mesop_0659"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_013891896.1"
                     /db_xref="GI:503657820"
                     /translation="MTSTNIKRALVTGAGAADGIGFAIARQLGHAGHAVFLTGASARV
                     LDRAAELRAEGIDANAAVADLTSAAEVERLRATAGAVDILVNNAGMGSLASPSVDKAF
                     LAMTEADWDRGIDVSLKTAFLVTRAFLPAMIEAGYGRIVNVASVTGPVVSFEGTSAYS
                     AAKAGMVGLMRTLALEVAKSGVTVNAVAPGWIETGASSEMERMAALQTPPARAGRPDE
                     VAAAVAFLASEGASYVNGALLVVDGGNSLQERKG"
     gene            complement(695666..696214)
                     /locus_tag="MESOP_RS03265"
                     /old_locus_tag="Mesop_0660"
     CDS             complement(695666..696214)
                     /locus_tag="MESOP_RS03265"
                     /old_locus_tag="Mesop_0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049802437.1"
                     /db_xref="GI:908670639"
                     /translation="MFAVLITVLVLDLRPPELPTFKALLELWPTWLSYSVSYLFIAIV
                     WANHHHLLRHAREATASLMWYNFAHLFSVSLLPLATAWMAVSELAPQPVAFYAAVFFL
                     VNLTYILLIRELIDPMPENAVPLAVRKRMRIRSLATLCLFALAGLVALKYPVAGLAIC
                     CCCLAVYLRPEAPGAGKSSGKG"
     gene            complement(696360..>696668)
                     /locus_tag="MESOP_RS03270"
                     /old_locus_tag="Mesop_0661"
                     /pseudo
     CDS             complement(696360..>696668)
                     /locus_tag="MESOP_RS03270"
                     /old_locus_tag="Mesop_0661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528513.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
     gene            696761..697432
                     /locus_tag="MESOP_RS03275"
                     /old_locus_tag="Mesop_0662"
     CDS             696761..697432
                     /locus_tag="MESOP_RS03275"
                     /old_locus_tag="Mesop_0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013891899.1"
                     /db_xref="GI:503657823"
                     /translation="MPAAFSAEPQMPATAEEEAYRHVQRALRLGRYKPGDRLIPEEIA
                     AEIGMSRMPVREAFRRLASDGLVVLRPNRGCVVAGLTVDELYEIFEIRSVLEGLAVRL
                     AMPRIDEEEFEEFERLLERMERAGQSGSSDWVVRHQEFHGRICALSRRPKLIHQIAAL
                     HVVIEPYMRIWFDDCDKPHSAREEHAAVIAALRSGDELQAEKVMQDHILSTAPMLAEC
                     VSPSR"
     gene            697523..698374
                     /locus_tag="MESOP_RS03280"
                     /old_locus_tag="Mesop_0663"
     CDS             697523..698374
                     /locus_tag="MESOP_RS03280"
                     /old_locus_tag="Mesop_0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013891900.1"
                     /db_xref="GI:503657824"
                     /translation="MKVCRLAAVAAALSMFGFMHTALAEDAPKAITIATEGAYAPWNF
                     TNADGKLDGLEIELANNLCERMKVKCTIIAQDWDGLIPSLKVGKFDVIMASMFITPKR
                     LETIDFTQPYAIDPGGFAAAKDSDLGKLGASTEKFKLDDEAASQAAVDKLKPLLKGKV
                     VGVQAATAMLEFVKKYFGDTVEIREYKTTEQHDLDLAAGRIDAIFAQKTALAATLAKP
                     EFSGFTVAGPGFVGGLFGAGTGAGLRKEDAKLKEMLNDAISAAIADGTIKRISEKWVK
                     TDVTPVK"
     gene            698447..699160
                     /locus_tag="MESOP_RS03285"
                     /old_locus_tag="Mesop_0664"
     CDS             698447..699160
                     /locus_tag="MESOP_RS03285"
                     /old_locus_tag="Mesop_0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891901.1"
                     /db_xref="GI:503657825"
                     /translation="MTDTLHILSLGKGGWGGALLLAAGVTFALSVLGFLLGALFGAVA
                     AGGRLSTRALPSWVAKGYGTVFRGVPDLLTIYLLYYGGSIALTEIGKFFGSAGFVGLP
                     TFATGVLAIGIISGAYQAEVYRGAYLAVDLGQFEASKALGLSRFQSLRLVIVPQLMRH
                     ALPGLGNVWQLVLKDSALISVIGLVELMRQSQIGAGSMREPFVFYVAAATLYFLIAAV
                     TGSVFRYGEARAWRGMVHA"
     gene            699157..699849
                     /locus_tag="MESOP_RS03290"
                     /old_locus_tag="Mesop_0665"
     CDS             699157..699849
                     /locus_tag="MESOP_RS03290"
                     /old_locus_tag="Mesop_0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891902.1"
                     /db_xref="GI:503657826"
                     /translation="MIDLAFFVEIIPTLLSGLPLTLQLAGLSIGIGFALALLLALAQQ
                     GNHRMLVWPIRSFVAVFRGTPLLVQIFLIYYGLGQFRPTLQSVGLWWLFREPYWCAII
                     ALSLNTAAYGSEILRGAIQGVPRGLVEAASAFGMTRLQTLRLVVLPLALRQAIPSYSN
                     EIILMVKGTSLASIVTLMEVTGIAQGLISQTYRAIEVFVAAGAIYLTINFTIISALNA
                     LETWLTPYRVRP"
     gene            699980..701566
                     /locus_tag="MESOP_RS03295"
                     /old_locus_tag="Mesop_0666"
     CDS             699980..701566
                     /locus_tag="MESOP_RS03295"
                     /old_locus_tag="Mesop_0666"
                     /EC_number="2.3.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006206633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltransferase"
                     /protein_id="WP_013891903.1"
                     /db_xref="GI:503657827"
                     /translation="MRDFQFPGRSPVRATQAVAATSHPLATLAAIDMLRAGGNAMDAA
                     VCAAAVQGVVEPQSTGIGGDCFVLYCPKGQGDVLAFNGSGRAPAGATVDWYLDKGFDE
                     LPKQGPHAVTVPGAVDAWSRLLEDHGRKSLAEALAPAIHYAENGYVVHDRVAFDWAEP
                     EIDLSADEHAARIFLPGGKAPRPGDIHRQPELAATLRTIAKHGRAGFYEGAVADDMVR
                     RLNELGGLHSYEDFAATKGDYVAPVSTTYGGYDIHQMPPNNQGLTALLMLNVLSGFKL
                     GGLDPNGAERLHLEIEAGRLAYQDRDRYVGDQDQVHVPTKQLLSGAYADRLRAEIDRD
                     RAMTHLPRLDLPGSDTVYISIVDRDRNAVSFINSTYYSFGSGVVGPKSGVVLQNRGSS
                     FRLDPTHPNAIAPGKRPMHTIMPGMATRNGRVVMPFGVMGGGYQPFGHVHLLTNMIDF
                     GMDPQQALDAPRVFYNDGMVEAERNVPAEALEGLRRRGHRLAEPQHPLGGGQAVLIDW
                     EKGTLTGASDPRKDGMALGY"
     gene            701779..703299
                     /locus_tag="MESOP_RS03300"
                     /old_locus_tag="Mesop_0667"
     CDS             701779..703299
                     /locus_tag="MESOP_RS03300"
                     /old_locus_tag="Mesop_0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase"
                     /protein_id="WP_041164495.1"
                     /db_xref="GI:752465786"
                     /translation="MTMSTNSKDLSRRLVAGTDDAPAILAPDRATLTHGELRSLIKAT
                     AERLRALGIGRGDRMAIVLPNGPEMATAFVAVAATASTAPLNPAYRADELDFYLTDIG
                     AKAILVAENEAGPAVAVAERLGIGVLRLVVSPAAGSFTIEGAAVGPQAAPDIAGDGDI
                     ALLLHTSGTTSRPKLVPLSHANIAASAAHIGATLGLTADDRCLNIMPLFHIHGLIAAV
                     LSSLASGGSIYCTPGFNALRFFQWLGEARPSWYTAVPTMHQAILARAARNTEALAGAR
                     LRFIRSSSASLPAQVMAELEATFGCPVIESYGMTEAAHQMASNRLPPGLRKPGSVGAG
                     AGPEVAVMAPDGRLLKAGETGEIVIRGPNVTAGYEKNPEANATAFAHGWFHTGDQGVL
                     DEDSYLRVTGRLKEIINRGGEKISPLEVDDVLMDHPAVAQVVTFAMPHDKLGEEVAAA
                     VVLREGMGATENDIRTYAATRLADFKVPRKVVILDEIPKGATGKLQRIGLAAKLGL"
     gene            703302..704282
                     /locus_tag="MESOP_RS03305"
                     /old_locus_tag="Mesop_0668"
     CDS             703302..704282
                     /locus_tag="MESOP_RS03305"
                     /old_locus_tag="Mesop_0668"
                     /EC_number="1.1.1.169"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q987N5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="WP_013891905.1"
                     /db_xref="GI:503657829"
                     /translation="MKITIFGAGAIGGYLAAKLAIAGRTDLSIVARGAHLEAIKADGL
                     RLIEDGQETLAPVRAAAKAEELGVQDTVVLALKAHSLTPALDQIAPLLGPKTSVVTMQ
                     NGVPWWYFHGVRGPLEGTRLNAVDPGGAIWQRIGPQRVIGAVVYPAVEVDAPGLIRHV
                     EGKRFSLGEPSGDRSERVTQLAEEMVKAGLQAPVRDDIRGEIWVKLWGNLSFNPISAL
                     TGSTLAAIVADEGTRALARTMMLEAQAIGESLGVRFPIGVDRRIKGAGDVGEHKTSML
                     QDLERGRPMEIDALVSAVQELGRLTDKPTPTVDAVLALVRRLALERGCYG"
     gene            704463..704747
                     /locus_tag="MESOP_RS03310"
                     /old_locus_tag="Mesop_0669"
     CDS             704463..704747
                     /locus_tag="MESOP_RS03310"
                     /old_locus_tag="Mesop_0669"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891906.1"
                     /db_xref="GI:503657830"
                     /translation="MVAASVSELVSALALASVSESVSELELVSALALALVSVLASALV
                     LVSVLASALVLVLALVLMSELELESGLEASFHGNVTKQLPPPNGAAKYVT"
     gene            complement(704846..706918)
                     /locus_tag="MESOP_RS03315"
                     /old_locus_tag="Mesop_0670"
     CDS             complement(704846..706918)
                     /locus_tag="MESOP_RS03315"
                     /old_locus_tag="Mesop_0670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015359094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163977.1"
                     /db_xref="GI:752465268"
                     /translation="MLDPASLESLVAMWLAILVTGLLAVPITGRLFPGETATHYFTGK
                     ILGWLICTYMAWLLSAFKLISFERSGVVVGLASLAAISALCSLGSKTMPRLRDVLRWE
                     MVFFLVYFAGVTLRAENPDIRNLEKFMDFGFVNAALRADYMPPPDPWWAGEPINYYYF
                     GHVAAAWLTKLSGVPSDHGYNLMIGVLFAFTAIMAFCIVRDGLRPAKPAISMALAVSA
                     AALVTLGGNFHSVLYGPLRGLSPTTLGREFRFPDSTRYVGFDPPTTDKVFTEMPAYGF
                     TVGDLHAHLLNLPAGLLILLILFRLVGRRLADRSSAGASPAEILALGFLFAVSAMTNS
                     WDAVSYGMLMGLAGLFIWLQPSQIDAKSLTWLVLRGVAVIAIACLLASPFLAAFKPFA
                     SNLRLAKAHTPIWQLAIVYGHVAVPCLVLLIGLFLWARDDAAWKSAAMLAALALLLVA
                     LPELVYVEDIYGGEYVRANTMFKFSFAAQPVAMLASVLFIGLLLSRGGLKMGALAAVL
                     AIPLFATLSYFWATHAGIGKALASNALTLDGLGSIDRDRAADRPLLDWLRAQGAGQRI
                     LLVEASGDSYTDAGRLSAMSGVPTVMGWQNHEWLWRGDYGATVIRAEDVASFYSSKTP
                     ANACRILTKYGITHIAIGTVEREKYAALDESLFRGLGTVIVNSGPSILVRFDASTCPN
                     GKSTDRMD"
     gene            complement(706911..707651)
                     /locus_tag="MESOP_RS03320"
     CDS             complement(706911..707651)
                     /locus_tag="MESOP_RS03320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017261466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163978.1"
                     /db_xref="GI:752465269"
                     /translation="MVGQNWSPQNMPALSVVLPAYNEQSNLADAVDEVLKHVASVVPD
                     LEIIVVNDGSTDQTQTILAALASRHPEVVAVHQANAGHGQALSNGVRKATGGYLLLLD
                     SDRQVSLEDFAVHWRMMADCDVLLGCRWPRADPLHRMIVSNSLRLLLAAKFGLAAKDA
                     NAPYKLLGRQVWHEAFDRMRTGSVIPSALLAARALQRTDIRVLQVSVAYRDRPHGPSS
                     LNLRRLASLCAKAVADIFFFRTSSRGHA"
     gene            complement(707722..709293)
                     /locus_tag="MESOP_RS03325"
                     /old_locus_tag="Mesop_0672"
     CDS             complement(707722..709293)
                     /locus_tag="MESOP_RS03325"
                     /old_locus_tag="Mesop_0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891909.1"
                     /db_xref="GI:503657833"
                     /translation="MVINKFWRSESGNFALLFALAAPAILAAVGFAADVSSVMRAKVN
                     LQNSLDAATLSSSHLSDDEAARRLAFDGYFQANVANHPELTNAKLTLSVDKGFNYVKT
                     KAIASADVNLYFAFLFGDNQHIEVDAGGVEATNNLEVVLVLDNTGSMAGAKIKALRDA
                     TKVLLDNLDGAKSPDRKVTAAIVPFVTAVNINGDKFDPSWIDMAGKSPNNGANFPLLP
                     DGKRVNHMDLFRDLAQGTGWQGTGWKGCVEARPGSAAISDVAPDQADANTLFVPYFAP
                     DDPGDATGPSASYGNDAKVYNNSYLSDDVQDGTDTKGKDKKIAKYENPKAKKINDKYA
                     PLTVGPNRACPTPVVPLTADLDKLRTAAAQMQEWNGSGTNVSEGLSWGMRVLSPAPPY
                     TDGAPWKTPNTSKIVVLLTDGENVVYGASAEPEKSDYTSYGYLSSGRFGTSNQTDAAR
                     SVDRWTLDVCDKLKAQQVQIYTITLQSDTAANRTLYGKCATNPADYYAVNDPSKLPNV
                     FQTIAGKFTTLQLVD"
     gene            complement(709497..710471)
                     /locus_tag="MESOP_RS03330"
                     /old_locus_tag="Mesop_0673"
     CDS             complement(709497..710471)
                     /locus_tag="MESOP_RS03330"
                     /old_locus_tag="Mesop_0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891910.1"
                     /db_xref="GI:503657834"
                     /translation="MAELTLRETSAGKTPAWLEWTLVGLGILGLLVAPFLVYPVFLMK
                     MLCFALFACAFNLLLGYTGLLSFGHATFFGGAAYFTAHAVKVWGWPPEAGILLGMAGA
                     ALLGLVMGFFAIRRQGIYFAMITLALSQMFFFFCVQAPFTEGEDGIQGVPRGVLLGVL
                     DLNVSLNMYYFVLAVFLVGVFSVWRIVNSPFGMILRSIRENEGRAISLGYSVAKYKLA
                     AFVMSAALAGLAGSLKAIVFQFATLTDVTWQMSGEVILMTLLGGIGTMVGPVIGASLV
                     VGLENTLATSGFPVTIATGLIFMVCVLIFRRGIVGELYARGLGRTGKG"
     gene            complement(710493..711380)
                     /locus_tag="MESOP_RS03335"
                     /old_locus_tag="Mesop_0674"
     CDS             complement(710493..711380)
                     /locus_tag="MESOP_RS03335"
                     /old_locus_tag="Mesop_0674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891911.1"
                     /db_xref="GI:503657835"
                     /translation="MTMIFGIPVQAFLGQLLVGLINGSFYAMLSLGLAVIFGLLRVIN
                     FAHGAQYMLGAFVGYLLLTYLGVGYWPALVLAPLIVGVFGVVVERLALSRLYDTDPLY
                     GLLFTFGLALVLEGIFRYYYGVSGNAYAVPPLLSGGTNLGFMFLPNYRGWVVVASLIV
                     CFGTWALIEKTRLGSYLRAATENPRLVQAFGVNVPLLLTLTYGLGSALAGLAGILAAP
                     IYQVSPLMGSDLIIVVFAVVVVGGMGSILGAIVTGYMLGLAEGLTKVFYPEASNLVVF
                     VIMAIVLLVRPAGLFGKDA"
     gene            complement(711388..712098)
                     /locus_tag="MESOP_RS03340"
                     /old_locus_tag="Mesop_0675"
     CDS             complement(711388..712098)
                     /locus_tag="MESOP_RS03340"
                     /old_locus_tag="Mesop_0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="WP_013891912.1"
                     /db_xref="GI:503657836"
                     /translation="MTSAAPLLAVRGLNAWYGEGHALHGVDLEVFAGETVTLLGRNGV
                     GKTTTLRAIMGLIRKRTGKVVFDGADLMRLPLHKTAHQGIGFVPEERGIFATLTVDEN
                     LVLPPVVAKGGMSVEEIFDLFPNLKERRNSPGTRLSGGEQQMLAIARMLRTGVKMLLL
                     DEPTEGLAPVIVQRIGELLATLKKRGMTILLVEQNFRFASRVADRFYLMEHGKIVAGF
                     PTGELADRMSLLHDVLGV"
     gene            complement(712091..712870)
                     /locus_tag="MESOP_RS03345"
                     /old_locus_tag="Mesop_0676"
     CDS             complement(712091..712870)
                     /locus_tag="MESOP_RS03345"
                     /old_locus_tag="Mesop_0676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_013891913.1"
                     /db_xref="GI:503657837"
                     /translation="MAPPDPNGNEPPVVLSARGLRRDFAGFVAVKNVDLDVRHGNIHA
                     LIGPNGAGKTTVFNLLTKFLAPTSGRIELLGHDITRTSPARVARMGLVRSFQISAIFP
                     HLSVLDNVRVALQRPGGLGVQFWRSLAALDRLTPRAMELLRSVGLDDAKNRLAGDLSY
                     GRKRVLEIATTLALDPKVLLLDEPMAGMGHEDVATVSDLIRSVASDRAVLMVEHNLTV
                     VADLCDWITVMQRGEVLAAGDYATVSRDERVKVAYMGTADD"
     gene            complement(712882..714090)
                     /locus_tag="MESOP_RS03350"
                     /old_locus_tag="Mesop_0677"
     CDS             complement(712882..714090)
                     /locus_tag="MESOP_RS03350"
                     /old_locus_tag="Mesop_0677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891914.1"
                     /db_xref="GI:503657838"
                     /translation="MKACYFVSAAFLAASAIPASAAEISDGKVKIGILNDQSGVYADF
                     GGKWSVEAAKMAVEDFGGKVQGAPIEIISADHQNKPDIASNIARQWYDTEQVDAIMEL
                     TTSSVALAVQGISKEKKKIDIVTGAATTELTGKQCSPYGFHWAYDTHSQAVGTGGSLV
                     QQGGDSWFFVTVDYAFGYSLKEQTAKFVEAHGGKVLGEVRYPLGATDYSSFLLQAQSS
                     GAKVIGLANAGLDTSNSIKQAAEFGIVQGGQRLAALLFTLAEVHGLGLQAAQGVVLTE
                     GYYWDRDDKSRAFGQRFFKRTNRMPNMIQAATYSAVTQYLKAIDKAGTDETEAVAKQL
                     HSLPVDDAVMTNGKVQADGNMVHDMYLYQVKAPSESSKDWDYYKYLATIPGKEAFLSE
                     KESGCPTAAQ"
     gene            714507..715271
                     /locus_tag="MESOP_RS03355"
                     /old_locus_tag="Mesop_0678"
     CDS             714507..715271
                     /locus_tag="MESOP_RS03355"
                     /old_locus_tag="Mesop_0678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006204575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_013891915.1"
                     /db_xref="GI:503657839"
                     /translation="MTAIQTFEAAQASLCAFDIDPDSPPAFVAADIEIAIIDDRSLMC
                     DCLARGLAEIEPAFRFQHFSSIETFDAADLEETQRISTVLMCAVWSNSEADHHLARIA
                     HLKVTRPWVSTIILADIENFDDVHKAIDNGACGYVPTSVSLQIAAKAIHLVAAGGIFI
                     PPSVLFQSAKNARDGHQATKSQAQEDNFFTSRQISVIEALRRGKANKIIAYELNMCES
                     TVKVHVRNIMKKLRARNRTEVAYILNTPPYEGLVKN"
     gene            complement(715291..717078)
                     /locus_tag="MESOP_RS03360"
                     /old_locus_tag="Mesop_0679"
     CDS             complement(715291..717078)
                     /locus_tag="MESOP_RS03360"
                     /old_locus_tag="Mesop_0679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013891916.1"
                     /db_xref="GI:503657840"
                     /translation="MTSNPEIILDIANLSVSVRGEDGERDVVSNLSLTLSRGETLCIA
                     GESGSGKSMTALAIMQLLPQPAARIASGKIRLRGGDMGDTDLATLDERQMRRIRGDRI
                     AMIFQEPMTSLNPVLSIGRQLTESIEAHTSLSQAEARQRAVEALKAVRISEAESRLKQ
                     FPHELSGGMRQRVMIAMALALEPDVLIADEPTTALDVTVQGEVLELLRDLQRQHGTSV
                     ILITHDMGVVAEMADRVIIMRHGRMVEEGKTSDIFARPQADYTRELLAAVPRIGSGIG
                     RQQSRDVEVAKPADVAVVNDLHVRFDLRGGFFGQVTRRVHAVEGVSFSIAPNETLALV
                     GESGCGKSTTAKALAGLVPYSGDIVIGGRNLSGLGRDERKAVRRDVQMIFQDPFASLD
                     PRMRVGDLVAEPLVIHGIASKEERLDRVAALFERVGLSSDQMELYPHEFSGGQRQRVC
                     IARALALRPKLIVADESVSALDVSVQARVLDLLKELQREFGVAYLFISHDMAVVENIS
                     DRVAVMYLGQIVEMGTRDQVFSNPRHPYTKRLIEAVPVPDPAQRRSRFARLDQEIPSA
                     TRKIGEAPRKLILSDVGGGHLVAAGSSDR"
     gene            complement(717290..718234)
                     /locus_tag="MESOP_RS03365"
                     /old_locus_tag="Mesop_0680"
     CDS             complement(717290..718234)
                     /locus_tag="MESOP_RS03365"
                     /old_locus_tag="Mesop_0680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetamidase"
                     /protein_id="WP_013891917.1"
                     /db_xref="GI:503657841"
                     /translation="MCNNCDYTIHGRHHHFGWDNSFVPAERVAPGSTIEFQCLDAGGG
                     QLQADSTVADVARMDFARVNPVTGPIFVEGAEPGDALKVTIELFKPSGFGWTANIPGF
                     GLLADDFKEPALNIWKYDAASLEPALFGKNARVPLKPFAGTIGNAPAEKGLHSVVPPR
                     RVGGNLDIRDLAAGTTLYLPVEVAGALFSVGDTHAAQGDGEVCGTAIESPMDVALKLD
                     LVKDARLKTPRFTTPGPVTRHLDAKGYEVTTGIGPYLMAGAREAVAQMVDLLAGRYRI
                     DPVEAYMLASVCGDLRISEIVDIPNWVVSFYFPRCVFE"
     gene            complement(718224..719867)
                     /locus_tag="MESOP_RS03370"
                     /old_locus_tag="Mesop_0681"
     CDS             complement(718224..719867)
                     /locus_tag="MESOP_RS03370"
                     /old_locus_tag="Mesop_0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013891918.1"
                     /db_xref="GI:503657842"
                     /translation="MKKFLASTVAASALALMLGMTSVRAEDAVDPNAKQGGAITITYK
                     DDVATLDPAIGYDWQNWSMIKSLFDGLMDYEPGTTNLKPDLAESYEISPDGKTFTFKL
                     RHGVKFHNGREMTADDVKYSLDRVTNPKTQSPGAGFFGSIKGYDDVAAGKATSLSGIT
                     VVDPYTVKFELTRPDATFLHVMAINFSHVVPKEEVEKYGADFGKHPVGTGAFKLAEWT
                     LGQRIVFERNADYWHKGLPHLDKITFEIGQEPIVALLRLQKGEIDVPGDGIPPAKFQE
                     VMADPEQKARVVEGGQLHTGYITMNITMAPFDNVKVRQAVNMAINKARIIQIINGRAV
                     PANQPLPPSMPGYDKEYKGYPYDVAKAKALLAEAGHPDGFETQLFAMNTDPNPRIAQA
                     IQQDLAAIGIKAGIQSLAQANVIAAGGDKAGAPMIWSGGMAWIADFPDPSNFYGPILG
                     CAGAVPGGWNWSWYCNKDLDAKAAEADSVVDPAKAAERDKMWSAIYDKVMEDAPWAPV
                     FNEQRFTMKSARMGGADNLYVDPVHIPINYDNVYVKDVQ"
     gene            complement(719913..720833)
                     /locus_tag="MESOP_RS03375"
                     /old_locus_tag="Mesop_0682"
     CDS             complement(719913..720833)
                     /locus_tag="MESOP_RS03375"
                     /old_locus_tag="Mesop_0682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891919.1"
                     /note="with GsiABD is involved in the transport of
                     glutathione into the cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione ABC transporter permease"
                     /protein_id="WP_013891919.1"
                     /db_xref="GI:503657843"
                     /translation="MIAYLGRRLIQSLLILLGVSLITFALLYLLPADPVRQIAGRSAT
                     PQTVENIRQQLGLDQPFVVQYWRYLTKLASGDLGRSYIQRSEVTELIVSRLPASLLLM
                     VGAILCELLIGLSMGLIAAVKRGTAADQTLMVASFVGVSAPQFVVGLLLLYVFAVRLS
                     WFPIGGYGTWRHLVLPSLTMGILGAGWYARMMRSSMIDVLRQDYVRTARAKGLARSAI
                     IFRHALPNAILPVIAMIGIDIGIFMGGIVVVESVFGWPGIGQLAWQAIQRVDIPIIMG
                     VTLVSAFAIVLGNLLADIIAPFIDPRIKLD"
     gene            complement(720830..721738)
                     /locus_tag="MESOP_RS03380"
                     /old_locus_tag="Mesop_0683"
     CDS             complement(720830..721738)
                     /locus_tag="MESOP_RS03380"
                     /old_locus_tag="Mesop_0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_013891920.1"
                     /db_xref="GI:503657844"
                     /translation="MTSPIAPDLAAPSRMPAKPRPGVWRRLVKRRLALLGLVIVAVVV
                     AGAVLAPWLTGYDPNEQMFDGLTIEGSPLPPDAKFWLGTDLLGRDLLTRILYGARTSL
                     IIGIVANGVALLIGTFVGVTAGYFRGWIGGALMRFTDLMMAFPALLLAICLAAVFQPS
                     LWIVAMVIALVNWVQTARVIYTETSSLAEREFIDAERTIGAGAPRILFRHILPHLLPT
                     IIVWGTLGISTTVLLEATLSFLGIGVQPPTASWGNIIFENQTYFQAAPWLVFFPGAAI
                     LALALAFNLIGDALRDILDPTQRGRA"
     gene            complement(721716..722348)
                     /locus_tag="MESOP_RS03385"
                     /old_locus_tag="Mesop_0684"
     CDS             complement(721716..722348)
                     /locus_tag="MESOP_RS03385"
                     /old_locus_tag="Mesop_0684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional antiterminator"
                     /protein_id="WP_013891921.1"
                     /db_xref="GI:503657845"
                     /translation="MTRISRIPNLGGARAFILHRPHPTVQAITRQLSAIGLVTLDCWP
                     ELPPEVLAADFVFFDADLGFDEQFPWKPGEASMPLVALIGSEAPGRIEWALSHNADAQ
                     LLKPVGNAGVYSALLIARQSFEARKHLASEIASLRQRVAERQTIVRAVAALSKGTDDE
                     RAYAQLRSLAMSWQISVEDAARRIVAMTSAEATGEEATDEEGGDDQSHRA"
     gene            complement(722345..723439)
                     /locus_tag="MESOP_RS03390"
                     /old_locus_tag="Mesop_0685"
     CDS             complement(722345..723439)
                     /locus_tag="MESOP_RS03390"
                     /old_locus_tag="Mesop_0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_041163979.1"
                     /db_xref="GI:752465270"
                     /translation="MKRRIEIGILYSRSGSYQLVSDACRMGAMRAIADINADRGHGIE
                     LVPIERDPQSNADRYATLCEDIFKTSSARHVVGCVTSWSRKETIPVLEKAGGMLWYAC
                     PYEGFEANEHVVYMHACPNQHLVPLMAHVAPRFGANGFLLGSNYIWGWEMNRVARDLI
                     ADAGGKVLGERYLRIGETDVTRLIAEIRATRPSFILNNLIGTSSYAFLAAYRDLGRDD
                     SAFSPETCPVISCNLTEGELPAIGESGKGHLSVGPYFAPRPAAFASSFEASAYASVQV
                     MADVLSRDPDAGPAEFSKAFAERRFSTRLGPIAIDAHSQHATLPVIIGRIADGFFEVV
                     SREDEVAPDPYLSRYDPAKTFGRPRLRVVS"
     gene            complement(723621..724109)
                     /locus_tag="MESOP_RS03395"
                     /old_locus_tag="Mesop_0686"
     CDS             complement(723621..724109)
                     /locus_tag="MESOP_RS03395"
                     /old_locus_tag="Mesop_0686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891923.1"
                     /db_xref="GI:503657847"
                     /translation="MTFSCIRKLALPILVVGVQSSCVIPDDTSRIAKVDPTTAAARKE
                     MVGLSEADVRMCAGFPTATADAGGSGQIWTYKRVVQRGNLSIVVPTLALGAIPTVGGS
                     VNVAPGGYCDTQIRMVDGRVAEVAYAGDNNLPNSRDALCVSTVDACVSYARQHSQRAT
                     AR"
     gene            complement(724273..725142)
                     /locus_tag="MESOP_RS03400"
                     /old_locus_tag="Mesop_0687"
     CDS             complement(724273..725142)
                     /locus_tag="MESOP_RS03400"
                     /old_locus_tag="Mesop_0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013891924.1"
                     /db_xref="GI:503657848"
                     /translation="MSQNSIPDFFVYGEPVRPLDVGFLHVETVLARSNIHLGQVAAHK
                     HPQMGQITYWTSGSGTYRIEDQSWDFSAPAVSFVPSNVVHGFSIGPGTDAIVVSVADD
                     ALAAIEAHSLLPLDRPVFADGLPQHAAWKRLAAVLDMIAAEYTEAQAGNDKTLPSLIA
                     VALSHIARLGPEVKDAAGSSEASLAQGLRRLVDAHFRDNWPVDRYVEALATTPHLLDK
                     ASRAVLGSGVKRVVGERRLLEAKRLLLFTVRTVEDITYEIGFDDPAYFSRFFRERVGE
                     APAAWRRRQLQGH"
     gene            725235..726779
                     /locus_tag="MESOP_RS03405"
                     /old_locus_tag="Mesop_0688"
     CDS             725235..726779
                     /locus_tag="MESOP_RS03405"
                     /old_locus_tag="Mesop_0688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Pyoverdin chromophore biosynthetic protein pvcC"
                     /protein_id="WP_013891925.1"
                     /db_xref="GI:503657849"
                     /translation="MRSEDFRADRARPFTGAEYLESLRDGREVFINGERIADVTTHPA
                     MRNSARSLARLYDALHDPKRRETLTTATDTGSGGYTHKYFRVAKSSGELAAQQTAIAE
                     WSRMSYGWMGRTPDYKAALMNTLGANADWYGPFKANALAWHSRAQEAVLFMNHAIVNP
                     PIDRHKPAEQVKDVFVHITKETDAGIYVSGAKVVATSSALTHYNFLAQSSATVTEDPS
                     LSVMFIVPMNAPGIKMFCRVSYEQTANTAAAPFDYPLSSRFDENDAILVLDNVFIPWE
                     DVLVLRDAQKILSFHPASGFMHGYCFQGCTRFAVKLDFLAGLLAKALRATGGDAFRGN
                     QAALGEVIALRHMFWSFSNAMAYNPIPWANGAVLPNLEAALAYRTFMSEAYPRVIDTV
                     RRVIASGLIYLPSSVRDFNNPEIDKYLAQYVRGSNDMGHVERIKIMKLLWDATGTEFG
                     GRHALYELNYAGAPEEVRLQVLKGAERGGRLKAMEELVDTCMADYDENGWTGDTWLNP
                     VPASAG"
     gene            726786..727295
                     /locus_tag="MESOP_RS03410"
                     /old_locus_tag="Mesop_0689"
     CDS             726786..727295
                     /locus_tag="MESOP_RS03410"
                     /old_locus_tag="Mesop_0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="WP_013891926.1"
                     /db_xref="GI:503657850"
                     /translation="MATQISKADFRDAMARVCAPVNIVTTDGPAGRGGFTATAMCSVS
                     DEPPTLLVCMNGRSAQAAMFLANRRFCVNVLTHDHMHLAGKFAGATKDMEARYSAARW
                     QTLTSGTPALSDAIVNFDCEIEDVHIVGTHNVMIGRVIDVRHGSGGSALLYVDRNYTQ
                     PTRLGSFGG"
     gene            complement(727299..727727)
                     /locus_tag="MESOP_RS03415"
                     /old_locus_tag="Mesop_0690"
     CDS             complement(727299..727727)
                     /locus_tag="MESOP_RS03415"
                     /old_locus_tag="Mesop_0690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013891927.1"
                     /db_xref="GI:503657851"
                     /translation="MLPENTRRSLPMALLHAREVVMARFRPMLAAHDVTEQQWRVLRV
                     LSEAGPVEATELADRASVLPPSLTRIIKALEGRKFITRNKAEGDGRRVVLTIAPAGSA
                     LIDALSPERRVIYDDIERRFGHERLEQLLDLLETLIDGES"
     gene            727913..728299
                     /locus_tag="MESOP_RS03420"
                     /old_locus_tag="Mesop_0691"
     CDS             727913..728299
                     /locus_tag="MESOP_RS03420"
                     /old_locus_tag="Mesop_0691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-carboxymethyl-2-hydroxymuconate isomerase"
                     /protein_id="WP_013891928.1"
                     /db_xref="GI:503657852"
                     /translation="MPHFSIEYSANLDAKVDMGELCGLVLRTLLDTGLFETGAVRVRA
                     FRADAYAIADRLPENAFLDMSFRIGTGRSAEDKKRTGEAVFTAVSEYLAVLFESPHFA
                     LSLEIREIDPVLSWKKNAIHPRLRGK"
     gene            728311..729828
                     /locus_tag="MESOP_RS03425"
                     /old_locus_tag="Mesop_0692"
     CDS             728311..729828
                     /locus_tag="MESOP_RS03425"
                     /old_locus_tag="Mesop_0692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891929.1"
                     /note="catalyzes the formation of betaine from betaine
                     aldehyde; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="betaine-aldehyde dehydrogenase"
                     /protein_id="WP_013891929.1"
                     /db_xref="GI:503657853"
                     /translation="MSDLEGNLKKAEAYLARFKRDGVLNQIGGEAVPAADGSSFETMS
                     PVDLKPLAKVARGSAADIDRAAKAAKAAFPAWAAMPGEARKKLLHKIADAIEARAEEI
                     ALVECMDTGQALKFMAKAALRGAENFRFFADRAPEARDGETLRTTGQVNITTRVPIGP
                     VGVITPWNTPFMLSTWKIAPALAAGCTVVHKPAEFSPLTARLLVEIAEEAGLPKGVWN
                     LVNGLGEHAGKALTEHPDIKAIGFVGESRTGSMIMKQGADTLKRVHFELGGKNPVIVF
                     ADADLERAADAAVFMIYSLNGERCTSSSRLLVEASVYDKFTDLVAEKAKRITIGHPLD
                     PKTVVGPLIHPVHEEKVLSYIEIGKSEGAVVAAGGGKFAGPGGGCYVSPTLFTGATNT
                     MRIAQEEIFGPVLTAIAFKDEAEALALANDTQYGLTGYLWTSDVTRAFRFTDALDAGM
                     IWVNSENVRHLPTPFGGVKNSGIGRDGGDHSFDFYMETKNIAFATSAHAIQKLGG"
     gene            729842..730822
                     /locus_tag="MESOP_RS03430"
                     /old_locus_tag="Mesop_0693"
     CDS             729842..730822
                     /locus_tag="MESOP_RS03430"
                     /old_locus_tag="Mesop_0693"
                     /EC_number="1.13.11.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
                     /protein_id="WP_013891930.1"
                     /db_xref="GI:503657854"
                     /translation="MPLPKPNLYPAFNIVRLSHVELAVTDLARSRAFYVDTLGLQVTD
                     ETSGAIYLRAMEERGHHCIVLRKATTPEARDLGFKVFSDEDLDKAVHFFKGKGLPVEW
                     VERPYQSRTFRTRDPHGIPLEFYAQMERLPPIHQKYALYKGVKPLRIDHFNCFSPNVD
                     ESVGFYNELGFRVTEYTEDAATGKLWAAWTHRKGGVHDIAFTNGIGPRLHHVAFWVPT
                     PLNIIDLLDLMATTGYLPNIERGPGRHGISNAFFLYVRDPDNHRIEIYCSDYQTVDPD
                     LEPIKWDLKDPQRQTLWGAPAPKSWFEEGSTFAGAAARQPDLTASPIIAP"
     gene            731063..731935
                     /locus_tag="MESOP_RS03435"
                     /old_locus_tag="Mesop_0694"
     CDS             731063..731935
                     /locus_tag="MESOP_RS03435"
                     /old_locus_tag="Mesop_0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
                     /protein_id="WP_013891931.1"
                     /db_xref="GI:503657855"
                     /translation="MTPPRLATFTADGKTRYGAVTGQGVVDLSARYAQWPTLREVIET
                     GALRRLAEEAEAFAVDFPLEAIAYDIPIPSPEKIICVGVNYPDRNEEYKDGQAAPSNP
                     SLFIRFPRSFVGHDAPLVRPPESPQLDYEGEIVIVIGKGGRRIAETDALGHIAALSLC
                     NEGTIRDWVRHAKFNVTQGKNFDRTGSIGPWLVPFTDEAQIADIALSTRVNGEIRQQD
                     RTSRMIFPFRKIINYISTFTTLVPGDIIVTGTPTGAGARFDPPIWLKPGDVIEVEADG
                     IGLLRNGVVDEASV"
     gene            731932..732738
                     /locus_tag="MESOP_RS03440"
                     /old_locus_tag="Mesop_0695"
     CDS             731932..732738
                     /locus_tag="MESOP_RS03440"
                     /old_locus_tag="Mesop_0695"
                     /EC_number="4.2.1.80"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxo-hept-3-ene-1,7-dioate hydratase"
                     /protein_id="WP_013891932.1"
                     /db_xref="GI:503657856"
                     /translation="MTPEQVEDAAARLFEAERSRRQMRLLSLDFPEATMEDAYRVQAA
                     LVARKIGAGLKPKGWKIGLTSKAMQYALAIDTPDSGVLFDDMFFSDGAAVPAGRFIQP
                     RVEAEIAFVMKAPLKGPGVTLFDVLNATDYITPALEILDTRIERVNAETKKVRTFFDT
                     ISDNAANAGIVIGGRPQRPDEADMRWIGAIVSRNAEVEETGLGAGVLNHPAMGIAWLA
                     DRLARYGMSIAAGEVVLSGSFVRPVEARPGDTIVADFGSSGTVSIHFAKS"
     gene            complement(732760..733779)
                     /locus_tag="MESOP_RS03445"
                     /old_locus_tag="Mesop_0696"
     CDS             complement(732760..733779)
                     /locus_tag="MESOP_RS03445"
                     /old_locus_tag="Mesop_0696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_013891933.1"
                     /db_xref="GI:503657857"
                     /translation="MSAVFAQSEPETEADVTALARRALEHWGVRDGEPELLKYRENAV
                     FRIRLPDGQPAAMRIHRPGYHSDAALSSELQWMGFLQSAGVATPSPVPTLNGDLFVPV
                     GTGTAAPRQVDCLSWLEGRAVGARGVPLGYAPEQARRVFTAIGRTIARMHNAAAGWAT
                     PPGFARHSWDFEGFFGATPIWGRFETCPFLDDISRELVFRAHEKAVAALSRHERSARN
                     FGLIHADLVRENVLLDGDAIQIIDFDDCGHGWHVYDLAVALYQNRDEAIYPLIEASLL
                     DGYRQERDLTPEDIASLPLFSALRAFAFLGWVQSRVEGDINRNAGMRISTIAADVVVA
                     YLRGT"
     gene            complement(733776..734009)
                     /locus_tag="MESOP_RS03450"
     CDS             complement(733776..734009)
                     /locus_tag="MESOP_RS03450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163980.1"
                     /db_xref="GI:752465271"
                     /translation="MFFGAELVHDRETREPAPDIAGRVINAMRHRGVLMGKTGIHGNV
                     LKIRPPMPFSRDNADLLIATLNEVLEEVGGVTA"
     repeat_region   734009..735486
     gene            734150..735181
                     /locus_tag="MESOP_RS03455"
                     /old_locus_tag="Mesop_0698"
     CDS             734150..735181
                     /locus_tag="MESOP_RS03455"
                     /old_locus_tag="Mesop_0698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013891550.1"
                     /db_xref="GI:503657474"
                     /translation="MEHYIGLDVSMKETAISIRQNGKRIWRGKCASDPQLLAAVIRKR
                     APHVRRVVFETGPLSVWFYHALTAEGLPVICIDARHAKAALDMAANKTDANDADGLAH
                     LAEVGFYREVRVKGFDSMLIRTLITARRQLLKMRLQISNQIRGLMKTFGLVVPKGAGS
                     VFERNVRDLLQGEEKLARIVVPMLQAWSGIRYQIAELSKQLAATAREDQHCRLLMSVP
                     GVGTVTATAFAAAVEDPANFRNSRAVGAWVGLTPRRYQSGEVDNDGHISRRGDNQLRG
                     LLYEAAAVILNRSTDTSSLRTWALELKDRIGFKRAAVALARKLAVIMHAMLRTGELFD
                     PHGGTQAAV"
     gene            complement(<735481..736554)
                     /locus_tag="MESOP_RS03460"
                     /pseudo
     CDS             complement(<735481..736554)
                     /locus_tag="MESOP_RS03460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528549.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
     gene            complement(736592..737941)
                     /locus_tag="MESOP_RS03465"
                     /old_locus_tag="Mesop_0699"
     CDS             complement(736592..737941)
                     /locus_tag="MESOP_RS03465"
                     /old_locus_tag="Mesop_0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891934.1"
                     /db_xref="GI:503657858"
                     /translation="MRDINFLTETNAKPIWHPMAHPAEMRANPPKVIMKGEGVTVTDI
                     DGNSVLDAVGGLWNVNLGYSCDPIKKAIADQLGALPYYSGFRGTSTGPSIELAYELSE
                     WFAPEGMVRTFFTSGGSDSVETALRLARQYWKIRGQGDRTKFLALKKGYHGTHFGAAS
                     VNGNANFRRNYEPLLPGVFHIPAPWTFRNPFDETDPARLAKLCAKALEDEIAFQGGDT
                     IAAFIMEPVLGAGGVIVPHESFMPLVREICDRHEILLIADEVVTGFGRTGAWAGSRLS
                     GVKPDFMTIAKAITSGYFPLGATLIGGKVADVFEADKTSFGAIGHGYTYSGHPVGCAA
                     GLAALAETKRLRLNENAAARGVELAAVLEGLKAKHEIVGDVRYKGLMAAVELVSDRAT
                     KKPSDKKTMAVVSEAAHEAGVMLRVSGNNIILSPPLIISAADVAKIGEAIDAGLSKL"
     gene            complement(737963..738631)
                     /locus_tag="MESOP_RS03470"
                     /old_locus_tag="Mesop_0700"
     CDS             complement(737963..738631)
                     /locus_tag="MESOP_RS03470"
                     /old_locus_tag="Mesop_0700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_013891935.1"
                     /db_xref="GI:503657859"
                     /translation="MSAVLAKALVLDFGGVVTRTLFETHALTEQALGLKPGTLQWRGP
                     FDPASDPLWRTMQADEISERDYWRTRTSEVGRLVGEDWQAMETFVQRARGAEPEKVVR
                     PEADSAIRAVHAAGFRLAILSNELDLFYGAGFRQKLPLLGLFDVIVDATHTGILKPDP
                     RAYAFVTEALGLPAGACVFVDDQQRNIDGGRAAGMRTVHFDVARPAFSYAEALGHFDL
                     VPAV"
     gene            complement(738628..739908)
                     /locus_tag="MESOP_RS03475"
                     /old_locus_tag="Mesop_0701"
     CDS             complement(738628..739908)
                     /locus_tag="MESOP_RS03475"
                     /old_locus_tag="Mesop_0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891936.1"
                     /db_xref="GI:503657860"
                     /translation="MPVDPAPRILVIGTGDTKADELLFMKACIEASGGRAVMMDVSVL
                     GDPPYSPDHDKHAVARAVDVTIAEIVSSGDENTAMTLMAGGAVQLVRQLHQRGEIDAF
                     IAIGGSMGTDLALDVALSLPLGVPKFVVSTIAYSHLIPPERVAPDLMMILWAGGLYGL
                     NNICKLVLSQACGAVVGAARIVLASRASAPALGPTIGMTSLGGSCLRYMKTLKPALER
                     RGYDVAVFHTTGMGGRAFESIAGQGHFCAVFDFSLQEITNHLAGSVVSSGADRLENAG
                     ARGIPQIAAPGAVDMVDLPTWQDLPAKFSQRPFHAHNRLIASVTVDADDRRQVARTIA
                     AKLGASKGRSAFILPSGGIQEWDMQGEPLYEPEALAAFVDEMRKAIPAGVEFHEIDAH
                     INSDAFVGKALEIFDRWVEEGVVPRGTPAKGVAA"
     gene            complement(739908..740678)
                     /locus_tag="MESOP_RS03480"
                     /old_locus_tag="Mesop_0702"
     CDS             complement(739908..740678)
                     /locus_tag="MESOP_RS03480"
                     /old_locus_tag="Mesop_0702"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_013891937.1"
                     /db_xref="GI:503657861"
                     /translation="MGTVGKAISLLELFTVAEPELGLSDLARRSGFDKATTRRLLVAL
                     TAHGFVEQDGGTRHYRLGAGLSRLARIREARFPFLQTAVPLVRDLASATAETVHLSEF
                     GIDRLVTVHVEHPTRANRVNVDIGQLLPLHSTASGIAYLSFAREETVKACLAGPLEAF
                     TAHTLTEPAAISRSLDEARGRGYSICDQGLEEGVIGVAAAILAADGFALGTIAVAAPK
                     ARTTAADIAARGLAAVAAAREISMRLNGENLQTLRRQA"
     gene            740869..742317
                     /locus_tag="MESOP_RS03485"
                     /old_locus_tag="Mesop_0703"
     CDS             740869..742317
                     /locus_tag="MESOP_RS03485"
                     /old_locus_tag="Mesop_0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_013891938.1"
                     /db_xref="GI:503657862"
                     /translation="MTAVLEQAPANRLRKNSLGVGAITFMVISAAAPLTAVAGGTPLG
                     MLMGNGAGFAGTYLIVTVLLLLFAVGYVAMSRHVGNAGAFYAYAARGLGGHAGGATAL
                     IAILSYNAMQIGVMGLLGAATAGLFAGWGINLPWWVWSFIAIALVAVLGYRQVDLSAK
                     ILTVLVLCEYAVVLILDIAILKTGGDSGLSAAPFSWSQITSGAPAIAILFCFAAFIGF
                     EATTIYAEEARDPKVTIPRATYISVVLIGVFYMVTAWLMAVGAGVDKLLPALQGLQDP
                     TTFLFGLSDRYAGTMLSQAMSILFVSSLFAGVLAFHNAVARYIYVSGREKLLPQSIGV
                     THSAHQSPHVASVIQSVLAAVVVGLFAVLGLDPVLALFSWLTNVATLGVIVMMAVASL
                     AVVMYFRANPSAQENALKTTILPGLTFIAFVVIIYLIVINFGSLSGAGGFLGVFLPGL
                     VLIAAVVGLLLAGALKSRDPVAFESLGLPLKD"
     gene            742383..743582
                     /locus_tag="MESOP_RS03490"
                     /old_locus_tag="Mesop_0704"
     CDS             742383..743582
                     /locus_tag="MESOP_RS03490"
                     /old_locus_tag="Mesop_0704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_013891939.1"
                     /db_xref="GI:503657863"
                     /translation="MSFAENITVEALEADPYPIYAELRRSAPVAFVPSVNLWFVTRWK
                     DVELVAKSPDIFSAIVKAGVSPVERSFGKPTILTTDGEIHKHLRQGVDPRYRPRTVAS
                     YAGDLVRSIAEPYLDRIASQGSAELMADYFEPVSTLCLARSLGLADIDMPTLRRWFYG
                     LAQGAINFEKDPKRQEIADAIGAEVGDAVTPTLERLVREPDDSALSHMLHDGMPEGKT
                     RPIEFLMPTVKVILLGGMQEPGHGAGSILVGLLRSPDQLRKVLDDPETFVPKAVDEGL
                     RWVAPIGTQTRETTRAVEIGGATIPAGAPVAALVSSASRDERRFADPDRFDIDRDEGN
                     HAAFGFGHHFCSGRFFAREQMCLAVRLLLERFPDLRLVPGKEPVFRGWEFRAPTTLHV
                     SFGVGPK"
     gene            743579..745066
                     /locus_tag="MESOP_RS03495"
                     /old_locus_tag="Mesop_0705"
     CDS             743579..745066
                     /locus_tag="MESOP_RS03495"
                     /old_locus_tag="Mesop_0705"
                     /EC_number="1.2.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009762358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyl-gamma-aminobutyraldehyde
                     dehydrogenase"
                     /protein_id="WP_013891940.1"
                     /db_xref="GI:503657864"
                     /translation="MITQNAIDILRKAEIGARGLFIDGAQAEATGGATLPVISPIDGR
                     PFASIADGNAADVDRAVQAARKAFEKGSWSRAAPAFRKKVLTRLAELVEKHIDELAVL
                     GVRDNGTEIGMAYKAEPLSAAGTIRYYAEAIDKVYGEIAPTAENVLGLIHKEPLGVVG
                     VIVPWNFPLMIGAWKIAPALAAGNCVVVKPPEIASLTLLRLAELAAEAGLPAGVLNVV
                     TGRGAAAGEALGLHMDVDAIAFTGSGPVGRRLLDYSARSNLKRVFLELGGKSPNIVFA
                     DAPDLKQAAVVSANGIFRNSGQVCVAGSRLLVQASVYDRFMDELLSATTRLRVGDPLD
                     LASDVGAVSSAEQLDKNLGFVAKAAEEGARLVTGGERILTETGGSYMAPTIFENVTQD
                     MQLAREEVFGPVLGVMRFETEEEAVRLANSTVYGLASAVWTSNLSTAHRMVRAINAGV
                     VHVNTYGGADITVPLGGVKQSGFGRDKSLHALEKYLELKTAWIAL"
     gene            745310..746164
                     /locus_tag="MESOP_RS03500"
                     /old_locus_tag="Mesop_0706"
     CDS             745310..746164
                     /locus_tag="MESOP_RS03500"
                     /old_locus_tag="Mesop_0706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013891941.1"
                     /db_xref="GI:503657865"
                     /translation="MSDVNNTSPASPWSTLNRRNGLALLFASAVAIGGLMAPHASFAE
                     DKKAIKVGIISGEDEDVWRVVVAQAAEKGLTIETVVFNDYTQPNEALERGEIDANAFQ
                     HQPYLDNQIKTQGYHIVRVGYTGVWPIGLYSKKYKAVADLPEGAVIGVPNDPSNEGRA
                     LRVLQNEGVIKLKDGTGILATTADIAENPKKVEIKELDAGIVGRSVEDLDAAVVNTDW
                     ALKSGLTPENRIAQEPIADNPYRNFIAVKVGNENEAWVKTLVASYQNEAVKSEFDKVY
                     KGTGLSAY"
     gene            746250..747338
                     /locus_tag="MESOP_RS03505"
                     /old_locus_tag="Mesop_0707"
     CDS             746250..747338
                     /locus_tag="MESOP_RS03505"
                     /old_locus_tag="Mesop_0707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter ATP-binding protein"
                     /protein_id="WP_013891942.1"
                     /db_xref="GI:503657866"
                     /translation="MNQHFTETTEAMDRPGAPPQDVVRLVDLKRRFGATAALDGISLT
                     VRKGEILGIIGRSGAGKSTLIRCLNGLERPDSGQVFIEGREISRLGERDLQPLRRRIG
                     MIFQHFNLLSAKTVEDNVALPLKIEGRSKAERLARAAELLDLVGLSEKAKAYPASLSG
                     GQKQRVGIARALAARPALLLSDEATSALDPETTRSILALLKDINRQLGLTILLITHEM
                     EVIRSIADRVAVIDAGRIVEEGPVWSVFADPRSDITRSLLGAIRPQLPAELAARLLPS
                     AGADTILRVDVAGDAARGPLLSDLAATVPGAFRLIHGGIDHVQQQPVGTLFLSVPGND
                     AGHLAEVITFLKSRQARVEVLGHVADPV"
     gene            747319..747975
                     /locus_tag="MESOP_RS03510"
                     /old_locus_tag="Mesop_0708"
     CDS             747319..747975
                     /locus_tag="MESOP_RS03510"
                     /old_locus_tag="Mesop_0708"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter permease"
                     /protein_id="WP_013891943.1"
                     /db_xref="GI:503657867"
                     /translation="MSPILFELLLRSIWETVLMTAASGLISLVFGLPLGLALIATERG
                     GLAESLWVNRVLGAVINGFRSVPFIILLVALIPLTRLIVGTSIGTWAAIVPLSIAATP
                     YYARIAEVSLREVDHGLIEAARAMGGNRWTIIREVLVPEALPGIVAGFTVTLVTLIGA
                     SAMAGAIGAGGLGDLAIRYGYQRFETSVMIAVVIVLIILVCGIQWAGDRLVARLDRRG
                     "
     gene            complement(747990..748563)
                     /locus_tag="MESOP_RS03515"
                     /old_locus_tag="Mesop_0710"
                     /pseudo
     CDS             complement(747990..748563)
                     /locus_tag="MESOP_RS03515"
                     /old_locus_tag="Mesop_0710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020048832.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine monophosphate-protein transferase"
     gene            complement(748567..748773)
                     /locus_tag="MESOP_RS03520"
     CDS             complement(748567..748773)
                     /locus_tag="MESOP_RS03520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012556851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163982.1"
                     /db_xref="GI:752465273"
                     /translation="MKSPSSRTIRSAKTGQFVLTSGRGEKISAVEGMKLSPRMAKVLN
                     HSARHGLSGDERRSLIKEEIGKKK"
     gene            complement(748833..749960)
                     /locus_tag="MESOP_RS03525"
                     /old_locus_tag="Mesop_0711"
     CDS             complement(748833..749960)
                     /locus_tag="MESOP_RS03525"
                     /old_locus_tag="Mesop_0711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein T"
                     /protein_id="WP_041163983.1"
                     /db_xref="GI:752465274"
                     /translation="METFLAERRSPFYSSIVGLGATMGRVGGDFISAKYYSGIADEHL
                     NTRKNVGVQDLSTMGKMDIKGPDAEALVNHVIVNDAAAMKPGQVRYSTVCREDGGILD
                     DLTVFRLGTEHFMLVTGSVNRLKMLPWLLHHAEGRKAYVTDITAAVPFPTIQGPRSRD
                     LLKALVRDADLDGLKRWAFTSGRVGETKVLISRTGVTGELGFELFVPADEAASVWERL
                     MQAGRDFGLKPYGVLAMFTLGLEKAYPAHGIDMDESRTPFHVGLDRWIKFDKGDFIGR
                     EALLKVRDKGLDERWTGLVLDGDKPATTDARVMADGEDAGIVTYSDHGYSLGKVLATA
                     HLRLPFTAIGTELSIEIEGKPTRAVVAPMPFFDPEGARLRG"
     gene            complement(750014..750790)
                     /locus_tag="MESOP_RS03530"
                     /old_locus_tag="Mesop_0712"
     CDS             complement(750014..750790)
                     /locus_tag="MESOP_RS03530"
                     /old_locus_tag="Mesop_0712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="WP_013891947.1"
                     /db_xref="GI:503657871"
                     /translation="MRLFGRFVLAASVALTLAAGAASAQDNKLRIGTEGAYPPFNYAN
                     ADGTLGGFDIDLGKALCAEMKADCEFTVQDFDGSIPALQAGKFDAIINITITPERAEK
                     VEFTRKYYQTPPAIAVPKDSPIAGTSPEDLRGKALGVQTATIHQKFAEQKYAGSTVKA
                     YPTGDDARTDMANGRLDAMMDGSIILTEWLKKPDGACCKLLGTLTADPAIHGPGVGIA
                     LQKGNKELADKFNAAIDALRAAGKYKEINDKYFSFDVYGN"
     gene            complement(750919..752661)
                     /locus_tag="MESOP_RS03535"
                     /old_locus_tag="Mesop_0713"
     CDS             complement(750919..752661)
                     /locus_tag="MESOP_RS03535"
                     /old_locus_tag="Mesop_0713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylhydantoinase"
                     /protein_id="WP_041164501.1"
                     /db_xref="GI:752465792"
                     /translation="MAKLDAITLSVLQAALQQVCDEMDLTFSRAAFSPVIAEANDRSD
                     GIYSAVDGSLIAQGSQGLPVFVGVMQYSTRTVIGMIADGRCLAPEPGDIYIVNDPYLG
                     GTHLMDVRFVMPVYRAGEIFCWLSNTGHWPDIGGSVPGGFSASATAVEQEGLRLPPVK
                     LFKKGVLDPEIYAIICSNIRVADQRIGDIRAQAAALLIGQDRLNGILDRYGDETVVEA
                     IAELRRRAAEQMRANIAAIPDGTYRSRAFVDSDGVVNEPLTIALAVEKKGDTLTFDFA
                     GSSQPCAGPMNSVLATTLSSVYLAMRHIFPDVPISAGAFEPLIVKRPEGTFLDARYPR
                     PVSGCAAEVSQRIAEAVFAAMVQALPDKVTAAPAGSSGNFALGGNDPARGRDYVMYQI
                     SGGGYGGNSGHDGLTNGCSTIGISKSPPVEIMEQAFPVLYRHYALREGSGGAGKHRGG
                     FGLAYEVEILRGDARASFVMDHGRFGPQGALGGSDGEPNTVTVFRNGEEHVPPHLSKE
                     QDIPLKAGDRVRVGTPGGGGYGDPFQRDADQVQRDVALGYYTPKEASQKFGVALSAND
                     LSVDRKATEAQRAG"
     gene            complement(752678..754762)
                     /locus_tag="MESOP_RS03540"
                     /old_locus_tag="Mesop_0714"
     CDS             complement(752678..754762)
                     /locus_tag="MESOP_RS03540"
                     /old_locus_tag="Mesop_0714"
                     /EC_number="3.5.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydantoinase"
                     /protein_id="WP_013891949.1"
                     /db_xref="GI:503657873"
                     /translation="MKENFSVQQPDSLGSVVAGIDVGGTFTDLLLIDGKDGGKVHIAK
                     TPTTVDNQAFGVVSALGDTGFPIDGIDLIVHGTTTTTNAVLERRLAKTGMITTRGFRD
                     VIELGRRTRPQAYGMTGTFVPVIPRNLRLEVSERVEASGTVRTPLDEAEMRAAVKALI
                     DAGCESLVIHFLHSYANPLHERRAAEIAAELWPNGYITTGHALLSEAREFERGVTASV
                     NASVQPILERYVERLRKELADKGYARDFLIMNGNGGMISARFVTRESAKTVMSGPASG
                     VIAAAYTGKRAGFENLVTYDMGGTSTDVALIRNAEPAVSNEIEIEYAMPIHVPMVAVH
                     TVGAGGGSIARVDAAGLIQIGPESAGANPGPICYGRGGLEPTITDANLVLGRLAPKKL
                     LAVENPVTSERVTGIFADRIGKATGLSGVEAAGAVLRLGNMKMAGAIRMVSVSRGHDP
                     RDFALFAFGGAGPLHATALARELGLPKVLVPARPGITNALGCVVADLRHDFVNTVNQP
                     VAILDETQLHDLLERHRNEGEELIGKEAVKPETIRVTHSADMQFVGQTHIINVPLPSS
                     SVTRQELQALFEKAYFARFKVELPEIRANLVNLNTSVTGVRPAIDLSRLIDPAGRAKT
                     LDEARREIRPVWYSGRWHDTPVYVREKLPLDAIIEGPAILEQMDATTVLEPGDRARSD
                     ADGNIIIDIGEA"
     gene            754984..755811
                     /locus_tag="MESOP_RS03545"
                     /old_locus_tag="Mesop_0715"
     CDS             754984..755811
                     /locus_tag="MESOP_RS03545"
                     /old_locus_tag="Mesop_0715"
                     /EC_number="1.18.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020629105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin--NADP reductase"
                     /protein_id="WP_013891950.1"
                     /db_xref="GI:503657874"
                     /translation="MNTTSAFSTDGARPLQFPIPANVYAETVVSVKHYTDRLFSFRIT
                     RPQSLRFRSGEFVMIGLPNAEKPVYRAYSVASPAWDEELEFFSIKVPDGPLTSELQKI
                     QVGDTVIMRQKSTGTLVVDALTPAKRLFMISTGTGIAPFASLLRDPDTYEKFDQLILT
                     HTCRDIAELTYGQELVAALESDPLIGELTTGRVTLYNSTTREESACMGRITALIGSGK
                     FYSDLGIEKLNPETDRIMICGSMHMLKDVKELAESLGFQEGSLSHPATFVVERAFVG"
     gene            756033..757079
                     /locus_tag="MESOP_RS03550"
                     /old_locus_tag="Mesop_0716"
     CDS             756033..757079
                     /locus_tag="MESOP_RS03550"
                     /old_locus_tag="Mesop_0716"
                     /EC_number="4.1.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribose-phosphate aldolase"
                     /protein_id="WP_013891951.1"
                     /db_xref="GI:503657875"
                     /translation="MSSTIREADLGTKVTPLPARAAANSAVPLDHRIARNPGMKLDLG
                     FMESVRSVNRSALERRVASLTKRRSIKADNQAAWLLRAVACMDLTTLNSNDTEERVRR
                     LCAKAINPFRRDIVEGLGIAGETIRPAAVCVYHPFVATAVDVVRGTGIHVAAVSTAFP
                     HGLAPLSTRLQEIEASVRDGADEIDVVIPRGLVFGAKWRELYNEIVSMRAACGDAHLK
                     VILGTGDLATLRNVMLASMVAMMAGADFIKTSTGKESVNATLPVGLAMVRAIRAYFEE
                     TGHLIGFKPAGGISTAKASLDWLVLMKEELGRPWLEPELFRFGASSLLTDIERQLEHH
                     LTGHYSANHRHAMA"
     gene            757314..759686
                     /locus_tag="MESOP_RS03555"
                     /old_locus_tag="Mesop_0717"
     CDS             757314..759686
                     /locus_tag="MESOP_RS03555"
                     /old_locus_tag="Mesop_0717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010912703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_013891952.1"
                     /db_xref="GI:503657876"
                     /translation="MNILERYHAMEYGPAPEARNEADAWLAGRDFSKALFIDGAWKAA
                     GGGKTFETSEPSSGKLLAKISDAGAADIDAAVAAATKALPKWSASSGYQRAKVLYAIG
                     RAMQRHQRLFAVLETIDNGKPIRESRDIDVPLAIRHFIHHAGWAQALDKDFPGHKGVG
                     VVGQIIPWNFPLLMLAWKVAPALAAGCTVVLKPAEFTPLTSILFAEICERAGVPKGVV
                     NIVQGGPEAGGAIVNHPGIQKIAFTGSSEVGKIIRKATAGSGKKLSLELGGKSAFIVF
                     EDADLDSAVEGLVDGIWFNQGQVCCAGSRLLVQEGIAEALIAKVKTRMSRLRVGSPLD
                     KNTDIGPLVDATQLDRVKGLVAEGARQGAVCWQPDAALPSSGYYHLPTLATGVSPANI
                     LAQEEVFGPVLATMTFRNTEEAIELANNTRYGLAASVWSENVNLALHVAPQLKAGVVW
                     VNGTNMFDAACGFGGYRESGFGREGGREGMFEYLAAKLPLGPAIKPATISAQPVEQAD
                     GSAIDRTAKLFIGGKQVRPDSNYSLAVATAKGKLAGEVGFGNRKDIRDAVSAARACKA
                     WPEATAYNRSQVLYYLAENLSGRASEFAARLTELTGATPKAAREEVDQSIERLFLYAG
                     LADKFEGRMHQPPARAVTLALHEPVGVVGIVAPDASPLLGLISLIAPALAMGNTVVAV
                     PSERYPLLATDLYQVIEYSDVPAGAINIVTGRTAELAGVLAKHDDVDGLWVFADAETC
                     AKAEASSIGNLKRVWSGNGRSLDWASDEAAGDALLRRAIEVKNVWVPYGD"
     gene            759874..760605
                     /locus_tag="MESOP_RS03560"
                     /old_locus_tag="Mesop_0718"
     CDS             759874..760605
                     /locus_tag="MESOP_RS03560"
                     /old_locus_tag="Mesop_0718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_013891953.1"
                     /db_xref="GI:503657877"
                     /translation="MADLTGKIVVVTAAAQGIGKASALAFAKAGATVYATDINETLLA
                     ELAKMTGIKARRLDVLNDEAVNTAFAEIGRVDVLFNCAGFVHSGSILEMKDSDLDFAF
                     NLNVRAMIRTIRAVLPGMLERGDGSIINMASLASSTKGVPNRFAYGVTKAAVIGLTKA
                     VAADYVGKGIRCNAICPGTVESPSLQDRMHAQGDYEAARAAFIARQPMGRLGTPEEIA
                     DLAVYLAGATYTSGQAYNIDGGWSI"
     gene            760810..761655
                     /locus_tag="MESOP_RS03565"
                     /old_locus_tag="Mesop_0719"
     CDS             760810..761655
                     /locus_tag="MESOP_RS03565"
                     /old_locus_tag="Mesop_0719"
                     /EC_number="4.3.2.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
                     /protein_id="WP_013891954.1"
                     /db_xref="GI:503657878"
                     /translation="MKLLRYGEVGNERPGLLDADGTIRDLSAHVADIAGTTLHPASLD
                     MLAKLDAKSLPAVSGKPRLGACVAGTGKFICIGLNYSDHAAETGATVPPEPIIFMKAS
                     SAIVGPDDDVLIPRGSEKTDWEVELGVVIGKTAKYVSEADALDYVAGYCVSHDVSERA
                     FQAERQGQWTKGKSCDTFGPTGPWLVTKDEVADPQNLKMWLTVNGKTMQNGSTRTMVY
                     GVAYLVAYLSQFMSLHPGDIISTGTPPGVGLGMKPPVFLKAGDVVELGIEGLGQQKQT
                     FKADE"
     gene            complement(761925..762923)
                     /locus_tag="MESOP_RS03570"
                     /old_locus_tag="Mesop_0720"
     CDS             complement(761925..762923)
                     /locus_tag="MESOP_RS03570"
                     /old_locus_tag="Mesop_0720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter ATPase"
                     /protein_id="WP_013891955.1"
                     /db_xref="GI:503657879"
                     /translation="MGSLKIENVKKAFGPVEVLKGIDLEVTDGEFVVFVGPSGCGKST
                     LLRVIAGLEDSTSGRVVIDGADVSATPPAKRGIAMVFQTYALYPHLTVKNNMGLGLKQ
                     AGTPTAEIDRRIGIASSMLSLEPYLERRPAELSGGQRQRVAIGRAVVREPKLFLFDEP
                     LSNLDAALRVNTRLEIAQLHRRLKATMIYVTHDQVEAMTLADKIVVLNAGRIEQIGGP
                     MELYNSPANEFVAGFIGSPKMNFIDGARLGDTAKTIGVRPEHLTVAPKSGSWKGTVVH
                     AEHLGADTNLYLDCEKAGLITVRIFGVYDAEPGATLYATPDPAKTYRFGADGKVLK"
     gene            complement(762982..764043)
                     /locus_tag="MESOP_RS03575"
                     /old_locus_tag="Mesop_0721"
     CDS             complement(762982..764043)
                     /locus_tag="MESOP_RS03575"
                     /old_locus_tag="Mesop_0721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_013891956.1"
                     /db_xref="GI:503657880"
                     /translation="MNSKPPLRVVVAGLGNMGRSHALAYHTNPGFQIAALVNRSDVPL
                     PDGLTGYGIRRSFDEALRDEKPDVACIATYSDSHADYAVRAFEAGCHVFVEKPLATTV
                     ADAKRVVAAAKANGRKLVIGYILRHHPSWIRLIAEARKLGGPYVFRMNLNQQSSGHTW
                     ETHKQLMQTTSPIVDCGVHYLDVMLQITDAKPVEVRGMGVRLTEEVAPSMYNYGHLQV
                     LFDDGSVGWYEAGWGPMISETAFFVKDVISPNGCVSIVMKEGVRSDDIDTHTKTSTIR
                     LHSAATGADGKFAKPDEMLSMEGEPGHQDLCDLEQAFVLKAIREDLDLTKHMDDAVKS
                     LAVCFAADESVRSGKAVRL"
     gene            complement(764292..765131)
                     /locus_tag="MESOP_RS03580"
                     /old_locus_tag="Mesop_0722"
     CDS             complement(764292..765131)
                     /locus_tag="MESOP_RS03580"
                     /old_locus_tag="Mesop_0722"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_010912697.1"
                     /db_xref="GI:499215157"
                     /translation="MSTATRSLPRTIGAHAILLTYTAIALFPVILVIMNSFKSRAGIF
                     GAPLTPPTPKTFDLIGYTTVIGQGDFIHYFQNSLVVTVASLFFVLLFGAMAAFALSEY
                     RFRGNSLMGLYLALGIMIPIRLGTVAILQLMVASGLVNTLTALILVYTAQGLPLAVFI
                     LSEFMKQVSDDLKNAGRIDGLSEYTIFFRLVLPLVRPSMATVAVFTMIPIWNDLWFPL
                     ILAPSEETKTVTLGAQLFLGQFVTNWNAILAALSLAIMPVLILYVIFSRQLIRGITSG
                     AVK"
     gene            complement(765356..766285)
                     /locus_tag="MESOP_RS03585"
                     /old_locus_tag="Mesop_0723"
     CDS             complement(765356..766285)
                     /locus_tag="MESOP_RS03585"
                     /old_locus_tag="Mesop_0723"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006202297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013891957.1"
                     /db_xref="GI:503657881"
                     /translation="MAAEIRPKRPVRWHIGIFLAPAVLVYTAIMILPLAGTLQLSLFR
                     NVSESQVFVGLENFRTLFGDPNWSVGFWNALRNNTWFFIIHMLVQNPIGVMLAALLSS
                     PRLRFAAFYRTAIFVPTILSFVIVGFAWKLILSPLWGVAPHMMDLVGLKSLFTPWLGK
                     EQYALTALSLISVWQFVGIPMMLIYAALLSIPEEVIEAAECDGITGLSQFWKIKLPLI
                     LPSIGIISILTFVGNFNAFDLIYTAQGALAGPNYSTDILGTFLYRAFFGFQLQVGDPN
                     MGAAIATMMFLIILGGVCVYLFLVQTRLRRYQF"
     gene            complement(766532..767791)
                     /locus_tag="MESOP_RS03590"
                     /old_locus_tag="Mesop_0724"
     CDS             complement(766532..767791)
                     /locus_tag="MESOP_RS03590"
                     /old_locus_tag="Mesop_0724"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_013891958.1"
                     /db_xref="GI:503657882"
                     /translation="MTTKLLTALLLGTSILGSAGLAHAADVTLNIESWRGDDLAIWKD
                     KLIPAFEAKNPGIKVVFAPSAPTEYDAALGAKLAAGSAGDLITCRPFDKSLELFKKGN
                     LADLSALPGMENFSPVAKSAWQTDDGKASFCVPMASVIHGFIYNKDAFDKLGIKVPQT
                     RDEFFAALDKIKADGTYIPMAMGTKDLWEAATMGYQNIGPNYWKGEDGRAALIKGDQK
                     LTDKDWVAPYEELAKWKPYLGDGFEAQTYPDSQNLFTLGRAAIYPAGSWEIGLFNTQA
                     QFKMGAFPPPVEKAGDTCYISDHTDIGMGLNAASKNADAAKTFLSWVASPDFATIYAN
                     ALPGFFSLNSAPVKMEDPLAQEFVSWRGKCKSTIRSTYQILSRGTPNLENETWVESAN
                     VINGTDTPEAAAKKLQTGLDSWYKPAK"
     gene            complement(767909..768859)
                     /locus_tag="MESOP_RS03595"
                     /old_locus_tag="Mesop_0725"
     CDS             complement(767909..768859)
                     /locus_tag="MESOP_RS03595"
                     /old_locus_tag="Mesop_0725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015314653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylmuramic acid-6-phosphate etherase"
                     /protein_id="WP_013891959.1"
                     /db_xref="GI:503657883"
                     /translation="MAETRTEALHRNAEGLDIQAPEAILASLADAQVEAAKAVRNAIP
                     SIAKAAEIIADRLNGGGRLAYAAAGSSGLMALADALELPGTFGIERDRIAILIAGGDE
                     AFHTLAGGPEDDTEEAAAAVASAGIGKGDCLIAVSASGTTPYAVHALQEAARRGAATI
                     GIANNRNSALLQQAGTAILLETPPEVIAGSTRMGAGTAQKIALNMLSTLTAVHLGHVH
                     DGYMVNLMADNIKLRDRAARIVAAVSGRGRDEAAQLLEKSGGAVKTAILLAAGADNAD
                     AARKILEGTGQKLRPALSALEHDPEKWNPLFGKDRARTKK"
     gene            769058..769939
                     /locus_tag="MESOP_RS03600"
                     /old_locus_tag="Mesop_0726"
     CDS             769058..769939
                     /locus_tag="MESOP_RS03600"
                     /old_locus_tag="Mesop_0726"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine kinase"
                     /protein_id="WP_013891960.1"
                     /db_xref="GI:503657884"
                     /translation="MNFVLGIDGGGTSCRAALANADGMVLGRAKSGAANIRTDLTGAR
                     SNIVEAARQAFIAAGQDPELIPQTPAILGLAGANVGTYRQQLEAVLPFSVSRVETDAE
                     IALEGAVGSGDGAMAILGTGTAYMARKQGKSRAIGGWGFQVGDQGSGARIGRDLLEQT
                     LLAYDGVREGSPLTDSMMAVFRNNPEDVVEFTTNAKPGDFGGFAPKVFEHAEKGDSVA
                     NWILDRAVADVEASLGALDLAEGAPLCLLGGLAPLYAPRLSARYRALLKPPLDGALGG
                     AVQMAVRLFAGHAGPAR"
     gene            769936..770718
                     /locus_tag="MESOP_RS03605"
                     /old_locus_tag="Mesop_0727"
     CDS             769936..770718
                     /locus_tag="MESOP_RS03605"
                     /old_locus_tag="Mesop_0727"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013891961.1"
                     /db_xref="GI:503657885"
                     /translation="MSDAADQIFATLKQSAQSGAPLYLQLRKSIEDAVNRGLIGPGDA
                     LPSERDIATKADISRVTVRKAVQDLVKGGILVQRHGSGTFVAPRMERVEQSLSRLTSF
                     TEDMARRGMAVRSAWLDRGLYAPSPGEMMVLGLSSSELVARVARLRIANDTPLAIERA
                     SLSASVLPDPAAIGSSLYAALEMTGNRPVRAVQRISAANLGDSDARLLEVPPGIAGLH
                     IERISYLASGKVIEFTRSIYRGDAYDFVAELRLTGPSEEGRP"
     gene            770715..771746
                     /locus_tag="MESOP_RS03610"
                     /old_locus_tag="Mesop_0728"
     CDS             770715..771746
                     /locus_tag="MESOP_RS03610"
                     /old_locus_tag="Mesop_0728"
                     /EC_number="2.6.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine--fructose-6-phosphate
                     aminotransferase"
                     /protein_id="WP_013891962.1"
                     /db_xref="GI:503657886"
                     /translation="MTEITHMRREIEEIPQAVTRLLDGSGTVIEEAGRGIKGRDPHFV
                     VTVARGSSDHAATFMKYAVELTAGLAVASVGPSIASIYGRKLRLTGSACLAISQSGKS
                     PDIVAMAETARTGGALTIAITNTADSPLARASDYAIDILAGPERSVAATKTFINSAVA
                     GLALMAHSTGDAALLAALARLPEHFGKAIACDWMSVLAETIEKQKSLFILGRGPSAAM
                     ANEAALKFKETCGMHAEAYSAAEVMHGPLALIGPDFPVLALAARDASEPSVAEAADSL
                     AAKGAPVFVTSALANRATRLPHVATGHPLTDPLTLIVSFYMFVEAFARHRGLDPDTPR
                     NLRKVTETV"
     gene            771743..772909
                     /locus_tag="MESOP_RS03615"
                     /old_locus_tag="Mesop_0729"
     CDS             771743..772909
                     /locus_tag="MESOP_RS03615"
                     /old_locus_tag="Mesop_0729"
                     /EC_number="3.5.1.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-6-phosphate deacetylase"
                     /protein_id="WP_013891963.1"
                     /db_xref="GI:503657887"
                     /translation="MSDRFALTGARIFDGDDWHEGAALVVRDGLVEAILPTGAIPSDV
                     RVVDTGGGMLVPGFVDIQVNGGGGVMLNDHPDVASIETICRAHAPFGTTALLPTLITD
                     TPDITAAAIAAGEAATLRKVPGFLGLHLEGPHLSIARKGAHDPALIRPMTDADQAMLI
                     AARRKLPVLLTTIAPESVEPARVTALTRAGIIVSLGHSDTGYATANAFAEAGASVVTH
                     LFNAMSQIGNREPGLAGTAIDIGTLSAGLIADGIHVHPATIRIALEAKQGPGKIVLVT
                     DAMATIGTDTTSFTLNGRTIYRKDGSLRLADGTLAGADLDMISAIRFMHRVVGLDLSE
                     ALRMASLYPAQAIGQSHRLGRLANGTAADIVALSDDLGIGSVWIGGDEVFSAGA"
     gene            772926..774038
                     /locus_tag="MESOP_RS03620"
                     /old_locus_tag="Mesop_0730"
     CDS             772926..774038
                     /locus_tag="MESOP_RS03620"
                     /old_locus_tag="Mesop_0730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_013891964.1"
                     /db_xref="GI:503657888"
                     /translation="MQAIDCVVAGAGVVGLAVARALALSGREVVVIEQADAIGTVTSS
                     RNSEVIHAGLHYAPGSLKARLCVEGRRLLYAYCAEHGVAHARTGKLIVASEPGQMDGL
                     RTIQANARRCGVEDLELLTRGEAESLEPALTCAGALLSPSTGIVDSHALMLSLRGDAE
                     AAGAAFAFLTCVAGATIDADGIRVDTRDADGETFALEARAFVNAAGLDAQAMAGRIEG
                     FPQSLIPRQWLARGNYFALPGRSPFSRLIYPVPVEGGLGVHLTHDLSGSARFGPDVEW
                     IDHVDYTVDPGRSAVFYEAIRRYWPDLGDGALQPAYAGIRPKLSGPGQPAADFMIQGP
                     GDHGLGRIVNLFGIESPGLTASLAIADHVVALLYPE"
     gene            774114..776162
                     /locus_tag="MESOP_RS03625"
                     /old_locus_tag="Mesop_0731"
     CDS             774114..776162
                     /locus_tag="MESOP_RS03625"
                     /old_locus_tag="Mesop_0731"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013891965.1"
                     /db_xref="GI:503657889"
                     /translation="MSEAKPKSTPADGIRPRGNPKPRRGKSRRQGPRDQTSGEPGEEK
                     PTPADAAPEVDGQAGPPPEAIEPDPQLTPEEAEQARKKYLLRRFWIGGRGYWGRQGDK
                     LAWPLTIGLLILIVINVGFQYGINVWNRAFFDAIEQRNVHTVYVLSAIFLPLVAGSAS
                     LVIAQVYLRMTMQRRWRSWLTTSVIARWLTNGRYYQLNLVAGDHSNPEARLTEDLRIA
                     TESPVDFISGVIIATLSASTFIVVLWTIGGALSFTLGGSTFTVPGFLVITAVIYAAIT
                     STSMVIIGRDFVRLSEEKNQSEAEFRYVLTRVRENGESIALLGGEEEERSGIDRTFAG
                     VLKRWAQLTGQHMRTALVSQGSSLFAPVVPVLLCAPKFLEGSMSLGQVMQAASAFAIV
                     QSAFGWLVDNYPRLADWNASARRIASLMMSLDGLERAEQSDELGRIKRGETGNGAMLS
                     LDNLSVTLDDGSSVVKETKVEIEPGERVLVAGESGSGKSTLVRAVAGLWPWGGGNVNF
                     HAGRRLFMLPQRPYIPTGTLRRAVAYPAAADKWTIKQIKAALDKVGLGYLTDRIKEEA
                     PWDQTLSGGEKQRLAFARLLLHRPDIVVLDEATSALDEKSQDTMMMTVIRELPDVTII
                     SVAHRAELEAFHSRKITLERREGGAKLVSDIDLVPRKRKRSLLKRALWGSGSGASNRG
                     "
     gene            complement(776201..777715)
                     /locus_tag="MESOP_RS03630"
                     /old_locus_tag="Mesop_0732"
     CDS             complement(776201..777715)
                     /locus_tag="MESOP_RS03630"
                     /old_locus_tag="Mesop_0732"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891966.1"
                     /note="catalyzes the formation of malonyl-CoA from
                     malonate and CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl-CoA synthase"
                     /protein_id="WP_013891966.1"
                     /db_xref="GI:503657890"
                     /translation="MSNHLFDAFRSRMPVPGHLLMETDDGRSLTHGDMLARSGQLAHA
                     LLQLGVEPGDRVAVQVEKSPEAVLLYLACVRAGAVFLPLNTAYTLTELGYFFDDAAPR
                     VIVCDPARAADVAAMVEPSGAVVVTLDRNGQGSLADQASRQSSDFHDVVRGGDDLAAI
                     LYTSGTTGRSKGAMLSHENLASNARVLVDQWRFTADDVLIHALPIFHTHGLFVATNVV
                     LMAGASMLFEQKFDAGRIVSLLSRATVLMGVPTFYVRLLQQDGLDREATKTIRLFVSG
                     SAPLLAETHRAWRERTGHAILERYGMTETNMNTSNPYEGERRAGTVGFPLPGVSLRIA
                     DPDSGRTLAQSEVGMIEVKGPNVFGGYWRMPDKTKAEFRADGFFITGDLGMIDADGYV
                     HIVGRGKDLIISGGYNIYPKELESEIDALDGVLESAVIGVAHPDFGEGVTAVVVRAPA
                     SRITGAEILRAIAGRVAKYKHPKQVIFVDELPRNTMGKVQKNLLRDAYKDLYAS"
     gene            complement(777896..778624)
                     /locus_tag="MESOP_RS03635"
                     /old_locus_tag="Mesop_0733"
     CDS             complement(777896..778624)
                     /locus_tag="MESOP_RS03635"
                     /old_locus_tag="Mesop_0733"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013891967.1"
                     /db_xref="GI:503657891"
                     /translation="MTYGAANLNDDGTGSKSTLASTVYHQLRDDLLGGALETESKLRV
                     EWVVSKYGAGASPVREALNRLASEGLLGRHDQRGFFIMPVTATELEELTRTRCWLEER
                     ALRESIAHRTAEWEEQLVLALHRLGRASRHDLPSINPDWEKLHRTFHRVLISACRSHW
                     LVGFCDQLSDHAYRYRQMANDGEGIQRDGFAEHRLIAECALDGNADGAVQALIDHYQL
                     TASMCMERFKQNETAAAPAERARR"
     gene            complement(779022..779699)
                     /locus_tag="MESOP_RS03640"
                     /old_locus_tag="Mesop_0734"
     CDS             complement(779022..779699)
                     /locus_tag="MESOP_RS03640"
                     /old_locus_tag="Mesop_0734"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_041164503.1"
                     /db_xref="GI:752465794"
                     /translation="MSKKTLIAPSVLASDFSRLGDEVEAVAAAGADWIHLDVMDGHFV
                     PNITFGPPVIKAIRSRTKAFFDCHLMIAPADPYLAAFADAGCDGMTVHAEAGPHLDRS
                     LQTIRNLGKKAGVSLNPATPESAVEYVLDRLDLILIMTVNPGFGGQAFIPGIVDKVRR
                     VKALIGDRPIRIEIDGGISAETAPLVTAAGADVLVAGAAIFKGGSVEAYRANIEAIRT
                     AADKAAG"
     gene            complement(779903..783646)
                     /locus_tag="MESOP_RS03645"
                     /old_locus_tag="Mesop_0735"
     CDS             complement(779903..783646)
                     /locus_tag="MESOP_RS03645"
                     /old_locus_tag="Mesop_0735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891969.1"
                     /db_xref="GI:503657893"
                     /translation="MNILAPSSPATPQKTVMETIMKPLSLARRGARWLMAAGIAVATL
                     TPLPSLAEDSAPITPELRLDLDSSRIINPRPDRIVPFFTKTGTQRGCDYVVYSLSFGL
                     RGDPQGFADPGLAARLSKLRIEFKDQLPHGLAIVNVNVSGDGTDSSGGPLPGATISNS
                     AGPNDTATVSDFRISASDLDGSGAPNERVITFKITAKIDHAAFPSPTIVDNQGLIKVT
                     NGTGTGTIIPSQDPGKPDDGDYKTGAKTSIKIDLTKCNPPPPPPGKECFKVERGTVDC
                     VPGGGAFIYHMPVGPEMGGKWVQVSTATPGITIIPDTQLVPAGGGVLNWKIVGASPGD
                     VIHLTVTGIETYAGPKEGWGLCCTQTIDIVIPRDQKCPPRDKEPDLKVEKRADVTRCT
                     MGGGCDFTIRVTNVGTAPYNGKIVLDEVTLPAGSTLSSGPNPPWVCAPGTTPMICTHP
                     VTTLNPGASVDLKLGFKPAGGWQGSSLRNCATYNYGASGKPLFGSQSNDRGCASIPIC
                     RRGDRDRDCQPPVEKKVDLILKKRARVPVCTADGICYFVIDIINNGSATYNGPLTVID
                     NYPGGAPASSTFGPSPPWTCGPNGPGQFRCDNAGISLPPGASTPIVVKAVMPAGYQSD
                     TVENCAAVKPIPGEVDLTNNRACAKERFRHPNGGKPTLRITKVCNGSLAGAALVSCRI
                     TVISLGTAAPTGPVRVNDAATLVAGGTPVQIQTVTPDGAEWACGPVPANALYCKIPGA
                     VMTPGTSRHFDVTVSANGEFENCARGSYGPAPGDDVVYPIGQACAKGGGSSTIRVEKT
                     GDRECRLGQPCSFDITISNDGTSPFSGPVRIGDAIGVEGLGRLDGVEITSIDPPFGCS
                     PEPATLPLSCIANLSLGAGESQSHHVTVVIPDDGRLANLQGDVNGQNCVGVLSPDTRV
                     EGGGDVLSKDAANAQGDRGKAYACHPFIITHEVKKECSPGFVMNDAGRCVCPEGTTFR
                     NGQCTGGGTNVLPTPPPPKRCVLLEGQIRTEDGRCVCPRGTALENGKCVRIDKPEQCT
                     IRGQVHDADGDCVCPRGTEVRNGACRPIRPKPEQCTIRGQVHDADGDCVCPRGTEVRN
                     GACRPIRPEPEQCTIRGQVHDADGNCVCPRGTEVQGNACRRKQPQLEQCDIRGQVHNK
                     RGECVCPRGTEVIDGACRKPRQQTECAPGSQMIDGQCQPIIRRRCPEGTIGRYPNCRP
                     IRGQPSLELNPGLLLQQVLPRLRPQAEQQQDPAANRILKLQQQ"
     gene            complement(783657..785909)
                     /locus_tag="MESOP_RS03650"
                     /old_locus_tag="Mesop_0736"
     CDS             complement(783657..785909)
                     /locus_tag="MESOP_RS03650"
                     /old_locus_tag="Mesop_0736"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041163984.1"
                     /db_xref="GI:752465275"
                     /translation="MTNNPEAPRSAGTTGARRDHRLRDGVDALGFPLIPLTPRKSGSN
                     VTVRKADNSIREERAGPPRLALICAATPDVSPVANGGSFMSRVRGTRVSSLMYSPLTY
                     SLEGRLRRAIHAGGLLALALGAGLWFGGAAKAQETQIIYPGSMAVTGFSGTVIPNFDP
                     PDSEKGGLPPGVDPVDETFIDTTRATLRVFDVSHLGGPASGQLVFTPPPFEVTSGQIG
                     QVFGLTYDDGVRDGVPSGIPNLYAGASSLHGIRIVTPDADEDGRPERQRRGMAGATFM
                     EGQFGAENGGGPGTIWKIDGITGQVAKFADIDTNSGPGIGNLTFDPNHRQFFASDLDT
                     GLVHRIDAGGRLIDTFDHGAAGRPAHGLAPVADDGAVMDIQGAAFDSEDPETWGYTQD
                     ERRVWAVSYHGGRLYYSVGEKAEIWSVGIARDGSFAGDPRWELTVKADKDYAVTDIAF
                     DNSGFMYLAQRGPVENRYDYSQFADSGKGEVIRYWRENPDDPGTESVWVEAPREYAVG
                     FPQANRQSAGGLDLQYGYDADGNLDTSVCTQTLVNTGDKLRDNPALAEKLAAGGPLAV
                     HGVQITPKELVKPANVPPFGSWFVDFDGYFEDPEVEGHVGDVAVWHPCDGRAGYYEEI
                     PGGYLPPFYPPDFPPPGNLPPCLDVEDVQYFCTPRGLEADLYLHDHAGFGGDSIKAQS
                     RTPGVGVTSPQSHAPGKPYTIDITGHYPGDRVDVGLCFYRQSDKDKGGYYPCCKMTLP
                     LRTPAVSCER"
     gene            786061..787653
                     /locus_tag="MESOP_RS03655"
                     /old_locus_tag="Mesop_0737"
     CDS             786061..787653
                     /locus_tag="MESOP_RS03655"
                     /old_locus_tag="Mesop_0737"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891971.1"
                     /note="DppABCDF is involved in the transport of
                     dipeptides; also binds heme and mediates chemotaxis to
                     dipeptides; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013891971.1"
                     /db_xref="GI:503657895"
                     /translation="MTSKRSVLLLATLSLFALPVHDSMAKTLVYCTEASPDTFDPALA
                     SGTRDASATALYNRIVEFEPGTTKVRPGLAEKWEISDDSLTYTFHLRHGVKFHTVDGF
                     TPSRDFNADDVLFTFERQADAQNPFHNYASRPYGYFDGMGMPRLVASWRKLDNYTVVM
                     TLKAPHAPMLANLAMDFASVVSREYADRLLAEKRPLDLATKPVGTGPFQLVDYQQDAV
                     IRYKANPDYWRGRPRIDDLIFAITTDASVRLEKLRAGECDVMPYPNPADLAAIKTAPG
                     IKVMQQEGLNTGYLAFNTLQKPFNDPRVRKAIDMAIDRKALVDVIFRGTGEIARNPLP
                     PTSWAYDKTTPDPVFDPDAARQALTDAGIKDLHMKVWAMPVQRPYNPNAQRMAEMIQS
                     DLARIGVTVDIVTYEWAEYLARSKPVDRDGAMLFGFTGDNGDPDNFLSVPLGCAGVGA
                     TNRANWCFPAFDDLLRQAAGSVDLDARMKLYAQAQGIFREQTPWVVIAHSVVSIPMRE
                     RVQGYVMDPFDHHDFSNVDISE"
     gene            787664..788539
                     /locus_tag="MESOP_RS03660"
                     /old_locus_tag="Mesop_0738"
     CDS             787664..788539
                     /locus_tag="MESOP_RS03660"
                     /old_locus_tag="Mesop_0738"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006332161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891972.1"
                     /db_xref="GI:503657896"
                     /translation="MRAGLDVADLDVYVESLGNFRSGEEYSIQSLLPRLEQAGMTVRV
                     LDRPAREHLAPAALLHVDLTDVPRLYHDIARRYARTINGHALSIHRQLYSSLRIRAGD
                     GHSGPVIVKTVLNSRGRPELRWRQYRNGWTRAMHFVRKTADPGYKERLCPRYRVYDTL
                     AQVPPEAWGDERLMVEKFAFDSLDLPIVKHRYMFLLGAEVNMRQTYNDVLCKGSEIIS
                     NEVGGAVPPEVRAVRERLRLDFGAIDYFIVDGKGIVVDANKTVGSNPEWLKKNRFRQE
                     FNDRMVEALIEFVRG"
     gene            788858..790774
                     /gene="dnaK"
                     /locus_tag="MESOP_RS03665"
                     /old_locus_tag="Mesop_0739"
     CDS             788858..790774
                     /gene="dnaK"
                     /locus_tag="MESOP_RS03665"
                     /old_locus_tag="Mesop_0739"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006326254.1"
                     /note="heat shock protein 70; assists in folding of
                     nascent polypeptide chains; refolding of misfolded
                     proteins; utilizes ATPase activity to help fold;
                     co-chaperones are DnaJ and GrpE; multiple copies in some
                     bacteria; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaK"
                     /protein_id="WP_013891973.1"
                     /db_xref="GI:503657897"
                     /translation="MAKVIGIDLGTTNSCIAIMDGKEPKVIENAEGARTTPSIVAISG
                     DGERLVGQPAKRQAVTNPENTIFAVKRLIGRRYDDPVTEKDKKLVPYKIVKGDNGDAW
                     VEAGGKKQSPSQISAMILQKMKETAEAYLGEKVEKAVITVPAYFNDAQRQATKDAGKI
                     AGLEVLRIINEPTAAALAYGLDKKEGKTIAVYDLGGGTFDISVLEIGDGVFEVKSTNG
                     DTFLGGEDFDMRLVEYLAAEFKKEQGIDLKNDKLALQRLKEAAEKAKIELSSTTQTEI
                     NLPFITADATGPKHLTLKLTRAKFESLVEDLVQRTIEPCKAALKDAGLKAGEIDEVVL
                     VGGMTRMPKIQEIVKQFFGKEPHKGVNPDEVVALGAAIQAGVLQGDVKDVLLLDVTPL
                     SLGIETLGGVFTRLIERNTTIPTKKSQVFSTAEDSQSAVTIRVFQGEREMAADNKPLG
                     QFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEHQIRIQASGGLSDADIE
                     KMVKDAEANADADKKRRAVVEARNQAEALVHSSEKSLKEYGDKVSEAERTAISDAIAA
                     LKTAAEGDDAADIEAKSQVLAEASMKLGQAMYEASQKEAAEADAKADAAKDSDVVDAD
                     FEEIDEDDDKKKSA"
     gene            790999..792129
                     /locus_tag="MESOP_RS03670"
                     /old_locus_tag="Mesop_0740"
     CDS             790999..792129
                     /locus_tag="MESOP_RS03670"
                     /old_locus_tag="Mesop_0740"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98DD2.1"
                     /note="chaperone Hsp40; co-chaperone with DnaK;
                     Participates actively in the response to hyperosmotic and
                     heat shock by preventing the aggregation of
                     stress-denatured proteins and by disaggregating proteins,
                     also in an autonomous, dnaK-independent fashion; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_013891974.1"
                     /db_xref="GI:503657898"
                     /translation="MKADFYETLGVQKGADEKELKSAFRKLAMQFHPDRNPGDHSCEH
                     KFKEINEAYETLKDPQKRAAYDRFGHAAFEQGGMNGGAQGFGAGGFADIFEDIFGDMM
                     GGRQRRSSGGRERGADLRYNMEISLEEAFAGKTAQIRVPASISCSECSGSGAKPGTQP
                     VTCSMCNGHGKVRATQGFFSIERTCPQCQGRGQTIKDPCPKCVGQGRVTEERSLSVNI
                     PAGIEDGTRIRLANEGEAGLRGGPSGDLYIFLAVKPHEFFQRDGADLYCKVPISMTTA
                     ALGGSFEVTTLDGTQTKVKVPEGTQNGRQFRLKGKGMPVLRQPNVGDLYIQTAVETPQ
                     NLSRRQRELLEEFEQLSSQDNSPQSSGFFARMKDFFESFGER"
     gene            792235..792837
                     /locus_tag="MESOP_RS03675"
                     /old_locus_tag="Mesop_0741"
     CDS             792235..792837
                     /locus_tag="MESOP_RS03675"
                     /old_locus_tag="Mesop_0741"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019862365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_013891975.1"
                     /db_xref="GI:503657899"
                     /translation="MTRGPGLRKALAEKFDDELKFFKGWIDKPKTVGSIVPTSSITAR
                     KMASIVNPKSGLPVLEVGPGTGVITRAILAQGVRPENLYAVEYSTDFVRHLRQLYPGV
                     NVIEGDAFNLNATLGERSGMIFDSVVSGVPLLNFPVAQRIAYIESLLDRIPAGRPIVQ
                     LTYGPMSPIPAGRGDYTVKHFDFIFRNIPPTQLWIYRREG"
     gene            792918..793514
                     /locus_tag="MESOP_RS03680"
                     /old_locus_tag="Mesop_0742"
     CDS             792918..793514
                     /locus_tag="MESOP_RS03680"
                     /old_locus_tag="Mesop_0742"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013528589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase"
                     /protein_id="WP_041163985.1"
                     /db_xref="GI:752465276"
                     /translation="MAVIPKILVFAGSVRGGAYSGRTADVAQKELAVQGAEVTRISLG
                     DYPLPILDEDLEKEKGVPENAVRLGRLIIAHDGLLIATPEYNGSIPPLLKNTIDWVSR
                     VRRDNSRPVRPLAGKVVGLCSSSNGHFAGIRCINHLRAVLVRCQMEVVTPECSVPEGG
                     DAFGEDGHFRDERLHTSMEHLCRTLIETSRMLSTRIEA"
     gene            793526..794239
                     /locus_tag="MESOP_RS03685"
                     /old_locus_tag="Mesop_0743"
     CDS             793526..794239
                     /locus_tag="MESOP_RS03685"
                     /old_locus_tag="Mesop_0743"
                     /EC_number="4.1.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q98DD5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotidine 5'-phosphate decarboxylase"
                     /protein_id="WP_013891977.1"
                     /db_xref="GI:503657901"
                     /translation="MQAKTMQAKSIQERLIVGLDVPTLKEAEQAVRELDGVVSFYKIG
                     YQLAFAGGLDFARELASGGAKVFLDMKLLDIDHTVAKGVENIVRMGMTMLTIHAYPKA
                     MQAAVEAARGSDLCLLAVSVLTSMDEQDVIDAGYEYDPHTLVLRRAEQALHAGMGGVV
                     CSAEEAEAVRRIVGPNMAVVTPGIRPAGSEHGDQKRVVTPAQAIRNGSSHLVVGRPIV
                     AAGDRRAAAEAILEEMRSA"
     repeat_region   794236..794365
     gene            794390..794677
                     /locus_tag="MESOP_RS03690"
                     /old_locus_tag="Mesop_0744"
     CDS             794390..794677
                     /locus_tag="MESOP_RS03690"
                     /old_locus_tag="Mesop_0744"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891978.1"
                     /db_xref="GI:503657902"
                     /translation="MPKGYWIARVDVRDAEGYKDYVAAAKPAFERFGAKFLARGGAHE
                     LAEGPGRARNVIIEFESLAAAHDCYHSPEYQRAVAIRQKVADGEIVLVEGA"
     gene            complement(794708..795454)
                     /locus_tag="MESOP_RS03695"
                     /old_locus_tag="Mesop_0745"
     CDS             complement(794708..795454)
                     /locus_tag="MESOP_RS03695"
                     /old_locus_tag="Mesop_0745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013891979.1"
                     /db_xref="GI:503657903"
                     /translation="MKPTKAKPPKSISPPSGATAPSTADLLRSEQAYEQLKSDIVACV
                     LSPGEALTEKQIEARYGIKKATIRSALARLMQEGLVRSEPRRGYVITTLTLRDVNEIF
                     DVRGLIEPEVFRVATTGITERGLDEIRLAARKVLKPETLRSPVAFLAADRAFRLAIAE
                     LSGNLRLAQLLSQILDQSERALHLGFKSRDFMPLIIEQQKRLLQACEKSDVPGIAKLA
                     RSHCLALKHQLIGALLGGSKLREANLQDFV"
     gene            795537..796097
                     /locus_tag="MESOP_RS03700"
                     /old_locus_tag="Mesop_0746"
     CDS             795537..796097
                     /locus_tag="MESOP_RS03700"
                     /old_locus_tag="Mesop_0746"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter"
                     /protein_id="WP_013891980.1"
                     /db_xref="GI:503657904"
                     /translation="MPLSADSSLYPAISDIVNAAAGADAFGQVKAVLGDYTKRFHALG
                     GLVHEEDDDELLLHASPKLTIYHITLSPGVQYPPHNHLMDALVGIYWGGETNFIYPLA
                     GDRVDEPERQDFSAPALVHMPSSTIHSVANTGSTRSGALHVYLGDLPGTSRQLWSLAD
                     KRPEPFDNIRYMAGARPIEQSTSEPK"
     gene            complement(796462..797520)
                     /locus_tag="MESOP_RS03705"
                     /old_locus_tag="Mesop_0747"
     CDS             complement(796462..797520)
                     /locus_tag="MESOP_RS03705"
                     /old_locus_tag="Mesop_0747"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013891981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013891981.1"
                     /db_xref="GI:503657905"
                     /