GenomeNet

Database: RefSeq
Entry: NC_015699
LinkDB: NC_015699
Original site: NC_015699 
LOCUS       NC_015699               7047 bp    DNA     circular CON 08-JUN-2013
DEFINITION  Lactobacillus reuteri SD2112 plasmid pLR580, complete sequence.
ACCESSION   NC_015699
VERSION     NC_015699.1  GI:338202351
DBLINK      Project: 55357
            BioProject: PRJNA55357
KEYWORDS    RefSeq.
SOURCE      Lactobacillus reuteri SD2112
  ORGANISM  Lactobacillus reuteri SD2112
            Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae;
            Lactobacillus.
REFERENCE   1  (bases 1 to 7047)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUN-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 7047)
  AUTHORS   Muzny,D., Qin,X., Buhay,C., Dugan-Rocha,S., Ding,Y., Chen,G.,
            Hawes,A., Holder,M., Jhangiani,S., Johnson,A., Khan,Z., Li,Z.,
            Liu,W., Liu,X., Perez,L., Shen,H., Wang,Q., Watt,J., Xi,L., Xin,Y.,
            Zhou,J., Deng,J., Jiang,H., Liu,Y., Qu,J., Song,X.-Z., Zhang,L.,
            Villasana,D., Johnson,A., Liu,J., Liyanage,D., Lorensuhewa,L.,
            Robinson,T., Song,A., Song,B.-B., Dinh,H., Thornton,R., Coyle,M.,
            Francisco,L., Jackson,L., Javaid,M., Korchina,V., Kovar,C.,
            Mata,R., Mathew,T., Ngo,R., Nguyen,L., Nguyen,N., Okwuonu,G.,
            Ongeri,F., Pham,C., Simmons,D., Wilczek-Boney,K., Hale,W.,
            Jakkamsetti,A., Pham,P., Ruth,R., San Lucas,F., Warren,J.,
            Zhang,J., Zhao,Z., Zhou,C., Zhu,D., Lee,S., Bess,C.,
            Blankenburg,K., Forbes,L., Fu,Q., Gubbala,S., Hirani,K.,
            Jayaseelan,J.C., Lara,F., Munidasa,M., Palculict,T., Patil,S.,
            Pu,L.-L., Saada,N., Tang,L., Weissenberger,G., Zhu,Y., Hemphill,L.,
            Shang,Y., Youmans,B., Ayvaz,T., Ross,M., Santibanez,J., Aqrawi,P.,
            Gross,S., Joshi,V., Fowler,G., Nazareth,L., Reid,J., Worley,K.,
            Petrosino,J., Highlander,S. and Gibbs,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2011) Human Genome Sequencing Center, Baylor
            College of Medicine, One Baylor Plaza, Houston, TX 77030, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002848.
            Lactobacillus reuteri SD2112
            
             Strain source, body site: Gastrointestinal tract
            
             Inquiries should be directed to microbe@hgsc.bcm.tmc.edu
            
             This is a reference genome for the Human Microbiome Project. This
            project is co-owned with the Human Microbiome Project DACC.  Source
            DNA provided by Versalovic, J. (Department of Pathology, Texas
            Children's Hospital, 1102 Bates Avenue, Suite 830, Feigin Center,
            Houston, TX, 77030, USA).  Funded by by 'Genomes and Genetics at
            BCM-HGSC' (U54 HG003273).
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler Assembler v. 2.3.10192009
            Genome Coverage          :: 63x
            Sequencing Technology    :: 454
            ##Genome-Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..7047
                     /organism="Lactobacillus reuteri SD2112"
                     /mol_type="genomic DNA"
                     /strain="SD2112"
                     /culture_collection="ATCC:55730"
                     /db_xref="HMP:00538"
                     /db_xref="HOMD:tax_818"
                     /db_xref="taxon:491077"
                     /plasmid="pLR580"
     gene            complement(join(6394..7047,1..1485))
                     /locus_tag="HMPREF0538_22304"
                     /db_xref="GeneID:10865984"
     CDS             complement(join(6394..7047,1..1485))
                     /locus_tag="HMPREF0538_22304"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="YP_004650765.1"
                     /db_xref="GI:338202352"
                     /db_xref="GeneID:10865984"
                     /translation="MAIKIKDSSKTLSGKFDTYIKSQYKFLSLVHAGAINGLLTVTKP
                     KDNKHKHNFKHQPILSDNGDLGYEQYYHLDMTDNVVIPHVTMVYSNGANTAGRVVYID
                     NTRIAHSPLRELNEASKRTQTMVKVLDTAKQLQQIRSGSSEFCSYMTTLTIPNCNKDE
                     LDQVVGSMSTRITAVIKALQDGYRNGNGLRLVDHNGRPVQILGAIVKIEITINQVKLK
                     TCDSQGIFHPHIHIVLITANELALGPSRRILFHYWSNKNSDMILSRKAFNFKKAYSKN
                     QMDSDDSTSIVAEATKYATKPTMYKLLPTIKDSNNLTSDDQFKLEIFCEVFKTIKGRQ
                     LSRSYGLIRDATGFVNFLKNGIMVKYRGNNPMHGKHERISIFDAFMFGNYNDNKQIHV
                     PDIMTTRNELIPGGNFNQVDLSDDELLYANKGLLSGATWELPDNIKWPSNNQKADEYK
                     ELLTRFGFVQPGLGNIIDQLQSWIQTIDQRKDKVLHTVLDASERSFQYNDLLHKGEDV
                     RRLVRILEDVCDQYGDDTTTLTTHDYSQIYRDVDLMQVMDAHHATLHYDSYGKPDDVT
                     FDEPDVERRLVASYKKHDDVRFMSATAFLPREILIEYGVWLKHTPSEFIDNLASYTSH
                     APELEIDTVSKMDAKTTQKWINKAFNVSSSNGPQIDFHTMFTSAKMSQVQADNNDDLD
                     HLFDDGVGDDDDDDNTEINSLSDVFPDLKW"
     misc_feature    complement(454..1047)
                     /locus_tag="HMPREF0538_22304"
                     /note="Replication protein; Region: Rep_1; cl02412"
                     /db_xref="CDD:261274"
     gene            complement(1978..2475)
                     /locus_tag="HMPREF0538_22305"
                     /db_xref="GeneID:10865978"
     CDS             complement(1978..2475)
                     /locus_tag="HMPREF0538_22305"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004650766.1"
                     /db_xref="GI:338202353"
                     /db_xref="GeneID:10865978"
                     /translation="MDRHVWQRLATVVLAALVIFSINTFSPVGNGDGLGITTIQAKKK
                     THQLPNLLDQQIAILVGLDINPNWVREQSAADSLIYGIVKPDDTVPAGINEDYSYLVT
                     SNRDKEISLFFKADKKKVTIKYANHGEKLHTKTVPLSRLVEQSYRTKKQRQQVNKYAS
                     ALRTE"
     gene            complement(2965..3522)
                     /locus_tag="HMPREF0538_22306"
                     /db_xref="GeneID:10865983"
     CDS             complement(2965..3522)
                     /locus_tag="HMPREF0538_22306"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004650767.1"
                     /db_xref="GI:338202354"
                     /db_xref="GeneID:10865983"
                     /translation="MIFDGPWDDDERYILDDRQLYFLKQAGERLSSQDFQDLKQENDD
                     ELGFYSCTVDGELDRKKLPSSFLEVKVRVGRKLRSQIKQMVDDPDKLPEFGFRDYRGM
                     TVTDCEYLSLLELPDEWLSNYLRYFMNYSGIHSDDVYVAASGRFKLVEIDNWKNVVPD
                     YSDFSTVDLLQCDMNFLKAYIASIE"
     gene            complement(3560..4057)
                     /locus_tag="HMPREF0538_22307"
                     /db_xref="GeneID:10865979"
     CDS             complement(3560..4057)
                     /locus_tag="HMPREF0538_22307"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004650768.1"
                     /db_xref="GI:338202355"
                     /db_xref="GeneID:10865979"
                     /translation="MNTKNQVKTKTKTYTTSELASLCGVTVGSISVLIKKQNLKPVKT
                     GQNNAKYYDAGVLKQLRLHYAKSKPKRDKTNNTQDLRTQLAVAQSENQLLRDQLESAK
                     STIEILRNELKIKNSQIDKLQDLTNQAQQLDLATHTQHQELLEQKSQPTDEPTKHKHG
                     IFNWF"
     misc_feature    complement(3872..4009)
                     /locus_tag="HMPREF0538_22307"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:261364"
     misc_feature    complement(order(3908..3916,3965..3967,4007..4009))
                     /locus_tag="HMPREF0538_22307"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     gene            complement(4075..5568)
                     /locus_tag="HMPREF0538_22308"
                     /db_xref="GeneID:10865980"
     CDS             complement(4075..5568)
                     /locus_tag="HMPREF0538_22308"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004650769.1"
                     /db_xref="GI:338202356"
                     /db_xref="GeneID:10865980"
                     /translation="MSSITFENSFQGSFRDMGESHISIHSGQHDNMVDGEDPIIELRG
                     NSVSDSSWALMIAKATSQGVVSPKDWPEYNRKIPDKKRRKKDYNDYLLTLCSKPIKRL
                     KATQTAKNTPKAQRTKISQELASVDRDHVLNDGSLWYVAKVDDRPDNVGKKEWREFEV
                     EALTRFDKDPTYRMLNPGTYRSEIHLDERGEIHKQDLAVWFRPDSRGRVQYSKTSTIQ
                     DVLLKLYGGNKDELDRRVSLVSEITNNIDKTPGQERADTKLWRSVKSNQQPTRMLHAG
                     KRYNSAMITLWRYENVRILRDTALQVAKERGIDYQVSDRYETDGVHRSRDIYMQHQQA
                     KDSLHGEQLKKKRAQYATGKLIDAINDIYRDTLKRDPGASESPLEQTNKIINHLNEIK
                     EESKRIQRENDRQQQQLDQLKRQNELMKRQQFRWFELRLLIVNIIEKLWHLMFDRDLQ
                     HDFTNDHQKWRDSMTNQVNKEMYNQLDQDQQKQLNAPNQSNGHNLER"
     gene            complement(5877..6131)
                     /locus_tag="HMPREF0538_22309"
                     /db_xref="GeneID:10865981"
     CDS             complement(5877..6131)
                     /locus_tag="HMPREF0538_22309"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004650770.1"
                     /db_xref="GI:338202357"
                     /db_xref="GeneID:10865981"
                     /translation="MKIFKKKCVLLEAAGRPLGERKLCKFYLHNIIAWYNRYVKSETF
                     HENSLSFSIDDTLKCADFTGFFNFDGFTIEPRFDFILSLD"
     gene            6145..6276
                     /locus_tag="HMPREF0538_22310"
                     /db_xref="GeneID:10865982"
     CDS             6145..6276
                     /locus_tag="HMPREF0538_22310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004650771.1"
                     /db_xref="GI:338202358"
                     /db_xref="GeneID:10865982"
                     /translation="MQVQIVTKIGPVYFPLTENKTASNGSTFRQKLTSKVGHFSVKK"
CONTIG      join(CP002848.1:1..7047)
//
DBGET integrated database retrieval system